4KVHA

Crystal structure of ketosteroid isomerase fold protein hmuk_0747
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
b'NAMDRVATARAYYRALDEHDYDLLSDVLAPDFVHDRPDRTIEGRERFVRFMREERPQTDTSHPIATIYTGASTVAVEGRLLNSDGAEITQFVDVFAFEDGVIGRIRTHTPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketosteroid isomerase fold protein Hmuk_0747
publication title Crystal structure of ketosteroid isomerase fold protein Hmuk_0747
rcsb
source organism Halomicrobium mukohataei
molecule tags Unknown function
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4kvhA00
2BNGA 1GS3A 3DM8A 3KE7A 5IG5A 2BMRB 1K41A 1JB4A 2B24B 3EBTA 3BLZA 1IDPA 3M8CA 4J9AA 4HVNA 3F7XA 2HMKB 5IENA 1ASKA 1TUHA 2BMQB 5TGNA 4PEJA 3K7CA 3EX9A 3HZPA 4HM3B 4HM8B 4XBXA 1O7GB 5DRVA 4FCMA 4J8TA 1W00A 1Q40A 1TP6A 1NU3A 3STDA 3VGNA 3KSPA 3H51A 3OXAA 2GXFA 3JUQA 3NBRA 1E3VA 1Z1SA 4R1KA 5IEOA 1OGZA 5AIIA 1O7NB 3A76A 1JB2A 3UNLA 4HJLB 5CK6A 3D9RA 2STDA 1CQSA 1W6YA 4Q53A 5CF2A 3MYTA 4IIAA 4LGQA 4K1UA 4HM4B 2INXA 3IPTA 3OX9A 5BXQA 3DMCA 3EC9A 1W01A 3NV0A 1O7MB 3VSYA 5CLKA 1JKGA 2Z7AA 2YFJB 4WP5A 5AI1A 4X2HA 3F40A 3NUVA 4OVMA 4HM7B 2R4IA 2XSOB 5AEWB 3MG3A 3H3HA 1STDA 5BVBA 1GY6A 7STDA 3ER7A 3SEDA 1EG9B 3KKGA 3ECFA 2HMJB 4WWUC 3FH1A 1QMAA 4KVHA 5DREA 4HZ9B 4K1VA 3KZTA 5IF6A 2CHCA 4HM5B 1AR0A 1NWWA 4LMIA 4HM0B 3DUKA 2K54A 3E99A 2A15A 2F99A 3F8HA 2I9WA 5KP3A 1Q40B 4HM1B 1UUVB 3Q90A 3EHCA 3EF8A 4XBTA 2RCDA 2GEXA 3JUPA 4WYKA 1OCVA 4GB5A 2XRXB 3EN8A 5IERA 1C7HA 3G0KA 4HM6B 1W02A 2B1XB 2UX0A 3I0YA 1ZX2A 3JUOA 1OHPA 1NDOB 5G2GA 4CDLA 3NM2A 3DXOA 2W2CA 3MSOA 1DMNA 4R9KA 1OHOA 3LZAA 5JPUA 5JPPA 2F98A 2GBWB 4XB5A 3RGAA 3BB9A 3F9SA 3FSDA 3NV0B 1JKGB 4XDWA 3OWYA 5D82A 3GZXB 5AIHA 3FGYA 1OGXA 4LEHA 4H3UA 3WMDA 3K0ZA 1GYBA 2IMJA 4R9LA 2Z76A 4OUQA 1GY7A 2OWPA 2HMOB 3HX8A 3FF2A 1JN5A 2RGQA 5AEUB 3F8XA 5IG0A 1OF5A 5CF1A 3F14A 3CNXA 5FW5A 4HM2B 4N3VA 3B7CA 3GWRA 3CU3A 1U5OA 3FF0A 5STDA 3GZBA 3MHEA 3B4OA 4RZMA 6STDA 3FKAA 1ZO2A 1ISKA 1OHSA 1HKXA 3B4PA 2CKFB 4I4KA 2YFIB 3GZYB 3F7SA 3RGRA 4WYKB 1OH0A 3T8UA 2RFRA 2QGUA 4L8OA 1E97A 4ORLA 1JB5A 1O7WB 3ROBA 2XSHB 4L8PA 1Q42A 2HMMB 2JQ5A 2GBXB 2YFLB 4HZBB 1OPYA 4U13A 3DZLA 4HKVB 1O7HB 3JUNA 5AIFA 2QIYA 3G8ZA 5KP1A 1O7PB 3EBYA 1ULJB 4XM4A 3B8LA 3CPOA 3MG2A 5EVHA 3G16A 3SOAA 3MKIA 3OWSA 3GZRA 3JUMA 3LYGA 4XDVA 3CNMA 4FCJA 5HGRA 1SJWA 3GRDA 3SOYA 5IG3A 1BUQA 1JN5B 1S5AA 3EJVA 5IEPA 3OWUA 4MJDA 1WQLB 5CXOA 5IG4A 1A2KA 1DMQA 2F86B 1OF5B 1UUWB 3EQQB 1EA2A 2GEYA 3MG1A 3T8NA 1OUNA 5D81A 5D83A 1GY5A 1DMMA 3EN1B 3S5CA 3FZWA 4XBYA 2BMOB 5KP4A 4X2OA 1E3RA 5AIGA 3FLJA 2Z77A 3OV4A 4STDA 2XR8B 3NXJA 3HK4A 1ULIB 2PZVA 1QJGA 2HMLB 3NHXA 1VZZA 8CHOA 2HMNB 3UJMA 4L7KA
chains in the Genus database with same CATH superfamily
2BNGA 5BIRA 1GS3A 1W2B2 3DM8A 3KE7A 4OK0A 3CCR3 5IG5A 2BMRB 1K41A 3CC23 1JB4A 2B24B 1BRKA 1V74A 1RN7A 3EBTA 2KF6A 3BLZA 4IPBA 5RNTA 1IDPA 3M8CA 4J9AA 4HVNA 3F7XA 1KQS2 1N5PA 2HMKB 2RSXA 1VQ63 2H0IA 3Q2PA 1STFI 1TFKA 1BRNL 3ALAA 3WR2A 1ASKA 2CWTA 5BU4A 1BRIA 1LNHA 1L5GB 5IENA 1TUHA 2BMQB 4KFEA 4BTYA 5TGNA 1S723 4PEJA 2K0MA 3K7CA 1R4YA 5M18A 3EX9A 5ELJA 3HIGA 3S29A 7GSPA 3HZPA 4KFFA 4HM3B 1LQMB 2XFTA 4O02B 4HM8B 3CD63 3PZWA 2OTL3 1FUSA 4XBXA 3DH2A 1IV9A 4G1MB 1DE3A 3RNTA 1MNLA 1M1K4 1O7GB 5DRVA 4FCMA 1GSPA 1K28A 4J8TA 1W00A 1Q40A 3X41A 1BAOA 1TP6A 3D79A 3U97A 4HAAA 1IVXA 3LTDA 2IY2A 4I5QA 4EV5A 3NX0A 1NU3A 3STDA 2W0QA 3VGNA 3D5IA 1B2ZA 3KSPA 3H51A 3OXAA 2GXFA 3JUQA 3NBRA 2ZL8A 1YIJ3 1US1A 1E3VA 1Z1SA 5FGOA 4R1KA 5IEOA 1OGZA 1B2UA 3N9HA 1FA3A 2RNTA 2CC3A 5AIIA 1N9JA 1O7NB 2W56B 3LMLA 1K9M4 3PCRA 4FMCA 4AEQA 3A76A 2P0MA 1W4NA 5M19A 1BNRA 1VQQA 1I2GA 1UCKA 1JB2A 1RTUA 4N6V0 2IUJA 3SVAA 3UNLA 3ZG5A 1X1UA 4HJLB 1BNJA 1G96A 1YNVX 2F5WA 1ZGXA 3S27A 2F4YA 5CK6A 1B21A 2L1SA 1KWIA 3D9RA 1IT7A 1GOUA 1UCJA 2F5MA 3BIRA 2STDA 1T2HA 1CQSA 1MGRA 1W6YA 3AMOA 4Q53A 5CF2A 1NO3A 3EB8A 3MYTA 4IIAA 3WDGB 1A90A 4LGQA 2QA43 1RSNA 8RNTA 2FXTA 3BNCA 4K1UA 3V92A 1FGQA 1SPUA 4HM4B 2INXA 3IPTA 2KF4A 3K9MC 3CCM3 1NB3I 3OX9A 1U8CB 3LTCA 1FGTA 1G02A 3DGOA 5BXQA 1YVBI 3DMCA 1T2IA 1IV7A 4MMZB 1A67A 1SQWA 1UGIA 1RRLA 2V1LA 3EC9A 1W01A 4J5GA 4R4KA 3PS8A 1K734 1BNIA 1NB5I 1W5ZA 4BU4A 3CC43 3DGYA 2GU1A 2Q07A 3UB1A 3NV0A 4GSPA 3T0UA 1FGMA 3VF1A 4JRFA 1O7MB 4EW5A 1V57A 5CLKA 3VSYA 1JKGA 2Z7AA 2H0GA 3HOHA 2YFJB 4BTWA 4WP5A 5AI1A 1LXEA 2BT3A 2GU3A 4N6OB 3URPA 3X42A 2CFWA 4R80A 1Y4KA 2ZDJA 4X2HA 1FGRA 3F40A 3NUVA 2KCDA 4HM7B 4OVMA 2R4IA 2XSOB 1RGLA 3DGNA 4LYLB 5AEWB 3BU4A 1W7CA 4N6TA 4WHAA 3MG3A 2Y73A 1TU5A 1VQK3 3H3HA 1STDA 5BVBA 1GY6A 3CCL3 2MC8A 7STDA 3ER7A 3SEDA 3D3LA 2WOFA 1EG9B 2CG1A 4MEIA 3KKGA 1EEJA 1MOLA 1GOVA 1Q7HA 1N8R4 1PY3A 2W9QA 3ECFA 1RRHA 2HMJB 4WWUC 4EYCA 3FH1A 3AGOA 1QMAA 3Q1CA 4KVHA 2CK3H 2MF7A 5DREA 1N9EA 4J5KA 1Q824 1LVNA 4HZ9B 3KZTA 4K1VA 5IF6A 2WOHA 1Q864 1D6ZA 2CHCA 4O8SA 3ZG0A 1FW7A 4HM5B 1BSAA 1AR0A 4GL6A 5I97A 1MWRA 1T5YA 2FNQA 1B3SA 1I8VA 2ZHXB 1NWWA 3WOFB 2W03A 4LMIA 1YGEA 4HM0B 4RBNA 4EC6A 1J2BA 1B2XA 3DUKA 1RGEA 2K54A 3E99A 1WMOA 2A15A 2F99A 4NREA 3F8HA 2I9WA 2SARA 1IT8A 5KP3A 1CYVA 1IQXA 1Q40B 1BSCA 2GSPA 5M1AA 3KN4A 4N6UA 1RN1A 4RNZA 1BNSA 4HM1B 1UUVB 1JBSA 1N8QA 3DGMA 3WOEB 1M1XB 3Q90A 3EHCA 3EF8A 3QK9A 4XBTA 7RNTA 1VQO3 1VQ83 2RCDA 2XH9A 1RJOA 2GEXA 2LYXA 3JUPA 2CX1A 1VQN3 2CH9A 4WYKA 1AQZA 1OCVA 1OACA 2KRTA 1RHLA 1UCIA 4GB5A 2XRXB 3EN8A 4N6LA 1IU7A 4NHFA 2ML6A 2QEX3 5IERA 1C7HA 2CIUA 3LTBA 3CC73 3DY5A 3G0KA 1AY7A 1W02A 2R41A 4HM6B 2D42A 2KF3A 1YIT3 3NQYA 1DVCA 1DETA 1SARA 2B1XB 2UX0A 3I0YA 4FMAA 1ZX2A 2AAEA 1LOVA 3UL6A 3JUOA 1OHPA 1NDOB 2FGTA 5ELUA 5G1LA 3U1WA 5G2GA 3V99A 4CDLA 1BSBA 3AMOB 1FZUA 3CMA3 1IYYA 2L4VA 3NM2A 3CCE3 3DXOA 4ZM8A 1B2SA 4BL2A 3BNDA 2KF5A 1MGWA 2W2CA 2Y74A 3MSOA 3X40A 1CYUA 2CFGA 4HOHA 1WNHA 3PGBA 1DMNA 1Q9EA 2M7OA 1UW1A 4R9KA 2BO9B 4FMBA 1OHOA 4CPKA 3CCV3 3LZAA 3G4S3 3KSED 1I0XA 5JPUA 3WODG 5JPPA 2F98A 1BOXA 1W6CA 2GBWB 4XB5A 3BB9A 2XF3A 1GD3A 1DYUA 3F9SA 3RGAA 1SIIA 3CCJ3 3QRDA 3CCQ3 2WO0A 3V98A 3FSDA 3NV0B 1RN4A 1D6UA 1BUJA 1BNEA 1LOXA 6GSPA 2BU4A 3N54B 1GMRA 1JKGB 4XDWA 3OWYA 1ROAA 1VQP3 5D82A 3D5GA 3S67A 3MPHA 3SLUA 1FGOA 1RGKA 1JZDA 3FGYA 3GZXB 1QAKA 5AIHA 1CH0A 1LNIA 1GD4A 1OGXA 4LEHA 4H3UA 3WMDA 1IVUA 3LXUX 2CFLA 3K0ZA 1GYBA 2IMJA 4R9LA 2Z76A 4OUQA 3GSPA 1GY7A 5IW9A 3LH4A 1BRJA 2OWPA 4N6MA 1RGGA 1WTHA 2HMOB 2IA7A 1AVLA 3FF2A 3HX8A 1BSEA 1JN5A 1IK3A 1RKYA 3J7Yd 2W6JH 1QALA 2F56A 1LQGC 2RGQA 1NNVA 1RGHA 3HIIA 1FUWA 1RCLA 1KSIA 2WGQA 1QAFA 5LC6A 5AEUB 4H61A 2ZA4A 3N8BA 4K90B 2C4BA 4MMYB 3F8XA 2XGLA 1B20A 5IG0A 1OF5A 1IVVA 2OQEC 2H0HA 1I2EA 5CF1A 6RNTA 1CEWI 4N6NB 3F14A 2D1WA 5EQLA 3CNXA 1IVWA 1YJ93 3WA3A 2P38A 2CG0A 5FW5A 2LQVA 4HM2B 5AYSC 4N3VA 3B7CA 1RCKA 3GWRA 3X3XA 3LT9A 2E2UA 1V58A 3CU3A 3Q3FA 1RNBA 1SIHA 1U5OA 1VQL3 3FF0A 1GMQA 4FMDA 5STDA 1VQ43 1BANA 1G0TA 1HZ1A 1JZOA 1N5HA 3GZBA 3MHEA 1WMNA 3B4OA 3SYUA 3SXXA 4RZMA 6STDA 1HYFA 2P05A 3FKAA 1ZO2A 1I70A 1ISKA 3PYJA 1D6YA 3AHSA 1LOWA 1OHSA 2PNCA 1HKXA 3B4PA 3WHOA 2JDIH 2O3OA 1RGCA 4CJNA 2CKFB 1TFOA 2Z6BA 2RBIA 4AKZA 4I4KA 2YFIB 3GZYB 3F7SA 3L0RA 3RGRA 1K8A4 1UCLA 1BRSA 1MWSA 4WYKB 5AYRB 4CCVA 1OH0A 3BNEA 3T8UA 2RFRA 2OOVC 2QGUA 4L8OA 5GSPA 4K61A 1I3IA 4LSOA 1VQ73 1BGSA 4NPBA 1E97A 4ORLA 1JB5A 1NJI4 1LRAA 2CFDA 1AVKA 1O7WB 2KAAA 3ROBA 2AADA 2XSHB 3AGNA 3KFQC 1B27A 1ZS7A 3EE1A 3LTAA 2ML5A 1Q42A 2HMMB 4L8PA 1VQ93 2JQ5A 1GOYA 2GBXB 2XFSA 2YFLB 4HZBB 4MMXB 2CX0A 3K63A 4HYZA 1R4CA 4TX4A 4HBRA 1OPYA 1BNFA 2BIRA 1HU9A 1X1XA 3LT8A 1WMPA 4U13A 4BTXA 3DZLA 2XEPA 4HKVB 5LC7A 1O7HB 1TRPA 3JUNA 3MWZA 3PCSA 5AIFA 2QIYA 3G8ZA 5KP1A 2E2TA 3NQZA 1O7PB 1I2FA 2W04A 2OQEA 1JRQA 5EEOA 1UUGB 3HI7A 3LOYA 2CFKA 4IT7A 1QVG2 3EBYA 3OW22 1LOYA 1ULJB 1MWTA 2J8XB 3WA2X 4XM4A 4EV2A 1A2VA 3B8LA 3CPOA 1M9GA 1RNTA 4O3VA 1KC84 1UDII 3MG2A 5EVHA 1EQKA 1X1YA 3G16A 3GAXA 3SOAA 1PFPA 2YX9A 4ILFA 1YJN3 3MKIA 3OWSA 2O9UX 4FCZA 5A0OB 3GZRA 3JUMA 3LYGA 4BL3A 1GMPA 1MWUA 3DGLA 1BVIA 4XDVA 1DVDA 3CCS3 2P09A 3CNMA 4FCJA 3I553 1FYSA 3UL5A 1TIJA 1RGFA 2K3DA 4EXRA 1JNQA 1TJDA 5HGRA 1SJWA 1VQ53 3GRDA 2OOVA 3NM7A 3SOYA 5IG3A 1BUQA 3X3YA 1VQM3 1QVF2 1RLSA 1T3BA 1JN5B 1S5AA 3JVCA 3EJVA 5IEPA 1M904 3OWUA 4AKYA 1FUTA 1BRGA 1WQLB 1W6GA 2P0XA 1TTOA 3BNBA 3NBJA 4MJDA 1X1WA 5CXOA 9RNTA 1EUIC 1JV2B 1UI8A 4WFOA 1RMSA 2W9PA 5IG4A 1JJ22 1I3FA 1A2KA 3PXMA 1DMQA 4EBGA 2F86B 3IJEB 1OF5B 2SBLA 2CW9A 1UUWB 4KT3B 3EQQB 1EA2A 2GEYA 2CWVA 3MG1A 2XGNA 1YHQ3 1JBTA 3D4AA 2KXGA 2OCTA 1YJW3 1Q7Y4 1C54A 3T8NA 1OUNA 2W56A 5D81A 5D83A 3S28A 1GY5A 1PYLA 1DMMA 4RNYA 3KIIA 3EN1B 1BU4A 3S5CA 4LZIA 2UGIA 4QWTA 3FZWA 2UUGC 4XBYA 4GHOA 3AHWA 5JBSA 5G1KA 3I563 3G713 4RNTA 2OTJ3 4FR9A 3K5TA 3NBBA 4DKIA 3G6E3 2BMOB 3CME3 1BSDA 1ROVA 3A5EA 2HOHA 4JF8A 4KFDA 5KP4A 4X2OA 3SX1A 1E3RA 5AIGA 3O8YA 2IUKA 1YI23 1BNGA 3FLJA 2Z77A 1I0VA 1TRQA 1YVSA 3OV4A 5HOHA 1BIRA 3FCSB 1UGHI 4STDA 1IQYA 3CCU3 2XR8B 3ZFZA 4O2HA 4BIRA 2WGOA 3NXJA 3CXC2 1UI7A 2IYJA 4KZ1A 3HK4A 1RGAA 2CWUA 1JBRA 3X3ZA 1IQ8A 1ULIB 2PZVA 1QJGA 1YGWA 1BRHA 3CPW2 1PU4A 3TDGA 1RDSA 1A2PA 1AV4A 1W2ZA 1KD14 2C11A 2HMLB 3NHXA 1Q814 1VZZA 3FG3A 1EKMA 8CHOA 3IMAB 3KCHA 2HMNB 3UJMA 3FG1A 2BHMA 4L7KA 3RDEA 1B2MA 2C10A 3FG4A 1F8NA 2E2VA
chains in the Genus database with same CATH topology
2BNGA 1GS3A 1W2B2 3DM8A 3KE7A 4OK0A 3CCR3 5IG5A 2BMRB 1K41A 3CC23 1JB4A 2B24B 1V74A 1RN7A 3EBTA 3BLZA 4IPBA 1IDPA 3M8CA 4J9AA 4HVNA 3F7XA 1KQS2 1N5PA 2HMKB 2RSXA 1VQ63 3Q2PA 1STFI 1TFKA 3ALAA 5IENA 1ASKA 2CWTA 1LNHA 1L5GB 1TUHA 2BMQB 4KFEA 4BTYA 5TGNA 1S723 4PEJA 2K0MA 3K7CA 3EX9A 5ELJA 3HIGA 3S29A 3HZPA 4KFFA 4HM3B 3CD63 2XFTA 4O02B 4HM8B 3PZWA 2OTL3 4XBXA 1IV9A 4G1MB 1MNLA 1M1K4 1O7GB 5DRVA 4FCMA 4J8TA 1K28A 1W00A 1Q40A 3X41A 1TP6A 3U97A 1IVXA 3LTDA 4EV5A 3NX0A 1NU3A 3STDA 2W0QA 3VGNA 3KSPA 3H51A 3OXAA 2GXFA 3JUQA 3NBRA 2ZL8A 1YIJ3 1US1A 1E3VA 1Z1SA 5FGOA 4R1KA 5IEOA 1OGZA 3N9HA 1FA3A 2CC3A 5AIIA 1N9JA 1O7NB 2W56B 3LMLA 1K9M4 3PCRA 4FMCA 4AEQA 3A76A 2P0MA 1W4NA 1DVDA 1JB2A 4N6V0 2IUJA 3SVAA 3UNLA 4HJLB 1G96A 3S27A 5CK6A 3D9RA 1KWIA 1IT7A 2STDA 1CQSA 1W6YA 3AMOA 4Q53A 5CF2A 1NO3A 3EB8A 3MYTA 4IIAA 3WDGB 1A90A 4LGQA 2QA43 2FXTA 3BNCA 4K1UA 3V92A 1FGQA 1SPUA 4HM4B 2INXA 3IPTA 3K9MC 3CCM3 1NB3I 3OX9A 1U8CB 3LTCA 1FGTA 5BXQA 3DGOA 1YVBI 3DMCA 4MMZB 1IV7A 1A67A 1SQWA 2V1LA 1RRLA 3EC9A 4R4KA 1W01A 1K734 3PS8A 1NB5I 1W5ZA 3CC43 2GU1A 2Q07A 3UB1A 3NV0A 3T0UA 1FGMA 3VF1A 4JRFA 1O7MB 3VSYA 5CLKA 1JKGA 2Z7AA 4BTWA 2YFJB 4WP5A 5AI1A 1LXEA 2BT3A 2GU3A 4N6OB 3X42A 2CFWA 4R80A 1Y4KA 2ZDJA 4X2HA 1FGRA 3F40A 3NUVA 2KCDA 4HM7B 4OVMA 2R4IA 2XSOB 3DGNA 5AEWB 1W7CA 4N6TA 4WHAA 3MG3A 2Y73A 1TU5A 1VQK3 3H3HA 1STDA 5BVBA 1GY6A 3CCL3 2MC8A 7STDA 3ER7A 3SEDA 3D3LA 2WOFA 1EG9B 2CG1A 4MEIA 3KKGA 1MOLA 1N8R4 2W9QA 3ECFA 1RRHA 2HMJB 4WWUC 4EYCA 3FH1A 1QMAA 3Q1CA 4KVHA 2CK3H 2MF7A 5DREA 1N9EA 1Q824 1LVNA 4HZ9B 3KZTA 4K1VA 5IF6A 2WOHA 1Q864 1D6ZA 2CHCA 4O8SA 4HM5B 5I97A 1AR0A 4GL6A 2FNQA 1T5YA 1NWWA 3WOFB 2W03A 4LMIA 1YGEA 4HM0B 4RBNA 4EC6A 1J2BA 3DUKA 2K54A 3E99A 1WMOA 2A15A 2F99A 4NREA 3F8HA 2I9WA 1IT8A 5KP3A 1CYVA 1IQXA 1Q40B 3KN4A 4N6UA 4RNZA 4HM1B 1UUVB 1N8QA 3DGMA 3WOEB 1M1XB 3Q90A 3EHCA 3EF8A 3QK9A 4XBTA 1VQO3 1VQ83 2RCDA 2XH9A 1RJOA 2GEXA 2LYXA 3JUPA 1VQN3 2CH9A 4WYKA 1OCVA 1OACA 2KRTA 4GB5A 2XRXB 3EN8A 4N6LA 1IU7A 4NHFA 2ML6A 2QEX3 5IERA 1C7HA 2CIUA 3LTBA 3CC73 3DY5A 3G0KA 4HM6B 1W02A 1YIT3 2D42A 3NQYA 1DVCA 2B1XB 2UX0A 3I0YA 4FMAA 1ZX2A 3UL6A 3JUOA 1OHPA 1NDOB 2FGTA 5ELUA 3U1WA 5G2GA 3V99A 4CDLA 3AMOB 3CMA3 2L4VA 3NM2A 3CCE3 3DXOA 4ZM8A 3BNDA 2W2CA 2Y74A 1CYUA 3MSOA 3X40A 2CFGA 1WNHA 3PGBA 1DMNA 2M7OA 1UW1A 4R9KA 2BO9B 4FMBA 1OHOA 3CCV3 3LZAA 3G4S3 3KSED 5JPUA 3WODG 5JPPA 2F98A 1W6CA 2GBWB 4XB5A 3BB9A 2XF3A 1GD3A 1DYUA 3F9SA 3RGAA 1SIIA 3CCJ3 3QRDA 3CCQ3 2WO0A 3V98A 3FSDA 3NV0B 1D6UA 1LOXA 3N54B 1JKGB 4XDWA 3OWYA 1ROAA 1VQP3 5D82A 3SLUA 3S67A 3MPHA 1FGOA 3GZXB 5AIHA 3FGYA 1QAKA 1OGXA 1GD4A 4LEHA 4H3UA 3WMDA 1IVUA 3LXUX 2CFLA 3K0ZA 1GYBA 2IMJA 4R9LA 2Z76A 4OUQA 1GY7A 5IW9A 3LH4A 2OWPA 4N6MA 2IA7A 1WTHA 2HMOB 3FF2A 1AVLA 3HX8A 1IK3A 1RKYA 1JN5A 3J7Yd 2W6JH 1QALA 2RGQA 3HIIA 1FUWA 1KSIA 2WGQA 1QAFA 5LC6A 5AEUB 4H61A 3N8BA 4K90B 4MMYB 3F8XA 2XGLA 5IG0A 1OF5A 1IVVA 2OQEC 5CF1A 1CEWI 4N6NB 3F14A 2D1WA 5EQLA 3CNXA 1IVWA 1YJ93 3WA3A 2P38A 2CG0A 5FW5A 2LQVA 4HM2B 5AYSC 4N3VA 3B7CA 3GWRA 3LT9A 2E2UA 3CU3A 1SIHA 1U5OA 1VQL3 3FF0A 4FMDA 5STDA 1VQ43 1N5HA 3GZBA 3MHEA 3SXXA 1WMNA 3B4OA 4RZMA 6STDA 3FKAA 2P05A 1ZO2A 1ISKA 3PYJA 1D6YA 3X3XA 1OHSA 2PNCA 1HKXA 3B4PA 2JDIH 2O3OA 2CKFB 1TFOA 2Z6BA 4AKZA 4I4KA 2YFIB 3GZYB 3F7SA 3L0RA 3RGRA 1K8A4 4WYKB 5AYRB 4CCVA 1OH0A 3BNEA 3T8UA 2RFRA 2OOVC 2QGUA 4L8OA 4K61A 4LSOA 1VQ73 1E97A 4ORLA 1JB5A 1NJI4 2CFDA 1AVKA 1O7WB 3ROBA 2XSHB 3KFQC 3EE1A 4L8PA 3LTAA 2ML5A 1Q42A 2HMMB 1VQ93 2JQ5A 2GBXB 2XFSA 2YFLB 4HZBB 4MMXB 3K63A 4HYZA 1R4CA 4TX4A 4HBRA 1OPYA 1HU9A 3LT8A 4U13A 1WMPA 4BTXA 3DZLA 2XEPA 4HKVB 5LC7A 1O7HB 3JUNA 3MWZA 3PCSA 5AIFA 2QIYA 3G8ZA 5KP1A 2E2TA 3NQZA 1O7PB 2W04A 2OQEA 1JRQA 5EEOA 3HI7A 4IT7A 3LOYA 2CFKA 1QVG2 3EBYA 3OW22 1ULJB 3WA2X 4XM4A 4EV2A 1A2VA 3B8LA 3CPOA 1M9GA 4O3VA 1KC84 3MG2A 5EVHA 1EQKA 3G16A 3GAXA 3SOAA 1PFPA 2YX9A 1YJN3 3MKIA 3OWSA 2O9UX 4FCZA 5A0OB 3GZRA 3JUMA 3LYGA 3DGLA 4XDVA 3CCS3 2P09A 3CNMA 4FCJA 3I553 3UL5A 1TIJA 4EXRA 1JNQA 5HGRA 1SJWA 1VQ53 3GRDA 2OOVA 3NM7A 3SOYA 5IG3A 1BUQA 3X3YA 1VQM3 1QVF2 1JN5B 1S5AA 3JVCA 3EJVA 5IEPA 1M904 3OWUA 4AKYA 4MJDA 1WQLB 2P0XA 1W6GA 3BNBA 3NBJA 5CXOA 1UI8A 1JV2B 4WFOA 2W9PA 5IG4A 1JJ22 3PXMA 1A2KA 1DMQA 4EBGA 2F86B 3IJEB 1OF5B 2SBLA 2CW9A 1UUWB 3EQQB 1EA2A 2GEYA 2CWVA 3MG1A 2XGNA 1YHQ3 2KXGA 2OCTA 1YJW3 1Q7Y4 3T8NA 1OUNA 2W56A 5D81A 5D83A 3S28A 1GY5A 1DMMA 4RNYA 3KIIA 3EN1B 3S5CA 4LZIA 4QWTA 3FZWA 4XBYA 5JBSA 3I563 3G713 2OTJ3 4FR9A 3K5TA 3NBBA 3G6E3 2BMOB 3CME3 1ROVA 4KFDA 4JF8A 5KP4A 4X2OA 3SX1A 1E3RA 5AIGA 3O8YA 2IUKA 1YI23 3FLJA 2Z77A 3OV4A 3FCSB 4STDA 1IQYA 3CCU3 2XR8B 4O2HA 2WGOA 3NXJA 3CXC2 1UI7A 4KZ1A 3HK4A 2CWUA 3X3ZA 1IQ8A 1ULIB 2PZVA 1QJGA 3CPW2 1PU4A 3TDGA 1AV4A 1W2ZA 1KD14 2C11A 2HMLB 3NHXA 1Q814 1VZZA 3FG3A 1EKMA 8CHOA 3IMAB 2HMNB 3UJMA 3FG1A 2BHMA 4L7KA 3RDEA 2C10A 3FG4A 1F8NA 2E2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNG A;  1GS3 A;  3DM8 A;  3KE7 A;  5IG5 A;  2BMR B;  1K41 A;  1JB4 A;  2B24 B;  3EBT A;  3BLZ A;  1IDP A;  3M8C A;  4J9A A;  4HVN A;  3F7X A;  2HMK B;  5IEN A;  1ASK A;  1TUH A;  2BMQ B;  5TGN A;  4PEJ A;  3K7C A;  3EX9 A;  3HZP A;  4HM3 B;  4HM8 B;  4XBX A;  1O7G B;  5DRV A;  4FCM A;  4J8T A;  1W00 A;  1Q40 A;  1TP6 A;  1NU3 A;  3STD A;  3VGN A;  3KSP A;  3H51 A;  3OXA A;  2GXF A;  3JUQ A;  3NBR A;  1E3V A;  1Z1S A;  4R1K A;  5IEO A;  1OGZ A;  5AII A;  1O7N B;  3A76 A;  1JB2 A;  3UNL A;  4HJL B;  5CK6 A;  3D9R A;  2STD A;  1CQS A;  1W6Y A;  4Q53 A;  5CF2 A;  3MYT A;  4IIA A;  4LGQ A;  4K1U A;  4HM4 B;  2INX A;  3IPT A;  3OX9 A;  5BXQ A;  3DMC A;  3EC9 A;  1W01 A;  3NV0 A;  1O7M B;  3VSY A;  5CLK A;  1JKG A;  2Z7A A;  2YFJ B;  4WP5 A;  5AI1 A;  4X2H A;  3F40 A;  3NUV A;  4OVM A;  4HM7 B;  2R4I A;  2XSO B;  5AEW B;  3MG3 A;  3H3H A;  1STD A;  5BVB A;  1GY6 A;  7STD A;  3ER7 A;  3SED A;  1EG9 B;  3KKG A;  3ECF A;  2HMJ B;  4WWU C;  3FH1 A;  1QMA A;  4KVH A;  5DRE A;  4HZ9 B;  4K1V A;  3KZT A;  5IF6 A;  2CHC A;  4HM5 B;  1AR0 A;  1NWW A;  4LMI A;  4HM0 B;  3DUK A;  2K54 A;  3E99 A;  2A15 A;  2F99 A;  3F8H A;  2I9W A;  5KP3 A;  1Q40 B;  4HM1 B;  1UUV B;  3Q90 A;  3EHC A;  3EF8 A;  4XBT A;  2RCD A;  2GEX A;  3JUP A;  4WYK A;  1OCV A;  4GB5 A;  2XRX B;  3EN8 A;  5IER A;  1C7H A;  3G0K A;  4HM6 B;  1W02 A;  2B1X B;  2UX0 A;  3I0Y A;  1ZX2 A;  3JUO A;  1OHP A;  1NDO B;  5G2G A;  4CDL A;  3NM2 A;  3DXO A;  2W2C A;  3MSO A;  1DMN A;  4R9K A;  1OHO A;  3LZA A;  5JPU A;  5JPP A;  2F98 A;  2GBW B;  4XB5 A;  3RGA A;  3BB9 A;  3F9S A;  3FSD A;  3NV0 B;  1JKG B;  4XDW A;  3OWY A;  5D82 A;  3GZX B;  5AIH A;  3FGY A;  1OGX A;  4LEH A;  4H3U A;  3WMD A;  3K0Z A;  1GYB A;  2IMJ A;  4R9L A;  2Z76 A;  4OUQ A;  1GY7 A;  2OWP A;  2HMO B;  3HX8 A;  3FF2 A;  1JN5 A;  2RGQ A;  5AEU B;  3F8X A;  5IG0 A;  1OF5 A;  5CF1 A;  3F14 A;  3CNX A;  5FW5 A;  4HM2 B;  4N3V A;  3B7C A;  3GWR A;  3CU3 A;  1U5O A;  3FF0 A;  5STD A;  3GZB A;  3MHE A;  3B4O A;  4RZM A;  6STD A;  3FKA A;  1ZO2 A;  1ISK A;  1OHS A;  1HKX A;  3B4P A;  2CKF B;  4I4K A;  2YFI B;  3GZY B;  3F7S A;  3RGR A;  4WYK B;  1OH0 A;  3T8U A;  2RFR A;  2QGU A;  4L8O A;  1E97 A;  4ORL A;  1JB5 A;  1O7W B;  3ROB A;  2XSH B;  4L8P A;  1Q42 A;  2HMM B;  2JQ5 A;  2GBX B;  2YFL B;  4HZB B;  1OPY A;  4U13 A;  3DZL A;  4HKV B;  1O7H B;  3JUN A;  5AIF A;  2QIY A;  3G8Z A;  5KP1 A;  1O7P B;  3EBY A;  1ULJ B;  4XM4 A;  3B8L A;  3CPO A;  3MG2 A;  5EVH A;  3G16 A;  3SOA A;  3MKI A;  3OWS A;  3GZR A;  3JUM A;  3LYG A;  4XDV A;  3CNM A;  4FCJ A;  5HGR A;  1SJW A;  3GRD A;  3SOY A;  5IG3 A;  1BUQ A;  1JN5 B;  1S5A A;  3EJV A;  5IEP A;  3OWU A;  4MJD A;  1WQL B;  5CXO A;  5IG4 A;  1A2K A;  1DMQ A;  2F86 B;  1OF5 B;  1UUW B;  3EQQ B;  1EA2 A;  2GEY A;  3MG1 A;  3T8N A;  1OUN A;  5D81 A;  5D83 A;  1GY5 A;  1DMM A;  3EN1 B;  3S5C A;  3FZW A;  4XBY A;  2BMO B;  5KP4 A;  4X2O A;  1E3R A;  5AIG A;  3FLJ A;  2Z77 A;  3OV4 A;  4STD A;  2XR8 B;  3NXJ A;  3HK4 A;  1ULI B;  2PZV A;  1QJG A;  2HML B;  3NHX A;  1VZZ A;  8CHO A;  2HMN B;  3UJM A;  4L7K A; 
#chains in the Genus database with same CATH topology
 2BNG A;  5BIR A;  1GS3 A;  1W2B 2;  3DM8 A;  3KE7 A;  4OK0 A;  3CCR 3;  5IG5 A;  2BMR B;  1K41 A;  3CC2 3;  1JB4 A;  2B24 B;  1BRK A;  1V74 A;  1RN7 A;  3EBT A;  2KF6 A;  3BLZ A;  4IPB A;  5RNT A;  1IDP A;  3M8C A;  4J9A A;  4HVN A;  3F7X A;  1KQS 2;  1N5P A;  2HMK B;  2RSX A;  1VQ6 3;  2H0I A;  3Q2P A;  1STF I;  1TFK A;  1BRN L;  3ALA A;  3WR2 A;  1ASK A;  2CWT A;  5BU4 A;  1BRI A;  1LNH A;  1L5G B;  5IEN A;  1TUH A;  2BMQ B;  4KFE A;  4BTY A;  5TGN A;  1S72 3;  4PEJ A;  2K0M A;  3K7C A;  1R4Y A;  5M18 A;  3EX9 A;  5ELJ A;  3HIG A;  3S29 A;  7GSP A;  3HZP A;  4KFF A;  4HM3 B;  1LQM B;  2XFT A;  4O02 B;  4HM8 B;  3CD6 3;  3PZW A;  2OTL 3;  1FUS A;  4XBX A;  3DH2 A;  1IV9 A;  4G1M B;  1DE3 A;  3RNT A;  1MNL A;  1M1K 4;  1O7G B;  5DRV A;  4FCM A;  1GSP A;  1K28 A;  4J8T A;  1W00 A;  1Q40 A;  3X41 A;  1BAO A;  1TP6 A;  3D79 A;  3U97 A;  4HAA A;  1IVX A;  3LTD A;  2IY2 A;  4I5Q A;  4EV5 A;  3NX0 A;  1NU3 A;  3STD A;  2W0Q A;  3VGN A;  3D5I A;  1B2Z A;  3KSP A;  3H51 A;  3OXA A;  2GXF A;  3JUQ A;  3NBR A;  2ZL8 A;  1YIJ 3;  1US1 A;  1E3V A;  1Z1S A;  5FGO A;  4R1K A;  5IEO A;  1OGZ A;  1B2U A;  3N9H A;  1FA3 A;  2RNT A;  2CC3 A;  5AII A;  1N9J A;  1O7N B;  2W56 B;  3LML A;  1K9M 4;  3PCR A;  4FMC A;  4AEQ A;  3A76 A;  2P0M A;  1W4N A;  5M19 A;  1BNR A;  1VQQ A;  1I2G A;  1UCK A;  1JB2 A;  1RTU A;  4N6V 0;  2IUJ A;  3SVA A;  3UNL A;  3ZG5 A;  1X1U A;  4HJL B;  1BNJ A;  1G96 A;  1YNV X;  2F5W A;  1ZGX A;  3S27 A;  2F4Y A;  5CK6 A;  1B21 A;  2L1S A;  1KWI A;  3D9R A;  1IT7 A;  1GOU A;  1UCJ A;  2F5M A;  3BIR A;  2STD A;  1T2H A;  1CQS A;  1MGR A;  1W6Y A;  3AMO A;  4Q53 A;  5CF2 A;  1NO3 A;  3EB8 A;  3MYT A;  4IIA A;  3WDG B;  1A90 A;  4LGQ A;  2QA4 3;  1RSN A;  8RNT A;  2FXT A;  3BNC A;  4K1U A;  3V92 A;  1FGQ A;  1SPU A;  4HM4 B;  2INX A;  3IPT A;  2KF4 A;  3K9M C;  3CCM 3;  1NB3 I;  3OX9 A;  1U8C B;  3LTC A;  1FGT A;  1G02 A;  3DGO A;  5BXQ A;  1YVB I;  3DMC A;  1T2I A;  1IV7 A;  4MMZ B;  1A67 A;  1SQW A;  1UGI A;  1RRL A;  2V1L A;  3EC9 A;  1W01 A;  4J5G A;  4R4K A;  3PS8 A;  1K73 4;  1BNI A;  1NB5 I;  1W5Z A;  4BU4 A;  3CC4 3;  3DGY A;  2GU1 A;  2Q07 A;  3UB1 A;  3NV0 A;  4GSP A;  3T0U A;  1FGM A;  3VF1 A;  4JRF A;  1O7M B;  4EW5 A;  1V57 A;  5CLK A;  3VSY A;  1JKG A;  2Z7A A;  2H0G A;  3HOH A;  2YFJ B;  4BTW A;  4WP5 A;  5AI1 A;  1LXE A;  2BT3 A;  2GU3 A;  4N6O B;  3URP A;  3X42 A;  2CFW A;  4R80 A;  1Y4K A;  2ZDJ A;  4X2H A;  1FGR A;  3F40 A;  3NUV A;  2KCD A;  4HM7 B;  4OVM A;  2R4I A;  2XSO B;  1RGL A;  3DGN A;  4LYL B;  5AEW B;  3BU4 A;  1W7C A;  4N6T A;  4WHA A;  3MG3 A;  2Y73 A;  1TU5 A;  1VQK 3;  3H3H A;  1STD A;  5BVB A;  1GY6 A;  3CCL 3;  2MC8 A;  7STD A;  3ER7 A;  3SED A;  3D3L A;  2WOF A;  1EG9 B;  2CG1 A;  4MEI A;  3KKG A;  1EEJ A;  1MOL A;  1GOV A;  1Q7H A;  1N8R 4;  1PY3 A;  2W9Q A;  3ECF A;  1RRH A;  2HMJ B;  4WWU C;  4EYC A;  3FH1 A;  3AGO A;  1QMA A;  3Q1C A;  4KVH A;  2CK3 H;  2MF7 A;  5DRE A;  1N9E A;  4J5K A;  1Q82 4;  1LVN A;  4HZ9 B;  3KZT A;  4K1V A;  5IF6 A;  2WOH A;  1Q86 4;  1D6Z A;  2CHC A;  4O8S A;  3ZG0 A;  1FW7 A;  4HM5 B;  1BSA A;  1AR0 A;  4GL6 A;  5I97 A;  1MWR A;  1T5Y A;  2FNQ A;  1B3S A;  1I8V A;  2ZHX B;  1NWW A;  3WOF B;  2W03 A;  4LMI A;  1YGE A;  4HM0 B;  4RBN A;  4EC6 A;  1J2B A;  1B2X A;  3DUK A;  1RGE A;  2K54 A;  3E99 A;  1WMO A;  2A15 A;  2F99 A;  4NRE A;  3F8H A;  2I9W A;  2SAR A;  1IT8 A;  5KP3 A;  1CYV A;  1IQX A;  1Q40 B;  1BSC A;  2GSP A;  5M1A A;  3KN4 A;  4N6U A;  1RN1 A;  4RNZ A;  1BNS A;  4HM1 B;  1UUV B;  1JBS A;  1N8Q A;  3DGM A;  3WOE B;  1M1X B;  3Q90 A;  3EHC A;  3EF8 A;  3QK9 A;  4XBT A;  7RNT A;  1VQO 3;  1VQ8 3;  2RCD A;  2XH9 A;  1RJO A;  2GEX A;  2LYX A;  3JUP A;  2CX1 A;  1VQN 3;  2CH9 A;  4WYK A;  1AQZ A;  1OCV A;  1OAC A;  2KRT A;  1RHL A;  1UCI A;  4GB5 A;  2XRX B;  3EN8 A;  4N6L A;  1IU7 A;  4NHF A;  2ML6 A;  2QEX 3;  5IER A;  1C7H A;  2CIU A;  3LTB A;  3CC7 3;  3DY5 A;  3G0K A;  1AY7 A;  1W02 A;  2R41 A;  4HM6 B;  2D42 A;  2KF3 A;  1YIT 3;  3NQY A;  1DVC A;  1DET A;  1SAR A;  2B1X B;  2UX0 A;  3I0Y A;  4FMA A;  1ZX2 A;  2AAE A;  1LOV A;  3UL6 A;  3JUO A;  1OHP A;  1NDO B;  2FGT A;  5ELU A;  5G1L A;  3U1W A;  5G2G A;  3V99 A;  4CDL A;  1BSB A;  3AMO B;  1FZU A;  3CMA 3;  1IYY A;  2L4V A;  3NM2 A;  3CCE 3;  3DXO A;  4ZM8 A;  1B2S A;  4BL2 A;  3BND A;  2KF5 A;  1MGW A;  2W2C A;  2Y74 A;  3MSO A;  3X40 A;  1CYU A;  2CFG A;  4HOH A;  1WNH A;  3PGB A;  1DMN A;  1Q9E A;  2M7O A;  1UW1 A;  4R9K A;  2BO9 B;  4FMB A;  1OHO A;  4CPK A;  3CCV 3;  3LZA A;  3G4S 3;  3KSE D;  1I0X A;  5JPU A;  3WOD G;  5JPP A;  2F98 A;  1BOX A;  1W6C A;  2GBW B;  4XB5 A;  3BB9 A;  2XF3 A;  1GD3 A;  1DYU A;  3F9S A;  3RGA A;  1SII A;  3CCJ 3;  3QRD A;  3CCQ 3;  2WO0 A;  3V98 A;  3FSD A;  3NV0 B;  1RN4 A;  1D6U A;  1BUJ A;  1BNE A;  1LOX A;  6GSP A;  2BU4 A;  3N54 B;  1GMR A;  1JKG B;  4XDW A;  3OWY A;  1ROA A;  1VQP 3;  5D82 A;  3D5G A;  3S67 A;  3MPH A;  3SLU A;  1FGO A;  1RGK A;  1JZD A;  3FGY A;  3GZX B;  1QAK A;  5AIH A;  1CH0 A;  1LNI A;  1GD4 A;  1OGX A;  4LEH A;  4H3U A;  3WMD A;  1IVU A;  3LXU X;  2CFL A;  3K0Z A;  1GYB A;  2IMJ A;  4R9L A;  2Z76 A;  4OUQ A;  3GSP A;  1GY7 A;  5IW9 A;  3LH4 A;  1BRJ A;  2OWP A;  4N6M A;  1RGG A;  1WTH A;  2HMO B;  2IA7 A;  1AVL A;  3FF2 A;  3HX8 A;  1BSE A;  1JN5 A;  1IK3 A;  1RKY A;  3J7Y d;  2W6J H;  1QAL A;  2F56 A;  1LQG C;  2RGQ A;  1NNV A;  1RGH A;  3HII A;  1FUW A;  1RCL A;  1KSI A;  2WGQ A;  1QAF A;  5LC6 A;  5AEU B;  4H61 A;  2ZA4 A;  3N8B A;  4K90 B;  2C4B A;  4MMY B;  3F8X A;  2XGL A;  1B20 A;  5IG0 A;  1OF5 A;  1IVV A;  2OQE C;  2H0H A;  1I2E A;  5CF1 A;  6RNT A;  1CEW I;  4N6N B;  3F14 A;  2D1W A;  5EQL A;  3CNX A;  1IVW A;  1YJ9 3;  3WA3 A;  2P38 A;  2CG0 A;  5FW5 A;  2LQV A;  4HM2 B;  5AYS C;  4N3V A;  3B7C A;  1RCK A;  3GWR A;  3X3X A;  3LT9 A;  2E2U A;  1V58 A;  3CU3 A;  3Q3F A;  1RNB A;  1SIH A;  1U5O A;  1VQL 3;  3FF0 A;  1GMQ A;  4FMD A;  5STD A;  1VQ4 3;  1BAN A;  1G0T A;  1HZ1 A;  1JZO A;  1N5H A;  3GZB A;  3MHE A;  1WMN A;  3B4O A;  3SYU A;  3SXX A;  4RZM A;  6STD A;  1HYF A;  2P05 A;  3FKA A;  1ZO2 A;  1I70 A;  1ISK A;  3PYJ A;  1D6Y A;  3AHS A;  1LOW A;  1OHS A;  2PNC A;  1HKX A;  3B4P A;  3WHO A;  2JDI H;  2O3O A;  1RGC A;  4CJN A;  2CKF B;  1TFO A;  2Z6B A;  2RBI A;  4AKZ A;  4I4K A;  2YFI B;  3GZY B;  3F7S A;  3L0R A;  3RGR A;  1K8A 4;  1UCL A;  1BRS A;  1MWS A;  4WYK B;  5AYR B;  4CCV A;  1OH0 A;  3BNE A;  3T8U A;  2RFR A;  2OOV C;  2QGU A;  4L8O A;  5GSP A;  4K61 A;  1I3I A;  4LSO A;  1VQ7 3;  1BGS A;  4NPB A;  1E97 A;  4ORL A;  1JB5 A;  1NJI 4;  1LRA A;  2CFD A;  1AVK A;  1O7W B;  2KAA A;  3ROB A;  2AAD A;  2XSH B;  3AGN A;  3KFQ C;  1B27 A;  1ZS7 A;  3EE1 A;  3LTA A;  2ML5 A;  1Q42 A;  2HMM B;  4L8P A;  1VQ9 3;  2JQ5 A;  1GOY A;  2GBX B;  2XFS A;  2YFL B;  4HZB B;  4MMX B;  2CX0 A;  3K63 A;  4HYZ A;  1R4C A;  4TX4 A;  4HBR A;  1OPY A;  1BNF A;  2BIR A;  1HU9 A;  1X1X A;  3LT8 A;  1WMP A;  4U13 A;  4BTX A;  3DZL A;  2XEP A;  4HKV B;  5LC7 A;  1O7H B;  1TRP A;  3JUN A;  3MWZ A;  3PCS A;  5AIF A;  2QIY A;  3G8Z A;  5KP1 A;  2E2T A;  3NQZ A;  1O7P B;  1I2F A;  2W04 A;  2OQE A;  1JRQ A;  5EEO A;  1UUG B;  3HI7 A;  3LOY A;  2CFK A;  4IT7 A;  1QVG 2;  3EBY A;  3OW2 2;  1LOY A;  1ULJ B;  1MWT A;  2J8X B;  3WA2 X;  4XM4 A;  4EV2 A;  1A2V A;  3B8L A;  3CPO A;  1M9G A;  1RNT A;  4O3V A;  1KC8 4;  1UDI I;  3MG2 A;  5EVH A;  1EQK A;  1X1Y A;  3G16 A;  3GAX A;  3SOA A;  1PFP A;  2YX9 A;  4ILF A;  1YJN 3;  3MKI A;  3OWS A;  2O9U X;  4FCZ A;  5A0O B;  3GZR A;  3JUM A;  3LYG A;  4BL3 A;  1GMP A;  1MWU A;  3DGL A;  1BVI A;  4XDV A;  1DVD A;  3CCS 3;  2P09 A;  3CNM A;  4FCJ A;  3I55 3;  1FYS A;  3UL5 A;  1TIJ A;  1RGF A;  2K3D A;  4EXR A;  1JNQ A;  1TJD A;  5HGR A;  1SJW A;  1VQ5 3;  3GRD A;  2OOV A;  3NM7 A;  3SOY A;  5IG3 A;  1BUQ A;  3X3Y A;  1VQM 3;  1QVF 2;  1RLS A;  1T3B A;  1JN5 B;  1S5A A;  3JVC A;  3EJV A;  5IEP A;  1M90 4;  3OWU A;  4AKY A;  1FUT A;  1BRG A;  1WQL B;  1W6G A;  2P0X A;  1TTO A;  3BNB A;  3NBJ A;  4MJD A;  1X1W A;  5CXO A;  9RNT A;  1EUI C;  1JV2 B;  1UI8 A;  4WFO A;  1RMS A;  2W9P A;  5IG4 A;  1JJ2 2;  1I3F A;  1A2K A;  3PXM A;  1DMQ A;  4EBG A;  2F86 B;  3IJE B;  1OF5 B;  2SBL A;  2CW9 A;  1UUW B;  4KT3 B;  3EQQ B;  1EA2 A;  2GEY A;  2CWV A;  3MG1 A;  2XGN A;  1YHQ 3;  1JBT A;  3D4A A;  2KXG A;  2OCT A;  1YJW 3;  1Q7Y 4;  1C54 A;  3T8N A;  1OUN A;  2W56 A;  5D81 A;  5D83 A;  3S28 A;  1GY5 A;  1PYL A;  1DMM A;  4RNY A;  3KII A;  3EN1 B;  1BU4 A;  3S5C A;  4LZI A;  2UGI A;  4QWT A;  3FZW A;  2UUG C;  4XBY A;  4GHO A;  3AHW A;  5JBS A;  5G1K A;  3I56 3;  3G71 3;  4RNT A;  2OTJ 3;  4FR9 A;  3K5T A;  3NBB A;  4DKI A;  3G6E 3;  2BMO B;  3CME 3;  1BSD A;  1ROV A;  3A5E A;  2HOH A;  4JF8 A;  4KFD A;  5KP4 A;  4X2O A;  3SX1 A;  1E3R A;  5AIG A;  3O8Y A;  2IUK A;  1YI2 3;  1BNG A;  3FLJ A;  2Z77 A;  1I0V A;  1TRQ A;  1YVS A;  3OV4 A;  5HOH A;  1BIR A;  3FCS B;  1UGH I;  4STD A;  1IQY A;  3CCU 3;  2XR8 B;  3ZFZ A;  4O2H A;  4BIR A;  2WGO A;  3NXJ A;  3CXC 2;  1UI7 A;  2IYJ A;  4KZ1 A;  3HK4 A;  1RGA A;  2CWU A;  1JBR A;  3X3Z A;  1IQ8 A;  1ULI B;  2PZV A;  1QJG A;  1YGW A;  1BRH A;  3CPW 2;  1PU4 A;  3TDG A;  1RDS A;  1A2P A;  1AV4 A;  1W2Z A;  1KD1 4;  2C11 A;  2HML B;  3NHX A;  1Q81 4;  1VZZ A;  3FG3 A;  1EKM A;  8CHO A;  3IMA B;  3KCH A;  2HMN B;  3UJM A;  3FG1 A;  2BHM A;  4L7K A;  3RDE A;  1B2M A;  2C10 A;  3FG4 A;  1F8N A;  2E2V A; 
#chains in the Genus database with same CATH homology
 2BNG A;  1GS3 A;  1W2B 2;  3DM8 A;  3KE7 A;  4OK0 A;  3CCR 3;  5IG5 A;  2BMR B;  1K41 A;  3CC2 3;  1JB4 A;  2B24 B;  1V74 A;  1RN7 A;  3EBT A;  3BLZ A;  4IPB A;  1IDP A;  3M8C A;  4J9A A;  4HVN A;  3F7X A;  1KQS 2;  1N5P A;  2HMK B;  2RSX A;  1VQ6 3;  3Q2P A;  1STF I;  1TFK A;  3ALA A;  5IEN A;  1ASK A;  2CWT A;  1LNH A;  1L5G B;  1TUH A;  2BMQ B;  4KFE A;  4BTY A;  5TGN A;  1S72 3;  4PEJ A;  2K0M A;  3K7C A;  3EX9 A;  5ELJ A;  3HIG A;  3S29 A;  3HZP A;  4KFF A;  4HM3 B;  3CD6 3;  2XFT A;  4O02 B;  4HM8 B;  3PZW A;  2OTL 3;  4XBX A;  1IV9 A;  4G1M B;  1MNL A;  1M1K 4;  1O7G B;  5DRV A;  4FCM A;  4J8T A;  1K28 A;  1W00 A;  1Q40 A;  3X41 A;  1TP6 A;  3U97 A;  1IVX A;  3LTD A;  4EV5 A;  3NX0 A;  1NU3 A;  3STD A;  2W0Q A;  3VGN A;  3KSP A;  3H51 A;  3OXA A;  2GXF A;  3JUQ A;  3NBR A;  2ZL8 A;  1YIJ 3;  1US1 A;  1E3V A;  1Z1S A;  5FGO A;  4R1K A;  5IEO A;  1OGZ A;  3N9H A;  1FA3 A;  2CC3 A;  5AII A;  1N9J A;  1O7N B;  2W56 B;  3LML A;  1K9M 4;  3PCR A;  4FMC A;  4AEQ A;  3A76 A;  2P0M A;  1W4N A;  1DVD A;  1JB2 A;  4N6V 0;  2IUJ A;  3SVA A;  3UNL A;  4HJL B;  1G96 A;  3S27 A;  5CK6 A;  3D9R A;  1KWI A;  1IT7 A;  2STD A;  1CQS A;  1W6Y A;  3AMO A;  4Q53 A;  5CF2 A;  1NO3 A;  3EB8 A;  3MYT A;  4IIA A;  3WDG B;  1A90 A;  4LGQ A;  2QA4 3;  2FXT A;  3BNC A;  4K1U A;  3V92 A;  1FGQ A;  1SPU A;  4HM4 B;  2INX A;  3IPT A;  3K9M C;  3CCM 3;  1NB3 I;  3OX9 A;  1U8C B;  3LTC A;  1FGT A;  5BXQ A;  3DGO A;  1YVB I;  3DMC A;  4MMZ B;  1IV7 A;  1A67 A;  1SQW A;  2V1L A;  1RRL A;  3EC9 A;  4R4K A;  1W01 A;  1K73 4;  3PS8 A;  1NB5 I;  1W5Z A;  3CC4 3;  2GU1 A;  2Q07 A;  3UB1 A;  3NV0 A;  3T0U A;  1FGM A;  3VF1 A;  4JRF A;  1O7M B;  3VSY A;  5CLK A;  1JKG A;  2Z7A A;  4BTW A;  2YFJ B;  4WP5 A;  5AI1 A;  1LXE A;  2BT3 A;  2GU3 A;  4N6O B;  3X42 A;  2CFW A;  4R80 A;  1Y4K A;  2ZDJ A;  4X2H A;  1FGR A;  3F40 A;  3NUV A;  2KCD A;  4HM7 B;  4OVM A;  2R4I A;  2XSO B;  3DGN A;  5AEW B;  1W7C A;  4N6T A;  4WHA A;  3MG3 A;  2Y73 A;  1TU5 A;  1VQK 3;  3H3H A;  1STD A;  5BVB A;  1GY6 A;  3CCL 3;  2MC8 A;  7STD A;  3ER7 A;  3SED A;  3D3L A;  2WOF A;  1EG9 B;  2CG1 A;  4MEI A;  3KKG A;  1MOL A;  1N8R 4;  2W9Q A;  3ECF A;  1RRH A;  2HMJ B;  4WWU C;  4EYC A;  3FH1 A;  1QMA A;  3Q1C A;  4KVH A;  2CK3 H;  2MF7 A;  5DRE A;  1N9E A;  1Q82 4;  1LVN A;  4HZ9 B;  3KZT A;  4K1V A;  5IF6 A;  2WOH A;  1Q86 4;  1D6Z A;  2CHC A;  4O8S A;  4HM5 B;  5I97 A;  1AR0 A;  4GL6 A;  2FNQ A;  1T5Y A;  1NWW A;  3WOF B;  2W03 A;  4LMI A;  1YGE A;  4HM0 B;  4RBN A;  4EC6 A;  1J2B A;  3DUK A;  2K54 A;  3E99 A;  1WMO A;  2A15 A;  2F99 A;  4NRE A;  3F8H A;  2I9W A;  1IT8 A;  5KP3 A;  1CYV A;  1IQX A;  1Q40 B;  3KN4 A;  4N6U A;  4RNZ A;  4HM1 B;  1UUV B;  1N8Q A;  3DGM A;  3WOE B;  1M1X B;  3Q90 A;  3EHC A;  3EF8 A;  3QK9 A;  4XBT A;  1VQO 3;  1VQ8 3;  2RCD A;  2XH9 A;  1RJO A;  2GEX A;  2LYX A;  3JUP A;  1VQN 3;  2CH9 A;  4WYK A;  1OCV A;  1OAC A;  2KRT A;  4GB5 A;  2XRX B;  3EN8 A;  4N6L A;  1IU7 A;  4NHF A;  2ML6 A;  2QEX 3;  5IER A;  1C7H A;  2CIU A;  3LTB A;  3CC7 3;  3DY5 A;  3G0K A;  4HM6 B;  1W02 A;  1YIT 3;  2D42 A;  3NQY A;  1DVC A;  2B1X B;  2UX0 A;  3I0Y A;  4FMA A;  1ZX2 A;  3UL6 A;  3JUO A;  1OHP A;  1NDO B;  2FGT A;  5ELU A;  3U1W A;  5G2G A;  3V99 A;  4CDL A;  3AMO B;  3CMA 3;  2L4V A;  3NM2 A;  3CCE 3;  3DXO A;  4ZM8 A;  3BND A;  2W2C A;  2Y74 A;  1CYU A;  3MSO A;  3X40 A;  2CFG A;  1WNH A;  3PGB A;  1DMN A;  2M7O A;  1UW1 A;  4R9K A;  2BO9 B;  4FMB A;  1OHO A;  3CCV 3;  3LZA A;  3G4S 3;  3KSE D;  5JPU A;  3WOD G;  5JPP A;  2F98 A;  1W6C A;  2GBW B;  4XB5 A;  3BB9 A;  2XF3 A;  1GD3 A;  1DYU A;  3F9S A;  3RGA A;  1SII A;  3CCJ 3;  3QRD A;  3CCQ 3;  2WO0 A;  3V98 A;  3FSD A;  3NV0 B;  1D6U A;  1LOX A;  3N54 B;  1JKG B;  4XDW A;  3OWY A;  1ROA A;  1VQP 3;  5D82 A;  3SLU A;  3S67 A;  3MPH A;  1FGO A;  3GZX B;  5AIH A;  3FGY A;  1QAK A;  1OGX A;  1GD4 A;  4LEH A;  4H3U A;  3WMD A;  1IVU A;  3LXU X;  2CFL A;  3K0Z A;  1GYB A;  2IMJ A;  4R9L A;  2Z76 A;  4OUQ A;  1GY7 A;  5IW9 A;  3LH4 A;  2OWP A;  4N6M A;  2IA7 A;  1WTH A;  2HMO B;  3FF2 A;  1AVL A;  3HX8 A;  1IK3 A;  1RKY A;  1JN5 A;  3J7Y d;  2W6J H;  1QAL A;  2RGQ A;  3HII A;  1FUW A;  1KSI A;  2WGQ A;  1QAF A;  5LC6 A;  5AEU B;  4H61 A;  3N8B A;  4K90 B;  4MMY B;  3F8X A;  2XGL A;  5IG0 A;  1OF5 A;  1IVV A;  2OQE C;  5CF1 A;  1CEW I;  4N6N B;  3F14 A;  2D1W A;  5EQL A;  3CNX A;  1IVW A;  1YJ9 3;  3WA3 A;  2P38 A;  2CG0 A;  5FW5 A;  2LQV A;  4HM2 B;  5AYS C;  4N3V A;  3B7C A;  3GWR A;  3LT9 A;  2E2U A;  3CU3 A;  1SIH A;  1U5O A;  1VQL 3;  3FF0 A;  4FMD A;  5STD A;  1VQ4 3;  1N5H A;  3GZB A;  3MHE A;  3SXX A;  1WMN A;  3B4O A;  4RZM A;  6STD A;  3FKA A;  2P05 A;  1ZO2 A;  1ISK A;  3PYJ A;  1D6Y A;  3X3X A;  1OHS A;  2PNC A;  1HKX A;  3B4P A;  2JDI H;  2O3O A;  2CKF B;  1TFO A;  2Z6B A;  4AKZ A;  4I4K A;  2YFI B;  3GZY B;  3F7S A;  3L0R A;  3RGR A;  1K8A 4;  4WYK B;  5AYR B;  4CCV A;  1OH0 A;  3BNE A;  3T8U A;  2RFR A;  2OOV C;  2QGU A;  4L8O A;  4K61 A;  4LSO A;  1VQ7 3;  1E97 A;  4ORL A;  1JB5 A;  1NJI 4;  2CFD A;  1AVK A;  1O7W B;  3ROB A;  2XSH B;  3KFQ C;  3EE1 A;  4L8P A;  3LTA A;  2ML5 A;  1Q42 A;  2HMM B;  1VQ9 3;  2JQ5 A;  2GBX B;  2XFS A;  2YFL B;  4HZB B;  4MMX B;  3K63 A;  4HYZ A;  1R4C A;  4TX4 A;  4HBR A;  1OPY A;  1HU9 A;  3LT8 A;  4U13 A;  1WMP A;  4BTX A;  3DZL A;  2XEP A;  4HKV B;  5LC7 A;  1O7H B;  3JUN A;  3MWZ A;  3PCS A;  5AIF A;  2QIY A;  3G8Z A;  5KP1 A;  2E2T A;  3NQZ A;  1O7P B;  2W04 A;  2OQE A;  1JRQ A;  5EEO A;  3HI7 A;  4IT7 A;  3LOY A;  2CFK A;  1QVG 2;  3EBY A;  3OW2 2;  1ULJ B;  3WA2 X;  4XM4 A;  4EV2 A;  1A2V A;  3B8L A;  3CPO A;  1M9G A;  4O3V A;  1KC8 4;  3MG2 A;  5EVH A;  1EQK A;  3G16 A;  3GAX A;  3SOA A;  1PFP A;  2YX9 A;  1YJN 3;  3MKI A;  3OWS A;  2O9U X;  4FCZ A;  5A0O B;  3GZR A;  3JUM A;  3LYG A;  3DGL A;  4XDV A;  3CCS 3;  2P09 A;  3CNM A;  4FCJ A;  3I55 3;  3UL5 A;  1TIJ A;  4EXR A;  1JNQ A;  5HGR A;  1SJW A;  1VQ5 3;  3GRD A;  2OOV A;  3NM7 A;  3SOY A;  5IG3 A;  1BUQ A;  3X3Y A;  1VQM 3;  1QVF 2;  1JN5 B;  1S5A A;  3JVC A;  3EJV A;  5IEP A;  1M90 4;  3OWU A;  4AKY A;  4MJD A;  1WQL B;  2P0X A;  1W6G A;  3BNB A;  3NBJ A;  5CXO A;  1UI8 A;  1JV2 B;  4WFO A;  2W9P A;  5IG4 A;  1JJ2 2;  3PXM A;  1A2K A;  1DMQ A;  4EBG A;  2F86 B;  3IJE B;  1OF5 B;  2SBL A;  2CW9 A;  1UUW B;  3EQQ B;  1EA2 A;  2GEY A;  2CWV A;  3MG1 A;  2XGN A;  1YHQ 3;  2KXG A;  2OCT A;  1YJW 3;  1Q7Y 4;  3T8N A;  1OUN A;  2W56 A;  5D81 A;  5D83 A;  3S28 A;  1GY5 A;  1DMM A;  4RNY A;  3KII A;  3EN1 B;  3S5C A;  4LZI A;  4QWT A;  3FZW A;  4XBY A;  5JBS A;  3I56 3;  3G71 3;  2OTJ 3;  4FR9 A;  3K5T A;  3NBB A;  3G6E 3;  2BMO B;  3CME 3;  1ROV A;  4KFD A;  4JF8 A;  5KP4 A;  4X2O A;  3SX1 A;  1E3R A;  5AIG A;  3O8Y A;  2IUK A;  1YI2 3;  3FLJ A;  2Z77 A;  3OV4 A;  3FCS B;  4STD A;  1IQY A;  3CCU 3;  2XR8 B;  4O2H A;  2WGO A;  3NXJ A;  3CXC 2;  1UI7 A;  4KZ1 A;  3HK4 A;  2CWU A;  3X3Z A;  1IQ8 A;  1ULI B;  2PZV A;  1QJG A;  3CPW 2;  1PU4 A;  3TDG A;  1AV4 A;  1W2Z A;  1KD1 4;  2C11 A;  2HML B;  3NHX A;  1Q81 4;  1VZZ A;  3FG3 A;  1EKM A;  8CHO A;  3IMA B;  2HMN B;  3UJM A;  3FG1 A;  2BHM A;  4L7K A;  3RDE A;  2C10 A;  3FG4 A;  1F8N A;  2E2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...