4KVME

The nata (naa10p/naa15p) amino-terminal acetyltransferase complex bound to a bisubstrate analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
b'MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit nat1
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase/transferase inhibitor
total genus 44
structure length 153
sequence length 153
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvmE00
2J8MA 4UBRA 4FD7A 3EC4A 2J8NA 4NCZA 4NEXA 1S60A 1QSTA 1N71A 4PSXA 4KLWA 4AB7A 4J3GA 2Q7BA 3TE4A 2IL4A 2VI7A 1NMTA 2CY2A 4II9A 4QVTA 1CJWA 4HNYB 4OAEA 4PK3A 4FD6A 4GS4A 3G8WA 2FIWA 5J8CA 2VXKA 2OZUA 1WK4A 2OZGA 4HNXB 3TO9A 2WPWA 1I1DA 4MJ8A 5IV0A 4QUSA 4KOSA 1UFHA 2Q0YA 1MJBA 2AJ6A 1VHSA 3LD2A 1S7FA 4H6ZA 4R3KA 2FSRA 2I79A 3P2HA 1GHEA 4NXYA 3GY9A 3FIXA 4MBUA 4YGOA 5F46A 4KZTA 2FL4A 3FNCA 1S7KA 1RO5A 4QB9A 2VQYA 4Y49B 1YR0A 2FIAA 3DR8A 4YFJA 2F5IA 2PQ8A 2VZZA 3ZJ0A 4R57A 1NE9A 2K5TA 2I00A 5DWNA 3FB3A 4AVAA 4UWJA 3TOAA 1ON0A 4KORA 3T90A 3W6XA 3D8PA 5C88A 4H89A 4MY3A 3DDDA 3I9SA 1L0CA 1WWZA 2FCKA 1I21A 4KVOE 3NE7A 4L8AA 3FRMA 1S3ZA 4LX9A 2Q4VA 4XPKA 4Y49C 1YK3A 2B58A 2HUZA 3BLNA 4PV6A 2Y0MA 3WR7A 2OB0A 4JLYA 1P0HA 1Y7RA 1Q2YA 2QECA 1M4DA 3GYAA 4PSWA 4CS0B 1IICA 4JD6A 2B5GB 2FS5A 2ATRA 4AG7A 2KCWA 2QIRA 1Z4EA 2R8VA 1QSRA 3UY5A 5CNPA 1MJAA 1V0CA 2P0WA 4BMHA 1U6MA 5IX3A 4KOXA 1YVKA 1QSNA 1P4NA 4E2AA 4M3SA 3R95A 3FXTA 3ZZIA 1XIXA 2GANA 4AVCA 1PUAA 2B4DA 5J8FA 4I49A 1KUXA 3TOBA 5HMNA 2R7HA 2C27A 3TCVA 4MY0A 1QSOA 4JWPA 1M1DA 2HQYA 2PSWA 2B4BA 1KUYA 4R3LA 3B8GA 2JDCA 2OU2A 4U5YA 1VKCA 4KLVA 4ONUA 2PR8A 3F8KA 1J4JA 2HV2A 3FBUA 3VWEA 1BOBA 4XPDB 1M4GA 2PDOA 2GE3A 2B3VA 3DNSA 3I3GA 2G3TA 1R57A 1IIDA 4M85A 2CNSA 2BL1A 3EXNA 3EO4A 4F0YA 2VZYA 5KTAA 3PGPA 2VBQA 3W6SA 1LRZA 1KUVA 1I12A 2FE7A 1XE4A 2ZW7A 2WPXA 3OWCA 4FD5A 1NSLA 3PP9A 4B5OA 1FY7A 1TIQA 2D4PA 2P6EA 4F6AA 3CXQA 3LODA 4CAXA 1YGHA 4KVXA 4H6UA 2O28A 1Q2CA 3K9UA 4JXQA 3S6HA 4XNHB 1Z9UA 1Y9WA 5H86A 4KVME 4XPDC 3IGRA 3T9YA 4CAVA 2CNTA 2DXQA 5DWMA 5EC4A 2A4NA 1S7LA 4AVBA 3QB8A 1Y9KA 3E0KA 3DR6A 3SXOA 5IB0A 4JXRA 1MJ9A 2ZW4A 3D2MA 4KOTA 3S6KA 3CXPA 3D2PA 4FD4A 3CXSA 2H5MA 2ZW5A 4LUAA 3P2FA 1RXTA 2FT0A 3TTHA 1PU9A 2Q4YA 3BJ7A 4KUAA 2FXFA 4DNCA 4IUSA 1Q2DA 4U9ZA 1XMTA 2RC4A 4IF5A 3N7ZA 4KUBA 2PR1A 4XNHC 1B6BA 3DSBA 2PRBA 2REEA 2AE6A 3FYNA 3EFAA 4ORFA 4CAWA 4KOVA 1M44A 3SHPA 3F5BA 4KOYA 2EVNA 2EUIA 1YVOA 5H84A 2BEIA 4AG9A 3D3SA 3GKRA 2G0BA 1BO4A 3JVNA 2ZW6A 3R1KA 1B87A 3R96A 4X5KA 4R87A 4RS2A 1QSMA 4NF1A 1IYKA 3G3SA 4QBJA 3W91A 4PK2A 3PZJA 5KTCA 4XPLA 3EY5A 2OZHA 4L89A 2Q44A 2CNMA 4HNWB 5F48A 5I0CA 5F49A 2B5GA 2JEVA 4B5PB 4YRHA 3VWDA 1YX0A 1OZPA 1S5KA 3V8IA 4ZBGA 1MK4A 2ARHA 1XF8A 2OH1A 3MGDA 3IWGA 2ZPAA 4K30A 3SXNA 2BUEA 2P6GA 5HH1A 2ZXVA 1IYLA 4MI4A 4UWIA 4OADA 4MHDA 5FVJA 2R1IA 1K4JA 2P6FA 5KTDA 1KZFA 4KOUA 4KOWA 4RI1A 4NSQA 2Z11A 3QAHA 3RYOA 5ISVA 3KKWA 2Q04A 5GCNA 1Z4RA 4HKFA 1YLEA 3R9EA 2X7BA 2G3AA 3S6FA 3TFYA 4QC6A 4B5PA 1M4IA 2QMLA 5JPHA 1IB1E 5E96A 4E8OA 4EVYA 5C82A 1CM0A 4U9YA 3TO7A 4E0AA 4R9MA 2Z0ZA 3R9GA 1YREA 4CRZB 4JJXA 2JLMA 3F0AA 2REFA 5F47A 5EBVA 2JDDA 4UA3A 3JUWA 3H4QA 2J8RA 2BSWA 2Z10A 1S7NA 2NMTA 2PC1A 2B3UA 1XEBA 2B4DB 2GIVA 2R98A 4CRYB 5JQ4A 1SQHA 3BJ8A 3C26A 2VEZA 3S6GA 3TT2A 3TO6A 4OLLA 3R9FA 2D4OA
chains in the Genus database with same CATH superfamily
3SJFA 1HEEA 2J8MA 2V8DA 4UBRA 4FD7A 1Z8XA 3EC4A 4NJRA 2J8NA 4NCZA 6CPAA 4NEXA 2Q51A 1S60A 1QSTA 3RO0A 2NYQA 3D7FA 3RZAA 3CPXA 1N71A 4PSXA 2V77A 1VHEA 3NFZA 4KLWA 4AB7A 4IHMA 4J3GA 2Q7BA 4UCPA 3TE4A 1VHOA 2IL4A 2VI7A 4X2TA 1NMTA 2CY2A 4II9A 2VL1A 4QVTA 3VARA 2ZEMA 1CJWA 4P4BA 1YW4A 4HNYB 2PJ3A 4B11A 4OAEA 4PK3A 4PXEA 4FD6A 4UEEA 4GS4A 3G8WA 2FIWA 5J8CA 2VXKA 4RUHA 2OZUA 1WK4A 3KI9A 4A38A 4A37A 4F9UA 1LOKA 5A28A 3NH5A 2F8HA 3BI1A 4F9VA 2OZGA 1TKHA 1ELLP 4UF4A 1ZLHA 4HNXB 3TO9A 3T8WA 2Q4ZA 2AFWA 2WPWA 3KZWA 5LYIA 3B3VA 4P4DA 4EWTA 4M6HA 1I1DA 4MJ8A 2DPSA 5IV0A 4QUSA 1YSJA 5BWAB 5LRKA 2PJ6A 2AFUA 2PJAA 3TX8A 4MCPA 4KOSA 1UFHA 2Q0YA 2YNEA 1MJBA 2AJ6A 3WC5A 4CYQA 2IQ6A 3TC8A 5G1ZA 1VHSA 3D7HA 1S7FA 3LD2A 4H6ZA 4R3KA 2FSRA 2I79A 4CGMA 3P2HA 1GHEA 4NXYA 4PXBA 4NGSA 2PVVA 3GY9A 2ZEEA 2EK9A 2AFMA 3FIXA 4MBUA 4YGOA 4TNUA 4AXVA 3FEEA 4X8IA 4UFVA 5F46A 1DE4C 4KZTA 2FL4A 3FNCA 1S7KA 2PVWA 1RO5A 4QB9A 2VQYA 2WSAA 3SI1A 3IC1A 1Z8LA 4OC2A 4Y49B 3WABA 4A30A 3GLJA 2OR4A 1YR0A 2XEJA 1JQGA 2FIAA 4MFJA 1IOIA 3DR8A 1VGYA 4YWYA 4DUKA 2F5IA 2ODFA 4YFJA 1JWQA 4ZY2A 2PQ8A 3B7IA 4MXUA 3JRUA 2VZZA 1LFWA 3ZJ0A 5LYLA 4R57A 1NE9A 2V8HA 2K5TA 3IU2A 2Z3MA 2QYVA 1ARMA 1BLLE 2BO9A 3IWEA 2I00A 4MFQA 1XRYA 4Q38A 5DWNA 3LACA 3FB3A 2QJ8A 4AVAA 2AFZA 1QQ9A 3IFEA 4UWJA 1ZG9A 3TOAA 2PJBA 1CPXA 1ON0A 4KORA 3T90A 3W6XA 1A2ZA 1XOVA 1AMPA 3D8PA 5C88A 4UIBA 3FJUA 4H89A 4MY3A 3DDDA 3I9SA 3BI0A 2PJCA 1IOFA 8CPAA 1L0CA 1WWZA 2FCKA 1X12A 4M6GA 2G9DA 1Q7LA 5D29A 2GU2A 1I21A 2C1CA 3PFOA 4KVOE 3NE7A 4L8AA 3VATA 3FRMA 4F8ZA 1S3ZA 4JZ0A 2Q4VA 4LX9A 4XPKA 1YK3A 1YW6A 4Y49C 2B58A 2HUZA 3BLNA 4PV6A 2Y0MA 5G21A 1CPSA 2OB0A 2JBKA 4JLYA 4MFKA 3WR7A 5LRGA 2GLFA 1P0HA 4ZGYB 5IB9A 2DEAA 1Y7RA 4PQAA 1Q2YA 2QECA 2ZEGA 3PB8X 2JBJA 2JEWA 4EMEA 1M4DA 3GYAA 4PSWA 4CS0B 1IICA 3QNVA 4YU9A 4O23A 4JD6A 2B5GB 4NFRA 3ISZA 4P4JA 1PYTB 2FS5A 2ATRA 3GB0A 2KCWA 2QIRA 4LQ6A 3CPAA 4AG7A 4MFZA 3S9NA 1Z4EA 1CP6A 2R8VA 1QSRA 3UY5A 2Z3NA 5CNPA 3WC6A 1MJAA 1V0CA 1AUGA 2P0WA 4BMHA 1U6MA 3D68A 4OC5A 3IO1A 5IX3A 4KOXA 4W9YA 1YVKA 1QSNA 3BXMA 1P4NA 4NGNA 4E2AA 2Z3PA 4HPSA 4M3SA 3WC7A 2EK8A 3R95A 3FXTA 1GYTA 1R3NA 1XIXA 3FX6A 3ZZIA 3PEIA 2PJ0A 2GANA 4P4IA 4AVCA 1PUAA 2B4DA 1CX8A 1ARLA 5J8FA 4I49A 1KUXA 2WYRA 2CIJA 4UCMA 3TOBA 2XEFA 5HMNA 5AG7A 5LRJA 5HXDA 2R7HA 2CF4A 2C27A 5CBMA 3TCVA 1Z2LA 1QSOA 4MY0A 3K2KA 1M1DA 4JWPA 3HUVA 5K8PA 5HVHA 2HQYA 1Z8WA 2PSWA 5THWA 1RTQA 2PIZA 2B4BA 1KUYA 4R3LA 3B8GA 3GUXA 4R8FA 2JDCA 2OU2A 4R7MA 1XBUA 3RAMA 1IU8A 4U5YA 2ZEDA 1VKCA 4KLVA 4ONUA 1TXRA 4NGTA 4OMEA 2PR8A 4H2KA 4CYNA 3H8GA 3F8KA 1J4JA 2HV2A 3FBUA 3SJGA 2ZENA 3D7GA 3VWEA 2AFXA 4KSIA 1YQEA 2WZNA 2Q43A 1BOBA 4XPDB 5AGEA 1M4GA 2PDOA 3LMSA 4MHYA 4TWEA 4FBEA 2GE3A 5J1QA 4R76A 1LANA 1DTDA 2B3VA 1Y7EA 3DNSA 3I3GA 1H8LA 1QMUA 4A33A 2PJ1A 3WT4A 2G3TA 3KHZA 1R57A 3RBUA 1IIDA 5K8MA 4M85A 2CNSA 2ZELA 2BL1A 3EXNA 1ZG7A 3EO4A 2PIYA 2YNCC 3KL9A 4F0YA 2VZYA 5KTAA 4C7HA 3PGPA 2VBQA 2NSMA 1LAMA 3W6SA 2YNDA 1LRZA 1Y0YA 1KUVA 1VIXA 1I12A 2FE7A 3FECA 1XE4A 2ZW7A 2WPXA 3OWCA 4B10A 4FD5A 1NSLA 4OC0A 3K9TA 4OC1A 4BBHA 3PP9A 3HLPA 4B5OA 1FY7A 1TIQA 4NJQA 2V8VA 3BHXA 4OKOA 4M6IA 2D4PA 1TKJA 2PJ9A 4C7IA 1Z8TA 1LCPA 2P6EA 4F6AA 2XEGA 3CXQA 1HDUA 3IJ3A 3LODA 4WWVA 4A32A 4CAXA 4ZYQA 2OOTA 4OIDA 1YGHA 4KVXA 2Z3OA 4OIWA 4FWUA 3VH9A 1F2OA 5G20A 4P10A 4H6UA 2O28A 1Q2CA 3K9UA 4JXQA 3S6HA 4XNHB 1Z9UA 1Y9WA 3FMCA 5H86A 4KVME 5JM6A 4XPDC 4PXCA 3IGRA 3T9YA 4MHPA 2CNTA 2DXQA 2V8GA 4CAVA 3IEHA 5DWMA 4FAIA 1BPNA 2HB6A 4KS9A 4WJBA 1ZO0A 5EC4A 2ABZA 5AG4A 3MRUA 2A4NA 4X3RA 1S7LA 4NGRA 2O4HA 3H5ZA 4OC4A 2CTBA 4MFPA 4AVBA 1IY7A 2PE3A 3QB8A 1Y9KA 3E0KA 4NGQA 5AG6A 3DR6A 5D8NA 3SXOA 7CPAA 4ONWA 5F09A 5IB0A 1Z5RA 4UFWA 5JPHA 1EE3P 4JXRA 4MCQA 4RN7A 1MJ9A 1TF9A 2ZW4A 2GREA 3D2MA 4KOTA 2YGWA 3KASA 3S6KA 3CXPA 2PJ8A 2POKA 4P6YA 2GFQA 2C6GA 4MFLA 3D2PA 4FD4A 3CXSA 2H5MA 2ZW5A 3PB6X 4G1PA 4LUAA 3P2FA 1RXTA 5AG5A 3KR5A 4FUUA 4B14A 1F2PA 2FT0A 4UCNA 3ISXA 1PU9A 2Q4YA 3TTHA 4MCRA 2ZEOA 4A2ZA 5K8NA 3BJ7A 4KUAA 2AFOA 2FXFA 4MHNA 4DNCA 4IUSA 1Q2DA 2EO8A 5DS0A 4BINA 4R6TA 4U9ZA 1LAPA 2ZOGA 1FNOA 1XMTA 2CTCA 2QVPA 2RC4A 3IIBA 4IF5A 4LQGA 4Q36A 3V38A 4P4FA 3N7ZA 4KUBA 4Q7AA 2PR1A 1BAVA 4XNHC 4KSAA 1B6BA 3DSBA 2PRBA 3KHXA 1XMBA 2REEA 2AE6A 4ZX9A 4UFXA 4C2ZA 3FYNA 5ELYA 4C2YA 4CYPA 3EFAA 4ORFA 4CAWA 4KOVA 1M44A 3FH4A 2IJZA 2Z3LA 3F5BA 4KOYA 2EVNA 3SHPA 1TKFA 2EUIA 3PB9X 4A31A 1YVOA 5H84A 3B3SA 2BEIA 2IMOA 4KSFA 3NH4A 3PFEA 2BCOA 3D3SA 4AG9A 3GKRA 3H8FA 4GM5A 4DJLA 2G0BA 1BO4A 3JVNA 2ZW6A 3R1KA 1B87A 3R96A 4NGPA 4UEFA 4R87A 4RS2A 1QSMA 4NF1A 3PBBA 4X5KA 1IYKA 1AYEA 1ELMP 2F7VA 3G3SA 4EFDA 4QBJA 3D66A 3W91A 4PK2A 4CGOA 4Z65A 4ZY1A 2ZEFA 3SI2A 4DYOA 2ZOFA 3PZJA 2PCUA 2FVGA 3FVLA 4C68A 4CGPA 3B3CA 3B3TA 3KR4A 4XPLA 1Y0RA 4GXHA 5EMIA 5KTCA 3EY5A 2CXAA 2OZHA 2AFSA 4L89A 3KGQA 1FT7A 2Q44A 2CNMA 4HNWB 5F48A 4CGNA 5I0CA 4CPAA 5F49A 2B5GA 2I3CA 2JEVA 4BD9A 4B5PB 2ZEHA 2WUUA 2ANPA 4YRHA 4B12A 2RFHA 3VWDA 1YX0A 2C6CA 1OZPA 3B2YA 5LYFA 3L2NA 1OBRA 1S5KA 4CYOA 3V8IA 4ZBGA 1MK4A 4NGMA 2EWBA 2ARHA 4MCSA 1XF8A 1KWMA 4CGLA 2OH1A 3MGDA 2GLJA 3IWGA 2ZPAA 3B35A 4CAEA 2PJ2A 4K30A 2BUEA 3SXNA 2YNCA 5JGFA 1HDQA 2HC9A 2P6GA 3LWUA 3SJEA 3D67A 5HH1A 2ZXVA 5CPAA 4ZX8A 1PCAA 3A9LA 1IYLA 5A27A 4MI4A 4UWIA 4OADA 3DGVA 4MHDA 3S9LA 5FVJA 4ZI6A 2Z3KA 4B13A 4MMOA 2R1IA 4P45A 3DLJA 3S9MA 1K4JA 2P6FA 2RB7A 4A94A 1IGBA 4C2XA 3I1UA 5KTDA 2PRQA 1CG2A 1XFOA 1KZFA 4KOUA 4KOWA 4RI1A 4NSQA 3MN8A 4K3NA 1NSAA 2Z11A 2J9AA 3QAHA 3RYOA 5ISVA 1ZG8A 4OC3A 1R43A 3KKWA 3KQXA 2Q04A 5GCNA 4ZY0A 1Z4RA 4HKFA 1YLEA 3H8EA 1CP7A 4IAVA 3R9EA 1UWYA 2X7BA 3KQZA 2BOAA 2DPTA 2G3AA 2Q7SA 4UIAA 3PB4X 3QAYA 3B3WA 3S6FA 3TFYA 1F57A 4UEZA 4QC6A 3IWWA 4MRIA 2XEIA 1CBXA 3NH8A 4B5PA 1M4IA 2O53A 1TF8A 2QMLA 1IB1E 3PBEA 4OP4A 1ZLIA 1M4LA 2PJ5A 5E96A 5G22A 4A95A 4E8OA 4EVYA 4F0XA 4P4EA 5C82A 3PB7X 2PJ7A 1YMEA 5LYDA 3SI0A 3D4UA 4A39A 2EBJA 1X10A 1CM0A 4U9YA 3TO7A 4E0AA 4R9MA 4JYWA 5HVFA 3JTKA 3CT9A 3CZXA 2Z0ZA 3R9GA 1YREA 3PRTA 4CRZB 4JJXA 2JLMA 3F0AA 3IU1A 3NE8A 2REFA 5F47A 2C6PA 3NA6A 5I4MA 3GIUA 5EBVA 2JDDA 4UA3A 2DF5A 3JUWA 3CDXA 3H4QA 1BPMA 2J8RA 4IK2A 2BSWA 4MHZA 3RNZA 2Z10A 1XJOA 1S7NA 2NMTA 2PC1A 4PXDA 2B3UA 1XEBA 2B4DB 2GIVA 2ZEPA 5HVGA 3N5FA 2PJ4A 2R98A 4CRYB 5JQ4A 1SQHA 3BJ8A 4B6ZA 3C26A 5JH9A 2VEZA 3V7ZA 3FF3A 3S6GA 3FEDA 1YLOA 4PPZA 3SJXA 3D7DA 4P44A 3TT2A 5K8OA 3TO6A 4OLLA 3R9FA 4CAFA 2D4OA
chains in the Genus database with same CATH topology
2J8MA 4UBRA 4FD7A 3EC4A 2J8NA 4NCZA 4NEXA 1S60A 1QSTA 1N71A 4PSXA 4KLWA 4AB7A 4J3GA 2Q7BA 4UCPA 3TE4A 2IL4A 2VI7A 1NMTA 2CY2A 4II9A 4QVTA 1CJWA 4HNYB 4B11A 4OAEA 4PK3A 4FD6A 4GS4A 3G8WA 2FIWA 5J8CA 2VXKA 2OZUA 1WK4A 5A28A 2OZGA 4HNXB 3TO9A 2WPWA 1I1DA 4MJ8A 2DPSA 5IV0A 4QUSA 5BWAB 4KOSA 1UFHA 2Q0YA 2YNEA 1MJBA 2AJ6A 4CYQA 5G1ZA 1VHSA 3LD2A 1S7FA 4H6ZA 4R3KA 2FSRA 2I79A 4CGMA 3P2HA 1GHEA 4NXYA 3GY9A 3FIXA 4MBUA 4YGOA 4UFVA 5F46A 4KZTA 2FL4A 3FNCA 1S7KA 1RO5A 4QB9A 2VQYA 2WSAA 4Y49B 4A30A 1YR0A 2FIAA 4MFJA 3DR8A 4YFJA 2F5IA 2PQ8A 2VZZA 3ZJ0A 4R57A 1NE9A 2K5TA 3IU2A 2Z3MA 3IWEA 2I00A 4MFQA 4Q38A 5DWNA 3FB3A 4AVAA 4UWJA 3TOAA 1ON0A 4KORA 3T90A 3W6XA 3D8PA 5C88A 4H89A 4MY3A 3DDDA 3I9SA 1L0CA 1WWZA 2FCKA 1I21A 4KVOE 3NE7A 4L8AA 3FRMA 1S3ZA 4LX9A 2Q4VA 4XPKA 4Y49C 1YK3A 2B58A 2HUZA 3BLNA 4PV6A 2Y0MA 5G21A 3WR7A 2OB0A 4ZGYB 4JLYA 4MFKA 1P0HA 1Y7RA 1Q2YA 2QECA 1M4DA 3GYAA 4PSWA 4CS0B 1IICA 4JD6A 2B5GB 2FS5A 2ATRA 4AG7A 2KCWA 2QIRA 4MFZA 1Z4EA 2R8VA 1QSRA 3UY5A 2Z3NA 5CNPA 1MJAA 1V0CA 2P0WA 4BMHA 1U6MA 5IX3A 4KOXA 1YVKA 1QSNA 1P4NA 4E2AA 2Z3PA 4M3SA 3R95A 3FXTA 3ZZIA 1XIXA 2GANA 4AVCA 1PUAA 2B4DA 5J8FA 4I49A 1KUXA 4UCMA 3TOBA 5HMNA 5AG7A 2R7HA 2C27A 3TCVA 4MY0A 1QSOA 4JWPA 1M1DA 2HQYA 2PSWA 2B4BA 1KUYA 4R3LA 3B8GA 4A2ZA 2JDCA 2OU2A 4U5YA 1VKCA 4KLVA 4ONUA 2PR8A 4CYNA 3F8KA 1J4JA 2HV2A 3FBUA 3VWEA 5AGEA 1BOBA 4XPDB 1M4GA 2PDOA 2GE3A 2B3VA 3DNSA 3I3GA 4A33A 2G3TA 1R57A 1IIDA 4M85A 2CNSA 2BL1A 3EXNA 3EO4A 2YNCC 4F0YA 2VZYA 5KTAA 4C7HA 3PGPA 2VBQA 3W6SA 2YNDA 1LRZA 1KUVA 1I12A 2FE7A 1XE4A 2ZW7A 2WPXA 3OWCA 4B10A 4FD5A 1NSLA 4BBHA 3PP9A 4B5OA 1FY7A 1TIQA 2D4PA 4C7IA 2P6EA 4F6AA 3CXQA 3LODA 4A32A 4CAXA 1YGHA 4KVXA 2Z3OA 5G20A 4H6UA 2O28A 1Q2CA 3K9UA 4JXQA 3S6HA 4XNHB 1Z9UA 1Y9WA 5H86A 4KVME 4XPDC 3IGRA 3T9YA 4CAVA 2CNTA 2DXQA 5DWMA 4KS9A 5EC4A 1ZO0A 5AG4A 2A4NA 1S7LA 3H5ZA 4AVBA 4MFPA 3QB8A 5AG6A 1Y9KA 3E0KA 3DR6A 3SXOA 5IB0A 4UFWA 4JXRA 1MJ9A 2ZW4A 3D2MA 4KOTA 2YGWA 3S6KA 3CXPA 4MFLA 3D2PA 4FD4A 3CXSA 2H5MA 2ZW5A 4LUAA 3P2FA 1RXTA 5AG5A 4B14A 2FT0A 4UCNA 3TTHA 1PU9A 2Q4YA 3BJ7A 4KUAA 2FXFA 4DNCA 4IUSA 1Q2DA 4U9ZA 1XMTA 2RC4A 4IF5A 4Q36A 3N7ZA 4KUBA 2PR1A 4XNHC 4KSAA 1B6BA 3DSBA 2PRBA 2REEA 2AE6A 4UFXA 4C2ZA 3FYNA 4C2YA 4CYPA 3EFAA 4ORFA 4CAWA 4KOVA 1M44A 2Z3LA 3SHPA 3F5BA 4KOYA 2EVNA 2EUIA 4A31A 1YVOA 5H84A 2BEIA 4KSFA 4AG9A 3D3SA 3GKRA 2G0BA 1BO4A 3JVNA 2ZW6A 3R1KA 1B87A 3R96A 4X5KA 4R87A 4RS2A 1QSMA 4NF1A 1IYKA 3G3SA 4QBJA 3W91A 4CGOA 4PK2A 3PZJA 4C68A 4CGPA 5KTCA 4XPLA 3EY5A 2CXAA 2OZHA 4L89A 2Q44A 2CNMA 4HNWB 5F48A 4CGNA 5I0CA 5F49A 2B5GA 2JEVA 4B5PB 2WUUA 4YRHA 4B12A 3VWDA 1YX0A 1OZPA 1S5KA 4CYOA 3V8IA 4ZBGA 1MK4A 2ARHA 1XF8A 4CGLA 2OH1A 3MGDA 3IWGA 2ZPAA 4CAEA 4K30A 3SXNA 2BUEA 2YNCA 2P6GA 5HH1A 2ZXVA 5A27A 3A9LA 1IYLA 4MI4A 4UWIA 4OADA 4MHDA 5FVJA 2Z3KA 4B13A 2R1IA 1K4JA 2P6FA 4C2XA 5KTDA 1KZFA 4KOUA 4KOWA 4RI1A 4NSQA 2Z11A 3QAHA 3RYOA 5ISVA 3KKWA 2Q04A 5GCNA 1Z4RA 4HKFA 1YLEA 3R9EA 2X7BA 2DPTA 2G3AA 3S6FA 3TFYA 4QC6A 4B5PA 1M4IA 2QMLA 5JPHA 1IB1E 5G22A 5E96A 4A95A 4E8OA 4F0XA 4EVYA 5C82A 1CM0A 4U9YA 3TO7A 4E0AA 4R9MA 3JTKA 2Z0ZA 3R9GA 1YREA 4CRZB 4JJXA 2JLMA 3F0AA 3IU1A 2REFA 5F47A 5EBVA 2JDDA 4UA3A 3JUWA 3H4QA 2J8RA 2BSWA 2Z10A 1S7NA 2NMTA 2PC1A 2B3UA 1XEBA 2B4DB 2GIVA 2R98A 4CRYB 5JQ4A 1SQHA 3BJ8A 3C26A 2VEZA 3S6GA 3TT2A 3TO6A 4OLLA 3R9FA 4CAFA 2D4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8M A;  4UBR A;  4FD7 A;  3EC4 A;  2J8N A;  4NCZ A;  4NEX A;  1S60 A;  1QST A;  1N71 A;  4PSX A;  4KLW A;  4AB7 A;  4J3G A;  2Q7B A;  3TE4 A;  2IL4 A;  2VI7 A;  1NMT A;  2CY2 A;  4II9 A;  4QVT A;  1CJW A;  4HNY B;  4OAE A;  4PK3 A;  4FD6 A;  4GS4 A;  3G8W A;  2FIW A;  5J8C A;  2VXK A;  2OZU A;  1WK4 A;  2OZG A;  4HNX B;  3TO9 A;  2WPW A;  1I1D A;  4MJ8 A;  5IV0 A;  4QUS A;  4KOS A;  1UFH A;  2Q0Y A;  1MJB A;  2AJ6 A;  1VHS A;  3LD2 A;  1S7F A;  4H6Z A;  4R3K A;  2FSR A;  2I79 A;  3P2H A;  1GHE A;  4NXY A;  3GY9 A;  3FIX A;  4MBU A;  4YGO A;  5F46 A;  4KZT A;  2FL4 A;  3FNC A;  1S7K A;  1RO5 A;  4QB9 A;  2VQY A;  4Y49 B;  1YR0 A;  2FIA A;  3DR8 A;  4YFJ A;  2F5I A;  2PQ8 A;  2VZZ A;  3ZJ0 A;  4R57 A;  1NE9 A;  2K5T A;  2I00 A;  5DWN A;  3FB3 A;  4AVA A;  4UWJ A;  3TOA A;  1ON0 A;  4KOR A;  3T90 A;  3W6X A;  3D8P A;  5C88 A;  4H89 A;  4MY3 A;  3DDD A;  3I9S A;  1L0C A;  1WWZ A;  2FCK A;  1I21 A;  4KVO E;  3NE7 A;  4L8A A;  3FRM A;  1S3Z A;  4LX9 A;  2Q4V A;  4XPK A;  4Y49 C;  1YK3 A;  2B58 A;  2HUZ A;  3BLN A;  4PV6 A;  2Y0M A;  3WR7 A;  2OB0 A;  4JLY A;  1P0H A;  1Y7R A;  1Q2Y A;  2QEC A;  1M4D A;  3GYA A;  4PSW A;  4CS0 B;  1IIC A;  4JD6 A;  2B5G B;  2FS5 A;  2ATR A;  4AG7 A;  2KCW A;  2QIR A;  1Z4E A;  2R8V A;  1QSR A;  3UY5 A;  5CNP A;  1MJA A;  1V0C A;  2P0W A;  4BMH A;  1U6M A;  5IX3 A;  4KOX A;  1YVK A;  1QSN A;  1P4N A;  4E2A A;  4M3S A;  3R95 A;  3FXT A;  3ZZI A;  1XIX A;  2GAN A;  4AVC A;  1PUA A;  2B4D A;  5J8F A;  4I49 A;  1KUX A;  3TOB A;  5HMN A;  2R7H A;  2C27 A;  3TCV A;  4MY0 A;  1QSO A;  4JWP A;  1M1D A;  2HQY A;  2PSW A;  2B4B A;  1KUY A;  4R3L A;  3B8G A;  2JDC A;  2OU2 A;  4U5Y A;  1VKC A;  4KLV A;  4ONU A;  2PR8 A;  3F8K A;  1J4J A;  2HV2 A;  3FBU A;  3VWE A;  1BOB A;  4XPD B;  1M4G A;  2PDO A;  2GE3 A;  2B3V A;  3DNS A;  3I3G A;  2G3T A;  1R57 A;  1IID A;  4M85 A;  2CNS A;  2BL1 A;  3EXN A;  3EO4 A;  4F0Y A;  2VZY A;  5KTA A;  3PGP A;  2VBQ A;  3W6S A;  1LRZ A;  1KUV A;  1I12 A;  2FE7 A;  1XE4 A;  2ZW7 A;  2WPX A;  3OWC A;  4FD5 A;  1NSL A;  3PP9 A;  4B5O A;  1FY7 A;  1TIQ A;  2D4P A;  2P6E A;  4F6A A;  3CXQ A;  3LOD A;  4CAX A;  1YGH A;  4KVX A;  4H6U A;  2O28 A;  1Q2C A;  3K9U A;  4JXQ A;  3S6H A;  4XNH B;  1Z9U A;  1Y9W A;  5H86 A;  4KVM E;  4XPD C;  3IGR A;  3T9Y A;  4CAV A;  2CNT A;  2DXQ A;  5DWM A;  5EC4 A;  2A4N A;  1S7L A;  4AVB A;  3QB8 A;  1Y9K A;  3E0K A;  3DR6 A;  3SXO A;  5IB0 A;  4JXR A;  1MJ9 A;  2ZW4 A;  3D2M A;  4KOT A;  3S6K A;  3CXP A;  3D2P A;  4FD4 A;  3CXS A;  2H5M A;  2ZW5 A;  4LUA A;  3P2F A;  1RXT A;  2FT0 A;  3TTH A;  1PU9 A;  2Q4Y A;  3BJ7 A;  4KUA A;  2FXF A;  4DNC A;  4IUS A;  1Q2D A;  4U9Z A;  1XMT A;  2RC4 A;  4IF5 A;  3N7Z A;  4KUB A;  2PR1 A;  4XNH C;  1B6B A;  3DSB A;  2PRB A;  2REE A;  2AE6 A;  3FYN A;  3EFA A;  4ORF A;  4CAW A;  4KOV A;  1M44 A;  3SHP A;  3F5B A;  4KOY A;  2EVN A;  2EUI A;  1YVO A;  5H84 A;  2BEI A;  4AG9 A;  3D3S A;  3GKR A;  2G0B A;  1BO4 A;  3JVN A;  2ZW6 A;  3R1K A;  1B87 A;  3R96 A;  4X5K A;  4R87 A;  4RS2 A;  1QSM A;  4NF1 A;  1IYK A;  3G3S A;  4QBJ A;  3W91 A;  4PK2 A;  3PZJ A;  5KTC A;  4XPL A;  3EY5 A;  2OZH A;  4L89 A;  2Q44 A;  2CNM A;  4HNW B;  5F48 A;  5I0C A;  5F49 A;  2B5G A;  2JEV A;  4B5P B;  4YRH A;  3VWD A;  1YX0 A;  1OZP A;  1S5K A;  3V8I A;  4ZBG A;  1MK4 A;  2ARH A;  1XF8 A;  2OH1 A;  3MGD A;  3IWG A;  2ZPA A;  4K30 A;  3SXN A;  2BUE A;  2P6G A;  5HH1 A;  2ZXV A;  1IYL A;  4MI4 A;  4UWI A;  4OAD A;  4MHD A;  5FVJ A;  2R1I A;  1K4J A;  2P6F A;  5KTD A;  1KZF A;  4KOU A;  4KOW A;  4RI1 A;  4NSQ A;  2Z11 A;  3QAH A;  3RYO A;  5ISV A;  3KKW A;  2Q04 A;  5GCN A;  1Z4R A;  4HKF A;  1YLE A;  3R9E A;  2X7B A;  2G3A A;  3S6F A;  3TFY A;  4QC6 A;  4B5P A;  1M4I A;  2QML A;  5JPH A;  1IB1 E;  5E96 A;  4E8O A;  4EVY A;  5C82 A;  1CM0 A;  4U9Y A;  3TO7 A;  4E0A A;  4R9M A;  2Z0Z A;  3R9G A;  1YRE A;  4CRZ B;  4JJX A;  2JLM A;  3F0A A;  2REF A;  5F47 A;  5EBV A;  2JDD A;  4UA3 A;  3JUW A;  3H4Q A;  2J8R A;  2BSW A;  2Z10 A;  1S7N A;  2NMT A;  2PC1 A;  2B3U A;  1XEB A;  2B4D B;  2GIV A;  2R98 A;  4CRY B;  5JQ4 A;  1SQH A;  3BJ8 A;  3C26 A;  2VEZ A;  3S6G A;  3TT2 A;  3TO6 A;  4OLL A;  3R9F A;  2D4O A; 
#chains in the Genus database with same CATH topology
 3SJF A;  1HEE A;  2J8M A;  2V8D A;  4UBR A;  4FD7 A;  1Z8X A;  3EC4 A;  4NJR A;  2J8N A;  4NCZ A;  6CPA A;  4NEX A;  2Q51 A;  1S60 A;  1QST A;  3RO0 A;  2NYQ A;  3D7F A;  3RZA A;  3CPX A;  1N71 A;  4PSX A;  2V77 A;  1VHE A;  3NFZ A;  4KLW A;  4AB7 A;  4IHM A;  4J3G A;  2Q7B A;  4UCP A;  3TE4 A;  1VHO A;  2IL4 A;  2VI7 A;  4X2T A;  1NMT A;  2CY2 A;  4II9 A;  2VL1 A;  4QVT A;  3VAR A;  2ZEM A;  1CJW A;  4P4B A;  1YW4 A;  4HNY B;  2PJ3 A;  4B11 A;  4OAE A;  4PK3 A;  4PXE A;  4FD6 A;  4UEE A;  4GS4 A;  3G8W A;  2FIW A;  5J8C A;  2VXK A;  4RUH A;  2OZU A;  1WK4 A;  3KI9 A;  4A38 A;  4A37 A;  4F9U A;  1LOK A;  5A28 A;  3NH5 A;  2F8H A;  3BI1 A;  4F9V A;  2OZG A;  1TKH A;  1ELL P;  4UF4 A;  1ZLH A;  4HNX B;  3TO9 A;  3T8W A;  2Q4Z A;  2AFW A;  2WPW A;  3KZW A;  5LYI A;  3B3V A;  4P4D A;  4EWT A;  4M6H A;  1I1D A;  4MJ8 A;  2DPS A;  5IV0 A;  4QUS A;  1YSJ A;  5BWA B;  5LRK A;  2PJ6 A;  2AFU A;  2PJA A;  3TX8 A;  4MCP A;  4KOS A;  1UFH A;  2Q0Y A;  2YNE A;  1MJB A;  2AJ6 A;  3WC5 A;  4CYQ A;  2IQ6 A;  3TC8 A;  5G1Z A;  1VHS A;  3D7H A;  1S7F A;  3LD2 A;  4H6Z A;  4R3K A;  2FSR A;  2I79 A;  4CGM A;  3P2H A;  1GHE A;  4NXY A;  4PXB A;  4NGS A;  2PVV A;  3GY9 A;  2ZEE A;  2EK9 A;  2AFM A;  3FIX A;  4MBU A;  4YGO A;  4TNU A;  4AXV A;  3FEE A;  4X8I A;  4UFV A;  5F46 A;  1DE4 C;  4KZT A;  2FL4 A;  3FNC A;  1S7K A;  2PVW A;  1RO5 A;  4QB9 A;  2VQY A;  2WSA A;  3SI1 A;  3IC1 A;  1Z8L A;  4OC2 A;  4Y49 B;  3WAB A;  4A30 A;  3GLJ A;  2OR4 A;  1YR0 A;  2XEJ A;  1JQG A;  2FIA A;  4MFJ A;  1IOI A;  3DR8 A;  1VGY A;  4YWY A;  4DUK A;  2F5I A;  2ODF A;  4YFJ A;  1JWQ A;  4ZY2 A;  2PQ8 A;  3B7I A;  4MXU A;  3JRU A;  2VZZ A;  1LFW A;  3ZJ0 A;  5LYL A;  4R57 A;  1NE9 A;  2V8H A;  2K5T A;  3IU2 A;  2Z3M A;  2QYV A;  1ARM A;  1BLL E;  2BO9 A;  3IWE A;  2I00 A;  4MFQ A;  1XRY A;  4Q38 A;  5DWN A;  3LAC A;  3FB3 A;  2QJ8 A;  4AVA A;  2AFZ A;  1QQ9 A;  3IFE A;  4UWJ A;  1ZG9 A;  3TOA A;  2PJB A;  1CPX A;  1ON0 A;  4KOR A;  3T90 A;  3W6X A;  1A2Z A;  1XOV A;  1AMP A;  3D8P A;  5C88 A;  4UIB A;  3FJU A;  4H89 A;  4MY3 A;  3DDD A;  3I9S A;  3BI0 A;  2PJC A;  1IOF A;  8CPA A;  1L0C A;  1WWZ A;  2FCK A;  1X12 A;  4M6G A;  2G9D A;  1Q7L A;  5D29 A;  2GU2 A;  1I21 A;  2C1C A;  3PFO A;  4KVO E;  3NE7 A;  4L8A A;  3VAT A;  3FRM A;  4F8Z A;  1S3Z A;  4JZ0 A;  2Q4V A;  4LX9 A;  4XPK A;  1YK3 A;  1YW6 A;  4Y49 C;  2B58 A;  2HUZ A;  3BLN A;  4PV6 A;  2Y0M A;  5G21 A;  1CPS A;  2OB0 A;  2JBK A;  4JLY A;  4MFK A;  3WR7 A;  5LRG A;  2GLF A;  1P0H A;  4ZGY B;  5IB9 A;  2DEA A;  1Y7R A;  4PQA A;  1Q2Y A;  2QEC A;  2ZEG A;  3PB8 X;  2JBJ A;  2JEW A;  4EME A;  1M4D A;  3GYA A;  4PSW A;  4CS0 B;  1IIC A;  3QNV A;  4YU9 A;  4O23 A;  4JD6 A;  2B5G B;  4NFR A;  3ISZ A;  4P4J A;  1PYT B;  2FS5 A;  2ATR A;  3GB0 A;  2KCW A;  2QIR A;  4LQ6 A;  3CPA A;  4AG7 A;  4MFZ A;  3S9N A;  1Z4E A;  1CP6 A;  2R8V A;  1QSR A;  3UY5 A;  2Z3N A;  5CNP A;  3WC6 A;  1MJA A;  1V0C A;  1AUG A;  2P0W A;  4BMH A;  1U6M A;  3D68 A;  4OC5 A;  3IO1 A;  5IX3 A;  4KOX A;  4W9Y A;  1YVK A;  1QSN A;  3BXM A;  1P4N A;  4NGN A;  4E2A A;  2Z3P A;  4HPS A;  4M3S A;  3WC7 A;  2EK8 A;  3R95 A;  3FXT A;  1GYT A;  1R3N A;  1XIX A;  3FX6 A;  3ZZI A;  3PEI A;  2PJ0 A;  2GAN A;  4P4I A;  4AVC A;  1PUA A;  2B4D A;  1CX8 A;  1ARL A;  5J8F A;  4I49 A;  1KUX A;  2WYR A;  2CIJ A;  4UCM A;  3TOB A;  2XEF A;  5HMN A;  5AG7 A;  5LRJ A;  5HXD A;  2R7H A;  2CF4 A;  2C27 A;  5CBM A;  3TCV A;  1Z2L A;  1QSO A;  4MY0 A;  3K2K A;  1M1D A;  4JWP A;  3HUV A;  5K8P A;  5HVH A;  2HQY A;  1Z8W A;  2PSW A;  5THW A;  1RTQ A;  2PIZ A;  2B4B A;  1KUY A;  4R3L A;  3B8G A;  3GUX A;  4R8F A;  2JDC A;  2OU2 A;  4R7M A;  1XBU A;  3RAM A;  1IU8 A;  4U5Y A;  2ZED A;  1VKC A;  4KLV A;  4ONU A;  1TXR A;  4NGT A;  4OME A;  2PR8 A;  4H2K A;  4CYN A;  3H8G A;  3F8K A;  1J4J A;  2HV2 A;  3FBU A;  3SJG A;  2ZEN A;  3D7G A;  3VWE A;  2AFX A;  4KSI A;  1YQE A;  2WZN A;  2Q43 A;  1BOB A;  4XPD B;  5AGE A;  1M4G A;  2PDO A;  3LMS A;  4MHY A;  4TWE A;  4FBE A;  2GE3 A;  5J1Q A;  4R76 A;  1LAN A;  1DTD A;  2B3V A;  1Y7E A;  3DNS A;  3I3G A;  1H8L A;  1QMU A;  4A33 A;  2PJ1 A;  3WT4 A;  2G3T A;  3KHZ A;  1R57 A;  3RBU A;  1IID A;  5K8M A;  4M85 A;  2CNS A;  2ZEL A;  2BL1 A;  3EXN A;  1ZG7 A;  3EO4 A;  2PIY A;  2YNC C;  3KL9 A;  4F0Y A;  2VZY A;  5KTA A;  4C7H A;  3PGP A;  2VBQ A;  2NSM A;  1LAM A;  3W6S A;  2YND A;  1LRZ A;  1Y0Y A;  1KUV A;  1VIX A;  1I12 A;  2FE7 A;  3FEC A;  1XE4 A;  2ZW7 A;  2WPX A;  3OWC A;  4B10 A;  4FD5 A;  1NSL A;  4OC0 A;  3K9T A;  4OC1 A;  4BBH A;  3PP9 A;  3HLP A;  4B5O A;  1FY7 A;  1TIQ A;  4NJQ A;  2V8V A;  3BHX A;  4OKO A;  4M6I A;  2D4P A;  1TKJ A;  2PJ9 A;  4C7I A;  1Z8T A;  1LCP A;  2P6E A;  4F6A A;  2XEG A;  3CXQ A;  1HDU A;  3IJ3 A;  3LOD A;  4WWV A;  4A32 A;  4CAX A;  4ZYQ A;  2OOT A;  4OID A;  1YGH A;  4KVX A;  2Z3O A;  4OIW A;  4FWU A;  3VH9 A;  1F2O A;  5G20 A;  4P10 A;  4H6U A;  2O28 A;  1Q2C A;  3K9U A;  4JXQ A;  3S6H A;  4XNH B;  1Z9U A;  1Y9W A;  3FMC A;  5H86 A;  4KVM E;  5JM6 A;  4XPD C;  4PXC A;  3IGR A;  3T9Y A;  4MHP A;  2CNT A;  2DXQ A;  2V8G A;  4CAV A;  3IEH A;  5DWM A;  4FAI A;  1BPN A;  2HB6 A;  4KS9 A;  4WJB A;  1ZO0 A;  5EC4 A;  2ABZ A;  5AG4 A;  3MRU A;  2A4N A;  4X3R A;  1S7L A;  4NGR A;  2O4H A;  3H5Z A;  4OC4 A;  2CTB A;  4MFP A;  4AVB A;  1IY7 A;  2PE3 A;  3QB8 A;  1Y9K A;  3E0K A;  4NGQ A;  5AG6 A;  3DR6 A;  5D8N A;  3SXO A;  7CPA A;  4ONW A;  5F09 A;  5IB0 A;  1Z5R A;  4UFW A;  5JPH A;  1EE3 P;  4JXR A;  4MCQ A;  4RN7 A;  1MJ9 A;  1TF9 A;  2ZW4 A;  2GRE A;  3D2M A;  4KOT A;  2YGW A;  3KAS A;  3S6K A;  3CXP A;  2PJ8 A;  2POK A;  4P6Y A;  2GFQ A;  2C6G A;  4MFL A;  3D2P A;  4FD4 A;  3CXS A;  2H5M A;  2ZW5 A;  3PB6 X;  4G1P A;  4LUA A;  3P2F A;  1RXT A;  5AG5 A;  3KR5 A;  4FUU A;  4B14 A;  1F2P A;  2FT0 A;  4UCN A;  3ISX A;  1PU9 A;  2Q4Y A;  3TTH A;  4MCR A;  2ZEO A;  4A2Z A;  5K8N A;  3BJ7 A;  4KUA A;  2AFO A;  2FXF A;  4MHN A;  4DNC A;  4IUS A;  1Q2D A;  2EO8 A;  5DS0 A;  4BIN A;  4R6T A;  4U9Z A;  1LAP A;  2ZOG A;  1FNO A;  1XMT A;  2CTC A;  2QVP A;  2RC4 A;  3IIB A;  4IF5 A;  4LQG A;  4Q36 A;  3V38 A;  4P4F A;  3N7Z A;  4KUB A;  4Q7A A;  2PR1 A;  1BAV A;  4XNH C;  4KSA A;  1B6B A;  3DSB A;  2PRB A;  3KHX A;  1XMB A;  2REE A;  2AE6 A;  4ZX9 A;  4UFX A;  4C2Z A;  3FYN A;  5ELY A;  4C2Y A;  4CYP A;  3EFA A;  4ORF A;  4CAW A;  4KOV A;  1M44 A;  3FH4 A;  2IJZ A;  2Z3L A;  3F5B A;  4KOY A;  2EVN A;  3SHP A;  1TKF A;  2EUI A;  3PB9 X;  4A31 A;  1YVO A;  5H84 A;  3B3S A;  2BEI A;  2IMO A;  4KSF A;  3NH4 A;  3PFE A;  2BCO A;  3D3S A;  4AG9 A;  3GKR A;  3H8F A;  4GM5 A;  4DJL A;  2G0B A;  1BO4 A;  3JVN A;  2ZW6 A;  3R1K A;  1B87 A;  3R96 A;  4NGP A;  4UEF A;  4R87 A;  4RS2 A;  1QSM A;  4NF1 A;  3PBB A;  4X5K A;  1IYK A;  1AYE A;  1ELM P;  2F7V A;  3G3S A;  4EFD A;  4QBJ A;  3D66 A;  3W91 A;  4PK2 A;  4CGO A;  4Z65 A;  4ZY1 A;  2ZEF A;  3SI2 A;  4DYO A;  2ZOF A;  3PZJ A;  2PCU A;  2FVG A;  3FVL A;  4C68 A;  4CGP A;  3B3C A;  3B3T A;  3KR4 A;  4XPL A;  1Y0R A;  4GXH A;  5EMI A;  5KTC A;  3EY5 A;  2CXA A;  2OZH A;  2AFS A;  4L89 A;  3KGQ A;  1FT7 A;  2Q44 A;  2CNM A;  4HNW B;  5F48 A;  4CGN A;  5I0C A;  4CPA A;  5F49 A;  2B5G A;  2I3C A;  2JEV A;  4BD9 A;  4B5P B;  2ZEH A;  2WUU A;  2ANP A;  4YRH A;  4B12 A;  2RFH A;  3VWD A;  1YX0 A;  2C6C A;  1OZP A;  3B2Y A;  5LYF A;  3L2N A;  1OBR A;  1S5K A;  4CYO A;  3V8I A;  4ZBG A;  1MK4 A;  4NGM A;  2EWB A;  2ARH A;  4MCS A;  1XF8 A;  1KWM A;  4CGL A;  2OH1 A;  3MGD A;  2GLJ A;  3IWG A;  2ZPA A;  3B35 A;  4CAE A;  2PJ2 A;  4K30 A;  2BUE A;  3SXN A;  2YNC A;  5JGF A;  1HDQ A;  2HC9 A;  2P6G A;  3LWU A;  3SJE A;  3D67 A;  5HH1 A;  2ZXV A;  5CPA A;  4ZX8 A;  1PCA A;  3A9L A;  1IYL A;  5A27 A;  4MI4 A;  4UWI A;  4OAD A;  3DGV A;  4MHD A;  3S9L A;  5FVJ A;  4ZI6 A;  2Z3K A;  4B13 A;  4MMO A;  2R1I A;  4P45 A;  3DLJ A;  3S9M A;  1K4J A;  2P6F A;  2RB7 A;  4A94 A;  1IGB A;  4C2X A;  3I1U A;  5KTD A;  2PRQ A;  1CG2 A;  1XFO A;  1KZF A;  4KOU A;  4KOW A;  4RI1 A;  4NSQ A;  3MN8 A;  4K3N A;  1NSA A;  2Z11 A;  2J9A A;  3QAH A;  3RYO A;  5ISV A;  1ZG8 A;  4OC3 A;  1R43 A;  3KKW A;  3KQX A;  2Q04 A;  5GCN A;  4ZY0 A;  1Z4R A;  4HKF A;  1YLE A;  3H8E A;  1CP7 A;  4IAV A;  3R9E A;  1UWY A;  2X7B A;  3KQZ A;  2BOA A;  2DPT A;  2G3A A;  2Q7S A;  4UIA A;  3PB4 X;  3QAY A;  3B3W A;  3S6F A;  3TFY A;  1F57 A;  4UEZ A;  4QC6 A;  3IWW A;  4MRI A;  2XEI A;  1CBX A;  3NH8 A;  4B5P A;  1M4I A;  2O53 A;  1TF8 A;  2QML A;  1IB1 E;  3PBE A;  4OP4 A;  1ZLI A;  1M4L A;  2PJ5 A;  5E96 A;  5G22 A;  4A95 A;  4E8O A;  4EVY A;  4F0X A;  4P4E A;  5C82 A;  3PB7 X;  2PJ7 A;  1YME A;  5LYD A;  3SI0 A;  3D4U A;  4A39 A;  2EBJ A;  1X10 A;  1CM0 A;  4U9Y A;  3TO7 A;  4E0A A;  4R9M A;  4JYW A;  5HVF A;  3JTK A;  3CT9 A;  3CZX A;  2Z0Z A;  3R9G A;  1YRE A;  3PRT A;  4CRZ B;  4JJX A;  2JLM A;  3F0A A;  3IU1 A;  3NE8 A;  2REF A;  5F47 A;  2C6P A;  3NA6 A;  5I4M A;  3GIU A;  5EBV A;  2JDD A;  4UA3 A;  2DF5 A;  3JUW A;  3CDX A;  3H4Q A;  1BPM A;  2J8R A;  4IK2 A;  2BSW A;  4MHZ A;  3RNZ A;  2Z10 A;  1XJO A;  1S7N A;  2NMT A;  2PC1 A;  4PXD A;  2B3U A;  1XEB A;  2B4D B;  2GIV A;  2ZEP A;  5HVG A;  3N5F A;  2PJ4 A;  2R98 A;  4CRY B;  5JQ4 A;  1SQH A;  3BJ8 A;  4B6Z A;  3C26 A;  5JH9 A;  2VEZ A;  3V7Z A;  3FF3 A;  3S6G A;  3FED A;  1YLO A;  4PPZ A;  3SJX A;  3D7D A;  4P44 A;  3TT2 A;  5K8O A;  3TO6 A;  4OLL A;  3R9F A;  4CAF A;  2D4O A; 
#chains in the Genus database with same CATH homology
 2J8M A;  4UBR A;  4FD7 A;  3EC4 A;  2J8N A;  4NCZ A;  4NEX A;  1S60 A;  1QST A;  1N71 A;  4PSX A;  4KLW A;  4AB7 A;  4J3G A;  2Q7B A;  4UCP A;  3TE4 A;  2IL4 A;  2VI7 A;  1NMT A;  2CY2 A;  4II9 A;  4QVT A;  1CJW A;  4HNY B;  4B11 A;  4OAE A;  4PK3 A;  4FD6 A;  4GS4 A;  3G8W A;  2FIW A;  5J8C A;  2VXK A;  2OZU A;  1WK4 A;  5A28 A;  2OZG A;  4HNX B;  3TO9 A;  2WPW A;  1I1D A;  4MJ8 A;  2DPS A;  5IV0 A;  4QUS A;  5BWA B;  4KOS A;  1UFH A;  2Q0Y A;  2YNE A;  1MJB A;  2AJ6 A;  4CYQ A;  5G1Z A;  1VHS A;  3LD2 A;  1S7F A;  4H6Z A;  4R3K A;  2FSR A;  2I79 A;  4CGM A;  3P2H A;  1GHE A;  4NXY A;  3GY9 A;  3FIX A;  4MBU A;  4YGO A;  4UFV A;  5F46 A;  4KZT A;  2FL4 A;  3FNC A;  1S7K A;  1RO5 A;  4QB9 A;  2VQY A;  2WSA A;  4Y49 B;  4A30 A;  1YR0 A;  2FIA A;  4MFJ A;  3DR8 A;  4YFJ A;  2F5I A;  2PQ8 A;  2VZZ A;  3ZJ0 A;  4R57 A;  1NE9 A;  2K5T A;  3IU2 A;  2Z3M A;  3IWE A;  2I00 A;  4MFQ A;  4Q38 A;  5DWN A;  3FB3 A;  4AVA A;  4UWJ A;  3TOA A;  1ON0 A;  4KOR A;  3T90 A;  3W6X A;  3D8P A;  5C88 A;  4H89 A;  4MY3 A;  3DDD A;  3I9S A;  1L0C A;  1WWZ A;  2FCK A;  1I21 A;  4KVO E;  3NE7 A;  4L8A A;  3FRM A;  1S3Z A;  4LX9 A;  2Q4V A;  4XPK A;  4Y49 C;  1YK3 A;  2B58 A;  2HUZ A;  3BLN A;  4PV6 A;  2Y0M A;  5G21 A;  3WR7 A;  2OB0 A;  4ZGY B;  4JLY A;  4MFK A;  1P0H A;  1Y7R A;  1Q2Y A;  2QEC A;  1M4D A;  3GYA A;  4PSW A;  4CS0 B;  1IIC A;  4JD6 A;  2B5G B;  2FS5 A;  2ATR A;  4AG7 A;  2KCW A;  2QIR A;  4MFZ A;  1Z4E A;  2R8V A;  1QSR A;  3UY5 A;  2Z3N A;  5CNP A;  1MJA A;  1V0C A;  2P0W A;  4BMH A;  1U6M A;  5IX3 A;  4KOX A;  1YVK A;  1QSN A;  1P4N A;  4E2A A;  2Z3P A;  4M3S A;  3R95 A;  3FXT A;  3ZZI A;  1XIX A;  2GAN A;  4AVC A;  1PUA A;  2B4D A;  5J8F A;  4I49 A;  1KUX A;  4UCM A;  3TOB A;  5HMN A;  5AG7 A;  2R7H A;  2C27 A;  3TCV A;  4MY0 A;  1QSO A;  4JWP A;  1M1D A;  2HQY A;  2PSW A;  2B4B A;  1KUY A;  4R3L A;  3B8G A;  4A2Z A;  2JDC A;  2OU2 A;  4U5Y A;  1VKC A;  4KLV A;  4ONU A;  2PR8 A;  4CYN A;  3F8K A;  1J4J A;  2HV2 A;  3FBU A;  3VWE A;  5AGE A;  1BOB A;  4XPD B;  1M4G A;  2PDO A;  2GE3 A;  2B3V A;  3DNS A;  3I3G A;  4A33 A;  2G3T A;  1R57 A;  1IID A;  4M85 A;  2CNS A;  2BL1 A;  3EXN A;  3EO4 A;  2YNC C;  4F0Y A;  2VZY A;  5KTA A;  4C7H A;  3PGP A;  2VBQ A;  3W6S A;  2YND A;  1LRZ A;  1KUV A;  1I12 A;  2FE7 A;  1XE4 A;  2ZW7 A;  2WPX A;  3OWC A;  4B10 A;  4FD5 A;  1NSL A;  4BBH A;  3PP9 A;  4B5O A;  1FY7 A;  1TIQ A;  2D4P A;  4C7I A;  2P6E A;  4F6A A;  3CXQ A;  3LOD A;  4A32 A;  4CAX A;  1YGH A;  4KVX A;  2Z3O A;  5G20 A;  4H6U A;  2O28 A;  1Q2C A;  3K9U A;  4JXQ A;  3S6H A;  4XNH B;  1Z9U A;  1Y9W A;  5H86 A;  4KVM E;  4XPD C;  3IGR A;  3T9Y A;  4CAV A;  2CNT A;  2DXQ A;  5DWM A;  4KS9 A;  5EC4 A;  1ZO0 A;  5AG4 A;  2A4N A;  1S7L A;  3H5Z A;  4AVB A;  4MFP A;  3QB8 A;  5AG6 A;  1Y9K A;  3E0K A;  3DR6 A;  3SXO A;  5IB0 A;  4UFW A;  4JXR A;  1MJ9 A;  2ZW4 A;  3D2M A;  4KOT A;  2YGW A;  3S6K A;  3CXP A;  4MFL A;  3D2P A;  4FD4 A;  3CXS A;  2H5M A;  2ZW5 A;  4LUA A;  3P2F A;  1RXT A;  5AG5 A;  4B14 A;  2FT0 A;  4UCN A;  3TTH A;  1PU9 A;  2Q4Y A;  3BJ7 A;  4KUA A;  2FXF A;  4DNC A;  4IUS A;  1Q2D A;  4U9Z A;  1XMT A;  2RC4 A;  4IF5 A;  4Q36 A;  3N7Z A;  4KUB A;  2PR1 A;  4XNH C;  4KSA A;  1B6B A;  3DSB A;  2PRB A;  2REE A;  2AE6 A;  4UFX A;  4C2Z A;  3FYN A;  4C2Y A;  4CYP A;  3EFA A;  4ORF A;  4CAW A;  4KOV A;  1M44 A;  2Z3L A;  3SHP A;  3F5B A;  4KOY A;  2EVN A;  2EUI A;  4A31 A;  1YVO A;  5H84 A;  2BEI A;  4KSF A;  4AG9 A;  3D3S A;  3GKR A;  2G0B A;  1BO4 A;  3JVN A;  2ZW6 A;  3R1K A;  1B87 A;  3R96 A;  4X5K A;  4R87 A;  4RS2 A;  1QSM A;  4NF1 A;  1IYK A;  3G3S A;  4QBJ A;  3W91 A;  4CGO A;  4PK2 A;  3PZJ A;  4C68 A;  4CGP A;  5KTC A;  4XPL A;  3EY5 A;  2CXA A;  2OZH A;  4L89 A;  2Q44 A;  2CNM A;  4HNW B;  5F48 A;  4CGN A;  5I0C A;  5F49 A;  2B5G A;  2JEV A;  4B5P B;  2WUU A;  4YRH A;  4B12 A;  3VWD A;  1YX0 A;  1OZP A;  1S5K A;  4CYO A;  3V8I A;  4ZBG A;  1MK4 A;  2ARH A;  1XF8 A;  4CGL A;  2OH1 A;  3MGD A;  3IWG A;  2ZPA A;  4CAE A;  4K30 A;  3SXN A;  2BUE A;  2YNC A;  2P6G A;  5HH1 A;  2ZXV A;  5A27 A;  3A9L A;  1IYL A;  4MI4 A;  4UWI A;  4OAD A;  4MHD A;  5FVJ A;  2Z3K A;  4B13 A;  2R1I A;  1K4J A;  2P6F A;  4C2X A;  5KTD A;  1KZF A;  4KOU A;  4KOW A;  4RI1 A;  4NSQ A;  2Z11 A;  3QAH A;  3RYO A;  5ISV A;  3KKW A;  2Q04 A;  5GCN A;  1Z4R A;  4HKF A;  1YLE A;  3R9E A;  2X7B A;  2DPT A;  2G3A A;  3S6F A;  3TFY A;  4QC6 A;  4B5P A;  1M4I A;  2QML A;  5JPH A;  1IB1 E;  5G22 A;  5E96 A;  4A95 A;  4E8O A;  4F0X A;  4EVY A;  5C82 A;  1CM0 A;  4U9Y A;  3TO7 A;  4E0A A;  4R9M A;  3JTK A;  2Z0Z A;  3R9G A;  1YRE A;  4CRZ B;  4JJX A;  2JLM A;  3F0A A;  3IU1 A;  2REF A;  5F47 A;  5EBV A;  2JDD A;  4UA3 A;  3JUW A;  3H4Q A;  2J8R A;  2BSW A;  2Z10 A;  1S7N A;  2NMT A;  2PC1 A;  2B3U A;  1XEB A;  2B4D B;  2GIV A;  2R98 A;  4CRY B;  5JQ4 A;  1SQH A;  3BJ8 A;  3C26 A;  2VEZ A;  3S6G A;  3TT2 A;  3TO6 A;  4OLL A;  3R9F A;  4CAF A;  2D4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...