4KVME

The nata (naa10p/naa15p) amino-terminal acetyltransferase complex bound to a bisubstrate analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase/transferase inhibitor
molecule keywords N-terminal acetyltransferase A complex subunit nat1
total genus 44
structure length 153
sequence length 153
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvmE00
4HNWB 4OADA 2Z10A 2R7HA 3C26A 4M3SA 2WPXA 3EFAA 1I21A 1S7KA 4HNYB 5C88A 5ISVA 4KLVA 1MJBA 2D4PA 4NCZA 2ZW6A 2B58A 1CM0A 2REFA 3DR6A 4KOXA 4KOYA 1S3ZA 5IB0A 1YLEA 3TE4A 4R3LA 3WR7A 1S60A 1Y9KA 1Y9WA 4U9ZA 4R57A 4OLLA 5KTCA 3CXSA 4MHDA 2D4OA 2FXFA 5F48A 2PDOA 3VWDA 2R98A 2B5GB 4F0YA 4KZTA 2BSWA 4QB9A 2PR1A 3IWGA 1NE9A 2B4BA 1YVKA 3TTHA 1MK4A 3LD2A 4LX9A 4KOWA 2I00A 4PSXA 4KVME 2P6EA 1RXTA 4PSWA 2VZZA 3D3SA 4MY3A 2CNTA 2B3UA 2AJ6A 2PR8A 3S6GA 4H6UA 4QUSA 4KUBA 1J4JA 2FCKA 2G3AA 2OZGA 3EY5A 3SXOA 2Z0ZA 2H5MA 3TO9A 2OZUA 2ZPAA 2VXKA 2NMTA 1SQHA 2P6GA 3FIXA 2JDCA 3FB3A 1NMTA 4CAVA 4XNHC 1U6MA 4R9MA 4B5PB 2Q7BA 2PSWA 2O28A 2A4NA 4JJXA 2J8RA 3FNCA 4CRYB 2X7BA 4NF1A 3LODA 1BOBA 3BJ8A 1QSMA 4GS4A 4QBJA 1QSNA 3CXQA 4NSQA 4R87A 2B3VA 3R95A 2CY2A 3TOBA 4UWJA 3K9UA 5EC4A 5F47A 4KOVA 2HUZA 3H4QA 3KKWA 4H89A 4II9A 5I0CA 3TOAA 3BLNA 3D2MA 3R9FA 1OZPA 1IICA 1XIXA 2FS5A 2Q4YA 4E2AA 3QB8A 4KUAA 2GE3A 3R1KA 3GKRA 4NEXA 2HQYA 4MJ8A 4FD7A 2B4DA 3F8KA 4QVTA 2BL1A 3TFYA 4XPDC 5IX3A 2WPWA 1P4NA 3FBUA 3ZJ0A 4OAEA 4FD5A 4RS2A 4DNCA 1FY7A 2P6FA 5F49A 4KVOE 4CS0B 1S7FA 4IF5A 1PU9A 4U9YA 4UWIA 1VHSA 2Q44A 1ON0A 4HKFA 3FXTA 3T9YA 5IV0A 1YREA 1R57A 4ZBGA 4FD4A 3T90A 4Y49C 1V0CA 2GIVA 4F6AA 2B4DB 2QECA 2RC4A 1S7LA 1UFHA 4YFJA 4RI1A 1XMTA 2JLMA 4MI4A 1S7NA 1NSLA 2J8MA 3R96A 1Q2DA 3S6HA 3G3SA 2VZYA 1KUYA 3EXNA 3FRMA 2FL4A 4JD6A 1QSOA 4UA3A 1WWZA 3VWEA 2ZW7A 5J8CA 4CAWA 4I49A 2CNMA 4E0AA 4XPDB 1I1DA 5H86A 1XEBA 4HNXB 2G0BA 5JQ4A 3DNSA 4L8AA 2ARHA 4AVBA 4XPLA 3EO4A 1WK4A 3G8WA 4CAXA 5DWNA 1KUVA 3UY5A 2Q4VA 4YRHA 1XF8A 3B8GA 4FD6A 3FYNA 1Z9UA 2VI7A 4JWPA 1KUXA 3GYAA 2FSRA 2R1IA 2OZHA 1YR0A 2HV2A 3QAHA 3BJ7A 3I3GA 2G3TA 3D2PA 3W91A 5FVJA 2K5TA 4X5KA 4AG9A 4EVYA 1PUAA 2I79A 1IYKA 1RO5A 2DXQA 4KORA 5H84A 1M4IA 3SHPA 3W6SA 2R8VA 1BO4A 1Z4EA 2P0WA 4ONUA 3E0KA 4UBRA 3PGPA 4AVCA 4AVAA 1TIQA 2ZW5A 1IB1E 2F5IA 5EBVA 3DDDA 2AE6A 5F46A 1IYLA 3OWCA 3TT2A 1GHEA 2KCWA 3TO7A 2Z11A 5DWMA 1M4GA 2REEA 1Q2YA 2PRBA 4H6ZA 2EUIA 4XNHB 4AG7A 1YK3A 4BMHA 2FIAA 3R9EA 3P2FA 2EVNA 2GANA 3V8IA 1M4DA 5HH1A 4MY0A 1B6BA 4LUAA 4XPKA 5JPHA 4AB7A 2JEVA 3F5BA 5J8FA 4JLYA 3R9GA 2ZW4A 4PV6A 3DR8A 2OB0A 2VBQA 4NXYA 2C27A 3N7ZA 2JDDA 1N71A 3TO6A 1XE4A 1MJAA 1M44A 3F0AA 1YGHA 4U5YA 4PK2A 1QSRA 3NE7A 3MGDA 2Q04A 3DSBA 2CNSA 1Z4RA 3TCVA 3D8PA 2B5GA 3GY9A 3S6KA 3W6XA 4Y49B 4YGOA 4J3GA 5HMNA 4L89A 4B5OA 2PQ8A 3JVNA 4JXRA 4K30A 5KTDA 5KTAA 3SXNA 5CNPA 4KOSA 4MBUA 4CRZB 4JXQA 2J8NA 1LRZA 4KVXA 3CXPA 1IIDA 2Q0YA 3S6FA 1YX0A 5C82A 3P2HA 2BUEA 1B87A 3ZZIA 3IGRA 3PZJA 4IUSA 1QSTA 1VKCA 1KZFA 3EC4A 5GCNA 3I9SA 2OU2A 2QIRA 2VEZA 4B5PA 1L0CA 1Q2CA 2ZXVA 5E96A 1K4JA 2FT0A 4PK3A 1M1DA 1I12A 1CJWA 1S5KA 4KOTA 2OH1A 2FE7A 2BEIA 2VQYA 3PP9A 4R3KA 2QMLA 2IL4A 4ORFA 4KOUA 4QC6A 2ATRA 2Y0MA 4E8OA 1Y7RA 3JUWA 4KLWA 1YVOA 3RYOA 1MJ9A 4M85A 2PC1A 1P0HA 2FIWA
chains in the Genus database with same CATH superfamily
4GM5A 4HNWB 3HUVA 4NJRA 5D29A 4GXHA 3SI2A 2ZOFA 2ZOGA 4OADA 2Z10A 1XFOA 2R7HA 4CGOA 4CYQA 3ZJ0A 3NH4A 3C26A 5JQ4A 4M3SA 4P4DA 2WPXA 3EFAA 1I21A 1HDUA 1S7KA 4HNYB 4CGPA 3WC7A 1RTQA 4YU9A 1ARMA 4DYOA 5C88A 2ZEMA 5ISVA 3HLPA 3PFOA 4KLVA 1MJBA 3B3CA 3IWWA 2D4PA 3NH5A 4NCZA 3VH9A 2ZW6A 3B35A 2B58A 1CM0A 2REFA 4K3NA 3DR6A 5G22A 4A37A 1TF9A 3CPAA 4KOXA 4KOYA 1S3ZA 5IB0A 1YLEA 4P10A 2C1CA 3LMSA 3TE4A 4R3LA 2GU2A 4ZYQA 3WR7A 1S60A 1Y9KA 1ZLHA 2JEWA 4FAIA 4NFRA 1CX8A 1Y9WA 3I1UA 2ZEDA 3NH8A 4MRIA 4U9ZA 4A32A 4R57A 4OLLA 2BO9A 3PB7X 5KTCA 3CXSA 2IJZA 4MHDA 2D4OA 2FXFA 4W9YA 3PB4X 3WC6A 5F48A 2PDOA 3VWDA 4EMEA 2R98A 2B5GB 5A28A 2HC9A 4F0YA 4ONWA 2RB7A 4KZTA 2BSWA 3SJFA 4MCQA 4CAFA 4C7IA 5HVFA 4QB9A 1BLLE 3KI9A 1ZG7A 2PR1A 3IWGA 4C2ZA 1NE9A 1IGBA 2B4BA 3H8FA 1CP7A 1YVKA 2EK9A 3PB6X 4ZY2A 1MK4A 3TTHA 4C68A 2ZEHA 3S9NA 4R76A 3S9LA 3LD2A 2GREA 4LX9A 4KOWA 2I00A 4PSXA 4KVME 2P6EA 2NSMA 5LRJA 2WSAA 5LYLA 2CXAA 5LYIA 1RXTA 4PSWA 4F9VA 2VZZA 3D66A 3D3SA 4MY3A 2CNTA 2B3UA 2ZEPA 3FH4A 4F9UA 2AJ6A 2PR8A 2OOTA 5DS0A 4F8ZA 3S6GA 4H6UA 2O4HA 1F2PA 4QUSA 4FUUA 3CT9A 1J4JA 2FCKA 2G3AA 2OZGA 2OR4A 2RFHA 3EY5A 2Z0ZA 4KUBA 2H5MA 2YNCA 4NGRA 3SXOA 3ISXA 4EFDA 1QMUA 3BXMA 1A2ZA 3TO9A 2OZUA 4OMEA 4B10A 2ZPAA 4MCSA 2YNDA 2VXKA 2NMTA 3MRUA 3IEHA 1SQHA 2P6GA 3FIXA 1EE3P 2JDCA 4C7HA 4P45A 4OC3A 3D68A 2EO8A 4OC4A 3FB3A 1DTDA 3QAYA 1NMTA 2Z3NA 4CAVA 1X10A 4P4BA 4XNHC 4CYOA 1U6MA 4R9MA 4B5PB 5HVHA 5K8OA 4OP4A 2Q7BA 2PSWA 4P4EA 4NGPA 2O28A 3JRUA 3IU1A 4OKOA 2A4NA 4JJXA 2Q43A 2XEIA 2J8RA 3FNCA 4ZY1A 4CRYB 2X7BA 1F2OA 4NF1A 3LODA 4MHNA 4B12A 1BOBA 3BJ8A 1QSMA 3PB9X 4GS4A 1QSNA 4QBJA 3CXQA 3KHZA 4JZ0A 3SJEA 2Q4ZA 4NSQA 4F0XA 1BAVA 4R87A 5AGEA 5LRKA 3FF3A 2B3VA 2PJ2A 2JBJA 3R95A 1ARLA 4CAEA 4KS9A 2CY2A 3TOBA 2F7VA 1XBUA 3PRTA 4UWJA 1VHEA 2PJCA 3KL9A 3QNVA 2PJ1A 3K9UA 5EC4A 1AMPA 2V8GA 5F47A 4KOVA 4NGTA 3K9TA 1BPNA 3T8WA 2PVVA 3KR5A 1Z8LA 2CIJA 2HUZA 4A94A 2QYVA 3H4QA 2C6GA 3KKWA 4H89A 4II9A 5JM6A 4MCRA 1DE4C 4C2XA 5I0CA 3TOAA 4MXUA 3PBEA 1IOFA 3BLNA 3B3TA 3D2MA 2PJ7A 5G21A 5K8NA 3D7DA 3R9FA 1OZPA 1IICA 2ANPA 2C6CA 1XIXA 2FS5A 3FVLA 3PB8X 3IO1A 2PCUA 2Q4YA 4OC2A 4UEFA 4UF4A 4NJQA 3RNZA 4LQ6A 4E2AA 4YWYA 1CPSA 3QB8A 4KUAA 3A9LA 1Y7EA 2GE3A 3R1KA 4DJLA 2EBJA 4P4JA 3GKRA 3BI0A 4NEXA 3FEDA 2PJ8A 2HQYA 2Z3OA 4B14A 4MJ8A 4P44A 3H5ZA 4FD7A 2B4DA 2AFZA 3F8KA 2BL1A 1YLOA 2ZEEA 3N5FA 4QVTA 3KZWA 4XPDC 3TFYA 3FMCA 3GIUA 3LACA 5IX3A 2WPWA 1P4NA 4A2ZA 3FBUA 2PJ6A 3ISZA 4OAEA 3B3WA 4UEZA 4FD5A 2QVPA 5AG7A 4RS2A 4RN7A 1FY7A 2P6FA 1Y0YA 4A38A 2EWBA 4BBHA 4DNCA 3KASA 5F49A 4KVOE 4NGQA 4CS0B 1CP6A 1S7FA 2AFUA 4IF5A 3IIBA 4CGMA 3DLJA 1PU9A 2XEFA 4U9YA 1VHSA 4UWIA 3GUXA 2Q44A 1ON0A 2GLFA 1CBXA 2FVGA 4B11A 4HKFA 3FXTA 4CGLA 4Q38A 2DF5A 3T9YA 5JGFA 1PCAA 1YMEA 5IV0A 3CPXA 4ZX9A 1YREA 2YNCC 1FT7A 2V77A 1R57A 2IQ6A 2PJ5A 4FWUA 4ZBGA 2DEAA 4FD4A 3FX6A 3WABA 3T90A 4Y49C 1V0CA 2GIVA 4F6AA 2B4DB 2QECA 2RC4A 1HDQA 4MFZA 1YW6A 4MCPA 4Z65A 2AFWA 3KQZA 1S7LA 1UFHA 4YFJA 4RI1A 5THWA 1XMTA 2JLMA 4MI4A 1S7NA 2POKA 1NSLA 2J8MA 4R8FA 3R96A 4UEEA 5AG5A 1Q2DA 4MFLA 1Y0RA 3S6HA 3NE8A 3DGVA 3G3SA 2VZYA 1KUYA 5CBMA 3IJ3A 3RAMA 3EXNA 3FRMA 4WWVA 1Z8WA 2FL4A 4JD6A 1QSOA 3D67A 4LQGA 4UA3A 5BWAB 1WWZA 4A39A 3VWEA 2ZW7A 5J8CA 3JTKA 4CAWA 4NGMA 4I49A 2BCOA 2CNMA 3PFEA 4E0AA 4MFPA 4NGNA 4PQAA 4XPDB 4ZX8A 1I1DA 2PRQA 5H86A 3V7ZA 1XEBA 3H8GA 3NFZA 1YW4A 2G0BA 2IMOA 4HNXB 1XMBA 3DNSA 4L8AA 1NSAA 4Q7AA 2ARHA 4AVBA 4RUHA 1JWQA 4XPLA 4KSFA 8CPAA 3EO4A 1Z8XA 4A31A 1WK4A 1Z2LA 3G8WA 4CAXA 3KR4A 5DWNA 1KUVA 3UY5A 2Q4VA 4YRHA 2GLJA 4UFVA 1XF8A 3B8GA 4FD6A 3PEIA 4MHYA 3FYNA 1Z9UA 2ODFA 2VI7A 1JQGA 4JWPA 1KUXA 3GYAA 3IU2A 2FSRA 4TNUA 3S9MA 2R1IA 2OZHA 1YR0A 4X8IA 2PIYA 1R43A 2HV2A 2ZENA 4UCPA 3QAHA 3BJ7A 1KWMA 3I3GA 2XEGA 4P4FA 1ZO0A 5G20A 2G3TA 4UIBA 2WZNA 5A27A 3D2PA 3W91A 5FVJA 2K5TA 4X5KA 4AG9A 4EVYA 2V8VA 1PUAA 2I79A 1IYKA 1XOVA 2J9AA 2PJBA 2Z3KA 3SJXA 1RO5A 1OBRA 2DXQA 4HPSA 4IHMA 1AYEA 4KORA 2ZEGA 2Z3LA 4M6HA 4DUKA 5H84A 3FECA 1CPXA 2PJ3A 4R7MA 4CYPA 1M4IA 1PYTB 4Q36A 4JYWA 3SHPA 1TKHA 1ELMP 4PXCA 3W6SA 2R8VA 2DPSA 1BO4A 5K8MA 1Z4EA 2P0WA 4MFKA 4ONUA 4MFJA 7CPAA 1UWYA 3E0KA 2Q7SA 4UBRA 5LYFA 3PGPA 4AVCA 4AVAA 1ELLP 1TIQA 2ZW5A 1IB1E 5HXDA 2F5IA 5EBVA 2CTBA 3DDDA 2AFXA 2PE3A 2AE6A 4A30A 3B3VA 5F46A 1IYLA 3OWCA 3TT2A 3B7IA 4PXBA 5AG4A 1GHEA 2NYQA 2KCWA 3TO7A 1LOKA 2YNEA 3K2KA 4H2KA 2Z11A 4R6TA 4CYNA 4OC1A 5DWMA 4CPAA 1M4GA 4MMOA 2REEA 1Q2YA 3LWUA 1CG2A 1LAMA 2PRBA 3B3SA 4H6ZA 2EUIA 4IK2A 4XNHB 3B2YA 4ZY0A 4MHZA 4AG7A 1YK3A 4X2TA 2ABZA 4BMHA 3V38A 2FIAA 3TX8A 5EMIA 3R9EA 3D7GA 1LFWA 3P2FA 4EWTA 2EVNA 2GANA 1YQEA 1Z5RA 3V8IA 1VIXA 1M4DA 1FNOA 5HH1A 4MY0A 2ZEFA 4BD9A 1B6BA 3GB0A 3FJUA 5J1QA 4A33A 1LANA 2PVWA 4LUAA 4XPKA 5JPHA 2PIZA 4OC0A 1M4LA 1VGYA 1R3NA 3FEEA 3IWEA 4AB7A 4UCMA 2JEVA 3F5BA 5J8FA 4JLYA 3R9GA 2V8DA 2ZW4A 5JH9A 4PV6A 2PJAA 3DR8A 4OIDA 2G9DA 1YSJA 1TKFA 3BI1A 3IC1A 3KGQA 5LYDA 1BPMA 2OB0A 2VBQA 3CDXA 3BHXA 4NXYA 2VL1A 2C27A 3N7ZA 2JDDA 1N71A 4MHPA 3TO6A 1QQ9A 1XE4A 1MJAA 1M44A 4ZI6A 3WC5A 4MFQA 2PJ0A 3F0AA 3WT4A 1YGHA 3IFEA 4U5YA 4PK2A 4UFXA 2EK8A 4UCNA 1QSRA 4TWEA 3SI0A 2O53A 1GYTA 4PXDA 1Z8TA 4UIAA 3NE7A 3MGDA 3NA6A 4BINA 2Q04A 5LRGA 3DSBA 5IB9A 2CNSA 4C2YA 2QJ8A 4G1PA 1Z4RA 3TCVA 2PJ9A 2B5GA 3D8PA 5ELYA 3GY9A 3S6KA 3W6XA 1IY7A 1TF8A 4O23A 4Y49B 4YGOA 5D8NA 4J3GA 2BOAA 3D7HA 5HMNA 4L89A 4B5OA 2PQ8A 3JVNA 3RZAA 5K8PA 4KSAA 1VHOA 4JXRA 4K30A 5KTDA 1ZLIA 4CGNA 5KTAA 3TC8A 4WJBA 2WYRA 4M6GA 3SXNA 5CNPA 4KOSA 3H8EA 4MBUA 4CRZB 4JXQA 2J8NA 1LRZA 4KVXA 3CXPA 1TXRA 4OC5A 1IIDA 1IU8A 3RO0A 3MN8A 2ZEOA 2GFQA 4NGSA 4PPZA 4P4IA 2PJ4A 2Z3MA 2YGWA 2Q0YA 3SI1A 3S6FA 1YX0A 5C82A 3P2HA 2BUEA 1B87A 3ZZIA 1AUGA 4B6ZA 3IGRA 3PZJA 3KQXA 2V8HA 4IUSA 1QSTA 2CTCA 1VKCA 1KZFA 1ZG9A 3EC4A 5GCNA 3RBUA 4P6YA 5HVGA 2JBKA 3I9SA 3VARA 2WUUA 1TKJA 2OU2A 2QIRA 2C6PA 4A95A 2VEZA 4B5PA 3VATA 3GLJA 4AXVA 1L0CA 2ZELA 1Q2CA 1H8LA 2ZXVA 5E96A 2AFSA 1K4JA 5F09A 2FT0A 1IOIA 4PK3A 2XEJA 4FBEA 1M1DA 1LCPA 1I12A 1CJWA 3L2NA 1S5KA 4KOTA 3D7FA 2OH1A 4IAVA 1Q7LA 1X12A 2FE7A 2DPTA 2F8HA 2Q51A 1F57A 5G1ZA 1LAPA 2BEIA 3CZXA 4KSIA 5I4MA 2VQYA 3PP9A 4R3KA 4X3RA 4B13A 2QMLA 1HEEA 2IL4A 6CPAA 4OIWA 4ORFA 4KOUA 3D4UA 4QC6A 4UFWA 2ATRA 2Y0MA 4PXEA 3SJGA 2CF4A 4E8OA 1Y7RA 2Z3PA 3JUWA 3KHXA 5AG6A 1XRYA 4KLWA 1XJOA 1YVOA 3RYOA 2HB6A 1ZG8A 1MJ9A 2AFOA 2AFMA 5CPAA 2I3CA 4M6IA 4ZGYB 4M85A 3PBBA 2PC1A 1P0HA 2FIWA
chains in the Genus database with same CATH topology
4HNWB 4OADA 2Z10A 4CGOA 2R7HA 4CYQA 3C26A 4M3SA 2WPXA 3EFAA 1I21A 1S7KA 4HNYB 4CGPA 5C88A 5ISVA 4KLVA 1MJBA 2D4PA 4NCZA 2ZW6A 2B58A 1CM0A 2REFA 3DR6A 5G22A 4KOXA 4KOYA 1S3ZA 5IB0A 1YLEA 3TE4A 4R3LA 3WR7A 1S60A 1Y9KA 1Y9WA 4U9ZA 4A32A 4R57A 4OLLA 5KTCA 3CXSA 4MHDA 2D4OA 2FXFA 5F48A 2PDOA 3VWDA 2R98A 2B5GB 5A28A 4F0YA 4KZTA 2BSWA 4CAFA 4C7IA 4QB9A 2PR1A 3IWGA 4C2ZA 1NE9A 2B4BA 1YVKA 3TTHA 1MK4A 4C68A 3LD2A 4LX9A 4KOWA 2I00A 4PSXA 4KVME 2P6EA 2WSAA 2CXAA 1RXTA 4PSWA 2VZZA 3D3SA 4MY3A 2CNTA 2B3UA 2AJ6A 2PR8A 3S6GA 4H6UA 4QUSA 4KUBA 1J4JA 2FCKA 2G3AA 2OZGA 3EY5A 3SXOA 2Z0ZA 2H5MA 2YNCA 3TO9A 2OZUA 4B10A 2ZPAA 2YNDA 2VXKA 2NMTA 1SQHA 2P6GA 3FIXA 2JDCA 4C7HA 3FB3A 1NMTA 2Z3NA 4CAVA 4XNHC 4CYOA 1U6MA 4R9MA 4B5PB 2Q7BA 2PSWA 2O28A 3IU1A 2A4NA 4JJXA 2J8RA 3FNCA 4CRYB 2X7BA 4NF1A 3LODA 4B12A 1BOBA 3BJ8A 1QSMA 4GS4A 4QBJA 1QSNA 3CXQA 4NSQA 4F0XA 4R87A 5AGEA 2B3VA 3R95A 4CAEA 4KS9A 2CY2A 3TOBA 4UWJA 3K9UA 5EC4A 5F47A 4KOVA 2HUZA 3H4QA 3KKWA 4H89A 4II9A 4C2XA 5I0CA 3TOAA 3BLNA 3D2MA 5G21A 3R9FA 1OZPA 1IICA 1XIXA 2FS5A 2Q4YA 4E2AA 4KUAA 3QB8A 3A9LA 2GE3A 3R1KA 3GKRA 4NEXA 2HQYA 2Z3OA 4B14A 4MJ8A 3H5ZA 4FD7A 2B4DA 3F8KA 4QVTA 2BL1A 3TFYA 4XPDC 5IX3A 2WPWA 1P4NA 4A2ZA 3FBUA 3ZJ0A 4OAEA 5AG7A 4FD5A 4RS2A 4DNCA 1FY7A 2P6FA 4BBHA 5F49A 4KVOE 4CS0B 1S7FA 4CGMA 4IF5A 1PU9A 4U9YA 4UWIA 1VHSA 2Q44A 1ON0A 4B11A 4HKFA 3FXTA 4CGLA 4Q38A 3T9YA 5IV0A 1YREA 2YNCC 1R57A 4ZBGA 4FD4A 3T90A 4Y49C 1V0CA 2GIVA 4F6AA 2B4DB 2QECA 2RC4A 4MFZA 1S7LA 1UFHA 4YFJA 4RI1A 1XMTA 2JLMA 4MI4A 1S7NA 1NSLA 2J8MA 3R96A 5AG5A 1Q2DA 4MFLA 3S6HA 3G3SA 2VZYA 1KUYA 3EXNA 3FRMA 2FL4A 4JD6A 1QSOA 4UA3A 5BWAB 1WWZA 3VWEA 2ZW7A 5J8CA 3JTKA 4CAWA 4I49A 2CNMA 4E0AA 4MFPA 4XPDB 1I1DA 5H86A 1XEBA 4HNXB 2G0BA 5JQ4A 3DNSA 4L8AA 2ARHA 4AVBA 4XPLA 4KSFA 3EO4A 4A31A 1WK4A 3G8WA 4CAXA 5DWNA 1KUVA 3UY5A 2Q4VA 4YRHA 4UFVA 1XF8A 3B8GA 4FD6A 3FYNA 1Z9UA 2VI7A 4JWPA 1KUXA 3GYAA 3IU2A 2FSRA 2R1IA 2OZHA 1YR0A 2HV2A 4UCPA 3QAHA 3BJ7A 3I3GA 1ZO0A 5G20A 2G3TA 5A27A 3D2PA 3W91A 5FVJA 2K5TA 4X5KA 4AG9A 4EVYA 1PUAA 2I79A 1IYKA 2Z3KA 1RO5A 2DXQA 4KORA 2Z3LA 5H84A 4CYPA 1M4IA 4Q36A 3SHPA 3W6SA 2R8VA 2DPSA 1BO4A 1Z4EA 2P0WA 4MFKA 4ONUA 4MFJA 3E0KA 4UBRA 3PGPA 4AVCA 4AVAA 1TIQA 2ZW5A 1IB1E 2F5IA 5EBVA 3DDDA 2AE6A 4A30A 5F46A 1IYLA 3OWCA 3TT2A 5AG4A 1GHEA 2KCWA 3TO7A 2YNEA 4CYNA 2Z11A 5DWMA 1M4GA 2REEA 1Q2YA 2PRBA 4H6ZA 2EUIA 4XNHB 4AG7A 1YK3A 4BMHA 2FIAA 3R9EA 3P2FA 2EVNA 2GANA 3V8IA 1M4DA 5HH1A 4MY0A 1B6BA 4A33A 4LUAA 4XPKA 5JPHA 3IWEA 4AB7A 4UCMA 2JEVA 3F5BA 5J8FA 4JLYA 3R9GA 2ZW4A 4PV6A 3DR8A 2OB0A 2VBQA 4NXYA 2C27A 3N7ZA 2JDDA 1N71A 3TO6A 1XE4A 1MJAA 1M44A 4MFQA 3F0AA 1YGHA 4U5YA 4PK2A 4UFXA 4UCNA 1QSRA 3NE7A 3MGDA 2Q04A 3DSBA 2CNSA 4C2YA 1Z4RA 3TCVA 3D8PA 2B5GA 3GY9A 3S6KA 3W6XA 4Y49B 4YGOA 4J3GA 5HMNA 4L89A 4B5OA 2PQ8A 3JVNA 4KSAA 4JXRA 4K30A 5KTDA 4CGNA 5KTAA 3SXNA 5CNPA 4KOSA 4MBUA 4CRZB 4JXQA 2J8NA 1LRZA 4KVXA 3CXPA 1IIDA 2Z3MA 2YGWA 2Q0YA 3S6FA 1YX0A 5C82A 3P2HA 2BUEA 1B87A 3ZZIA 3IGRA 3PZJA 4IUSA 1QSTA 1VKCA 1KZFA 3EC4A 5GCNA 3I9SA 2WUUA 2OU2A 2QIRA 4A95A 2VEZA 4B5PA 1L0CA 1Q2CA 2ZXVA 5E96A 1K4JA 2FT0A 4PK3A 1M1DA 1I12A 1CJWA 1S5KA 4KOTA 2OH1A 2FE7A 2DPTA 5G1ZA 2BEIA 2VQYA 3PP9A 4R3KA 4B13A 2QMLA 2IL4A 4ORFA 4KOUA 4QC6A 4UFWA 2ATRA 2Y0MA 4E8OA 1Y7RA 2Z3PA 3JUWA 5AG6A 4KLWA 1YVOA 3RYOA 1MJ9A 4ZGYB 4M85A 2PC1A 1P0HA 2FIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNW B;  4OAD A;  2Z10 A;  2R7H A;  3C26 A;  4M3S A;  2WPX A;  3EFA A;  1I21 A;  1S7K A;  4HNY B;  5C88 A;  5ISV A;  4KLV A;  1MJB A;  2D4P A;  4NCZ A;  2ZW6 A;  2B58 A;  1CM0 A;  2REF A;  3DR6 A;  4KOX A;  4KOY A;  1S3Z A;  5IB0 A;  1YLE A;  3TE4 A;  4R3L A;  3WR7 A;  1S60 A;  1Y9K A;  1Y9W A;  4U9Z A;  4R57 A;  4OLL A;  5KTC A;  3CXS A;  4MHD A;  2D4O A;  2FXF A;  5F48 A;  2PDO A;  3VWD A;  2R98 A;  2B5G B;  4F0Y A;  4KZT A;  2BSW A;  4QB9 A;  2PR1 A;  3IWG A;  1NE9 A;  2B4B A;  1YVK A;  3TTH A;  1MK4 A;  3LD2 A;  4LX9 A;  4KOW A;  2I00 A;  4PSX A;  4KVM E;  2P6E A;  1RXT A;  4PSW A;  2VZZ A;  3D3S A;  4MY3 A;  2CNT A;  2B3U A;  2AJ6 A;  2PR8 A;  3S6G A;  4H6U A;  4QUS A;  4KUB A;  1J4J A;  2FCK A;  2G3A A;  2OZG A;  3EY5 A;  3SXO A;  2Z0Z A;  2H5M A;  3TO9 A;  2OZU A;  2ZPA A;  2VXK A;  2NMT A;  1SQH A;  2P6G A;  3FIX A;  2JDC A;  3FB3 A;  1NMT A;  4CAV A;  4XNH C;  1U6M A;  4R9M A;  4B5P B;  2Q7B A;  2PSW A;  2O28 A;  2A4N A;  4JJX A;  2J8R A;  3FNC A;  4CRY B;  2X7B A;  4NF1 A;  3LOD A;  1BOB A;  3BJ8 A;  1QSM A;  4GS4 A;  4QBJ A;  1QSN A;  3CXQ A;  4NSQ A;  4R87 A;  2B3V A;  3R95 A;  2CY2 A;  3TOB A;  4UWJ A;  3K9U A;  5EC4 A;  5F47 A;  4KOV A;  2HUZ A;  3H4Q A;  3KKW A;  4H89 A;  4II9 A;  5I0C A;  3TOA A;  3BLN A;  3D2M A;  3R9F A;  1OZP A;  1IIC A;  1XIX A;  2FS5 A;  2Q4Y A;  4E2A A;  3QB8 A;  4KUA A;  2GE3 A;  3R1K A;  3GKR A;  4NEX A;  2HQY A;  4MJ8 A;  4FD7 A;  2B4D A;  3F8K A;  4QVT A;  2BL1 A;  3TFY A;  4XPD C;  5IX3 A;  2WPW A;  1P4N A;  3FBU A;  3ZJ0 A;  4OAE A;  4FD5 A;  4RS2 A;  4DNC A;  1FY7 A;  2P6F A;  5F49 A;  4KVO E;  4CS0 B;  1S7F A;  4IF5 A;  1PU9 A;  4U9Y A;  4UWI A;  1VHS A;  2Q44 A;  1ON0 A;  4HKF A;  3FXT A;  3T9Y A;  5IV0 A;  1YRE A;  1R57 A;  4ZBG A;  4FD4 A;  3T90 A;  4Y49 C;  1V0C A;  2GIV A;  4F6A A;  2B4D B;  2QEC A;  2RC4 A;  1S7L A;  1UFH A;  4YFJ A;  4RI1 A;  1XMT A;  2JLM A;  4MI4 A;  1S7N A;  1NSL A;  2J8M A;  3R96 A;  1Q2D A;  3S6H A;  3G3S A;  2VZY A;  1KUY A;  3EXN A;  3FRM A;  2FL4 A;  4JD6 A;  1QSO A;  4UA3 A;  1WWZ A;  3VWE A;  2ZW7 A;  5J8C A;  4CAW A;  4I49 A;  2CNM A;  4E0A A;  4XPD B;  1I1D A;  5H86 A;  1XEB A;  4HNX B;  2G0B A;  5JQ4 A;  3DNS A;  4L8A A;  2ARH A;  4AVB A;  4XPL A;  3EO4 A;  1WK4 A;  3G8W A;  4CAX A;  5DWN A;  1KUV A;  3UY5 A;  2Q4V A;  4YRH A;  1XF8 A;  3B8G A;  4FD6 A;  3FYN A;  1Z9U A;  2VI7 A;  4JWP A;  1KUX A;  3GYA A;  2FSR A;  2R1I A;  2OZH A;  1YR0 A;  2HV2 A;  3QAH A;  3BJ7 A;  3I3G A;  2G3T A;  3D2P A;  3W91 A;  5FVJ A;  2K5T A;  4X5K A;  4AG9 A;  4EVY A;  1PUA A;  2I79 A;  1IYK A;  1RO5 A;  2DXQ A;  4KOR A;  5H84 A;  1M4I A;  3SHP A;  3W6S A;  2R8V A;  1BO4 A;  1Z4E A;  2P0W A;  4ONU A;  3E0K A;  4UBR A;  3PGP A;  4AVC A;  4AVA A;  1TIQ A;  2ZW5 A;  1IB1 E;  2F5I A;  5EBV A;  3DDD A;  2AE6 A;  5F46 A;  1IYL A;  3OWC A;  3TT2 A;  1GHE A;  2KCW A;  3TO7 A;  2Z11 A;  5DWM A;  1M4G A;  2REE A;  1Q2Y A;  2PRB A;  4H6Z A;  2EUI A;  4XNH B;  4AG7 A;  1YK3 A;  4BMH A;  2FIA A;  3R9E A;  3P2F A;  2EVN A;  2GAN A;  3V8I A;  1M4D A;  5HH1 A;  4MY0 A;  1B6B A;  4LUA A;  4XPK A;  5JPH A;  4AB7 A;  2JEV A;  3F5B A;  5J8F A;  4JLY A;  3R9G A;  2ZW4 A;  4PV6 A;  3DR8 A;  2OB0 A;  2VBQ A;  4NXY A;  2C27 A;  3N7Z A;  2JDD A;  1N71 A;  3TO6 A;  1XE4 A;  1MJA A;  1M44 A;  3F0A A;  1YGH A;  4U5Y A;  4PK2 A;  1QSR A;  3NE7 A;  3MGD A;  2Q04 A;  3DSB A;  2CNS A;  1Z4R A;  3TCV A;  3D8P A;  2B5G A;  3GY9 A;  3S6K A;  3W6X A;  4Y49 B;  4YGO A;  4J3G A;  5HMN A;  4L89 A;  4B5O A;  2PQ8 A;  3JVN A;  4JXR A;  4K30 A;  5KTD A;  5KTA A;  3SXN A;  5CNP A;  4KOS A;  4MBU A;  4CRZ B;  4JXQ A;  2J8N A;  1LRZ A;  4KVX A;  3CXP A;  1IID A;  2Q0Y A;  3S6F A;  1YX0 A;  5C82 A;  3P2H A;  2BUE A;  1B87 A;  3ZZI A;  3IGR A;  3PZJ A;  4IUS A;  1QST A;  1VKC A;  1KZF A;  3EC4 A;  5GCN A;  3I9S A;  2OU2 A;  2QIR A;  2VEZ A;  4B5P A;  1L0C A;  1Q2C A;  2ZXV A;  5E96 A;  1K4J A;  2FT0 A;  4PK3 A;  1M1D A;  1I12 A;  1CJW A;  1S5K A;  4KOT A;  2OH1 A;  2FE7 A;  2BEI A;  2VQY A;  3PP9 A;  4R3K A;  2QML A;  2IL4 A;  4ORF A;  4KOU A;  4QC6 A;  2ATR A;  2Y0M A;  4E8O A;  1Y7R A;  3JUW A;  4KLW A;  1YVO A;  3RYO A;  1MJ9 A;  4M85 A;  2PC1 A;  1P0H A;  2FIW A; 
#chains in the Genus database with same CATH topology
 4GM5 A;  4HNW B;  3HUV A;  4NJR A;  5D29 A;  4GXH A;  3SI2 A;  2ZOF A;  2ZOG A;  4OAD A;  2Z10 A;  1XFO A;  2R7H A;  4CGO A;  4CYQ A;  3ZJ0 A;  3NH4 A;  3C26 A;  5JQ4 A;  4M3S A;  4P4D A;  2WPX A;  3EFA A;  1I21 A;  1HDU A;  1S7K A;  4HNY B;  4CGP A;  3WC7 A;  1RTQ A;  4YU9 A;  1ARM A;  4DYO A;  5C88 A;  2ZEM A;  5ISV A;  3HLP A;  3PFO A;  4KLV A;  1MJB A;  3B3C A;  3IWW A;  2D4P A;  3NH5 A;  4NCZ A;  3VH9 A;  2ZW6 A;  3B35 A;  2B58 A;  1CM0 A;  2REF A;  4K3N A;  3DR6 A;  5G22 A;  4A37 A;  1TF9 A;  3CPA A;  4KOX A;  4KOY A;  1S3Z A;  5IB0 A;  1YLE A;  4P10 A;  2C1C A;  3LMS A;  3TE4 A;  4R3L A;  2GU2 A;  4ZYQ A;  3WR7 A;  1S60 A;  1Y9K A;  1ZLH A;  2JEW A;  4FAI A;  4NFR A;  1CX8 A;  1Y9W A;  3I1U A;  2ZED A;  3NH8 A;  4MRI A;  4U9Z A;  4A32 A;  4R57 A;  4OLL A;  2BO9 A;  3PB7 X;  5KTC A;  3CXS A;  2IJZ A;  4MHD A;  2D4O A;  2FXF A;  4W9Y A;  3PB4 X;  3WC6 A;  5F48 A;  2PDO A;  3VWD A;  4EME A;  2R98 A;  2B5G B;  5A28 A;  2HC9 A;  4F0Y A;  4ONW A;  2RB7 A;  4KZT A;  2BSW A;  3SJF A;  4MCQ A;  4CAF A;  4C7I A;  5HVF A;  4QB9 A;  1BLL E;  3KI9 A;  1ZG7 A;  2PR1 A;  3IWG A;  4C2Z A;  1NE9 A;  1IGB A;  2B4B A;  3H8F A;  1CP7 A;  1YVK A;  2EK9 A;  3PB6 X;  4ZY2 A;  1MK4 A;  3TTH A;  4C68 A;  2ZEH A;  3S9N A;  4R76 A;  3S9L A;  3LD2 A;  2GRE A;  4LX9 A;  4KOW A;  2I00 A;  4PSX A;  4KVM E;  2P6E A;  2NSM A;  5LRJ A;  2WSA A;  5LYL A;  2CXA A;  5LYI A;  1RXT A;  4PSW A;  4F9V A;  2VZZ A;  3D66 A;  3D3S A;  4MY3 A;  2CNT A;  2B3U A;  2ZEP A;  3FH4 A;  4F9U A;  2AJ6 A;  2PR8 A;  2OOT A;  5DS0 A;  4F8Z A;  3S6G A;  4H6U A;  2O4H A;  1F2P A;  4QUS A;  4FUU A;  3CT9 A;  1J4J A;  2FCK A;  2G3A A;  2OZG A;  2OR4 A;  2RFH A;  3EY5 A;  2Z0Z A;  4KUB A;  2H5M A;  2YNC A;  4NGR A;  3SXO A;  3ISX A;  4EFD A;  1QMU A;  3BXM A;  1A2Z A;  3TO9 A;  2OZU A;  4OME A;  4B10 A;  2ZPA A;  4MCS A;  2YND A;  2VXK A;  2NMT A;  3MRU A;  3IEH A;  1SQH A;  2P6G A;  3FIX A;  1EE3 P;  2JDC A;  4C7H A;  4P45 A;  4OC3 A;  3D68 A;  2EO8 A;  4OC4 A;  3FB3 A;  1DTD A;  3QAY A;  1NMT A;  2Z3N A;  4CAV A;  1X10 A;  4P4B A;  4XNH C;  4CYO A;  1U6M A;  4R9M A;  4B5P B;  5HVH A;  5K8O A;  4OP4 A;  2Q7B A;  2PSW A;  4P4E A;  4NGP A;  2O28 A;  3JRU A;  3IU1 A;  4OKO A;  2A4N A;  4JJX A;  2Q43 A;  2XEI A;  2J8R A;  3FNC A;  4ZY1 A;  4CRY B;  2X7B A;  1F2O A;  4NF1 A;  3LOD A;  4MHN A;  4B12 A;  1BOB A;  3BJ8 A;  1QSM A;  3PB9 X;  4GS4 A;  1QSN A;  4QBJ A;  3CXQ A;  3KHZ A;  4JZ0 A;  3SJE A;  2Q4Z A;  4NSQ A;  4F0X A;  1BAV A;  4R87 A;  5AGE A;  5LRK A;  3FF3 A;  2B3V A;  2PJ2 A;  2JBJ A;  3R95 A;  1ARL A;  4CAE A;  4KS9 A;  2CY2 A;  3TOB A;  2F7V A;  1XBU A;  3PRT A;  4UWJ A;  1VHE A;  2PJC A;  3KL9 A;  3QNV A;  2PJ1 A;  3K9U A;  5EC4 A;  1AMP A;  2V8G A;  5F47 A;  4KOV A;  4NGT A;  3K9T A;  1BPN A;  3T8W A;  2PVV A;  3KR5 A;  1Z8L A;  2CIJ A;  2HUZ A;  4A94 A;  2QYV A;  3H4Q A;  2C6G A;  3KKW A;  4H89 A;  4II9 A;  5JM6 A;  4MCR A;  1DE4 C;  4C2X A;  5I0C A;  3TOA A;  4MXU A;  3PBE A;  1IOF A;  3BLN A;  3B3T A;  3D2M A;  2PJ7 A;  5G21 A;  5K8N A;  3D7D A;  3R9F A;  1OZP A;  1IIC A;  2ANP A;  2C6C A;  1XIX A;  2FS5 A;  3FVL A;  3PB8 X;  3IO1 A;  2PCU A;  2Q4Y A;  4OC2 A;  4UEF A;  4UF4 A;  4NJQ A;  3RNZ A;  4LQ6 A;  4E2A A;  4YWY A;  1CPS A;  3QB8 A;  4KUA A;  3A9L A;  1Y7E A;  2GE3 A;  3R1K A;  4DJL A;  2EBJ A;  4P4J A;  3GKR A;  3BI0 A;  4NEX A;  3FED A;  2PJ8 A;  2HQY A;  2Z3O A;  4B14 A;  4MJ8 A;  4P44 A;  3H5Z A;  4FD7 A;  2B4D A;  2AFZ A;  3F8K A;  2BL1 A;  1YLO A;  2ZEE A;  3N5F A;  4QVT A;  3KZW A;  4XPD C;  3TFY A;  3FMC A;  3GIU A;  3LAC A;  5IX3 A;  2WPW A;  1P4N A;  4A2Z A;  3FBU A;  2PJ6 A;  3ISZ A;  4OAE A;  3B3W A;  4UEZ A;  4FD5 A;  2QVP A;  5AG7 A;  4RS2 A;  4RN7 A;  1FY7 A;  2P6F A;  1Y0Y A;  4A38 A;  2EWB A;  4BBH A;  4DNC A;  3KAS A;  5F49 A;  4KVO E;  4NGQ A;  4CS0 B;  1CP6 A;  1S7F A;  2AFU A;  4IF5 A;  3IIB A;  4CGM A;  3DLJ A;  1PU9 A;  2XEF A;  4U9Y A;  1VHS A;  4UWI A;  3GUX A;  2Q44 A;  1ON0 A;  2GLF A;  1CBX A;  2FVG A;  4B11 A;  4HKF A;  3FXT A;  4CGL A;  4Q38 A;  2DF5 A;  3T9Y A;  5JGF A;  1PCA A;  1YME A;  5IV0 A;  3CPX A;  4ZX9 A;  1YRE A;  2YNC C;  1FT7 A;  2V77 A;  1R57 A;  2IQ6 A;  2PJ5 A;  4FWU A;  4ZBG A;  2DEA A;  4FD4 A;  3FX6 A;  3WAB A;  3T90 A;  4Y49 C;  1V0C A;  2GIV A;  4F6A A;  2B4D B;  2QEC A;  2RC4 A;  1HDQ A;  4MFZ A;  1YW6 A;  4MCP A;  4Z65 A;  2AFW A;  3KQZ A;  1S7L A;  1UFH A;  4YFJ A;  4RI1 A;  5THW A;  1XMT A;  2JLM A;  4MI4 A;  1S7N A;  2POK A;  1NSL A;  2J8M A;  4R8F A;  3R96 A;  4UEE A;  5AG5 A;  1Q2D A;  4MFL A;  1Y0R A;  3S6H A;  3NE8 A;  3DGV A;  3G3S A;  2VZY A;  1KUY A;  5CBM A;  3IJ3 A;  3RAM A;  3EXN A;  3FRM A;  4WWV A;  1Z8W A;  2FL4 A;  4JD6 A;  1QSO A;  3D67 A;  4LQG A;  4UA3 A;  5BWA B;  1WWZ A;  4A39 A;  3VWE A;  2ZW7 A;  5J8C A;  3JTK A;  4CAW A;  4NGM A;  4I49 A;  2BCO A;  2CNM A;  3PFE A;  4E0A A;  4MFP A;  4NGN A;  4PQA A;  4XPD B;  4ZX8 A;  1I1D A;  2PRQ A;  5H86 A;  3V7Z A;  1XEB A;  3H8G A;  3NFZ A;  1YW4 A;  2G0B A;  2IMO A;  4HNX B;  1XMB A;  3DNS A;  4L8A A;  1NSA A;  4Q7A A;  2ARH A;  4AVB A;  4RUH A;  1JWQ A;  4XPL A;  4KSF A;  8CPA A;  3EO4 A;  1Z8X A;  4A31 A;  1WK4 A;  1Z2L A;  3G8W A;  4CAX A;  3KR4 A;  5DWN A;  1KUV A;  3UY5 A;  2Q4V A;  4YRH A;  2GLJ A;  4UFV A;  1XF8 A;  3B8G A;  4FD6 A;  3PEI A;  4MHY A;  3FYN A;  1Z9U A;  2ODF A;  2VI7 A;  1JQG A;  4JWP A;  1KUX A;  3GYA A;  3IU2 A;  2FSR A;  4TNU A;  3S9M A;  2R1I A;  2OZH A;  1YR0 A;  4X8I A;  2PIY A;  1R43 A;  2HV2 A;  2ZEN A;  4UCP A;  3QAH A;  3BJ7 A;  1KWM A;  3I3G A;  2XEG A;  4P4F A;  1ZO0 A;  5G20 A;  2G3T A;  4UIB A;  2WZN A;  5A27 A;  3D2P A;  3W91 A;  5FVJ A;  2K5T A;  4X5K A;  4AG9 A;  4EVY A;  2V8V A;  1PUA A;  2I79 A;  1IYK A;  1XOV A;  2J9A A;  2PJB A;  2Z3K A;  3SJX A;  1RO5 A;  1OBR A;  2DXQ A;  4HPS A;  4IHM A;  1AYE A;  4KOR A;  2ZEG A;  2Z3L A;  4M6H A;  4DUK A;  5H84 A;  3FEC A;  1CPX A;  2PJ3 A;  4R7M A;  4CYP A;  1M4I A;  1PYT B;  4Q36 A;  4JYW A;  3SHP A;  1TKH A;  1ELM P;  4PXC A;  3W6S A;  2R8V A;  2DPS A;  1BO4 A;  5K8M A;  1Z4E A;  2P0W A;  4MFK A;  4ONU A;  4MFJ A;  7CPA A;  1UWY A;  3E0K A;  2Q7S A;  4UBR A;  5LYF A;  3PGP A;  4AVC A;  4AVA A;  1ELL P;  1TIQ A;  2ZW5 A;  1IB1 E;  5HXD A;  2F5I A;  5EBV A;  2CTB A;  3DDD A;  2AFX A;  2PE3 A;  2AE6 A;  4A30 A;  3B3V A;  5F46 A;  1IYL A;  3OWC A;  3TT2 A;  3B7I A;  4PXB A;  5AG4 A;  1GHE A;  2NYQ A;  2KCW A;  3TO7 A;  1LOK A;  2YNE A;  3K2K A;  4H2K A;  2Z11 A;  4R6T A;  4CYN A;  4OC1 A;  5DWM A;  4CPA A;  1M4G A;  4MMO A;  2REE A;  1Q2Y A;  3LWU A;  1CG2 A;  1LAM A;  2PRB A;  3B3S A;  4H6Z A;  2EUI A;  4IK2 A;  4XNH B;  3B2Y A;  4ZY0 A;  4MHZ A;  4AG7 A;  1YK3 A;  4X2T A;  2ABZ A;  4BMH A;  3V38 A;  2FIA A;  3TX8 A;  5EMI A;  3R9E A;  3D7G A;  1LFW A;  3P2F A;  4EWT A;  2EVN A;  2GAN A;  1YQE A;  1Z5R A;  3V8I A;  1VIX A;  1M4D A;  1FNO A;  5HH1 A;  4MY0 A;  2ZEF A;  4BD9 A;  1B6B A;  3GB0 A;  3FJU A;  5J1Q A;  4A33 A;  1LAN A;  2PVW A;  4LUA A;  4XPK A;  5JPH A;  2PIZ A;  4OC0 A;  1M4L A;  1VGY A;  1R3N A;  3FEE A;  3IWE A;  4AB7 A;  4UCM A;  2JEV A;  3F5B A;  5J8F A;  4JLY A;  3R9G A;  2V8D A;  2ZW4 A;  5JH9 A;  4PV6 A;  2PJA A;  3DR8 A;  4OID A;  2G9D A;  1YSJ A;  1TKF A;  3BI1 A;  3IC1 A;  3KGQ A;  5LYD A;  1BPM A;  2OB0 A;  2VBQ A;  3CDX A;  3BHX A;  4NXY A;  2VL1 A;  2C27 A;  3N7Z A;  2JDD A;  1N71 A;  4MHP A;  3TO6 A;  1QQ9 A;  1XE4 A;  1MJA A;  1M44 A;  4ZI6 A;  3WC5 A;  4MFQ A;  2PJ0 A;  3F0A A;  3WT4 A;  1YGH A;  3IFE A;  4U5Y A;  4PK2 A;  4UFX A;  2EK8 A;  4UCN A;  1QSR A;  4TWE A;  3SI0 A;  2O53 A;  1GYT A;  4PXD A;  1Z8T A;  4UIA A;  3NE7 A;  3MGD A;  3NA6 A;  4BIN A;  2Q04 A;  5LRG A;  3DSB A;  5IB9 A;  2CNS A;  4C2Y A;  2QJ8 A;  4G1P A;  1Z4R A;  3TCV A;  2PJ9 A;  2B5G A;  3D8P A;  5ELY A;  3GY9 A;  3S6K A;  3W6X A;  1IY7 A;  1TF8 A;  4O23 A;  4Y49 B;  4YGO A;  5D8N A;  4J3G A;  2BOA A;  3D7H A;  5HMN A;  4L89 A;  4B5O A;  2PQ8 A;  3JVN A;  3RZA A;  5K8P A;  4KSA A;  1VHO A;  4JXR A;  4K30 A;  5KTD A;  1ZLI A;  4CGN A;  5KTA A;  3TC8 A;  4WJB A;  2WYR A;  4M6G A;  3SXN A;  5CNP A;  4KOS A;  3H8E A;  4MBU A;  4CRZ B;  4JXQ A;  2J8N A;  1LRZ A;  4KVX A;  3CXP A;  1TXR A;  4OC5 A;  1IID A;  1IU8 A;  3RO0 A;  3MN8 A;  2ZEO A;  2GFQ A;  4NGS A;  4PPZ A;  4P4I A;  2PJ4 A;  2Z3M A;  2YGW A;  2Q0Y A;  3SI1 A;  3S6F A;  1YX0 A;  5C82 A;  3P2H A;  2BUE A;  1B87 A;  3ZZI A;  1AUG A;  4B6Z A;  3IGR A;  3PZJ A;  3KQX A;  2V8H A;  4IUS A;  1QST A;  2CTC A;  1VKC A;  1KZF A;  1ZG9 A;  3EC4 A;  5GCN A;  3RBU A;  4P6Y A;  5HVG A;  2JBK A;  3I9S A;  3VAR A;  2WUU A;  1TKJ A;  2OU2 A;  2QIR A;  2C6P A;  4A95 A;  2VEZ A;  4B5P A;  3VAT A;  3GLJ A;  4AXV A;  1L0C A;  2ZEL A;  1Q2C A;  1H8L A;  2ZXV A;  5E96 A;  2AFS A;  1K4J A;  5F09 A;  2FT0 A;  1IOI A;  4PK3 A;  2XEJ A;  4FBE A;  1M1D A;  1LCP A;  1I12 A;  1CJW A;  3L2N A;  1S5K A;  4KOT A;  3D7F A;  2OH1 A;  4IAV A;  1Q7L A;  1X12 A;  2FE7 A;  2DPT A;  2F8H A;  2Q51 A;  1F57 A;  5G1Z A;  1LAP A;  2BEI A;  3CZX A;  4KSI A;  5I4M A;  2VQY A;  3PP9 A;  4R3K A;  4X3R A;  4B13 A;  2QML A;  1HEE A;  2IL4 A;  6CPA A;  4OIW A;  4ORF A;  4KOU A;  3D4U A;  4QC6 A;  4UFW A;  2ATR A;  2Y0M A;  4PXE A;  3SJG A;  2CF4 A;  4E8O A;  1Y7R A;  2Z3P A;  3JUW A;  3KHX A;  5AG6 A;  1XRY A;  4KLW A;  1XJO A;  1YVO A;  3RYO A;  2HB6 A;  1ZG8 A;  1MJ9 A;  2AFO A;  2AFM A;  5CPA A;  2I3C A;  4M6I A;  4ZGY B;  4M85 A;  3PBB A;  2PC1 A;  1P0H A;  2FIW A; 
#chains in the Genus database with same CATH homology
 4HNW B;  4OAD A;  2Z10 A;  4CGO A;  2R7H A;  4CYQ A;  3C26 A;  4M3S A;  2WPX A;  3EFA A;  1I21 A;  1S7K A;  4HNY B;  4CGP A;  5C88 A;  5ISV A;  4KLV A;  1MJB A;  2D4P A;  4NCZ A;  2ZW6 A;  2B58 A;  1CM0 A;  2REF A;  3DR6 A;  5G22 A;  4KOX A;  4KOY A;  1S3Z A;  5IB0 A;  1YLE A;  3TE4 A;  4R3L A;  3WR7 A;  1S60 A;  1Y9K A;  1Y9W A;  4U9Z A;  4A32 A;  4R57 A;  4OLL A;  5KTC A;  3CXS A;  4MHD A;  2D4O A;  2FXF A;  5F48 A;  2PDO A;  3VWD A;  2R98 A;  2B5G B;  5A28 A;  4F0Y A;  4KZT A;  2BSW A;  4CAF A;  4C7I A;  4QB9 A;  2PR1 A;  3IWG A;  4C2Z A;  1NE9 A;  2B4B A;  1YVK A;  3TTH A;  1MK4 A;  4C68 A;  3LD2 A;  4LX9 A;  4KOW A;  2I00 A;  4PSX A;  4KVM E;  2P6E A;  2WSA A;  2CXA A;  1RXT A;  4PSW A;  2VZZ A;  3D3S A;  4MY3 A;  2CNT A;  2B3U A;  2AJ6 A;  2PR8 A;  3S6G A;  4H6U A;  4QUS A;  4KUB A;  1J4J A;  2FCK A;  2G3A A;  2OZG A;  3EY5 A;  3SXO A;  2Z0Z A;  2H5M A;  2YNC A;  3TO9 A;  2OZU A;  4B10 A;  2ZPA A;  2YND A;  2VXK A;  2NMT A;  1SQH A;  2P6G A;  3FIX A;  2JDC A;  4C7H A;  3FB3 A;  1NMT A;  2Z3N A;  4CAV A;  4XNH C;  4CYO A;  1U6M A;  4R9M A;  4B5P B;  2Q7B A;  2PSW A;  2O28 A;  3IU1 A;  2A4N A;  4JJX A;  2J8R A;  3FNC A;  4CRY B;  2X7B A;  4NF1 A;  3LOD A;  4B12 A;  1BOB A;  3BJ8 A;  1QSM A;  4GS4 A;  4QBJ A;  1QSN A;  3CXQ A;  4NSQ A;  4F0X A;  4R87 A;  5AGE A;  2B3V A;  3R95 A;  4CAE A;  4KS9 A;  2CY2 A;  3TOB A;  4UWJ A;  3K9U A;  5EC4 A;  5F47 A;  4KOV A;  2HUZ A;  3H4Q A;  3KKW A;  4H89 A;  4II9 A;  4C2X A;  5I0C A;  3TOA A;  3BLN A;  3D2M A;  5G21 A;  3R9F A;  1OZP A;  1IIC A;  1XIX A;  2FS5 A;  2Q4Y A;  4E2A A;  4KUA A;  3QB8 A;  3A9L A;  2GE3 A;  3R1K A;  3GKR A;  4NEX A;  2HQY A;  2Z3O A;  4B14 A;  4MJ8 A;  3H5Z A;  4FD7 A;  2B4D A;  3F8K A;  4QVT A;  2BL1 A;  3TFY A;  4XPD C;  5IX3 A;  2WPW A;  1P4N A;  4A2Z A;  3FBU A;  3ZJ0 A;  4OAE A;  5AG7 A;  4FD5 A;  4RS2 A;  4DNC A;  1FY7 A;  2P6F A;  4BBH A;  5F49 A;  4KVO E;  4CS0 B;  1S7F A;  4CGM A;  4IF5 A;  1PU9 A;  4U9Y A;  4UWI A;  1VHS A;  2Q44 A;  1ON0 A;  4B11 A;  4HKF A;  3FXT A;  4CGL A;  4Q38 A;  3T9Y A;  5IV0 A;  1YRE A;  2YNC C;  1R57 A;  4ZBG A;  4FD4 A;  3T90 A;  4Y49 C;  1V0C A;  2GIV A;  4F6A A;  2B4D B;  2QEC A;  2RC4 A;  4MFZ A;  1S7L A;  1UFH A;  4YFJ A;  4RI1 A;  1XMT A;  2JLM A;  4MI4 A;  1S7N A;  1NSL A;  2J8M A;  3R96 A;  5AG5 A;  1Q2D A;  4MFL A;  3S6H A;  3G3S A;  2VZY A;  1KUY A;  3EXN A;  3FRM A;  2FL4 A;  4JD6 A;  1QSO A;  4UA3 A;  5BWA B;  1WWZ A;  3VWE A;  2ZW7 A;  5J8C A;  3JTK A;  4CAW A;  4I49 A;  2CNM A;  4E0A A;  4MFP A;  4XPD B;  1I1D A;  5H86 A;  1XEB A;  4HNX B;  2G0B A;  5JQ4 A;  3DNS A;  4L8A A;  2ARH A;  4AVB A;  4XPL A;  4KSF A;  3EO4 A;  4A31 A;  1WK4 A;  3G8W A;  4CAX A;  5DWN A;  1KUV A;  3UY5 A;  2Q4V A;  4YRH A;  4UFV A;  1XF8 A;  3B8G A;  4FD6 A;  3FYN A;  1Z9U A;  2VI7 A;  4JWP A;  1KUX A;  3GYA A;  3IU2 A;  2FSR A;  2R1I A;  2OZH A;  1YR0 A;  2HV2 A;  4UCP A;  3QAH A;  3BJ7 A;  3I3G A;  1ZO0 A;  5G20 A;  2G3T A;  5A27 A;  3D2P A;  3W91 A;  5FVJ A;  2K5T A;  4X5K A;  4AG9 A;  4EVY A;  1PUA A;  2I79 A;  1IYK A;  2Z3K A;  1RO5 A;  2DXQ A;  4KOR A;  2Z3L A;  5H84 A;  4CYP A;  1M4I A;  4Q36 A;  3SHP A;  3W6S A;  2R8V A;  2DPS A;  1BO4 A;  1Z4E A;  2P0W A;  4MFK A;  4ONU A;  4MFJ A;  3E0K A;  4UBR A;  3PGP A;  4AVC A;  4AVA A;  1TIQ A;  2ZW5 A;  1IB1 E;  2F5I A;  5EBV A;  3DDD A;  2AE6 A;  4A30 A;  5F46 A;  1IYL A;  3OWC A;  3TT2 A;  5AG4 A;  1GHE A;  2KCW A;  3TO7 A;  2YNE A;  4CYN A;  2Z11 A;  5DWM A;  1M4G A;  2REE A;  1Q2Y A;  2PRB A;  4H6Z A;  2EUI A;  4XNH B;  4AG7 A;  1YK3 A;  4BMH A;  2FIA A;  3R9E A;  3P2F A;  2EVN A;  2GAN A;  3V8I A;  1M4D A;  5HH1 A;  4MY0 A;  1B6B A;  4A33 A;  4LUA A;  4XPK A;  5JPH A;  3IWE A;  4AB7 A;  4UCM A;  2JEV A;  3F5B A;  5J8F A;  4JLY A;  3R9G A;  2ZW4 A;  4PV6 A;  3DR8 A;  2OB0 A;  2VBQ A;  4NXY A;  2C27 A;  3N7Z A;  2JDD A;  1N71 A;  3TO6 A;  1XE4 A;  1MJA A;  1M44 A;  4MFQ A;  3F0A A;  1YGH A;  4U5Y A;  4PK2 A;  4UFX A;  4UCN A;  1QSR A;  3NE7 A;  3MGD A;  2Q04 A;  3DSB A;  2CNS A;  4C2Y A;  1Z4R A;  3TCV A;  3D8P A;  2B5G A;  3GY9 A;  3S6K A;  3W6X A;  4Y49 B;  4YGO A;  4J3G A;  5HMN A;  4L89 A;  4B5O A;  2PQ8 A;  3JVN A;  4KSA A;  4JXR A;  4K30 A;  5KTD A;  4CGN A;  5KTA A;  3SXN A;  5CNP A;  4KOS A;  4MBU A;  4CRZ B;  4JXQ A;  2J8N A;  1LRZ A;  4KVX A;  3CXP A;  1IID A;  2Z3M A;  2YGW A;  2Q0Y A;  3S6F A;  1YX0 A;  5C82 A;  3P2H A;  2BUE A;  1B87 A;  3ZZI A;  3IGR A;  3PZJ A;  4IUS A;  1QST A;  1VKC A;  1KZF A;  3EC4 A;  5GCN A;  3I9S A;  2WUU A;  2OU2 A;  2QIR A;  4A95 A;  2VEZ A;  4B5P A;  1L0C A;  1Q2C A;  2ZXV A;  5E96 A;  1K4J A;  2FT0 A;  4PK3 A;  1M1D A;  1I12 A;  1CJW A;  1S5K A;  4KOT A;  2OH1 A;  2FE7 A;  2DPT A;  5G1Z A;  2BEI A;  2VQY A;  3PP9 A;  4R3K A;  4B13 A;  2QML A;  2IL4 A;  4ORF A;  4KOU A;  4QC6 A;  4UFW A;  2ATR A;  2Y0M A;  4E8O A;  1Y7R A;  2Z3P A;  3JUW A;  5AG6 A;  4KLW A;  1YVO A;  3RYO A;  1MJ9 A;  4ZGY B;  4M85 A;  2PC1 A;  1P0H A;  2FIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...