4KVME

The nata (naa10p/naa15p) amino-terminal acetyltransferase complex bound to a bisubstrate analog
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit nat1
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase/transferase inhibitor
total genus 44
structure length 153
sequence length 153
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvmE00
3D2MA 2CY2A 1M44A 3ZZIA 1Z4EA 2QMLA 2ZXVA 2PSWA 3P2FA 3FYNA 5C82A 1KUXA 4KVXA 2VZYA 1NMTA 4R57A 4RI1A 3V8IA 4K30A 1P4NA 2Q44A 3OWCA 1RXTA 3R9FA 3T90A 3S6GA 4KOSA 5IX3A 5GCNA 2FSRA 2AJ6A 3T9YA 2REFA 4E2AA 3EY5A 1U6MA 4L89A 4OADA 4YGOA 2Q0YA 4LX9A 1CJWA 4JJXA 2FE7A 1IB1E 1Z9UA 2I79A 2B5GA 5E96A 1YGHA 3TO7A 5I0CA 1YR0A 2G3TA 2Q04A 3VWDA 3EXNA 4PSWA 4FD7A 1MJBA 4IF5A 4KVOE 4M3SA 4CAWA 5FVJA 2R98A 1ON0A 2AE6A 4B5PA 4DNCA 2F5IA 4F6AA 1L0CA 4KLVA 4KUAA 5H84A 4KOUA 4XNHC 1YK3A 2CNTA 5F49A 1I12A 2HUZA 2OZGA 3SXNA 1YX0A 4KZTA 1Q2CA 3CXQA 1I21A 2PR8A 4I49A 4NCZA 4XPDB 4R87A 2P6FA 4BMHA 1LRZA 4ORFA 2HQYA 3W91A 2B3UA 2P0WA 5DWNA 4JLYA 4FD4A 2BSWA 1NE9A 1VHSA 3TE4A 4KVME 2VBQA 3P2HA 1P0HA 4EVYA 4R3LA 3R95A 1Y7RA 4NSQA 1N71A 2Q7BA 3IGRA 5DWMA 3QB8A 2H5MA 2CNMA 1B6BA 1XMTA 4E0AA 1TIQA 4IUSA 3UY5A 4QUSA 2ZW7A 1VKCA 2Q4VA 3K9UA 3R9EA 4B5OA 2BL1A 2VQYA 4GS4A 1KZFA 5HMNA 5HH1A 3I3GA 2O28A 3F8KA 1QSNA 2P6GA 3I9SA 3BJ7A 3B8GA 2PDOA 4AVBA 2JDCA 3VWEA 3CXSA 2FCKA 3GKRA 3TTHA 2PR1A 2D4PA 2ZW4A 4UWIA 2CNSA 1WK4A 1M4DA 3TOBA 3BJ8A 2K5TA 5JPHA 1XIXA 2GANA 4KOVA 4JXQA 4UWJA 1KUYA 4FD6A 2P6EA 3D2PA 1I1DA 2B5GB 4AVCA 2B3VA 2OB0A 2HV2A 1BO4A 3PZJA 4KOTA 4PK3A 2QECA 2Q4YA 4ONUA 3EO4A 2VEZA 4B5PB 4U9YA 1NSLA 4NXYA 2A4NA 4QC6A 3KKWA 1YREA 2R1IA 1J4JA 4JD6A 4KUBA 3D8PA 4HNWB 2I00A 2EUIA 1K4JA 1MK4A 1IYKA 3CXPA 2FXFA 2BEIA 2REEA 1M4GA 1KUVA 2GE3A 3DNSA 4MI4A 1S7KA 4ZBGA 2DXQA 3S6HA 1S7FA 4AG9A 4MY0A 1M4IA 2R7HA 2D4OA 1XEBA 5EC4A 3TFYA 4AB7A 3DSBA 2Z10A 2ZPAA 2J8RA 4NF1A 4X5KA 4FD5A 1M1DA 3TCVA 1IIDA 2FIWA 2JLMA 4MY3A 4PK2A 2B4BA 3FB3A 1S7LA 3GY9A 5CNPA 1IICA 4CAVA 4XNHB 4U5YA 3DR6A 3D3SA 3WR7A 1YVKA 3FBUA 3TO6A 3R1KA 4UA3A 2X7BA 3JVNA 3W6XA 2J8MA 1MJ9A 2ZW5A 1S3ZA 4Y49C 3FNCA 4M85A 4OLLA 3DR8A 4J3GA 3S6KA 3LODA 3G8WA 4AG7A 2FT0A 1S7NA 3ZJ0A 3DDDA 1FY7A 2OH1A 3EC4A 1WWZA 3PGPA 4NEXA 3SXOA 4L8AA 4KOWA 1UFHA 4H6UA 2ZW6A 3C26A 4XPDC 2GIVA 3W6SA 4E8OA 3FIXA 3BLNA 5KTDA 3TOAA 4CAXA 2KCWA 3G3SA 3LD2A 5KTAA 2C27A 2WPWA 4XPKA 1QSOA 1PUAA 3R9GA 5F48A 2R8VA 4HNYB 2JEVA 5F47A 1CM0A 5H86A 2IL4A 4H89A 3QAHA 4R9MA 2OZHA 5ISVA 3R96A 1Y9WA 1Q2YA 2NMTA 4YRHA 1R57A 2VZZA 2G0BA 2EVNA 3H4QA 4Y49B 2ATRA 3F0AA 4QBJA 4KOYA 4R3KA 4CRZB 3NE7A 3SHPA 3RYOA 4H6ZA 1Y9KA 5KTCA 1Z4RA 4JWPA 3IWGA 2G3AA 2FIAA 4CS0B 3FXTA 3GYAA 5JQ4A 1SQHA 3EFAA 3F5BA 2ARHA 5J8CA 1QSRA 2FL4A 4KOXA 4CRYB 1V0CA 1GHEA 5C88A 5EBVA 2Z11A 1YLEA 4OAEA 4F0YA 4HNXB 2WPXA 4XPLA 4MJ8A 2Y0MA 5IV0A 2BUEA 3JUWA 4UBRA 3TT2A 4U9ZA 2B4DA 1QSMA 4QB9A 3S6FA 2PC1A 1OZPA 2OU2A 2B4DB 1RO5A 4KLWA 4RS2A 4AVAA 4MBUA 2J8NA 4MHDA 4II9A 2FS5A 1XF8A 5IB0A 2B58A 1QSTA 1S60A 4JXRA 1BOBA 3N7ZA 4LUAA 3TO9A 2PQ8A 2OZUA 3E0KA 3FRMA 4PSXA 5F46A 1PU9A 4KORA 2Z0ZA 2VXKA 2QIRA 1Q2DA 1S5KA 2JDDA 2PRBA 1MJAA 3PP9A 1YVOA 2VI7A 1XE4A 3MGDA 1B87A 5J8FA 4QVTA 2RC4A 4YFJA 4PV6A 1IYLA 4HKFA
chains in the Genus database with same CATH superfamily
1NSAA 3D2MA 2V8DA 2CY2A 3BI0A 1M44A 2DEAA 4CPAA 3ZZIA 2XEGA 2Q43A 1Z4EA 2QMLA 3WC7A 2Q51A 1Z8WA 2DF5A 3KHXA 3T8WA 1R43A 2PSWA 2ZXVA 3P2FA 2POKA 3B3SA 4CYNA 4Q7AA 3KZWA 3WABA 1XOVA 2IMOA 3SI2A 4ZY0A 4ZY1A 6CPAA 3FYNA 5C82A 1KUXA 2PJAA 1XBUA 2AFWA 4KVXA 2VZYA 4MCRA 1NMTA 3PFOA 1CX8A 2AFMA 2ZEEA 4R57A 4RI1A 4K30A 1P4NA 2Q44A 2RFHA 3OWCA 1YLOA 4NJRA 1RXTA 3R9FA 3KL9A 3T90A 2PJ0A 3S6GA 4KOSA 5IX3A 4GXHA 2FSRA 5GCNA 2GFQA 2ZOFA 5ELYA 2AJ6A 2NSMA 3T9YA 3S9NA 2REFA 4E2AA 3EY5A 1U6MA 2C6CA 3D7DA 4L89A 4OADA 4YGOA 2Q0YA 4LX9A 3V38A 4MFKA 1CJWA 2EO8A 4JJXA 4JZ0A 4MHNA 4A38A 1BPNA 5LRJA 4B10A 2FE7A 1IB1E 4ZX9A 1Z9UA 2I79A 5LRGA 3FEDA 1FT7A 2B5GA 5E96A 1YGHA 2V8HA 3TO7A 4MHPA 5I0CA 1YR0A 2G3TA 2IJZA 2Q04A 3VWDA 3FMCA 3EXNA 4PSWA 1LCPA 4FD7A 1MJBA 4NGSA 4IF5A 4KVOE 2JBKA 4M3SA 3RO0A 5FVJA 4CAWA 5JH9A 2R98A 1ON0A 2AE6A 3B3CA 1CG2A 3RAMA 3PB6X 4B5PA 4DNCA 2F5IA 1QMUA 4F6AA 2OR4A 1YW6A 4UF4A 8CPAA 3FX6A 1L0CA 4KLVA 4KUAA 5H84A 1VHOA 4KOUA 4XNHC 1YK3A 2CNTA 3SI1A 7CPAA 5F49A 4OC1A 5HXDA 4B14A 1I12A 2HUZA 2OZGA 3SXNA 1YX0A 4KZTA 2DPTA 4M6IA 1Q2CA 3CXQA 4PPZA 1H8LA 3IIBA 3VARA 1I21A 4BBHA 3PBBA 2Z3PA 2PR8A 4I49A 4OIDA 1CPXA 4OC3A 5LYDA 5LYLA 1AYEA 1QQ9A 4NCZA 4XPDB 4R87A 4M6GA 2QJ8A 2P6FA 4BMHA 2PJ6A 2V77A 2ZELA 1LRZA 4ORFA 2PVWA 1ELMP 3ISZA 2CTCA 4MFQA 4UFVA 2BOAA 2HQYA 2I3CA 3W91A 2B3UA 1AUGA 2P0WA 5LYIA 3FJUA 3IWEA 5DWNA 1CP7A 4JLYA 4FD4A 4MCSA 5I4MA 3SJFA 4C7IA 2BSWA 1NE9A 1VHSA 1ZG8A 3IC1A 3TE4A 2PJBA 4KVME 2VBQA 3P2HA 3PRTA 1P0HA 4A33A 4EVYA 2IQ6A 4PXDA 4R3LA 3NE8A 3R95A 1Y7RA 4NSQA 1N71A 2Q7BA 3IGRA 5DWMA 3VATA 3QB8A 1JWQA 3BHXA 1GYTA 2BO9A 1LANA 2H5MA 2CNMA 1B6BA 3S9LA 4MHZA 1XMTA 2ZENA 3JRUA 4CYOA 2PCUA 4C2XA 4HPSA 4E0AA 1TIQA 3CPAA 1Y0RA 2GREA 1F57A 1F2OA 3B3WA 3D67A 4IUSA 3KASA 3UY5A 3V7ZA 4QUSA 2ZW7A 1ARLA 4MCQA 1VKCA 2Q4VA 1Z8TA 1BAVA 3K9UA 3R9EA 4A32A 4H2KA 4MXUA 2Z3OA 3D7FA 4B5OA 3LACA 3B3VA 3GB0A 3NH5A 2BL1A 2VQYA 3TX8A 4CGNA 5IB9A 3TC8A 3QAYA 5K8PA 4GS4A 3CPXA 1KZFA 4NGQA 4C2YA 5HMNA 1HDQA 4UCPA 3IO1A 5HH1A 3NH4A 3I3GA 1R3NA 2O28A 4R76A 2V8GA 1IOFA 3WT4A 3F8KA 2PIYA 1QSNA 2P6GA 1IY7A 2ZEDA 3I9SA 4K3NA 1TKFA 3PFEA 3BJ7A 5G20A 3B8GA 3BI1A 3DGVA 2EWBA 2PDOA 4AVBA 2JDCA 4UEFA 3CXSA 3CZXA 4WWVA 3VWEA 2FCKA 4A2ZA 3GKRA 4X2TA 1UWYA 4ZX8A 3TTHA 2PR1A 3IU1A 2D4PA 2CXAA 2ZW4A 4CGPA 5A27A 4UWIA 2CNSA 3RNZA 1WK4A 4Q36A 4CAEA 1M4DA 2PJ2A 4TWEA 5HVFA 3TOBA 4CYQA 4G1PA 3BJ8A 2K5TA 2ZEGA 1Y0YA 2GLJA 5JPHA 2JEWA 4MMOA 1XIXA 2GANA 4KOVA 2AFXA 4UEZA 5AGEA 1YMEA 1Z8LA 5BWAB 4JXQA 5A28A 3D7HA 4UWJA 1KUYA 1YSJA 4FD6A 2P6EA 2XEIA 3D68A 3MRUA 5D8NA 3D2PA 1LFWA 3N5FA 1I1DA 2B5GB 4AVCA 2ANPA 1X12A 2B3VA 4YWYA 2OB0A 2HV2A 4LQ6A 1BO4A 3PZJA 5AG4A 5AG5A 3S9MA 1DTDA 1JQGA 3D7GA 4KOTA 5K8OA 4NJQA 2QECA 4PK3A 4ZGYB 2YNDA 2Q4YA 3WC6A 4ONUA 3EO4A 4ZYQA 2VEZA 4NFRA 4OC0A 5AG6A 4B5PB 4U9YA 1ZG7A 2PJ8A 2F7VA 3L2NA 1ZLIA 2F8HA 3FF3A 5AG7A 1NSLA 2EK9A 3PB4X 4YU9A 1Z2LA 4IHMA 2Z3NA 4NXYA 2A4NA 2CF4A 2ZEFA 1LAMA 4QC6A 3I1UA 3KKWA 1YREA 2R1IA 4WJBA 4OC4A 1J4JA 4JD6A 4KUBA 3D8PA 4R8FA 2PJ9A 4F9UA 2YNCA 2PJCA 1TF9A 4MFZA 1X10A 4HNWB 2I00A 2EUIA 3H8EA 1K4JA 1MK4A 2EK8A 1VIXA 5DS0A 3LWUA 5HVGA 1IYKA 2XEJA 1RTQA 2BEIA 2FXFA 3CXPA 1M4GA 2REEA 3IFEA 2O4HA 4P4FA 5CBMA 3KGQA 2PJ1A 4OMEA 1KUVA 3PEIA 1AMPA 4OIWA 2GE3A 3DNSA 4MI4A 1S7KA 4R7MA 4ZBGA 1CP6A 1Y7EA 3IWWA 4PXEA 4CYPA 3BXMA 2DXQA 3S6HA 1S7FA 4AG9A 4MY0A 1M4IA 2R7HA 4O23A 2WYRA 4P44A 2D4OA 3KQXA 1XEBA 4UIBA 5EC4A 3TFYA 4AB7A 1ZG9A 4CGOA 5J1QA 2V8VA 2PVVA 1VHEA 3DSBA 3D4UA 2Z10A 2OOTA 2VL1A 2ZPAA 4NGRA 2J8RA 4LQGA 4NF1A 1KWMA 4X5KA 4DUKA 4FD5A 1ELLP 1TKJA 4C2ZA 1M1DA 2Z3KA 3TCVA 1IIDA 1XMBA 2FIWA 2JLMA 2O53A 2ZEPA 2B4BA 2J9AA 4MY3A 4PK2A 4MFJA 4W9YA 3FB3A 4F9VA 2PIZA 1S7LA 3GY9A 2WSAA 5CNPA 3SI0A 3B3TA 4GM5A 2HB6A 1IICA 4JYWA 3WC5A 4CAVA 4XNHB 4U5YA 2CTBA 4PXCA 3DR6A 1TXRA 2BCOA 3HLPA 3D3SA 4ZI6A 3JTKA 1YVKA 3WR7A 2PRQA 3FBUA 1DE4C 3K9TA 4IAVA 3TO6A 2C6GA 4A94A 1HDUA 2WUUA 3R1KA 4PQAA 4UA3A 4NGNA 2X7BA 4FUUA 4UCNA 3JVNA 3W6XA 2J8MA 1MJ9A 4P4DA 3KQZA 2ZW5A 4UFXA 1S3ZA 3KR5A 2YNEA 4PXBA 2YNCC 4UIAA 4CGLA 4OC5A 4Y49C 4EMEA 1EE3P 3FNCA 4M85A 4OLLA 4P4BA 4RUHA 3DR8A 4J3GA 3S6KA 3LODA 3SJEA 4OC2A 3SJXA 3G8WA 5JGFA 4AG7A 2FT0A 2C1CA 1S7NA 4EFDA 1XFOA 4MFPA 3ZJ0A 3DDDA 4F0XA 1FY7A 2OH1A 3EC4A 4CGMA 1WWZA 4UCMA 3PGPA 2AFSA 4NEXA 1ZO0A 3SXOA 2QVPA 1TF8A 3NA6A 2PJ7A 4L8AA 2HC9A 4A30A 4KOWA 5K8NA 1OBRA 4P6YA 1UFHA 4TNUA 4H6UA 2ZW6A 1VGYA 3C26A 4XPDC 3A9LA 4A31A 1LAPA 4ZY2A 2GIVA 3W6SA 1XJOA 3B35A 4E8OA 3FIXA 3RZAA 3BLNA 5KTDA 4DJLA 3CT9A 3TOAA 3QNVA 2KCWA 4X3RA 3G3SA 2FVGA 4CAXA 3LD2A 5KTAA 2C27A 2WPWA 4XPKA 1QSOA 4Z65A 1PUAA 2YGWA 3R9GA 5F48A 2GLFA 4P45A 5HVHA 4MRIA 2R8VA 4HNYB 2JEVA 3FEEA 4RN7A 1CM0A 5F47A 1CBXA 3B7IA 3H5ZA 4UEEA 1XRYA 5H86A 4A39A 4KSFA 4EWTA 2IL4A 5JM6A 4BD9A 1IGBA 4H89A 4P10A 3QAHA 4R9MA 2OZHA 2G9DA 2PJ4A 3FECA 4UFWA 3IEHA 4CAFA 5ISVA 3ISXA 3R96A 1Y9WA 3GLJA 1Q2YA 2ZEMA 3KHZA 1BLLE 2NMTA 3MN8A 4YRHA 4B12A 2PJ3A 1R57A 2VZZA 1Q7LA 2G0BA 2EVNA 3SJGA 3H4QA 4Y49B 2ATRA 3F0AA 3NFZA 4FAIA 4QBJA 4KOYA 4R3KA 4DYOA 4BINA 2ZOGA 5G21A 2AFZA 4P4IA 4CRZB 3NE7A 4A37A 4P4EA 3FVLA 3SHPA 3RYOA 4H6ZA 1Y9KA 2Z3MA 4KS9A 5KTCA 4P4JA 1Z4RA 3GUXA 4MCPA 4JWPA 3IWGA 3PBEA 1FNOA 2WZNA 2G3AA 3PB8X 3B2YA 2FIAA 4CS0B 3FXTA 1PCAA 2C6PA 3GYAA 5D29A 4FWUA 1Z5RA 2ODFA 3H8FA 4C7HA 5JQ4A 1SQHA 3EFAA 5G1ZA 3F5BA 4A95A 2ARHA 5J8CA 1QSRA 2FL4A 3H8GA 4AXVA 4KOXA 5CPAA 4CRYB 1V0CA 1GHEA 5C88A 5EBVA 3IJ3A 2Z11A 3RBUA 1YLEA 2AFOA 4OAEA 4F0YA 2PE3A 1PYTB 1BPMA 5LRKA 4HNXB 3LMSA 4NGTA 2WPXA 3DLJA 2EBJA 5F09A 4XPLA 4MJ8A 4KSIA 2Q4ZA 2Y0MA 5IV0A 2BUEA 3JUWA 4UBRA 4MHYA 3TT2A 5K8MA 4U9ZA 5THWA 4B6ZA 3NH8A 2Q7SA 2B4DA 1QSMA 2PJ5A 3FH4A 2PC1A 4M6HA 4QB9A 4Q38A 3S6FA 4B11A 1OZPA 2OU2A 2XEFA 2B4DB 1RO5A 4KLWA 4F8ZA 5G22A 1M4LA 4RS2A 4AVAA 4MBUA 1ZLHA 4ONWA 2J8NA 3VH9A 4MHDA 2DPSA 2RB7A 4II9A 1Z8XA 2FS5A 1XF8A 5IB0A 1YW4A 3CDXA 1YQEA 4NGPA 2B58A 2JBJA 3V8IA 1LOKA 3GIUA 1QSTA 1S60A 4X8IA 4JXRA 2QYVA 1F2PA 1BOBA 4OKOA 2AFUA 3PB9X 3N7ZA 4LUAA 3TO9A 2PQ8A 4OP4A 5LYFA 2OZUA 4B13A 3E0KA 3FRMA 1IU8A 1TKHA 4PSXA 4C68A 1ARMA 5F46A 3PB7X 1PU9A 5EMIA 4NGMA 2Z3LA 4KORA 2Z0ZA 2NYQA 2VXKA 3IU2A 2QIRA 1A2ZA 1Q2DA 3KR4A 1IOIA 1S5KA 3K2KA 2JDDA 2PRBA 4KSAA 4MFLA 4R6TA 1MJAA 3PP9A 1HEEA 1YVOA 2VI7A 3KI9A 4FBEA 1XE4A 3MGDA 2ZEHA 1B87A 4IK2A 2ZEOA 2GU2A 5J8FA 4QVTA 2RC4A 3HUVA 1CPSA 2ABZA 4YFJA 4PV6A 2CIJA 3D66A 1IYLA 4HKFA
chains in the Genus database with same CATH topology
3D2MA 2CY2A 1M44A 3ZZIA 1Z4EA 2QMLA 4CYNA 2ZXVA 2PSWA 3P2FA 3FYNA 5C82A 1KUXA 4KVXA 2VZYA 1NMTA 4R57A 4RI1A 3V8IA 4K30A 1P4NA 2Q44A 3OWCA 1RXTA 3R9FA 3T90A 3S6GA 4KOSA 5IX3A 5GCNA 2FSRA 2AJ6A 3T9YA 2REFA 4E2AA 3EY5A 1U6MA 4L89A 4OADA 4YGOA 2Q0YA 4LX9A 4MFKA 1CJWA 4JJXA 4B10A 2FE7A 1IB1E 1Z9UA 2I79A 2B5GA 5E96A 1YGHA 3TO7A 5I0CA 1YR0A 2G3TA 2Q04A 3VWDA 3EXNA 4PSWA 4FD7A 1MJBA 4IF5A 4KVOE 4M3SA 4CAWA 5FVJA 2R98A 1ON0A 2AE6A 4B5PA 4DNCA 2F5IA 4F6AA 1L0CA 4KLVA 4KUAA 5H84A 4KOUA 4XNHC 1YK3A 2CNTA 5F49A 4B14A 1I12A 2HUZA 2OZGA 3SXNA 1YX0A 4KZTA 2DPTA 1Q2CA 3CXQA 1I21A 4BBHA 2Z3PA 2PR8A 4I49A 4NCZA 4XPDB 4R87A 2P6FA 4BMHA 1LRZA 4ORFA 4MFQA 4UFVA 2HQYA 3W91A 2B3UA 2P0WA 3IWEA 5DWNA 4JLYA 4FD4A 4C7IA 2BSWA 1NE9A 1VHSA 3TE4A 4KVME 2VBQA 3P2HA 1P0HA 4A33A 4EVYA 4R3LA 3R95A 1Y7RA 4NSQA 1N71A 2Q7BA 3IGRA 5DWMA 3QB8A 2H5MA 2CNMA 1B6BA 1XMTA 4CYOA 4C2XA 4E0AA 1TIQA 4IUSA 3UY5A 4QUSA 2ZW7A 1VKCA 2Q4VA 3K9UA 3R9EA 4A32A 2Z3OA 4B5OA 2BL1A 2VQYA 4CGNA 4GS4A 1KZFA 4C2YA 5HMNA 5HH1A 4UCPA 3I3GA 2O28A 3F8KA 1QSNA 2P6GA 3I9SA 3BJ7A 5G20A 3B8GA 2PDOA 4AVBA 2JDCA 3VWEA 3CXSA 2FCKA 4A2ZA 3GKRA 3TTHA 2PR1A 3IU1A 2D4PA 2CXAA 2ZW4A 4CGPA 5A27A 4UWIA 2CNSA 1WK4A 4Q36A 4CAEA 1M4DA 4CYQA 3TOBA 3BJ8A 2K5TA 5JPHA 1XIXA 2GANA 4KOVA 5AGEA 5BWAB 4JXQA 5A28A 4UWJA 1KUYA 4FD6A 2P6EA 3D2PA 1I1DA 2B5GB 4AVCA 2B3VA 2OB0A 2HV2A 1BO4A 3PZJA 5AG4A 5AG5A 4KOTA 4PK3A 2QECA 4ZGYB 2YNDA 2Q4YA 4ONUA 3EO4A 2VEZA 4B5PB 5AG6A 4U9YA 5AG7A 1NSLA 2Z3NA 4NXYA 2A4NA 4QC6A 3KKWA 1YREA 2R1IA 1J4JA 4JD6A 4KUBA 3D8PA 2YNCA 4MFZA 4HNWB 2I00A 2EUIA 1K4JA 1MK4A 1IYKA 3CXPA 2FXFA 2BEIA 2REEA 1M4GA 1KUVA 2GE3A 3DNSA 4MI4A 1S7KA 4ZBGA 4CYPA 2DXQA 3S6HA 1S7FA 4AG9A 4MY0A 1M4IA 2R7HA 2D4OA 1XEBA 5EC4A 3TFYA 4AB7A 4CGOA 3DSBA 2Z10A 2ZPAA 2J8RA 4NF1A 4X5KA 4FD5A 4C2ZA 1M1DA 2Z3KA 3TCVA 1IIDA 2FIWA 2JLMA 4MY3A 4PK2A 2B4BA 4MFJA 3FB3A 1S7LA 3GY9A 2WSAA 5CNPA 1IICA 4CAVA 4XNHB 4U5YA 3DR6A 3D3SA 3JTKA 1YVKA 3WR7A 3FBUA 3TO6A 2WUUA 3R1KA 4UA3A 2X7BA 4UCNA 3JVNA 3W6XA 2J8MA 1MJ9A 2ZW5A 4UFXA 1S3ZA 2YNEA 2YNCC 4CGLA 4Y49C 3FNCA 4M85A 4OLLA 3DR8A 4J3GA 3S6KA 3LODA 3G8WA 4AG7A 2FT0A 1S7NA 4MFPA 3ZJ0A 3DDDA 4F0XA 1FY7A 2OH1A 3EC4A 4CGMA 1WWZA 4UCMA 3PGPA 4NEXA 3SXOA 1ZO0A 4L8AA 4A30A 4KOWA 1UFHA 4H6UA 2ZW6A 3C26A 4XPDC 3A9LA 4A31A 2GIVA 3W6SA 4E8OA 3FIXA 3BLNA 5KTDA 3TOAA 4CAXA 2KCWA 3G3SA 3LD2A 5KTAA 2C27A 2WPWA 4XPKA 1QSOA 1PUAA 2YGWA 3R9GA 5F48A 2R8VA 4HNYB 2JEVA 5F47A 1CM0A 3H5ZA 5H86A 4KSFA 2IL4A 4H89A 3QAHA 4R9MA 2OZHA 4UFWA 4CAFA 5ISVA 3R96A 1Y9WA 1Q2YA 4B12A 2NMTA 4YRHA 1R57A 2VZZA 2G0BA 2EVNA 3H4QA 4Y49B 2ATRA 3F0AA 4QBJA 4KOYA 4R3KA 5G21A 4CRZB 3NE7A 3SHPA 3RYOA 4H6ZA 1Y9KA 2Z3MA 4KS9A 5KTCA 1Z4RA 4JWPA 3IWGA 2G3AA 2FIAA 4CS0B 3FXTA 3GYAA 5JQ4A 4C7HA 1SQHA 3EFAA 5G1ZA 3F5BA 4A95A 2ARHA 5J8CA 1QSRA 2FL4A 4KOXA 4CRYB 1V0CA 1GHEA 5C88A 5EBVA 2Z11A 1YLEA 4OAEA 4F0YA 4HNXB 2WPXA 4XPLA 4MJ8A 2Y0MA 5IV0A 2BUEA 3JUWA 4UBRA 3TT2A 4U9ZA 2B4DA 1QSMA 4QB9A 3S6FA 2PC1A 4B11A 4Q38A 1OZPA 2OU2A 2B4DB 1RO5A 4KLWA 5G22A 4RS2A 4AVAA 4MBUA 2J8NA 4MHDA 2DPSA 4II9A 2FS5A 1XF8A 5IB0A 2B58A 1QSTA 1S60A 4JXRA 1BOBA 3N7ZA 4LUAA 3TO9A 2PQ8A 2OZUA 4B13A 3E0KA 3FRMA 4PSXA 4C68A 5F46A 1PU9A 2Z3LA 4KORA 2Z0ZA 3IU2A 2VXKA 2QIRA 1Q2DA 4MFLA 1S5KA 2JDDA 2PRBA 4KSAA 1MJAA 3PP9A 1YVOA 2VI7A 1XE4A 3MGDA 1B87A 5J8FA 4QVTA 2RC4A 4YFJA 4PV6A 1IYLA 4HKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2M A;  2CY2 A;  1M44 A;  3ZZI A;  1Z4E A;  2QML A;  2ZXV A;  2PSW A;  3P2F A;  3FYN A;  5C82 A;  1KUX A;  4KVX A;  2VZY A;  1NMT A;  4R57 A;  4RI1 A;  3V8I A;  4K30 A;  1P4N A;  2Q44 A;  3OWC A;  1RXT A;  3R9F A;  3T90 A;  3S6G A;  4KOS A;  5IX3 A;  5GCN A;  2FSR A;  2AJ6 A;  3T9Y A;  2REF A;  4E2A A;  3EY5 A;  1U6M A;  4L89 A;  4OAD A;  4YGO A;  2Q0Y A;  4LX9 A;  1CJW A;  4JJX A;  2FE7 A;  1IB1 E;  1Z9U A;  2I79 A;  2B5G A;  5E96 A;  1YGH A;  3TO7 A;  5I0C A;  1YR0 A;  2G3T A;  2Q04 A;  3VWD A;  3EXN A;  4PSW A;  4FD7 A;  1MJB A;  4IF5 A;  4KVO E;  4M3S A;  4CAW A;  5FVJ A;  2R98 A;  1ON0 A;  2AE6 A;  4B5P A;  4DNC A;  2F5I A;  4F6A A;  1L0C A;  4KLV A;  4KUA A;  5H84 A;  4KOU A;  4XNH C;  1YK3 A;  2CNT A;  5F49 A;  1I12 A;  2HUZ A;  2OZG A;  3SXN A;  1YX0 A;  4KZT A;  1Q2C A;  3CXQ A;  1I21 A;  2PR8 A;  4I49 A;  4NCZ A;  4XPD B;  4R87 A;  2P6F A;  4BMH A;  1LRZ A;  4ORF A;  2HQY A;  3W91 A;  2B3U A;  2P0W A;  5DWN A;  4JLY A;  4FD4 A;  2BSW A;  1NE9 A;  1VHS A;  3TE4 A;  4KVM E;  2VBQ A;  3P2H A;  1P0H A;  4EVY A;  4R3L A;  3R95 A;  1Y7R A;  4NSQ A;  1N71 A;  2Q7B A;  3IGR A;  5DWM A;  3QB8 A;  2H5M A;  2CNM A;  1B6B A;  1XMT A;  4E0A A;  1TIQ A;  4IUS A;  3UY5 A;  4QUS A;  2ZW7 A;  1VKC A;  2Q4V A;  3K9U A;  3R9E A;  4B5O A;  2BL1 A;  2VQY A;  4GS4 A;  1KZF A;  5HMN A;  5HH1 A;  3I3G A;  2O28 A;  3F8K A;  1QSN A;  2P6G A;  3I9S A;  3BJ7 A;  3B8G A;  2PDO A;  4AVB A;  2JDC A;  3VWE A;  3CXS A;  2FCK A;  3GKR A;  3TTH A;  2PR1 A;  2D4P A;  2ZW4 A;  4UWI A;  2CNS A;  1WK4 A;  1M4D A;  3TOB A;  3BJ8 A;  2K5T A;  5JPH A;  1XIX A;  2GAN A;  4KOV A;  4JXQ A;  4UWJ A;  1KUY A;  4FD6 A;  2P6E A;  3D2P A;  1I1D A;  2B5G B;  4AVC A;  2B3V A;  2OB0 A;  2HV2 A;  1BO4 A;  3PZJ A;  4KOT A;  4PK3 A;  2QEC A;  2Q4Y A;  4ONU A;  3EO4 A;  2VEZ A;  4B5P B;  4U9Y A;  1NSL A;  4NXY A;  2A4N A;  4QC6 A;  3KKW A;  1YRE A;  2R1I A;  1J4J A;  4JD6 A;  4KUB A;  3D8P A;  4HNW B;  2I00 A;  2EUI A;  1K4J A;  1MK4 A;  1IYK A;  3CXP A;  2FXF A;  2BEI A;  2REE A;  1M4G A;  1KUV A;  2GE3 A;  3DNS A;  4MI4 A;  1S7K A;  4ZBG A;  2DXQ A;  3S6H A;  1S7F A;  4AG9 A;  4MY0 A;  1M4I A;  2R7H A;  2D4O A;  1XEB A;  5EC4 A;  3TFY A;  4AB7 A;  3DSB A;  2Z10 A;  2ZPA A;  2J8R A;  4NF1 A;  4X5K A;  4FD5 A;  1M1D A;  3TCV A;  1IID A;  2FIW A;  2JLM A;  4MY3 A;  4PK2 A;  2B4B A;  3FB3 A;  1S7L A;  3GY9 A;  5CNP A;  1IIC A;  4CAV A;  4XNH B;  4U5Y A;  3DR6 A;  3D3S A;  3WR7 A;  1YVK A;  3FBU A;  3TO6 A;  3R1K A;  4UA3 A;  2X7B A;  3JVN A;  3W6X A;  2J8M A;  1MJ9 A;  2ZW5 A;  1S3Z A;  4Y49 C;  3FNC A;  4M85 A;  4OLL A;  3DR8 A;  4J3G A;  3S6K A;  3LOD A;  3G8W A;  4AG7 A;  2FT0 A;  1S7N A;  3ZJ0 A;  3DDD A;  1FY7 A;  2OH1 A;  3EC4 A;  1WWZ A;  3PGP A;  4NEX A;  3SXO A;  4L8A A;  4KOW A;  1UFH A;  4H6U A;  2ZW6 A;  3C26 A;  4XPD C;  2GIV A;  3W6S A;  4E8O A;  3FIX A;  3BLN A;  5KTD A;  3TOA A;  4CAX A;  2KCW A;  3G3S A;  3LD2 A;  5KTA A;  2C27 A;  2WPW A;  4XPK A;  1QSO A;  1PUA A;  3R9G A;  5F48 A;  2R8V A;  4HNY B;  2JEV A;  5F47 A;  1CM0 A;  5H86 A;  2IL4 A;  4H89 A;  3QAH A;  4R9M A;  2OZH A;  5ISV A;  3R96 A;  1Y9W A;  1Q2Y A;  2NMT A;  4YRH A;  1R57 A;  2VZZ A;  2G0B A;  2EVN A;  3H4Q A;  4Y49 B;  2ATR A;  3F0A A;  4QBJ A;  4KOY A;  4R3K A;  4CRZ B;  3NE7 A;  3SHP A;  3RYO A;  4H6Z A;  1Y9K A;  5KTC A;  1Z4R A;  4JWP A;  3IWG A;  2G3A A;  2FIA A;  4CS0 B;  3FXT A;  3GYA A;  5JQ4 A;  1SQH A;  3EFA A;  3F5B A;  2ARH A;  5J8C A;  1QSR A;  2FL4 A;  4KOX A;  4CRY B;  1V0C A;  1GHE A;  5C88 A;  5EBV A;  2Z11 A;  1YLE A;  4OAE A;  4F0Y A;  4HNX B;  2WPX A;  4XPL A;  4MJ8 A;  2Y0M A;  5IV0 A;  2BUE A;  3JUW A;  4UBR A;  3TT2 A;  4U9Z A;  2B4D A;  1QSM A;  4QB9 A;  3S6F A;  2PC1 A;  1OZP A;  2OU2 A;  2B4D B;  1RO5 A;  4KLW A;  4RS2 A;  4AVA A;  4MBU A;  2J8N A;  4MHD A;  4II9 A;  2FS5 A;  1XF8 A;  5IB0 A;  2B58 A;  1QST A;  1S60 A;  4JXR A;  1BOB A;  3N7Z A;  4LUA A;  3TO9 A;  2PQ8 A;  2OZU A;  3E0K A;  3FRM A;  4PSX A;  5F46 A;  1PU9 A;  4KOR A;  2Z0Z A;  2VXK A;  2QIR A;  1Q2D A;  1S5K A;  2JDD A;  2PRB A;  1MJA A;  3PP9 A;  1YVO A;  2VI7 A;  1XE4 A;  3MGD A;  1B87 A;  5J8F A;  4QVT A;  2RC4 A;  4YFJ A;  4PV6 A;  1IYL A;  4HKF A; 
#chains in the Genus database with same CATH topology
 1NSA A;  3D2M A;  2V8D A;  2CY2 A;  3BI0 A;  1M44 A;  2DEA A;  4CPA A;  3ZZI A;  2XEG A;  2Q43 A;  1Z4E A;  2QML A;  3WC7 A;  2Q51 A;  1Z8W A;  2DF5 A;  3KHX A;  3T8W A;  1R43 A;  2PSW A;  2ZXV A;  3P2F A;  2POK A;  3B3S A;  4CYN A;  4Q7A A;  3KZW A;  3WAB A;  1XOV A;  2IMO A;  3SI2 A;  4ZY0 A;  4ZY1 A;  6CPA A;  3FYN A;  5C82 A;  1KUX A;  2PJA A;  1XBU A;  2AFW A;  4KVX A;  2VZY A;  4MCR A;  1NMT A;  3PFO A;  1CX8 A;  2AFM A;  2ZEE A;  4R57 A;  4RI1 A;  4K30 A;  1P4N A;  2Q44 A;  2RFH A;  3OWC A;  1YLO A;  4NJR A;  1RXT A;  3R9F A;  3KL9 A;  3T90 A;  2PJ0 A;  3S6G A;  4KOS A;  5IX3 A;  4GXH A;  2FSR A;  5GCN A;  2GFQ A;  2ZOF A;  5ELY A;  2AJ6 A;  2NSM A;  3T9Y A;  3S9N A;  2REF A;  4E2A A;  3EY5 A;  1U6M A;  2C6C A;  3D7D A;  4L89 A;  4OAD A;  4YGO A;  2Q0Y A;  4LX9 A;  3V38 A;  4MFK A;  1CJW A;  2EO8 A;  4JJX A;  4JZ0 A;  4MHN A;  4A38 A;  1BPN A;  5LRJ A;  4B10 A;  2FE7 A;  1IB1 E;  4ZX9 A;  1Z9U A;  2I79 A;  5LRG A;  3FED A;  1FT7 A;  2B5G A;  5E96 A;  1YGH A;  2V8H A;  3TO7 A;  4MHP A;  5I0C A;  1YR0 A;  2G3T A;  2IJZ A;  2Q04 A;  3VWD A;  3FMC A;  3EXN A;  4PSW A;  1LCP A;  4FD7 A;  1MJB A;  4NGS A;  4IF5 A;  4KVO E;  2JBK A;  4M3S A;  3RO0 A;  5FVJ A;  4CAW A;  5JH9 A;  2R98 A;  1ON0 A;  2AE6 A;  3B3C A;  1CG2 A;  3RAM A;  3PB6 X;  4B5P A;  4DNC A;  2F5I A;  1QMU A;  4F6A A;  2OR4 A;  1YW6 A;  4UF4 A;  8CPA A;  3FX6 A;  1L0C A;  4KLV A;  4KUA A;  5H84 A;  1VHO A;  4KOU A;  4XNH C;  1YK3 A;  2CNT A;  3SI1 A;  7CPA A;  5F49 A;  4OC1 A;  5HXD A;  4B14 A;  1I12 A;  2HUZ A;  2OZG A;  3SXN A;  1YX0 A;  4KZT A;  2DPT A;  4M6I A;  1Q2C A;  3CXQ A;  4PPZ A;  1H8L A;  3IIB A;  3VAR A;  1I21 A;  4BBH A;  3PBB A;  2Z3P A;  2PR8 A;  4I49 A;  4OID A;  1CPX A;  4OC3 A;  5LYD A;  5LYL A;  1AYE A;  1QQ9 A;  4NCZ A;  4XPD B;  4R87 A;  4M6G A;  2QJ8 A;  2P6F A;  4BMH A;  2PJ6 A;  2V77 A;  2ZEL A;  1LRZ A;  4ORF A;  2PVW A;  1ELM P;  3ISZ A;  2CTC A;  4MFQ A;  4UFV A;  2BOA A;  2HQY A;  2I3C A;  3W91 A;  2B3U A;  1AUG A;  2P0W A;  5LYI A;  3FJU A;  3IWE A;  5DWN A;  1CP7 A;  4JLY A;  4FD4 A;  4MCS A;  5I4M A;  3SJF A;  4C7I A;  2BSW A;  1NE9 A;  1VHS A;  1ZG8 A;  3IC1 A;  3TE4 A;  2PJB A;  4KVM E;  2VBQ A;  3P2H A;  3PRT A;  1P0H A;  4A33 A;  4EVY A;  2IQ6 A;  4PXD A;  4R3L A;  3NE8 A;  3R95 A;  1Y7R A;  4NSQ A;  1N71 A;  2Q7B A;  3IGR A;  5DWM A;  3VAT A;  3QB8 A;  1JWQ A;  3BHX A;  1GYT A;  2BO9 A;  1LAN A;  2H5M A;  2CNM A;  1B6B A;  3S9L A;  4MHZ A;  1XMT A;  2ZEN A;  3JRU A;  4CYO A;  2PCU A;  4C2X A;  4HPS A;  4E0A A;  1TIQ A;  3CPA A;  1Y0R A;  2GRE A;  1F57 A;  1F2O A;  3B3W A;  3D67 A;  4IUS A;  3KAS A;  3UY5 A;  3V7Z A;  4QUS A;  2ZW7 A;  1ARL A;  4MCQ A;  1VKC A;  2Q4V A;  1Z8T A;  1BAV A;  3K9U A;  3R9E A;  4A32 A;  4H2K A;  4MXU A;  2Z3O A;  3D7F A;  4B5O A;  3LAC A;  3B3V A;  3GB0 A;  3NH5 A;  2BL1 A;  2VQY A;  3TX8 A;  4CGN A;  5IB9 A;  3TC8 A;  3QAY A;  5K8P A;  4GS4 A;  3CPX A;  1KZF A;  4NGQ A;  4C2Y A;  5HMN A;  1HDQ A;  4UCP A;  3IO1 A;  5HH1 A;  3NH4 A;  3I3G A;  1R3N A;  2O28 A;  4R76 A;  2V8G A;  1IOF A;  3WT4 A;  3F8K A;  2PIY A;  1QSN A;  2P6G A;  1IY7 A;  2ZED A;  3I9S A;  4K3N A;  1TKF A;  3PFE A;  3BJ7 A;  5G20 A;  3B8G A;  3BI1 A;  3DGV A;  2EWB A;  2PDO A;  4AVB A;  2JDC A;  4UEF A;  3CXS A;  3CZX A;  4WWV A;  3VWE A;  2FCK A;  4A2Z A;  3GKR A;  4X2T A;  1UWY A;  4ZX8 A;  3TTH A;  2PR1 A;  3IU1 A;  2D4P A;  2CXA A;  2ZW4 A;  4CGP A;  5A27 A;  4UWI A;  2CNS A;  3RNZ A;  1WK4 A;  4Q36 A;  4CAE A;  1M4D A;  2PJ2 A;  4TWE A;  5HVF A;  3TOB A;  4CYQ A;  4G1P A;  3BJ8 A;  2K5T A;  2ZEG A;  1Y0Y A;  2GLJ A;  5JPH A;  2JEW A;  4MMO A;  1XIX A;  2GAN A;  4KOV A;  2AFX A;  4UEZ A;  5AGE A;  1YME A;  1Z8L A;  5BWA B;  4JXQ A;  5A28 A;  3D7H A;  4UWJ A;  1KUY A;  1YSJ A;  4FD6 A;  2P6E A;  2XEI A;  3D68 A;  3MRU A;  5D8N A;  3D2P A;  1LFW A;  3N5F A;  1I1D A;  2B5G B;  4AVC A;  2ANP A;  1X12 A;  2B3V A;  4YWY A;  2OB0 A;  2HV2 A;  4LQ6 A;  1BO4 A;  3PZJ A;  5AG4 A;  5AG5 A;  3S9M A;  1DTD A;  1JQG A;  3D7G A;  4KOT A;  5K8O A;  4NJQ A;  2QEC A;  4PK3 A;  4ZGY B;  2YND A;  2Q4Y A;  3WC6 A;  4ONU A;  3EO4 A;  4ZYQ A;  2VEZ A;  4NFR A;  4OC0 A;  5AG6 A;  4B5P B;  4U9Y A;  1ZG7 A;  2PJ8 A;  2F7V A;  3L2N A;  1ZLI A;  2F8H A;  3FF3 A;  5AG7 A;  1NSL A;  2EK9 A;  3PB4 X;  4YU9 A;  1Z2L A;  4IHM A;  2Z3N A;  4NXY A;  2A4N A;  2CF4 A;  2ZEF A;  1LAM A;  4QC6 A;  3I1U A;  3KKW A;  1YRE A;  2R1I A;  4WJB A;  4OC4 A;  1J4J A;  4JD6 A;  4KUB A;  3D8P A;  4R8F A;  2PJ9 A;  4F9U A;  2YNC A;  2PJC A;  1TF9 A;  4MFZ A;  1X10 A;  4HNW B;  2I00 A;  2EUI A;  3H8E A;  1K4J A;  1MK4 A;  2EK8 A;  1VIX A;  5DS0 A;  3LWU A;  5HVG A;  1IYK A;  2XEJ A;  1RTQ A;  2BEI A;  2FXF A;  3CXP A;  1M4G A;  2REE A;  3IFE A;  2O4H A;  4P4F A;  5CBM A;  3KGQ A;  2PJ1 A;  4OME A;  1KUV A;  3PEI A;  1AMP A;  4OIW A;  2GE3 A;  3DNS A;  4MI4 A;  1S7K A;  4R7M A;  4ZBG A;  1CP6 A;  1Y7E A;  3IWW A;  4PXE A;  4CYP A;  3BXM A;  2DXQ A;  3S6H A;  1S7F A;  4AG9 A;  4MY0 A;  1M4I A;  2R7H A;  4O23 A;  2WYR A;  4P44 A;  2D4O A;  3KQX A;  1XEB A;  4UIB A;  5EC4 A;  3TFY A;  4AB7 A;  1ZG9 A;  4CGO A;  5J1Q A;  2V8V A;  2PVV A;  1VHE A;  3DSB A;  3D4U A;  2Z10 A;  2OOT A;  2VL1 A;  2ZPA A;  4NGR A;  2J8R A;  4LQG A;  4NF1 A;  1KWM A;  4X5K A;  4DUK A;  4FD5 A;  1ELL P;  1TKJ A;  4C2Z A;  1M1D A;  2Z3K A;  3TCV A;  1IID A;  1XMB A;  2FIW A;  2JLM A;  2O53 A;  2ZEP A;  2B4B A;  2J9A A;  4MY3 A;  4PK2 A;  4MFJ A;  4W9Y A;  3FB3 A;  4F9V A;  2PIZ A;  1S7L A;  3GY9 A;  2WSA A;  5CNP A;  3SI0 A;  3B3T A;  4GM5 A;  2HB6 A;  1IIC A;  4JYW A;  3WC5 A;  4CAV A;  4XNH B;  4U5Y A;  2CTB A;  4PXC A;  3DR6 A;  1TXR A;  2BCO A;  3HLP A;  3D3S A;  4ZI6 A;  3JTK A;  1YVK A;  3WR7 A;  2PRQ A;  3FBU A;  1DE4 C;  3K9T A;  4IAV A;  3TO6 A;  2C6G A;  4A94 A;  1HDU A;  2WUU A;  3R1K A;  4PQA A;  4UA3 A;  4NGN A;  2X7B A;  4FUU A;  4UCN A;  3JVN A;  3W6X A;  2J8M A;  1MJ9 A;  4P4D A;  3KQZ A;  2ZW5 A;  4UFX A;  1S3Z A;  3KR5 A;  2YNE A;  4PXB A;  2YNC C;  4UIA A;  4CGL A;  4OC5 A;  4Y49 C;  4EME A;  1EE3 P;  3FNC A;  4M85 A;  4OLL A;  4P4B A;  4RUH A;  3DR8 A;  4J3G A;  3S6K A;  3LOD A;  3SJE A;  4OC2 A;  3SJX A;  3G8W A;  5JGF A;  4AG7 A;  2FT0 A;  2C1C A;  1S7N A;  4EFD A;  1XFO A;  4MFP A;  3ZJ0 A;  3DDD A;  4F0X A;  1FY7 A;  2OH1 A;  3EC4 A;  4CGM A;  1WWZ A;  4UCM A;  3PGP A;  2AFS A;  4NEX A;  1ZO0 A;  3SXO A;  2QVP A;  1TF8 A;  3NA6 A;  2PJ7 A;  4L8A A;  2HC9 A;  4A30 A;  4KOW A;  5K8N A;  1OBR A;  4P6Y A;  1UFH A;  4TNU A;  4H6U A;  2ZW6 A;  1VGY A;  3C26 A;  4XPD C;  3A9L A;  4A31 A;  1LAP A;  4ZY2 A;  2GIV A;  3W6S A;  1XJO A;  3B35 A;  4E8O A;  3FIX A;  3RZA A;  3BLN A;  5KTD A;  4DJL A;  3CT9 A;  3TOA A;  3QNV A;  2KCW A;  4X3R A;  3G3S A;  2FVG A;  4CAX A;  3LD2 A;  5KTA A;  2C27 A;  2WPW A;  4XPK A;  1QSO A;  4Z65 A;  1PUA A;  2YGW A;  3R9G A;  5F48 A;  2GLF A;  4P45 A;  5HVH A;  4MRI A;  2R8V A;  4HNY B;  2JEV A;  3FEE A;  4RN7 A;  1CM0 A;  5F47 A;  1CBX A;  3B7I A;  3H5Z A;  4UEE A;  1XRY A;  5H86 A;  4A39 A;  4KSF A;  4EWT A;  2IL4 A;  5JM6 A;  4BD9 A;  1IGB A;  4H89 A;  4P10 A;  3QAH A;  4R9M A;  2OZH A;  2G9D A;  2PJ4 A;  3FEC A;  4UFW A;  3IEH A;  4CAF A;  5ISV A;  3ISX A;  3R96 A;  1Y9W A;  3GLJ A;  1Q2Y A;  2ZEM A;  3KHZ A;  1BLL E;  2NMT A;  3MN8 A;  4YRH A;  4B12 A;  2PJ3 A;  1R57 A;  2VZZ A;  1Q7L A;  2G0B A;  2EVN A;  3SJG A;  3H4Q A;  4Y49 B;  2ATR A;  3F0A A;  3NFZ A;  4FAI A;  4QBJ A;  4KOY A;  4R3K A;  4DYO A;  4BIN A;  2ZOG A;  5G21 A;  2AFZ A;  4P4I A;  4CRZ B;  3NE7 A;  4A37 A;  4P4E A;  3FVL A;  3SHP A;  3RYO A;  4H6Z A;  1Y9K A;  2Z3M A;  4KS9 A;  5KTC A;  4P4J A;  1Z4R A;  3GUX A;  4MCP A;  4JWP A;  3IWG A;  3PBE A;  1FNO A;  2WZN A;  2G3A A;  3PB8 X;  3B2Y A;  2FIA A;  4CS0 B;  3FXT A;  1PCA A;  2C6P A;  3GYA A;  5D29 A;  4FWU A;  1Z5R A;  2ODF A;  3H8F A;  4C7H A;  5JQ4 A;  1SQH A;  3EFA A;  5G1Z A;  3F5B A;  4A95 A;  2ARH A;  5J8C A;  1QSR A;  2FL4 A;  3H8G A;  4AXV A;  4KOX A;  5CPA A;  4CRY B;  1V0C A;  1GHE A;  5C88 A;  5EBV A;  3IJ3 A;  2Z11 A;  3RBU A;  1YLE A;  2AFO A;  4OAE A;  4F0Y A;  2PE3 A;  1PYT B;  1BPM A;  5LRK A;  4HNX B;  3LMS A;  4NGT A;  2WPX A;  3DLJ A;  2EBJ A;  5F09 A;  4XPL A;  4MJ8 A;  4KSI A;  2Q4Z A;  2Y0M A;  5IV0 A;  2BUE A;  3JUW A;  4UBR A;  4MHY A;  3TT2 A;  5K8M A;  4U9Z A;  5THW A;  4B6Z A;  3NH8 A;  2Q7S A;  2B4D A;  1QSM A;  2PJ5 A;  3FH4 A;  2PC1 A;  4M6H A;  4QB9 A;  4Q38 A;  3S6F A;  4B11 A;  1OZP A;  2OU2 A;  2XEF A;  2B4D B;  1RO5 A;  4KLW A;  4F8Z A;  5G22 A;  1M4L A;  4RS2 A;  4AVA A;  4MBU A;  1ZLH A;  4ONW A;  2J8N A;  3VH9 A;  4MHD A;  2DPS A;  2RB7 A;  4II9 A;  1Z8X A;  2FS5 A;  1XF8 A;  5IB0 A;  1YW4 A;  3CDX A;  1YQE A;  4NGP A;  2B58 A;  2JBJ A;  3V8I A;  1LOK A;  3GIU A;  1QST A;  1S60 A;  4X8I A;  4JXR A;  2QYV A;  1F2P A;  1BOB A;  4OKO A;  2AFU A;  3PB9 X;  3N7Z A;  4LUA A;  3TO9 A;  2PQ8 A;  4OP4 A;  5LYF A;  2OZU A;  4B13 A;  3E0K A;  3FRM A;  1IU8 A;  1TKH A;  4PSX A;  4C68 A;  1ARM A;  5F46 A;  3PB7 X;  1PU9 A;  5EMI A;  4NGM A;  2Z3L A;  4KOR A;  2Z0Z A;  2NYQ A;  2VXK A;  3IU2 A;  2QIR A;  1A2Z A;  1Q2D A;  3KR4 A;  1IOI A;  1S5K A;  3K2K A;  2JDD A;  2PRB A;  4KSA A;  4MFL A;  4R6T A;  1MJA A;  3PP9 A;  1HEE A;  1YVO A;  2VI7 A;  3KI9 A;  4FBE A;  1XE4 A;  3MGD A;  2ZEH A;  1B87 A;  4IK2 A;  2ZEO A;  2GU2 A;  5J8F A;  4QVT A;  2RC4 A;  3HUV A;  1CPS A;  2ABZ A;  4YFJ A;  4PV6 A;  2CIJ A;  3D66 A;  1IYL A;  4HKF A; 
#chains in the Genus database with same CATH homology
 3D2M A;  2CY2 A;  1M44 A;  3ZZI A;  1Z4E A;  2QML A;  4CYN A;  2ZXV A;  2PSW A;  3P2F A;  3FYN A;  5C82 A;  1KUX A;  4KVX A;  2VZY A;  1NMT A;  4R57 A;  4RI1 A;  3V8I A;  4K30 A;  1P4N A;  2Q44 A;  3OWC A;  1RXT A;  3R9F A;  3T90 A;  3S6G A;  4KOS A;  5IX3 A;  5GCN A;  2FSR A;  2AJ6 A;  3T9Y A;  2REF A;  4E2A A;  3EY5 A;  1U6M A;  4L89 A;  4OAD A;  4YGO A;  2Q0Y A;  4LX9 A;  4MFK A;  1CJW A;  4JJX A;  4B10 A;  2FE7 A;  1IB1 E;  1Z9U A;  2I79 A;  2B5G A;  5E96 A;  1YGH A;  3TO7 A;  5I0C A;  1YR0 A;  2G3T A;  2Q04 A;  3VWD A;  3EXN A;  4PSW A;  4FD7 A;  1MJB A;  4IF5 A;  4KVO E;  4M3S A;  4CAW A;  5FVJ A;  2R98 A;  1ON0 A;  2AE6 A;  4B5P A;  4DNC A;  2F5I A;  4F6A A;  1L0C A;  4KLV A;  4KUA A;  5H84 A;  4KOU A;  4XNH C;  1YK3 A;  2CNT A;  5F49 A;  4B14 A;  1I12 A;  2HUZ A;  2OZG A;  3SXN A;  1YX0 A;  4KZT A;  2DPT A;  1Q2C A;  3CXQ A;  1I21 A;  4BBH A;  2Z3P A;  2PR8 A;  4I49 A;  4NCZ A;  4XPD B;  4R87 A;  2P6F A;  4BMH A;  1LRZ A;  4ORF A;  4MFQ A;  4UFV A;  2HQY A;  3W91 A;  2B3U A;  2P0W A;  3IWE A;  5DWN A;  4JLY A;  4FD4 A;  4C7I A;  2BSW A;  1NE9 A;  1VHS A;  3TE4 A;  4KVM E;  2VBQ A;  3P2H A;  1P0H A;  4A33 A;  4EVY A;  4R3L A;  3R95 A;  1Y7R A;  4NSQ A;  1N71 A;  2Q7B A;  3IGR A;  5DWM A;  3QB8 A;  2H5M A;  2CNM A;  1B6B A;  1XMT A;  4CYO A;  4C2X A;  4E0A A;  1TIQ A;  4IUS A;  3UY5 A;  4QUS A;  2ZW7 A;  1VKC A;  2Q4V A;  3K9U A;  3R9E A;  4A32 A;  2Z3O A;  4B5O A;  2BL1 A;  2VQY A;  4CGN A;  4GS4 A;  1KZF A;  4C2Y A;  5HMN A;  5HH1 A;  4UCP A;  3I3G A;  2O28 A;  3F8K A;  1QSN A;  2P6G A;  3I9S A;  3BJ7 A;  5G20 A;  3B8G A;  2PDO A;  4AVB A;  2JDC A;  3VWE A;  3CXS A;  2FCK A;  4A2Z A;  3GKR A;  3TTH A;  2PR1 A;  3IU1 A;  2D4P A;  2CXA A;  2ZW4 A;  4CGP A;  5A27 A;  4UWI A;  2CNS A;  1WK4 A;  4Q36 A;  4CAE A;  1M4D A;  4CYQ A;  3TOB A;  3BJ8 A;  2K5T A;  5JPH A;  1XIX A;  2GAN A;  4KOV A;  5AGE A;  5BWA B;  4JXQ A;  5A28 A;  4UWJ A;  1KUY A;  4FD6 A;  2P6E A;  3D2P A;  1I1D A;  2B5G B;  4AVC A;  2B3V A;  2OB0 A;  2HV2 A;  1BO4 A;  3PZJ A;  5AG4 A;  5AG5 A;  4KOT A;  4PK3 A;  2QEC A;  4ZGY B;  2YND A;  2Q4Y A;  4ONU A;  3EO4 A;  2VEZ A;  4B5P B;  5AG6 A;  4U9Y A;  5AG7 A;  1NSL A;  2Z3N A;  4NXY A;  2A4N A;  4QC6 A;  3KKW A;  1YRE A;  2R1I A;  1J4J A;  4JD6 A;  4KUB A;  3D8P A;  2YNC A;  4MFZ A;  4HNW B;  2I00 A;  2EUI A;  1K4J A;  1MK4 A;  1IYK A;  3CXP A;  2FXF A;  2BEI A;  2REE A;  1M4G A;  1KUV A;  2GE3 A;  3DNS A;  4MI4 A;  1S7K A;  4ZBG A;  4CYP A;  2DXQ A;  3S6H A;  1S7F A;  4AG9 A;  4MY0 A;  1M4I A;  2R7H A;  2D4O A;  1XEB A;  5EC4 A;  3TFY A;  4AB7 A;  4CGO A;  3DSB A;  2Z10 A;  2ZPA A;  2J8R A;  4NF1 A;  4X5K A;  4FD5 A;  4C2Z A;  1M1D A;  2Z3K A;  3TCV A;  1IID A;  2FIW A;  2JLM A;  4MY3 A;  4PK2 A;  2B4B A;  4MFJ A;  3FB3 A;  1S7L A;  3GY9 A;  2WSA A;  5CNP A;  1IIC A;  4CAV A;  4XNH B;  4U5Y A;  3DR6 A;  3D3S A;  3JTK A;  1YVK A;  3WR7 A;  3FBU A;  3TO6 A;  2WUU A;  3R1K A;  4UA3 A;  2X7B A;  4UCN A;  3JVN A;  3W6X A;  2J8M A;  1MJ9 A;  2ZW5 A;  4UFX A;  1S3Z A;  2YNE A;  2YNC C;  4CGL A;  4Y49 C;  3FNC A;  4M85 A;  4OLL A;  3DR8 A;  4J3G A;  3S6K A;  3LOD A;  3G8W A;  4AG7 A;  2FT0 A;  1S7N A;  4MFP A;  3ZJ0 A;  3DDD A;  4F0X A;  1FY7 A;  2OH1 A;  3EC4 A;  4CGM A;  1WWZ A;  4UCM A;  3PGP A;  4NEX A;  3SXO A;  1ZO0 A;  4L8A A;  4A30 A;  4KOW A;  1UFH A;  4H6U A;  2ZW6 A;  3C26 A;  4XPD C;  3A9L A;  4A31 A;  2GIV A;  3W6S A;  4E8O A;  3FIX A;  3BLN A;  5KTD A;  3TOA A;  4CAX A;  2KCW A;  3G3S A;  3LD2 A;  5KTA A;  2C27 A;  2WPW A;  4XPK A;  1QSO A;  1PUA A;  2YGW A;  3R9G A;  5F48 A;  2R8V A;  4HNY B;  2JEV A;  5F47 A;  1CM0 A;  3H5Z A;  5H86 A;  4KSF A;  2IL4 A;  4H89 A;  3QAH A;  4R9M A;  2OZH A;  4UFW A;  4CAF A;  5ISV A;  3R96 A;  1Y9W A;  1Q2Y A;  4B12 A;  2NMT A;  4YRH A;  1R57 A;  2VZZ A;  2G0B A;  2EVN A;  3H4Q A;  4Y49 B;  2ATR A;  3F0A A;  4QBJ A;  4KOY A;  4R3K A;  5G21 A;  4CRZ B;  3NE7 A;  3SHP A;  3RYO A;  4H6Z A;  1Y9K A;  2Z3M A;  4KS9 A;  5KTC A;  1Z4R A;  4JWP A;  3IWG A;  2G3A A;  2FIA A;  4CS0 B;  3FXT A;  3GYA A;  5JQ4 A;  4C7H A;  1SQH A;  3EFA A;  5G1Z A;  3F5B A;  4A95 A;  2ARH A;  5J8C A;  1QSR A;  2FL4 A;  4KOX A;  4CRY B;  1V0C A;  1GHE A;  5C88 A;  5EBV A;  2Z11 A;  1YLE A;  4OAE A;  4F0Y A;  4HNX B;  2WPX A;  4XPL A;  4MJ8 A;  2Y0M A;  5IV0 A;  2BUE A;  3JUW A;  4UBR A;  3TT2 A;  4U9Z A;  2B4D A;  1QSM A;  4QB9 A;  3S6F A;  2PC1 A;  4B11 A;  4Q38 A;  1OZP A;  2OU2 A;  2B4D B;  1RO5 A;  4KLW A;  5G22 A;  4RS2 A;  4AVA A;  4MBU A;  2J8N A;  4MHD A;  2DPS A;  4II9 A;  2FS5 A;  1XF8 A;  5IB0 A;  2B58 A;  1QST A;  1S60 A;  4JXR A;  1BOB A;  3N7Z A;  4LUA A;  3TO9 A;  2PQ8 A;  2OZU A;  4B13 A;  3E0K A;  3FRM A;  4PSX A;  4C68 A;  5F46 A;  1PU9 A;  2Z3L A;  4KOR A;  2Z0Z A;  3IU2 A;  2VXK A;  2QIR A;  1Q2D A;  4MFL A;  1S5K A;  2JDD A;  2PRB A;  4KSA A;  1MJA A;  3PP9 A;  1YVO A;  2VI7 A;  1XE4 A;  3MGD A;  1B87 A;  5J8F A;  4QVT A;  2RC4 A;  4YFJ A;  4PV6 A;  1IYL A;  4HKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...