4KVNH

Crystal structure of fab 39.29 in complex with influenza hemagglutinin a/perth/16/2009 (h3n2)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
225
structure length
216
Chain Sequence
VQLVESGGGVVQPGKSPRLSCAASGSSYAVHWVRQAPGKGLEWVTLISYDGANQYYADSVKGRFTISRDNSKNTVYLQMNSLRPEDTAVYYCAVPGPVFGIFPPWSYFDNWGQGILVTVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title A Novel In vivo Human Plasmablast Enrichment Technique Allows Rapid Identification of Therapeutic Anti-Influenza A Antibodies
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 40
structure length 216
sequence length 225
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvnH01
3P4MA 3N1FC 3TBVA 4L3EE 1RZFL 4PLOB 4MA7H 2ED7A 2ZJSL 5GISH 4O2CB 5HYIA 1SBSL 4BFBD 3T65A 2YD9A 3NABH 4IEFB 5HGHB 3HNVL 3SDAC 5TGBA 1QZ1A 4LPWA 1X5IA 4GMSH 3WFEL 5DDHB 3GSXA 5DEGB 1P69B 1U6AH 1VACA 4HUMB 3VXNA 5LAXA 1T89C 2KQMA 4NO3A 1EAPB 5J11B 1BD2E 4LCUB 4L3CB 3TP4A 4EEEA 1A3RH 2XYCA 2P5WA 1I1FA 1IC7H 2A6IA 2B1HH 5BVPH 1BQHB 4XCNB 5KSUB 4UIKL 2AVGA 1MHEB 4HC1H 5D96C 2J4WH 1HH6B 3NCYS 2R15A 2R39A 2D7QA 2VDPL 3MV7E 4KDVA 1RURL 4Z0BH 2L0DA 4NQEB 4F9LA 4K94L 5FEBA 2E7LC 2FSEB 2E3VA 2BCKA 4UT6H 3VRLF 4QT5B 5L0QB 4P2QE 3IDNB 3CLFL 4NKIH 5C08B 1TQBC 1ROWA 3SE9L 4RWHA 2ZOLA 1ERNA 3LDBB 5A16A 4I3GA 5DSCA 3O4LE 2D7PA 4QXUH 2AJ3A 1L0QA 3P4NB 1HYSD 1INDL 3ZDXE 3O6ML 1OW0C 2DTMH 5D6CB 5GSVB 3V4UL 4YH6A 3C6LB 3ROOB 3WNOA 2B1AL 5I1HH 5BCAA 3S9DB 3VI4E 1ZANH 5D7IF 3EDDA 2LU3A 3RGVC 4XWGL 5C0FA 5LWYH 1T03H 5IGXH 1VPOH 2MHAB 5E8EA 1RUKL 5C2BL 1BJ1J 3HAEB 1AGCB 4U7MA 2IAMA 5IESL 1GZPA 1XZ0A 5HPMB 4M5ZH 4QYOB 3NCJL 5BMFL 5IT2H 1CVSC 1J88A 2WW8A 2DYPB 5EU3A 5F3BB 2QHRH 2PTUA 5ITFB 1H5BC 4MAUH 1I8LA 3MNWA 3B6SB 3F7YA 1BVZA 1CQKA 1HINH 4NCC2 4PGZA 5D7JC 2GUOB 3OXRB 3CAFA 3JWDL 3OKYA 3QUYA 1NMAH 3VXUD 1FC1A 5C09B 1AGDB 2WINB 1FH5H 1CD0A 4WI8A 3LQAC 3MUY1 4IJ3C 3WHE0 3WS3B 1MJJA 3FT2A 1I3GH 1T7XA 2OL3B 2OMBA 4ZUVA 1NQBA 3WE6A 1JGUL 2C3XA 2QSTA 4YXLH 2F58H 4RFOL 2XTJD 5F44A 2LVEA 3FB8A 2PO6D 5SWZD 3S8WA 1UQSB 5SV4A 1M05A 4H8WH 1N8ZA 1OL0A 3WO4C 1H3WM 3MOBH 4KI5F 3HI1A 3S34L 3ZO0A 1M7DA 1FNEB 1FP5A 5KN5B 1FRGH 4ZUWA 5D2NA 1OT1A 3BW9B 1YEEL 2Z35A 1I9EA 5I30L 3MLRL 2VDRL 3OB0K 1RPQA 3K4ZA 4KHTH 5IBUB 5E6ID 5GGRA 2CRYA 1QKZH 2GEEA 1TZHB 4K7PL 3TH2T 3A6CL 2CRIA 4Z8FL 2EXWD 1E4JA 5JO5B 4LSPH 1KENL 3RL2A 4PRPE 3VD7A 4LMQI 2A6KB 4TRPH 4QXWA 2CUMA 3K81A 3FFCE 1CXEA 1KNOA 5A2IH 4P5TC 8CGTA 4O5LH 4RDQF 2C3GA 5IM7A 4L8CA 4IOFC 1OAYL 5TQ0H 5DK2A 4ORGA 3O6KH 1LDSA 4N8VG 1R3JA 4OI9A 4ODTL 3NPSC 1CLOL 2DLIA 4KAQL 2VDOH 2R2BA 4PP2B 5T3XD 1NGXB 5DEFA 3KJ4C 4P23C 1T6WA 4YHKL 3WNPA 4MNQA 4DZ8B 2YMXL 3ZL4L 5J9PB 4QTIH 4M6NH 1AC6A 2VO5A 3P11H 2Y6SD 3MV9E 3QFJA 4MA3B 5ALBL 1GXEA 3NCFB 3VE0A 1PLGH 1QPPA 3O3DB 2I9LB 4ODHH 2LU4A 4IMKA 3QUXC 4Q0XL 1NCTA 3DVNB 4Y16C 1YPZF 3W2DH 2IH3B 5E9DD 4YUEL 3HZMA 3S3JA 3SE8L 3D3VE 4IBLT 4I0PD 1U95A 1TCRA 3K2UH 1IGFL 3ORJA 3QRFM 4WRLA 4Z5RB 3EJJX 4PJ9D 4YZFE 4N90D 2YBRA 3GMQB 2BNRD 5KTEL 2V5RA 3RTQA 3C60C 2OTWB 2R23A 3ROLA 2BC4A 2PTVA 5AWNL 2QQLH 4KQ4H 5ADPH 4F9PA 5INCB 2VE6B 4YHZL 2AI0L 1W2KT 2HMIC 3MRBB 4CDHA 3NA9L 5SWSA 4TTDD 3EGSB 4P2RA 4OF6A 5JMOC 1BVKB 4J3VA 2YD4A 4U2YA 2EDFA 4LHJB 2O5YH 3S98A 3VG9C 2O61A 3X11B 4LSDA 5TDOA 3X14B 2W59A 4NSKB 1MFEH 3BZDA 5DJDA 1KACB 1QACA 5CJXC 3ESVF 3WDHA 3BPLC 3MV8E 3G9AB 4CVUA 3F7QA 2K9UA 5L7XH 1NMCB 1PDKA 5KSBF 1RZJL 3T4AB 3F7VA 3CDFA 5DRNA 1YUHA 5D9SA 1ZA6B 2Y07H 4KZDL 1KXQE 4RAUB 3MA9L 4NQDB 5FGRA 2Z31A 1LDPH 5D2LE 4MXVF 4KUZH 4OM0L 3X3FH 1KIUA 4LSQL 3KYNB 2Q8AL 5C3LD 4PJEB 1FV1A 1FL6A 1K8IA 5F97E 2MCPL 4U7KA 4N0UB 1ZVSA 3QDGB 4UUJA 1ZGLA 5FHAH 5F71A 4E41B 4RFEA 1EXUA 3RWJB 5HXMA 1KC5H 3FQXB 5EIVA 4KTEL 2H8PB 5F7DA 4JZNB 3OAZH 1R3HA 3U0TB 5DJ6B 4U7SA 1R3LA 2V7HA 3PDDA 4AL8L 3VFUA 4HZLB 3BYTA 1A7NL 4G6KH 2JB5L 5D7LD 3SY0B 4G7VH 4ERSH 2X4UA 2ZZUT 4NQVB 1UM6H 5E8NA 4AG4L 3R0MA 4PJXB 4FS0A 1MRFL 4GKSB 1N5YL 3GSOB 4FNLL 5EOTA 4LSSL 3SCMB 2I9TB 2FJGA 2RFXB 3MPCA 2ATPA 1Q8MA 2VUYA 1KIPB 2ADJA 4WFEE 4ZG1A 3DRQA 3QQ3A 1EEUA 4MZ2A 1NPUA 1OAUH 3GO1H 1T5WA 2CLVA 1ZA3A 2VL4A 4NN7B 3QEQA 1FLTX 4ZQKA 3D9AL 1LD9B 4GW1A 5I18H 3ULVH 4NKMA 3FQTB 4X6EA 4HS8H 3UYPA 4JB9H 4C59B 4BFGA 4MD0A 4ODVL 1FORL 2A9NL 4UDTB 1BAFL 1JHLH 5EU6E 2OL3L 5DMGC 4X6BA 3TWCH 3VXPA 2VR9A 5GGVH 1RZ7H 4KKLC 4LLUB 3ZE0F 1U93A 2YC1A 4I3SH 1S7QA 4NQTA 5CZVH 4JFFB 4XTRD 1TTGA 2AK4D 1KELL 1QQDB 2EDWA 1MI5A 2Y5TB 4IRJB 3NTCL 1T7ZA 1HH9B 1K8DA 1DQDL 2AEPL 2CKBL 1KLUB 1UXSB 1AGFA 4KMTH 2IQAB 1ACZA 1XR9A 2DJ4A 1BPVA 3LKSA 1ZVYA 5HGDB 4JQXA 3QIWB 4R2GC 5KS9A 1CYGA 2OCFD 1DBBL 2IH1B 3QIUA 4GW5A 4JO3L 4L9LC 1U8IB 5FDWA 4M1GH 2E8YA 3U7YL 1NGQL 4XAKE 5HHMD 5GS3A 3O81A 4MJID 3CZJA 1MCIA 5IJVB 4L8DB 5BS0D 4G80B 1BWWA 1GZQA 1QRND 2VDLL 5T1DL 1NCAL 2MJWA 1MF2L 5KJRL 4OAWB 3RWCA 4GRLD 5DQJA 5TJWK 4PRBA 1F90H 2XWBB 1KCVL 2PNDA 5KG9A 1WGOA 4XGZA 4P5MB 2JK5B 3RWFB 5C0EB 5LKNA 4PGEA 1MRDL 2DJUA 2B0SL 4E5XB 1CLYL 3T0EE 5ENWA 1LMKA 4QNPE 1XF4A 4OZGF 4PTUA 3LB6C 4G8GA 4C56D 3UXFA 1JHTB 1OTUD 4HBCL 3BEVB 1ETZB 4KROC 3L95B 4HIHA 1WTGT 32C2A 4I3RL 1EO5A 4MX7A 3QYCA 5DRZA 4OJFH 5GRVK 2EDDA 4JFQA 3AREA 3TBYB 1CF8H 1CICA 4PR5B 4ZFOA 1Q1JH 3P9WB 3FQNB 5HYEA 1T80A 3UDWC 1JTPA 4XC1L 4IRSD 3MRGB 2AV1A 4V2CB 3BVNB 5CUSH 2KUTA 3WIHH 3KLSA 4XMPL 1FFOA 4Y4HC 3IFPA 1EFXB 1BEYH 1BQUA 3PWUB 1WFTA 1LK3L 1OGAD 3QSKB 4J6RL 4Y4KA 3REVB 3W9DA 4NRZB 3DXAE 1EUUA 4K7PX 2H2SC 1F4XH 4CN1A 3KPMA 3NIFF 2VLJA 3O3BB 4X6FA 4JKPH 3ARGB 3GKWL 1TITA 4Z7UF 3JVGC 1S9WB 5I1AB 2R1YB 4K8RD 5EZIL 3MV7D 2VZTA 5T1KD 3P0GB 3UJIH 4LIQL 4TVPH 3V6OE 3OJMB 5JUEL 2ZUSA 4ZAKB 2B4CC 2BY0A 1U92A 2XKSA 4WWKC 1UWGH 4DQOL 1N6QH 1H3VA 5ISZB 2EEDA 2FLRT 3MRJB 3FB7B 1IM9B 1OAXH 4X7FC 3MUGB 1DN2A 4OF3A 4EI5C 1E6OL 1G9EA 5IV2B 2IFGA 4FQHB 3NZHL 5IVNA 5F7YC 2HVJA 3P0YL 5JMRA 1NCBH 5SWQB 3V5HB 1JGEA 5I16A 1MJ8L 4Y19D 4GG6F 3SKMA 2YA0A 3Q2CA 1UWEH 2OYPA 4OB5L 1PY4A 3CPLA 5IFHH 5I1EH 5F7HA 2DQJH 4RA3A 1RJZA 2F8VA 4S1RH 3AVEA 1I9IH 1ZT7B 1QLEL 5K59F 1ZLSH 5KOMC 1OY3B 4LRIA 2EDQA 3B9KA 1N64H 1MCKA 4PYHA 4XXCA 3SE4C 5KZCB 4DK3A 1DUZB 1KJ2B 4FQXB 2Q3ZA 3TT1H 2P7TA 4PJ5A 2HLFC 3PWPE 2CH8A 1HQRB 4UAOC 4HUVB 3L3GA 2FLBT 2AKRB 3VXSA 5AYUL 2X40A 4ONFH 2AJUL 3RJDA 3UYRL 3O2DH 4JRWA 4UOJA 1HHKB 2DQCH 3QXAB 3CVIH 1GPOL 3HR5A 3U2SB 1HKLL 2V9RA 1IKNC 3G5VB 2X4PA 4AH2A 4HEPG 4XP4H 4M93C 5MHSE 4R4FH 1DEEA 3SGJA 3H9ZA 4MCZA 5CIPB 1AR1D 3QH3A 4NJAL 2BVPA 1A2YA 4M7ZB 2Q3AA 3N9GH 2JJTA 3MJ7A 1JE6A 1QO3A 3GSNH 1KEGL 1U8HB 4OV5B 4L5FH 1IFHL 1KB9K 3P30H 3OR7B 4HFWA 2NW3A 3S35L 3UZVB 3MLZL 2P42B 3ZSTA 5CJ5A 3HNTH 2VIRB 3CXDH 3WKMH 4LARL 3LV3A 5GGTH 2BSRB 1RY7B 2D03L 1TVBB 4JFYA 1D5IL 5CBAB 1WICA 4N8PA 4MA8L 2DM4A 3V4VH 5M94B 2Y06L 1YYLH 1JV5A 2NX5B 5CJ8A 5F72S 3FQUB 5IQ7L 4HQQL 5J1TC 2XIDA 3IKCA 1JK8B 3R1GH 4RMRA 4PRAB 1GGCL 4KRLB 4P3WA 1CN4A 4J8RB 2XG4A 3KLHD 1MQ8A 4LKCA 4U6HB 3TIEA 4PRPD 5J8OA 3DUSB 4OQ1A 4Y5XC 3MCLH 4H20H 1WSST 1H3TA 4U1KA 4OZFH 5I15H 2J6EL 2EH8H 1FLRH 1NGPH 1J0KA 4R0LA 4XP9H 3O0RH 5TH2A 4YDIH 1DBJH 1P4LA 1G7LA 4NP4H 1S9VA 1N0XL 4PJBA 3VXMA 3LKNA 4ALAH 2YN5A 3LZFH 4ZXBC 3W0WA 1JPGB 3BP7B 3OGCB 1D6VH 4OCRH 4NQXA 5GZNC 1A4KA 1RK1B 1VERA 2GJZB 1E4KC 1CGSH 3D18A 5FK9A 1Q9WA 4I18A 3EO0B 5ICYB 4RGNC 1AY1H 1CFNB 1KIRA 4I0KA 1AGBA 1YN7B 2VQ1A 3PGCA 5M95B 1NDMA 3MV9D 2P8LB 3EYQD 3BE1H 3HPJB 5C0AD 2FBJH 4P3CH 5J3HD 1YNKL 1CFQA 1KPUB 3D25B 5EZLA 4KKNA 2ZOKA 4WWID 1XF5A 3QHFL 4GG8B 3FB5B 1G7PA 4XCCL 5CS7A 1KJVB 3VXUB 2R29L 4YEEA 1FAKT 3WNLA 2XFXA 3HRPA 5D7SH 2Z8VC 1FFNA 3D2UD 4XH2A 2E7HA 4O58L 3RKDC 1AJ7H 3P3YA 1RZ8A 4I2XA 5KSAC 4CMMA 4YPJA 3U0WL 2XTJB 5DD0L 3G6JF 5MEOA 3QAZC 2PO6B 5SWZB 2UV3A 3QUKB 3B2UD 2Q8BH 5EU5A 3DWTA 1NFKA 2MQ0A 4XCEB 3RAJL 4QHMA 1WF5A 3BMWA 3ALXA 2P8PB 5DVLA 4HH9A 4U1SA 3MV8D 4PJ8A 3CFJB 1QBBA 4NBYB 5I17A 3EJYC 5IEKA 3RVVC 4LP5A 2HAZA 1BGXH 1RZFH 5E6IB 3PDGA 5DTFA 4WUKH 3LVEA 5D2NE 1KJMA 2ZJSH 3RNKA 4XNXL 3VH8G 4M8VA 5JOPE 1SBSH 3ZT7A 2VLRA 4FQJL 3MRHA 1JYNA 3HNVH 4H5SB 5TQ2L 4JM2A 5BJTA 3DX8B 5F7FA 2IWGA 1BQSA 2AGJL 2VUOA 1V3LA 2MWCA 2DQEL 3WFEH 2BDNL 4RMVA 1B0WA 2W65A 4K3DL 2PKDA 4WO4B 4RFNB 4WHTA 4WV1A 4ZPVA 4PJIB 3QCVL 5CHNB 1F3RB 2DM2A 1IGTB 1DVFD 5D8JL 2EH7L 2ZKHL 3EAKA 2ZUYA 1DQJA 3MLSL 1QP1A 4OCMC 4U1NA 4XNQA 3UO1L 3ULUL 4J7RA 4N68A 3REWA 3PL6D 2FWOB 4UIKH 1TZGL 4ELMF 3BAEL 3TBSA 3CFBA 5DVNA 4FHBD 2H32H 4MVBD 1EBPA 1SEBB 5HYJD 4M3JA 4MD5B 4QKXB 2VDPH 4PTTB 4AT6A 2VABA 4MNQE 2YD2A 5FF6A 3VWJC 1IGCL 3CLFH 3AGVA 1WC7A 1R5WA 3IDJA 4PY7B 5E24E 3SE9H 5DHVH 3QFJE 4AM0A 4K3JL 1KJ2L 3BOVA 5GS1C 2ICWI 2OBGA 4WFED 3C08L 4YGAB 4I0PB 3MJ6A 4BUGA 1TFHA 3D69B 3DV6B 4KK5C 1INDH 3DI3B 3O6MH 5C70A 2CLRB 4PRIB 4LDLB 4XXDB 3WIFB 2J8UA 2BNRB 3V4UH 3IB4A 3FO9A 1PZUB 5I8KH 2B1AH 3QEHB 3DJ9A 3GGWB 1H8OA 4XWGH 1R5VA 3ZTJH 2H26A 2WWKO 4DGVL 3SBWA 2UWEA 3DGGA 3FOLB 1RUKH 1GOGA 1ED3A 1FGNL 5C2BH 2ZCLL 5IESH 3C5ZB 3PQYA 4Q6IA 4Z7QE 5BMFH 3STBA 3NCBB 3OQ3B 5SWSE 1U8LA 4P2RE 1NDGA 1ORQA 3A67L 3FOMB 5MI0B 1WITA 3J8F7 3AMLA 2Q86B 4OGXL 3TA3D 3KPSD 1WBXA 4K7FA 5J06A 3JWDH 4CN4A 1M6OA 2V5SA 5HI3C 4HGWB 3NGBB 5EPMA 1GC1L 2AJXL 4APQA 4NKDA 4YK4B 1OP3H 2W9LA 4IOIA 4K3GA 4P2CG 5DR5H 2NYYC 4XAKD 4RRPG 3C5JA 1MUJA 1JGUH 4W4OA 4RFOH 4X6CF 1N59A 4M6OL 1GGUA 2XY2A 1U8PA 4F33B 5IR1A 2FEEI 4PJCB 1YN6A 3C5SA 5CFHA 3MMEB 1NCWL 1OQXA 4GH7B 5DI8B 3GM0A 2D7MA 3CX5J 1A7RL 1Y6KR 4TNVF 1AXSA 4JN1L 3S34H 5J12B 2ZUWA 4LASL 4KU1A 4ZO9A 2CSPA 4ZDHA 3T0ED 1YEEH 5D1ZB 3HHRB 5F7MC 3MLRH 5I30H 4TSAL 3ZDYE 4KV5E 4K7PH 1NFDF 3A6CH 1CDYA 4Z8FH 5D7LB 4LLWA 1C5BL 2A74B 4BH8A 4HJ0D 4P9ML 5F7EL 5L9DL 3HS0A 5B39B 3K7UA 4OCSL 1SYVB 3ARDA 3V6ZA 4GAGL 1BX2B 1MHCA 1KENH 3JWOH 4FP8L 4Y2OA 3VD3A 1X4YA 3GJFK 2ZCKL 4RNRB 3BHBB 3TPKA 2YPVL 1A7QH 4RMTA 3ULVE 3LKOA 1D5XB 1J86A 4PD4J 5FM5O 4ODTH 3QEQE 4A6YB 1VFUA 1CLOH 1HI6B 4KAQH 4MD4B 4WW2A 2FCBA 3HE6A 1UH4A 5LGJA 3I6KA 3DXAD 4YHKH 1XF1A 1CZ8L 5D6DC 1FNHA 2YMXH 1Z9LA 1UCTA 2D0GA 3ZL4H 5I6XB 2ZCHL 3S4SB 4IDJL 2X4RA 1C08A 1CFBA 1S5IL 5ALBH 2AK4B 3CVHL 1A6AA 4PJFA 3QDMA 4OLXL 2VZ3A 1UB5A 3WMSA 3WSQL 4JFDA 4Q0XH 1S7UB 4OBRA 4OI8A 3DIFB 4YUEH 5D5MB 3WL9B 4JFOB 3SE8H 1BREA 1MI5E 5HVWA 5FUCE 1E27A 1IGFH 2XKNA 4LL9A 4NUJB 3IU3B 5C0BD 2IANA 1C8PA 1LNUB 2EKJA 4O2CA 1BFVL 4XAWL 4Y2DD 5JPMA 1GOFA 5KTEH 3PWNB 5KS9E 5HDOA 1QSFD 4NZDA 4I4WB 1UB6A 4KGJA 5AWNH 1DSFH 1WFOA 4LCYB 5HHMB 1UZ8B 4MJIB 1ZHNB 2AI0H 2HTKC 4KGLA 4Y0GA 4HPYH 5DEGA 3NA9H 4U6XB 3ARBC 1GIGL 1E6JL 3PWJB 4GRLB 3MJ9L 4LCUA 4L3CA 4PGDB 2XWJB 4MA1B 1YEGL 3P9LA 4MJ6B 4PRHB 5EBLB 2GSIB 5HBBA 4QRPB 4XCNA 5KSUA 3IFLL 2ZSWB 3MR9B 1MHEA 3VA6A 4FQIH 1HH6A 4ZUSB 1CU4L 5T3XL 3P77B 4C56B 3A6OA 3MRFB 5CSBA 1JNHB 2YPLB 5KOVC 4NQEA 2QADD 5EBWB 2FSEA 4CU8A 1RZJH 4J4PD 4QT5A 4KKBC 1ZLUH 4G8GE 3IDNA 4KZDH 5C08A 3PIQB 3MA9H 2HG5A 4GRWE 4PRNB 1S8DB 1WIUA 5E99L 4B7LA 2H41A 3K3QA 4G9DB 4OM0H 3BQUD 3X13B 3P4NA 4LSQH 2C3VB 4KKAC 2Q8AH 2W1NA 3GSQB 4IRSB 5D6CA 5IBTL 2FX8L 5GSVA 2MCPH 1DQQB 3C6LA 4FQPA 4L9DA 5IK3A 3ROOA 5MHSD 5DZOA 4OM1L 4AENB 2NTFB 4MQXC 2WMPA 1I1AC 4HUWB 1OGAB 1EMTH 1TPXC 4KTEH 5GRZA 3MOQA 1RIHH 5EOCJ 2GSGA 3KYOB 1J1OL 1WBZB 4ISVB 4DOHE 4LCCC 4AL8H 3QQ4B 1AGCA 1FZJB 2FJHA 1A7NH 3WNNA 4MLSA 4QYOA 3TF7C 1B88A 3HAEH 3ARXA 2NY2D 4YGVB 1TQBB 1MRFH 4L29B 2DYPA 1FFPB 5F3BA 1N5YH 4DGYL 2Q6WB 5ITFA 4KRPD 3MNVB 4BZ1H 1ZHKA 2P5WD 2EDBA 4ZFFB 4H1LA 1L7TL 2GUOA 3OXRA 1T1WB 1U8MB 3RGHA 1MCJA 5C09A 2E9IA 2WINA 3D9AH 3VXRE 1KTLB 1DQML 2JF1A 1WAAF 4TVPE 5LGKA 2Y4SA 3P9MB 4BZ2L 5E4EC 2OL3A 3P2TA 1EZVY 2EDEA 4BSVB 1MRCL 3DYPA 4I9WE 1FORH 3BIKA 2A9NH 1BAFH 2R0WL 5JXEC 3OKLB 5HGBB 4AY0A 3UX9B 1MJUL 1MREL 3G5ZB 4NO2B 1NGYA 4OD1L 1KELH 2F54A 3E8UL 3X12B 1JPST 3NTCH 1IC4L 3BWAB 4Y19B 2CKBH 1QFWI 5KN5A 3ILPA 2NY5L 2BVUA 3BW9A 3SKNB 2ERJC 5D7JB 5E1AB 4FMKA 3EOAB 1VKXA 3Q6GL 4CRPA 1MH5A 1TZHA 4OD3H 3EFDL 2ADFH 4P4RA 3PABB 4GSDL 5EO1B 3HC4L 3KPLB 5GGQL 5JO5A 1DBBH 1MVFA 4Q6YA 3OB0H 5C0JB 4UIMB 1CXIA 2IAMD 4UI2A 1SYSA 2A6KA 1NGQH 2CD0A 3U7YH 3MACL 1FCCA 1XCTA 4PJ5E 3EO1A 3OTTA 1KXTB 5T1DH 1NCAH 1MF2H 3BKYH 3VXSE 5KJRH 1V7NL 4DEPB 1IQDB 3Q5TA 1T0NB 3ZKNC 1V3KA 3GBNL 1KCVH 3MV11 3QUYD 1B4RA 5CJOL 2MFNA 2JB6B 3RVVD 1NGXA 4NO0A 1MRDH 3UTZB 3CUPA 2NY4D 1BZ7A 5J9PA 4NCDA 1I3VA 3DHMA 1NAMB 4HBCH 3VFWA 4HF5L 1JF6A 1S78D 1YEJL 3O3DA 2I9LA 4QOKD 3UPRB 2DBLH 3BDBA 1D5ZB 4Q7DA 4I3RH 3DVNA 2ZG2A 4NFBA 2IH3A 1WT5C 4PG2A 4JDVB 2APBA 1WZKA 5J6GB 4Z5RA 4XC1H 1AHWC 4WI4A 4NOFA 5JOPD 1XGUB 2J7LA 2OTWA 3CXHK 3ZKXC 5L2JB 4XMPH 4HJJL 1T83A 1HIMH 5ERWB 2W38A 5EU4B 1LK3H 3KJ4B 3T8XB 4J6RH 5INCA 2VE6A 4Y4FC 3OR6B 2DOCA 1ZWIB 2ATKA 3EGSA 1MFNA 3AAZB 1XR8B 1P5VA 3MFFB 2VB5A 1BVKA 3LEVL 4NGHL 4M8QB 4WTWA 3X11A 3QUXB 3X14A 3GKWH 1TNMA 4DAGL 4NSKA 5BOZG 5IHZA 5C0GA 4PJBE 1LO5B 3VXME 3VFMB 1MIEL 5FYJU 3W0WE 3TVMC 5EZIH 2FATH 4K71C 4LIQH 2KZWA 5JUEH 2CR3A 2NXZD 4MNQD 4X98A 4AK1A 1SMAA 5DK0B 3WDIA 3WHXA 1HXMB 4YDJB 4O9HL 5C0AB 4NQDA 3QUMB 4XPBL 4KK9C 4DQOH 4W81A 3VFVB 2VISB 4CJ0A 2I25N 1A1MA 2QHLA 3KYNA 1N6UA 3BZ4B 2BNQB 2YD7A 4PJEA 1XT5A 3OF6A 4HMDA 4HFUL 1HHHB 1FJ1B 4U05A 2X9YA 3NZHH 4N0UA 3SN6N 1GGTA 2V5MA 3MRNB 2BX5A 3D2UB 3P0YH 3RIAK 4E41A 3RWJA 3BPLB 1MFAL 1MJ8H 2APXA 3FQXA 2H8PA 1UZ6E 4YHPB 1NUNB 3RTQD 1HQ4A 4JZNA 3CSGA 3U0TA 3NH7L 5EBGA 4I2XE 3U82B 4HZLA 4C83A 1QLEH 3ZE2E 1UH2A 3KPTA 4NQVA 5SWSD 1NEUA 4PJXA 4P2RD 4DCQB 4CJ1A 4GKSA 1AD9B 1H3UA 4LCIL 3GSOA 4NCC1 3SCMA 4XVSL 2RFXA 1A9BA 3RUGB 4PJ7F 2VDQL 5AYUH 2AJUH 3SKUD 3UYRH 3IETB 1VFBA 2CDFB 4OCWL 1GPOH 4U6VL 2IGFL 1R5IB 1HKLH 3N1PC 1C1EL 2X10A 1LD9A 3HPLB 2O5ZH 4UZGA 4JRYA 4K8RL 2VQTA 3FQTA 1E28A 3FT4A 3NFSL 4PJHB 4NJAH 1TLKA 3RVWD 1O7VA 3EZJB 5H2BB 1U3ZA 3FRPA 2E8ZA 1KEGH 2VLRE 1UEYA 3L5XL 4UDTA 1IFHH 3PWLB 2ED8A 3O6LL 5FUZL 3S35H 2Z31D 3MLZH 4UDUB 4XMKL 4U3HA 1JPFB 2Y1VA 1RUPL 5DWUL 1Q94A 4JFFA 2H1PL 3GM8A 4OLYL 1W0VB 1DVFB 3IDXL 3SDDC 3T2QA 1QQDA 4LARH 2D03H 2E6QA 4IRJA 1HH9A 1D5IH 5FA3B 4MA8H 2DQFB 1NUFA 4X8JA 1KLUA 2Y06H 1UXSA 2IQAA 3SE3C 5IQ7H 4HQQH 5HYJB 1G7MB 4U1JB 1GGCH 2AJYH 4RQQA 1KYOK 3KYKL 2IH1A 4OT1L 3RL1B 4JPIB 4YHYC 4WNQB 1U8IA 1X5JA 3ZSSA 2AERT 4TSCL 4WHYG 4OZIF 1T66C 4XZUB 2J6EH 1CL7I 1RUQH 4WEMB 3WFCL 5IJVA 4L8DA 4G80A 5IVXF 4ZODA 5GJSL 3LKQA 3QWOA 4OAWA 5ID0A 4QCIB 2AEWA 4CNIB 2ADGB 2XWBA 5KVGL 4M62L 3BRFA 1UC6A 4BKLB 3QEQD 2FX7L 3FTGB 2JK5A 3RWFA 5GS0D 5C0EA 2J8UE 1A1OB 2ZUTA 2APVA 3MRRB 4FZ8L 1H0DA 2QR0B 2YSSA 5ESVB 5K93A 3GSUB 5DQDL 3DMMD 3SEPA 1OSPL 1JHTA 4WJ5B 3BEVA 3MRKB 1ETZA 4M9PA 2UWEE 2EE9A 5DHYA 4X7CC 5JZ7C 1NAML 4L9LB 4ZFZB 3ULSA 5CP3A 4WUUD 4JHWL 1RAMA 3TBYA 2AJSL 2NW2B 4DKEL 4PR5A 3H3KA 2HTKD 1J0IA 2XACC 3KPSB 1FSKB 1OPGL 1MI5D 5BV7C 5I73C 1F3JA 3LD8C 1CD9B 4LGSB 4GBXC 2CMRH 2G75B 4XCCH 2R29H 4HK0B 3HC3L 2G60L 3I3BA 4OZGA 2VJXA 3M45A 3H9SB 4O58H 4X6DB 4M6AA 3P4LA 2WWMD 1EFXA 1F2QA 2ENYA 2E6JA 4YAQB 3QIUD 3U0WH 4NRZA 4Z77B 5DD0H 2FL5A 3CSYA 4RCAA 3VI3F 4YJZL 3VMOA 3O3BA 2PW1B 3RAJH 5JR1L 5AZ2L 3ARGA 4UINL 1DDHB 3ME0A 4ESKA 3RWDB 3FO1B 25C8L 2X1WL 4K9EL 1CLCA 1J1XH 3T0EB 1S9WA 2CXGA 5I1AA 3VGDA 5GIRA 5IFAH 4AIXA 1UXWB 4FXKA 4TULL 1OWRM 2M1KA 3STZB 4XNXH 4Y4HB 4ZAKA 5HI4D 2P47B 4FQJH 3L6FB 2JJVA 4JZOB 1MCFA 1QSVA 4OF8A 1CDIA 2MTPA 5TQ2H 5F1NB 5ISZA 2AGJH 1GH7A 3QUML 2DQEH 1ZT1A 3FB7A 3SJVE 4PJGF 3MUGA 2W0KA 3JUYA 1ZHLB 1LE5B 1LWRA 3ARED 4K3DH 1CICD 1FG2A 1OF2B 5IV2A 3O4OC 4FQHA 4ACPA 5E95B 1K3IA 1INQA 3OPZL 2EH7H 2ZKHH 3HB3D 1YNLH 3MLSH 3UO1H 2KDGA 3IKKA 3V5HA 2DICA 4QEGA 3ULUH 4XP5H 2UUDK 1TZGH 3BAEH 3DXAB 1ND0B 3QUZC 2HRLA 4XP1H 1PJ9A 4IMLB 4P2YA 1FVDA 2YPKB 5IHBA 5HI5D 3WNKA 1DUZA 3QO1B 1IGCH 1HQRA 2VLJD 4H88L 2AKRA 4K3JH 1KJ2H 5JA8B 4PJFE 3C08H 3QDME 4JO2L 4E0RA 1HHKA 1V05A 4FQ1L 3QXAA 1JHKL 4GKNB 5F9OL 5DFVD 3K0WA 1AO7B 4EI5B 3U2SA 3G5VA 4OGYL 5C0BB 1MQKL 4FQQB 3E3QC 1NAKL 4Y2DB 2ZSVB 4P4KC 5CIPA 1C12B 5D1QC 1QSFB 2GKIA 4X0KB 3V6OC 1MCQA 2IANE 5E8OB 3GI9L 5CIPH 1L6XA 4I9WD 3HMXL 1BMGA 3P0VL 4FMFA 3KR3L 4DGVH 3OG6B 3OR7A 2GK2A 3D39D 5IWLA 3ZE1F 2VOTA 1FGNH 2NY6C 5JW4R 2VIRA 2Y7QB 1QUNA 1NCNA 3MBEC 1CDHA 2NLJB 2BSRA 2YUZA 1TVBA 3H7BB 5CBAA 1I3RB 2VXVL 1FO0A 1UYWH 2NX5A 4NBZB 4JY5H 1EZVX 3FQUA 5DJ8B 1A9EA 3ZHLA 4GAYB 4DUWA 1NCDL 1JK8A 1PEZA 4JZJC 4PRAA 1KGCE 1WWCA 4J8RA 2UYLB 1IL1B 5DQ9B 4JFED 2RGSA 1GC1H 2EEAA 5HHVL 2AJXH 4RAVA 4U6HA 4F7PB 5CP7B 4NQEE 2X9WA 3DUSA 4RA0C 3D48R 4XBGA 3NMEA 3RY6C 3TNMB 3BQUB 4XVUD 5C08E 1AFVL 4M6OH 4AIZB 5EBMB 1T6VN 1W8NA 3VXSD 3GMLB 1HHJA 1NCWH 5B8CA 1YEHL 5D93C 1VFOA 4WFFD 1A7RH 3V6BR 2EKSB 4BJLA 1JPGA 4JN1H 3BP7A 3M17B 3OGCA 1F58H 1I75A 1RK1A 4LASH 2D4DA 3ZKMD 2GJZA 5ACZB 3NN8A 5ICYA 4TSAH 5TGBB 1CFNA 4KTDL 1X5ZA 1YN7A 4I5BB 5DD5L 3BPNC 4P9MH 2NY2B 5F7EH 4PJAB 1L7IL 2NCMA 3QJHA 3HPJA 4OCSH 3VXNB 5L9DH 2LQRA 2DIJA 4R90L 4GAGH 4LNRB 4Y5XB 2HWZL 3WFBL 2Z9TA 1FL3A 4KRPB 1JYWA 5JIPA 3AS2A 4AYFA 4FP8H 2P5WB 2DD8L 1KG0B 2NTSP 4GG8A 2ZCKH 1UVQA 1RHHB 1DE4B 3FB5A 2H6PA 2VWEC 1N0LA 5GHWH 1RV6X 1F45A 1TCMA 4XPAL 2YPVH 3NA4A 3W5NA 1CFVL 2HKHL 5C09E 4ODXB 4JY4B 4W4NA 1DBAL 2CDEB 4RGNB 5E6ZA 1CZ8H 5SWZA 1KB9J 2ZOLB 3SPVB 3SQOL 3QUKA 2ZCHH 4JFHD 3L1OL 2VLME 4IDJH 3QDJD 4XCEA 1S5IH 3CVHH 3M07A 4JPKL 4OLXH 3WSQH 2P8PA 4PLJC 4MAYC 4QHLB 2DKSA 5DK3A 3CFJA 3K8KA 3VXMD 3GHEL 1NANI 3VDCA 5INDB 2AJZA 2F54E 3JTTB 4YHLH 3H7LA 2JCCF 5DC4B 5GJTL 3PP4L 2IMMA 1HILA 2H3NB 3BP6B 3RX5A 5C0FB 3V0WL 3VWKA 5AUMB 4XAWH 1BFVH 2BHZA 5E8EB 2K7QA 4MB3A 3A6BL 3KPOA 1IEBB 2ILLA 1ORSB 2GTWA 3KAAA 5E0QA 4H5SA 4WEBL 5KSAB 3DX8A 1LO0L 4Z18A 3GIZL 3UTSA 5EU3B 1FIEA 3MJ9A 2BRRL 1I8KA 2N4IA 3KWWA 2WUBL 2HLAB 3MNWB 3SDXF 4WHCA 1GIGH 4WO4A 1E6JH 4G3YL 3MJ9H 3OHXB 5DD1L 4LF3B 1VDGA 4Y5YC 1IGTA 43CAB 1YEGH 1FZOB 3C87A 2MMXA 5HVFB 3QUYB 5EN2A 4BELD 3OB8A 3IDIB 3TV3L 3V4PL 2ICWJ 3IFLH 2FWOA 3I3DA 4LVNB 4N0CC 3HRZB 1IEHA 4O2EB 3IYLW 1CU4H 5T3XH 4MD5A 3WKNA 4PTTA 1A0QL 2FGWH 5B38B 4EKXA 1N7ML 4H0GA 2XXCB 3OX8B 4F7MA 5FYKL 2EO1A 3GI8L 4OCNC 4OLWL 4QOKB 5TE6L 4JDTL 2ARJA 5CKGA 1WFNA 3Q5YA 4PY7A 1XGYL 5D1XC 1N8ZB 4H8WC 1VA9A 5E99H 2A6DB 4I0PA 1B0RB 1H9VA 1IBGH 5HDQL 3D69A 3N1QC 3DV6A 4ELMA 2WNGA 1JYXA 1RJLB 2CLRA 4PRIA 4NZTL 4URTB 5IBTH 2Z35B 1RULH 2FX8H 2BNRA 3HCVA 3SDDD 4HULB 2EYRB 1FBIL 1FFQA 4OM1H 4X4YA 3QEHA 3GGWA 5HPOA 3ARFC 2GJ6D 2VLRD 5DGRA 1J1OH 3DVGA 2DQHL 3E1F1 4Q9CA 3EYVB 1KT2A 4JM2D 4OFDA 1RVFL 2HVKB 2D31A 3C5ZA 4QF1B 4JGMA 4QHUB 1MCBA 3VWJB 2WM0A 4OSUL 4Z7VF 1F2XK 3VD5A 3FOMA 3NBNA 4L8CB 3HZVA 5ANMA 4DGYH 1T66D 3MJ8B 1NLBL 2Q86A 1OP5H 3P73B 1R3JB 7FABL 3QWQB 1F11A 1GVIA 2R2BB 3JWNC 1L7TH 4NN6C 2LABA 1KN4L 5DEFB 2EYSB 1BF2A 1DQMH 2NXZB 4HGWA 3MREB 1HDMB 4J3XA 4EUPB 4BZ2H 1G0YR 4HXBL 3VE0B 1GCFA 1MRCH 5F7WC 1MCHA 1D9KC 3MLPA 1IT9L 2R0WH 2XV6B 1A6WH 3ARPA 4NQDE 4U6YB 3EYFB 2K3TA 1TQCC 4F33A 3HZMB 3L5WB 3BZFB 4PJCA 3TN0C 1SJEA 1U95B 5GGRY 4WGVB 3BKMH 3CJJA 3G04B 1JZ8A 4OD1H 3K46A 3E8UH 5BO1H 3WEXB 4PJEE 1K9TA 1IC4H 2YBRB 2DL9A 4N0UE 3QDGE 2NY5H 5ESAB 3ROLB 1FNLA 5A1AA 4ZMAT 2HJFB 4JPWL 5D1ZA 4E41E 5FM4A 3WXWH 4HIEB 4D9QD 3Q6GH 1XCQA 1MCDA 4G6AC 1EFQA 1UFUA 2UZIL 4XPTL 1IMHC 4NRYA 3EFDH 1QD0A 5D7LA 2X1PA 4GSDH 3HC4H 4FFVC 5GGQH 2PF6A 5B39A 2AEQL 1SYVA 2MPAL 3EUUA 1CQYA 3PQYD 3O8XA 4JHAL 1CBVL 4JQVA 4LDEB 2O61B 3BZEA 3MACH 5TDOB 1CGTA 2VR4A 4PJXE 3LH2L 4TQEH 3DSFL 3HG1D 3AB0B 2W9DL 3BHBA 4KZEL 3QEUB 3RI5F 1V7NH 1F4AA 1AI1L 2Q87A 1C5CL 2DWEA 2VMFA 3MXWL 1D5XA 3GBNH 5IBLC 4UILL 1B6UA 3IDUA 1NFDA 3AMKA 3IFNH 5CJOH 4A6YA 4HD9A 1HI6A 3F7VB 4HWBA 4BSJA 5C0IA 1YUHB 5D9SB 1RUAL 1VADB 2ZUVA 1S7SB 2VTFA 3TIDB 1A47A 4APQD 4GLRI 4XT1C 5C86A 2HA1A 3S4SA 4JREC 1A14L 4X9HA 1ZGLP 1BFTA 4HF5H 4RGMC 4KJPC 4HG4K 2AK4A 1YEJH 4PJDF 1HHIB 3RX7A 1S7VB 5MEND 4OF0A 1S7UA 4P99A 5F6IB 4JFFE 3DIFA 2X42A 1ZVSB 3WL9A 4UUJB 3TGXA 5A3ID 4JFOA 1KXVC 1T0PB 4JGUA 1OTSD 4N0FB 4C4KT 1QHOA 2C1OA 3T3ME 5F7NC 1U58B 1YY9D 1OP9A 4I48B 3CFEB 5D7KE 1A21A 4NUJA 3IU3A 3MTRA 4P2OC 3NIGE 3FO2A 4IDLA 1LNUA 5E5UB 4TTGA 1AXTL 4KTYA 4ODBD 5DEZA 1R3LB 3AC0A 5EUOB 1IEAA 3PWNA 2RQ8A 2D2OA 4HJJH 5LJYH 3GSWA 4I4WA 3IGAB 4MQTB 3EDJA 5ESQB 1UZ8A 4B41A 4JO1L 4E42B 5BW7A 1ZHNA 4OGAD 3CLEL 2FJGB 1KCSL 4U6XA 2VDNH 4N1CA 3PWJA 1KTKE 3MX0A 4PGDA 3LEVH 1T1YB 3DTXB 3LPGA 3TT3L 4MJ6A 4PRHA 5EULV 4DAGH 3WV0A 1F4YL 2GSIA 4OUUB 4NKMB 4QRPA 3ULVC 5IJKC 3RZCC 2FEDC 2ZSWA 5DYOB 3WN5C 3MR9A 1CE6B 2XNAB 5TDPB 1XAUA 2F15A 1QFUL 3MRMB 4CADB 3ARWA 3P77A 4C56A 3DMMB 1JNHA 3HE6D 2YPLA 1T21B 1I1YB 3EOTL 3VXPB 5I19L 2F19L 3JV4A 4NNPL 2VITB 3SDAA 3PIQA 4O9HH 3K2MC 4XHJC 4WUUB 3SKOB 1S8DA 2PTTB 1XIWC 2Y9RT 2EIEA 4G9DA 3KPPB 1MI5B 4JFDD 3HC0B 3ARBB 1T89A 2C3VA 4PBXA 1OGTB 3GSQA 5FXCH 4HFUH 5DD6A 3BSZL 3RRQA 4KRMB 1DQQA 5FUCC 1BOGB 4MB5A 3KJ6L 4POZC 1I85C 2ITDB 4AENA 4X7TB 2NTFA 5IMLB 1JF1B 2R1XA 2IAND 4HUWA 3QIUB 5JHLL 4PP1C 3NH7H 4ISVA 1MCOL 5FDWB 3IJYB 3OKOB 2XQYG 4PLKC 2E7LA 1JIBA 1FZJA 5ADOL 1S7RA 4Y1AD 1GZQB 1QTYT 1X4XA 2ZWLT 4YGVA 4LCIH 5DQJB 2Q6WA 5DUML 1G1YA 2OX5A 1JRHL 3MNVA 4XVSH 4BQBA 2V2WA 2VDQH 4NYLB 5KG9B 3LHPL 4D0CB 4Z7WB 35C8L 3BYYA 4OCWH 1OW0A 5EZJB 1T1WA 4U6VH 1U8MA 1C1EH 3FN3A 3RDTC 1EJOL 1KTLA 4K8RH 4LHUB 3VGFA 5F9JB 3UZEA 4PTUB 3NFSH 3LS5L 1I1AB 1WISA 5FV1L 4BSVA 3SQBA 2FD6L 4G8EA 3G5YA 1VGEL 4LQ1A 3L5XH 3IFOB 3NIFE 3U30C 3OKLA 5HGBA 1X5GA 3W39A 3O6LH 3UAJD 5FUZH 3AREB 4XMKH 5ISZE 3G5ZA 4NO2A 1RUPH 5DWUH 2H1PH 2YHGA 4OLYH 1TZIB 3IDXH 3X12A 1P4IH 2A1WL 2Y23A 3TO2B 2EIZB 4XI5C 4Y19A 3DRTB 3ULUE 1NUDA 2NR6D 2A73A 4KVNL 4UTAH 3EHBC 5GXBB 4F7TB 4UQ3A 1U8OB 5D7JA 5E1AA 4IRZH 4HDIB 3U6RB 3EOAA 3QXUA 4X9FA 4FG6C 1HN1A 5K9JL 1KN2L 4P9HL 1PAMA 3E6HB 1UADC 2L7UA 3PABA 5EO1A 1FIGL 1QEWA 3KYKH 4Y4KC 4OT1H 4H26A 3VI4F 3C9NA 4G8FA 4UIMA 5C0JA 1EHXA 4KVCH 2ICEB 2VLJB 4FQ2L 4TSCH 1NFIB 3ARUA 4L4JA 3WFCH 5KSVA 4XBEH 5GJSH 1DZBA 1ZHBB 3VGAC 1IQDA 5CEZE 4WDIB 1T0NA 4CVZB 5FA4A 1MHHB 5KVGH 1X5HA 1IGML 4M62H 4XPFL 5K9QG 1FN4B 3HAEG 2FX7H 1J87A 2JB6A 5EC2B 1KFAL 5IEHB 4FZ8H 5DA0B 3UTZA 2BXYA 4UT7L 1U92B 4LOUC 3D39B 1YECL 2HKFL 5IHUL 1OSPH 2VLMD 1NAMA 4G43B 4P46D 2P1YA 3FCTB 5LBSL 2HT3D 2IBZY 2OZ4A 4ENEC 3L3DA 1NAMH 1D5ZA 1J9CT 4NM4L 5F6HI 5IOPA 5DO2C 4H1LG 1JGDB 3TO4C 1IILE 4JHWH 2HVJB 3O2WL 2AJSH 2F54D 3UEZA 5I1LB 4JDVA 5L8KB 1OPGH 5E70A 5DGQA 4P5TA 4UQ2A 5J6GA 2COQA 3SO3B 4LDOB 5D72H 2NX5E 3HC3H 2G60H 1XGUA 4JFEB 2W60B 1RZKH 1YZZA 4OIAA 1QA9B 5HDBE 5ILTL 3TFKC 5L2JA 3VFOB 4KFZC 3VGEA 5ERWA 1HOCB 5EU4A 3T8XA 2GI7A 3MZGB 1WEJL 4IIQC 1MAJA 1ZWIA 4QRSA 1KCKA 4N5EC 2XWTB 1Z9SA 1HWHB 2R0ZL 3B9KC 3L3GB 2X44D 4KI5D 4KDWA 3MFFA 1R3IL 3JSSA 4M8QA 3UTTA 5JR1H 5AZ2H 3QUXA 3HR5B 4Y16A 4HWEH 1O0VA 4UINH 5IBUG 3RVTC 4AH2B 3LN4B 25C8H 1LO5A 4K9EH 3VFMA 4OFKA 2E5EA 3QH3B 2PW2B 4A2LA 2BVPB 5GS0L 1A2YB 2BNUB 1UM5L 1RK0B 1AHWB 3SGJC 4NO0D 3CH8A 5DMJB 4TULH 1BQLH 1QHPA 4RMWA 1BOYA 3SDCC 5B4MD 3S96B 5KBNC 2DQDL 5DK0A 1HXMA 4YDJA 1CXHA 4M7LT 2CIKA 3CFDA 3DETC 3QUMA 3ARFD 1IZJA 2VL5A 4LVOC 2VKWA 1FVCB 2VISA 1IARB 3EO9L 5LGHL 3LV3B 3QUMH 4Q97A 3BZ4A 2BNQA 3WBDA 1JV5B 1HHHA 3S5LB 1FJ1A 3RVUD 2XT1B 3D2UA 4YBLC 1DFBH 3OPZH 2EXYC 2BY1A 4OLVH 3ARVA 3VXUE 5CJXA 4M7JL 4XNUL 3ES6B 1WTLA 5TE7L 2GHWB 4JKWA 3O3UN 4LKCB 3D0VA 3TVMB 3DVFA 2VAJA 4W70A 1FAIL 4YZFF 4YQXL 4V2BA 2QQQA 4K71B 3QDJB 2XTJE 1NUGA 5FYKU 5SWZE 2A38A 3Q5OA 1P4LB 4DCQA 1KOAA 5JXAL 4UOW0 4MSWA 3RIAF 3RUGA 1D9KD 1JFQL 4MS8D 4JO2H 1ZLVK 2OXHA 2CDFA 1JHKH 5F9OH 1F8TL 3M1BB 1R5IA 1A4KB 4HUXB 4OGYH 3HPLA 1MQKH 4EN3C 3FFDA 1NAKH 3F58L 3D18B 1JWMA 1Q9WB 3K1KC 2OMNA 1G7JB 1CR9L 1AGBB 1H3GA 3RA7L 5H2BA 5C07B 2GCYA 2ITCB 4HX1B 3UYOD 1L9NA 4WU5B 5DS8A 2DQUL 3HMXH 3S97C 1QBML 4XCYB 3P0VH 4ZOAA 3KR3H 4NQDD 4PJ7A 2NY3C 4UDUA 3UTSE 1JPFA 3PF2A 1W0VA 4ZFOL 2KH2B 3OF6D 3EYOA 2FX9L 5CD5C 2NY1C 3QP3A 4PJIE 4OF7A 5D2LF 3O3AB 2AAVA 5FA3A 3T3PE 5IB3B 2VXVH 1KTRL 2UY7A 4N9GA 4LLYA 5GRUL 2C1PB 2DRUA 3MROB 4R6UA 1NCDH 5DUPH 5T3XE 1IC5L 3O9WC 4U1JA 4CMMB 4UMGA 1XGQB 2VYRE 1EGJL 1JZ2A 1A5FL 1EEZB 3RL1A 5HHVH 2A6JB 3LKRB 4QHKJ 3TZVC 4WNQA 4KJYB 3RKPA 3KS0J 4XZUA 1HHGB 5A2FA 1AFVH 4LPTA 1F6FB 4KJPD 4JFZL 3SDDB 4CNIA 1DLHB 1YEHH 2ADGA 4S1DC 4MXQC 4PJ8C 5JLZA 2OTUB 4BKLA 5IIEB 2YOCA 1WQVT 3RNKB 4CVWA 1BLNB 4PRIE 4JRYD 2BNRE 1MNUL 2GJ6B 3MRRA 3C8KB 3OV6A 2QR0A 5IF0B 5ESVA 3V0VB 3GSUA 3ALPA 3QCUL 4RBPK 4JM2B 4KTDH 5BJTB 3LOWA 3K80A 1MSPA 4WJ5A 3MRKA 5IVXA 2GTZB 5DD5H 3BPOC 1L7IH 4L9LA 4N8CL 2P4AB 2HT4D 4HAFA 1YY8B 4R90H 4WV1B 4B53A 3E0GA 4ZPVB 5AAWA 2HWZH 4JFFD 3WFBH 2P8MB 2NW2A 4HV8A 3UTPD 2DQTL 4WENB 5EU7E 3KPSA 1DQJB 2DD8H 4XNQB 4IRJD 1NKOA 5ANME 2D9QB 1XFPA 4YBQC 5D7KD 3RQ3A 2G75A 4G7YL 3OJDA 2UY6A 4NKQB 1B9ZA 3FRPG 4HK0A 2K7PA 3QBTB 4JANB 4XPAH 1BZ9B 3H9SA 4X6DA 4JHBA 1CFVH 2GIYA 4D3CL 3IXTB 2N7AA 3WLBB 3CZFB 2WBJC 3VD9A 1CXFA 5FF6B 3KNBB 4YAQA 1G6RB 4Z77A 1DBAH 4LPVA 1FNSL 1RJYA 1KB5H 1R5WB 1XH3A 2B5IC 2R0KL 4RMUA 2YD5A 3SQOH 3RZWA 4WTZA 3L1OH 4GUPB 1MFDL 4M7LL 3ISWA 5I9QC 4PJCE 2JE8A 3RWDA 1JF5A 1F3DH 3F65A 1XIWD 5SX5H 2IPKA 5BV7B 5I73B 3SGKC 2AQ1A 3UCRA 4GBXB 5GJTH 1MVUB 3PP4H 3UDWA 2FH6A 3BUTA 4BQCA 3TJHD 1UXWA 2H26B 3STZA 1CD8A 3O6FC 4UBDD 4Y4HA 4PFEA 2V17L 3A6BH 1KYOJ 3L6FA 2MOVA 2FZ3B 4LP4A 4MDIA 4JZOA 3PQYB 4WEBH 5D7LE 4FFWC 4BSWB 5F1NA 3GIZH 4BUHA 1Y6NR 3T09A 2LU7A 3HG1B 1V3JA 1RD6A 2BRRH 3EJZC 1ZHLA 1LE5A 1IAII 2WUBH 3PHOB 2LFGA 4G3YH 5DD1H 3FN0L 4KQ3H 4K7FB 4KK8D 4TNWK 3QQ9C 2DJSA 4Q2ZB 1M6OB 1SEQL 3HUJB 3TV3H 1NC4D 3V4PH 3DUUA 4QHNB 3BGMA 5ID1A 5EPMB 2PUQT 3OGOE 2H2PC 1P7KA 4NKDB 1EFXD 5C0RL 4M02A 4IMLA 3IDMB 1A0QH 2YKLH 3T0VA 2YPKA 4PJGA 1N7MH 2NZ9D 4Y89A 1MLBB 2UUDH 2XOTA 2J5LB 3GI8H 4OLWH 5TE6H 3QT2A 3QO1A 5C8JB 5FO8B 1I7ZB 3C5SB 4WWKA 5CZXC 5MENB 1X5LA 1T7VA 2VZ1A 2HFTA 4CU6A 2AK4E 1U42A 2IPTL 3KXFD 4FQLH 3ARGD 2OJEA 5IW1B 4GKNA 3L9RB 5HDQH 1AO7A 5FYJD 4EI5A 4XNZC 3O4OB 1FVEA 4NZTH 2WAHA 2ADIA 1LP9B 2BOCA 1FBIH 4XI5D 4NT6A 1C12A 4D8PB 1D6EB 2Z4QA 5E8OA 1Y0LB 1H3XA 3GK8H 3MV01 4ZAKD 2C5DC 3QUZB 1GGYA 1NH6A 5BZDB 2DQHH 2PR4H 4XMLL 3B4NA 3QZWB 3T08A 1K3ZA 4LU5L 5HHME 5HVGB 3JWOC 3SE4A 4MJIE 2Y7QA 2PXYC 4NC1C 4OSUH 1NLDL 1VEMA 2YA2A 3H7BA 4OKVA 1BFSA 2XZQL 4XBPB 3THML 1I3RA 3LRSA 1NLBH 4EIGB 1F4HA 1JL8A 1BBJB 7FABH 2FBOJ 4PRHE 5DJ8A 4GAYA 4X7DC 3JUZA 1J5OL 3ZT5A 1IKNA 4QRPE 4WW2B 3HE6B 1KN4H 2QKIB 2EC9U 3I6KB 5EO9B 2E7BA 1VFMA 2UYLA 2FHCA 2AK1L 4C56E 1IAIL 3H3BC 4F7PA 5CP7A 2YPLE 1KF9B 4LVEA 2X4RB 2XQYK 3RWGB 1C08B 4OIIL 1N26A 4HXBH 2ORBL 1EDQA 3TNMA 2C4XA 3PV6B 1UB5B 4W68A 1IT9H 3BQUA 5C71A 4JFDB 4QGYA 1G0XA 3SGEH 4FTVA 4X4XA 1C7SA 3MUJA 3GMLA 1T0MB 5CEZD 4NQUA 3MBEB 4BK5A 3MA7B 2MCG1 1E27B 1U91B 4HIJB 5DO2D 2XKNB 2EKSA 3IF1A 1ZT4B 1AR2A 3BN9D 2IANB 3PHSA 1OAQL 3M17A 5JPMB 4MJ5B 2X4OB 2EYTA 4JPWH 5ACZA 1P5UA 3QNXB 4S0TD 2ZNWA 1UB6B 2D7OA 1OGAE 4HLZG 4XPTH 4ZOBA 1A1NB 4U3CA 4I5BA 4Y1AB 3V6FB 4PJAA 1IVLA 2AEQH 2MPAH 4ZS6C 4X7SH 5GRXG 5I8OL 3O41A 4LNRA 4Y5XA 1QSZA 4JHAH 3P9LB 4LLQB 1CBVH 2GW5A 4GKZB 1UKSA 1KG0A 4ETYA 3LH2H 3MCKB 3DSFH 1RHHA 1DE4A 2W9DH 4KZEH 4QY8B 2HJKB 2NX5D 1ZLUK 1AI1H 5D93B 1C5CH 3MXWH 4ZXBA 4PY8I 3RVTD 3L7EA 3R06B 3VXTB 2IBZX 3DX7A 4ODXA 3VW3L 1RZJC 3FZUC 1IC1A 1X5XA 5FYLE 1E4KA 4JY4A 1ZKAA 2CDEA 1C5DB 2HG5B 3ARYA 3SPVA 4YPGB 1G6RL 3BDXA 3S7GA 1A14H 5FOBB 5GQBA 4AZ8A 3ECBA 4WEUD 2WP3O 2FJFA 3GMRA 3LN9A 5ABDE 1QBAA 4HK3J 3VFTB 1LO4L 3F8UB 2DAVA 5I1IL 4QHLA 3V52L 4PREB 3GRWL 1Q38A 5IK3B 5H35A 5INDA 5IW6B 3JTTA 3RVXD 3MRPB 5HDLA 2CIIB 3WHE1 4QO1A 4Y19E 1T1ZA 4TOYL 4ZFGL 2H3NA 5BV7L 3BP6A 3TBTA 2GSGB 1IAKB 5AUMA 1AXTH 1RHFA 1IEBA 3GNML 2OJZL 1ORSA 3BT2L 2FJHB 4OBSA 4MNHB 3OJ2C 4KJQC 2D0HA 5KSAA 2HT2C 4HWZB 4JO1H 4KUCF 5IROC 4XRCB 4YC2B 3CLEH 2XA3A 2HLAA 1G7QB 1NC2D 5ACMA 4S1QL 1FCGA 3UC0H 1ZHKB 1YDPB 5D7IB 3OHXA 1D5BB 1OSZB 4FN0A 4LF3A 2QSCL 4KJWC 43CAA 4H1LB 1K4DB 1FZOA 3TT3H 3BGFB 3ZMRA 3IDIA 4ZYKB 5IQ9B 3TNNB 3VG0L 1F4YH 2XKUA 4YHNA 3N50A 3HRZA 2EIDA 4JVUA 4EBQL 3BH8B 2GT9B 1QFUH 3BPCB 4O2EA 5FM5M 2R69L 2R9HD 4HK3N 3BIKB 5B38A 3MGTB 3OX8A 2QTEA 4P46B 3RPIA 3EOTH 3SDXA 2F19H 5I19H 2RHEA 1O7SA 4QOKA 1NBZB 3QIBC 1J0ZA 3V8CA 4OZ4A 1T22B 1NGYB 2DB8A 5FUOL 2F54B 2A6DA 5GZOD 3U46B 1B0RA 3U9PL 5CCKL 3LPWA 3ILPB 3FQWA 3AROA 1RJLA 4XNYL 4G6ML 4R7DB 4JY6B 3BSZH 2EYRA 1SBBA 1VKXB 4GLRH 4R8WL 1MH5B 3KJ6H 5ELIA 3QDAA 2NY1D 3VWKD 5F3HB 1LEGB 2BJML 4P4RB 5BZWB 5HHXL 3RJQB 3MRDA 3EYVA 1MCOH 1JMZA 1SYSB 2HVKA 1XCTB 3UTSD 5ADOH 4QF1A 4QHUA 3V8OA 3EO1B 3VXQB 2F5BL 4M1CD 3C2SA 3VWJA 1D5MB 4RWYL 4WO4D 1KTDA 4LBEB 2J88H 5GS1A 3KPQA 5DUMH 2G2RA 3MJ8A 5EZOL 4EDXB 3P73A 2WLZA 5IMKA 4HEME 35C8H 4WVRA 4XWOC 4XCFL 3L5IA 4NO0B 2EYSA 4MJ4A 3CUPB 3LRGA 1EJOH 1NEZB 1BZ7B 3MREA 1HDMA 1TXKA 4EUPA 2CR6A 4MQ7A 3LS5H 1KPVA 1QSED 3VFWB 3S37L 3ARFB 4Z7VA 2FD6H 4UT9L 1M71A 1VGEH 1MY5A 4FXGB 4PV9A 1IKFL 5FIEA 5C0AE 2XZAL 4U6YA 3EYFA 3T0DA 2UZXB 3L5WA 3BZFA 5K9QI 1KPRB 3BKCL 1N5AA 4M5YL 3G04A 4QRQA 4OCYH 2A1WH 2BNQE 3WEXA 4P3DB 3AU1B 2VRAA 4PG2C 1KULA 4PRID 2EZ0C 5DD3L 4KKCC 1HCFX 4KVNH 5ESAA 4BH7B 5JQHC 3PP3K 1UKTA 1DUYB 2HJFA 3X17A 4ODUB 4NN6B 4HIEA 1S7TB 3U36A 4WHDA 5K9JH 4P9HH 1YPZB 2ATKB 1FIGH 1F42A 2FYYB 2JJWA 3FB6B 1X3DA 5BRZB 3QI9C 3C5ZD 1SQ2N 4FQ2H 1D9KB 4WCYL 1FNGB 3BUYB 1Q9KB 1TQCB 4HUUB 3S36L 5IHZB 5C0GB 3QEUA 3TN0B 4DUVA 4LSRL 3RUGE 4HKXB 5E5RB 1H3PL 5C0NC 3IDYB 4G8IB 1PFCA 1KEML 4Z7QF 1FYTB 2DLHA 2EEBA 3NIDE 4OF5A 1IGMH 4UB0H 4XPFH 1CIDA 4AIOA 1NMCC 2DF3A 4ZTOL 2CRMA 1KFAH 2EE6A 4X98B 1VADA 3DSNA 4DW2L 5IB2A 3QNZB 1S7SA 2BVQB 3TIDA 3WHXB 5I71C 4PJHE 3QR2A 1I1RA 3BD3A 4R97B 4UT7H 1DANU 2PETA 2X4TB 1YECH 2HKFH 4M9OA 5IHUH 1A1MB 4C57C 5LBSH 4E9LA 1HHIA 4YXKL 4NM4H 1S7VA 1G7HB 1V8HA 3O2WH 4HUKB 1T2JA 4WHYH 4N0FA 5KSBB 3QO0B 1CE1L 1U58A 1DBKL 4I48A 5HJ3A 3CFEA 1HQ4B 3GMOA 4R4ND 2VLLB 5D1ZD 5EUOA 1JN6B 2PYFB 4XP6H 4UNUA 3ARZA 2ED9A 4HC1L 4LRNL 5HYJE 5ILTH 4C83B 1L4IA 1WWBX 4FZEH 3RHWF 2X1OA 3I50L 3IGAA 4HH8A 5ESQA 2OSLB 1UEMA 4E42A 1WEJH 2X89A 3RNQB 5D6DA 5JQ6L 1YEIL 5HHOA 3LRHA 3ZDYF 2R0ZH 4R9HA 4KV5F 1A9BB 3O8XD 4JREB 2P5EB 3DI2B 1T3FB 1VFBB 1T1YA 1R3IH 3DTXA 3CK0H 5CZXD 4HIXH 4NHUB 5HD8C 5IB5A 4QXUL 3BIBX 4JRYB 4OUUA 4XVJL 5DYOA 1E28B 3FT4B 1CE6A 2XNAA 5TDPA 4NN7C 4F2MB 1JZ5A 5GS0H 3MRMA 1YQ2A 5B39G 3T1FB 4CADA 3F6LA 1UM5H 3OKKA 3DMMA 4P2OB 5E94A 4EDWL 5JIIA 1LO2H 1ZANL 4NC2B 1T21A 3DX6B 2HTLC 3UJTH 2D4FA 4PG9A 3QEGH 4DFHA 1I1YA 3ULVF 1BZQK 4JM4L 2DQDH 2VITA 3VDBA 2R56L 4WUUA 2LAAA 1Q94B 5IVXE 3SKOA 3HE7C 2PTTA 3NFPB 3EO9H 4GT7A 5LGHH 5C6WH 1MHPL 3KPPA 3R4DA 1SY6A 3U4BL 3ARBA 3HC0A 2OXGA 1OGTA 3TPUB 4X8JB 3KPRA 2QHRL 2X7LA 4OCLC 3KPSE 2HRPL 3X3GL 1H8SA 4NN5C 5JA9A 1BOGA 5EG6C 4R7NB 2ITDA 4X7TA 5IMLA 1JF1A 2VC2L 3ILQD 4M7JH 4XNUH 3K1DA 4ZOEA 3S4SG 4OI7A 1JTOA 4RQQB 1NBVL 2XPGA 3QIWC 4EZMA 3H9SE 4X6DE 3OJVC 3IJYA 4CDGC 3C09C 3MLVL 3OKOA 3ARRA 3MRIA 1FAIH 4YQXH 2ARWA 3ETBF 4NUGL 3KLAB 4QRRB 4KH2A 4V1DD 3LKQB 3QWOB 5K33A 5KS9F 3D85A 1DEDA 5ID0B 5JXAH 3V5DB 4OQTA 1MAKA 4ZSOB 1XIWB 4OUOA 3MGOB 1JFQH 3MRQB 4NYLA 4CUCA 4H8WL 4PRHD 4G9FD 4Z7WA 4D0CA 4CU7A 2OLDA 4X99A 1F8TH 5EZJA 4QRPD 1YMHB 1N4XL 4L3EA 2CK2A 1H0DB 2YSSB 4LHUA 3F58H 5F9JA 3EKCA 6FABL 4YEFA 2IG2L 4JEGB 1I1AA 1Z9MA 2YPLD 4KHTL 3EOBA 3RA7H 1GSMA 5JW4Q 1K2DA 5DHYB 3LY6A 1T4KB 3QPQC 2DQUH 1MFCL 3IFOA 1QBMH 3SDAD 4Z6AT 4GRWH 3ULSB 3K4DA 4LCCA 1II4E 3AY4C 4BK4A 4RMSA 5CZKA 4HWNA 1BVLB 1EEYA 4G6JL 3EW3B 1F3JB 4ODSL 1TZIA 4TRPL 4ZS6D 4MWFB 3TO2A 2EIZA 4QRTB 3DRTA 1NC4B 4OZGB 2QL1A 5F9WC 4AMKL 4G42B 2A0LC 4F7TA 2R1WB 1U8OA 3OKMB 5EIQA 4HDIA 5GRUH 3HN3A 3U6RA 1I9JL 1EGJA 2NZIA 3RDTB 1IC5H 4WFGE 3E6HA 5TFSH 2FL5B 4HCRL 3CSYB 3QXDB 4CVXB 5L88L 2Z93B 2PYEB 3BRGC 1A5FH 3RWIB 5FYKE 2ICEA 4P2QA 2GAZB 4PJGE 3HKFA 4X9GA 1NFIA 3KXFB 1GHFH 5JXEA 3WUZA 4GW4B 3O4LA 1ZHBA 4PV8B 1A6VL 4BM7A 1P7HL 1E0OB 4WDIA 4LPYA 3T2NL 3WLWC 4CVZA 5GIRB 1MHHA 1AO7E 5F6HJ 1W72B 1TETL 5IB1B 5C0BE 1FN4A 4FXKB 5I0DA 1K6QL 4NWTL 1F4WL 5EC2A 5FYLD 5ALCL 1MNUH 3FJTA 5IEHA 1JUFB 2DKMA 1G9ML 5C0DA 4M7KL 1QSFE 1J7VR 3QRGL 3RGVD 3WFZA 3B83A 3D39A 3QCUH 1CFSB 3R8QA 4G43A 3FO0L 1IGYB 5IKCB 1ZT1B 3FCTA 3R0NA 1Q0XL 4Z7UB 4JVPA 2DKUA 4GS7C 4KJQD 4N8CH 3U83A 4CBPA 1FG2B 1JGDA 3CFKA 1I7RB 3MLYL 3T2PA 1INQB 2DQTH 4LLMB 5I1LA 3ULUC 4JJHA 1G9NC 3VGAB 4G7YH 3KYMA 4KJWD 2C7UB 2P44B 2Y36L 2UVFA 5D7JD 4JFEA 2W60A 3J7HA 5SX4H 5FECA 3U4EB 1QA9A 3VFOA 1BIIA 1FVDB 1HOCA 1ZK9A 1VSCA 4BZYA 3LN5A 1WFUA 2XWTA 4F7CA 4B50A 2R8SL 4NQSB 3I85A 3NPZB 4FQXC 4E0RB 1MFDH 4M7LH 4GG6B 4N0YL 3EFFB 5CGYC 4NHCL 1YNTA 2ZPKH 5FB8A 7CGTA 3HA0A 4KUZL 3X3FL 4JAMB 3LN4A 1WT5A 3GHBL 1E4XI 2DM3A 2PW2A 2J2ZA 2BNUA 3H9YA 3UPCA 1RK0A 1AHWA 1T1XA 4Q9RL 3CC5A 3L3HB 4ONOA 5I74B 3S96A 2P49B 2V17H 3T0WA 4GKOA 5GRYA 3VGBA 1X5AA 3PXJA 4HKJA 2CPCA 2YD6A 4Y4FA 1OLZA 4G6KL 1FVCA 2HJLA 4IIQB 3IAGC 4PJAE 4F58L 3TYGL 1N6VA 1NBQA 2VAAB 5LQBL 1FO0B 1IGJB 3FFCA 3RY5A 2P5WE 3S5LA 4HBQA 1A9EB 3FN0H 4P5TD 3U0PB 4OFYA 2OK0L 4IOFD 1XEDA 2RR3A 4TUOB 4J1UA 5ICZA 3OZ9L 3ES6A 5BOPA 3LCYA 4RAVB 1GC1C 3TVMA 5KVDL 3QWRA 3D0LA 5C0RH 3QHZL 4XBGB 4P23D 4JB9L 3QDJA 1NKRA 3SDCB 4C55A 4RGNE 4Z7OE 1E4WL 1P1ZA 4K07A 3TWCL 1HHJB 4J2XA 4IS6B 4NC0B 5GGVL 5B8CB 1ZLWK 3UTTD 1HYSC 2GQHA 1FL5B 2IPTH 3QUXD 5KW9L 1F6AB 4Y16D 3D3VA 3H42L 3M1BA 5I1DA 4HUXA 2WUCL 4YBLB 4YE4L 3NN8B 1YMMB 1G7JA 4PS4H 1ZLVH 1MOEA 4HGKC 5IQ9A 5C07A 4EQ2A 4PJBF 2QQKL 3C60D 4CGTA 2ITCA 4ZNCD 4HX1A 4WU5A 3QJHB 4XCYA 5HHQB 3UMTA 2V6HA 1JVKA 1FL3B 1NC2B 1BJMA 4NNXA 4LU5H 2JKXA 2HMID 4Q74A 1E4XL 4XC3L 1N3NA 3F12A 4ZD3L 3L3IB 1UVQB 2H6PB 2BNQD 3UBXB 2ZUQB 1NLDH 5KVEL 1DLFL 3BMVA 3CFCL 5T5NG 4Z76B 2XZQH 3CH1B 5JDSB 3IJHB 4JJ5B 3THMH 3O3AA 5IB3A 3TJEL 2C1PA 1J5OH 1RZIB 3FMGL 3MROA 2XN9B 4EN3B 4D0BB 4ZO7A 1XGQA 3CX2A 5HGGS 1EEZA 3NZ8A 5IW3A 4FA8A 1QNZL 1IAIH 2A6JA 5CINH 3LKRA 2XTJC 4OZHF 4R26L 4KJYA 4G5ZL 2RB8A 5C92A 4M00A 1UZ6F 4OIIH 5JOFA 2PO6C 2ORBH 4MXWL 2FH8A 4QOKE 1HHGA 1T5XB 4IOSD 5FHBH 1L0XA 2ZUXA 3F6IA 1EPFA 2ICES 2AJZB 3ZE2F 1SMOA 2K1MA 5FYJL 3SDDA 1YEFL 1DLHA 1CF8L 4X5XB 2FHFA 4P59L 3H0TB 4HS3B 2DTSA 1HILB 2OTUA 3VU2A 5CWSB 4EXPX 4HKZB 5IIEA 3G6JB 2NY1B 5E5MB 1BLNA 3VWKB 4YR6B 1OAQH 1C7TA 5E6IC 1W72L 2GJ6A 3KPOB 3C8KA 5CUSL 5DJYA 3SE3A 3V0VA 5IF0A 2GTWB 2EDKA 2EXWC 3TYFB 3UTSB 1KCRL 1S9KC 4S2SA 2GTZA 1I8KB 1U3HC 2AP2A 4G6FB 3KWWB 1AKJD 1GGIL 1KJ3L 3MXVL 3TZVB 4NJ9L 5I8OH 1YY8A 4RBPH 2APWA 2P8MA 3VCLA 1YJDL 5C9JB 1F4XL 2CXKA 4RFNC 5EN2B 3GB7B 1A8JH 5IFJA 2F9BT 4A2MA 5DJ0B 4DVRL 3G6AA 4JANA 3CFIC 1BZ9A 2YWYA 1G84A 1RJCA 3EYUL 2F74B 1RURH 4XPHL 1QSEB 4K94H 4LVHC 3IXTA 4F7MB 3VW3H 3WLBA 2OR9L 3CZFA 4PGCB 1KCLA 2ARJB 3KNBA 1G6RA 2M26A 3V2AR 2Y6SC 4LEOB 2IADB 2ESVB 2FB4L 4Z7VE 4Z7NE 2DLEA 1JZ4A 1G6RH 4GJTB 3VGGA 5DMGD 4GUPA 5EIIB 4U1MB 1DN0B 3JBG7 1VEPA 4KKLD 4KHXL 4ELMB 5CEZL 3GRWA 2MKWA 5I8EB 1LO4H 3HI5L 5I1IH 3HCVB 3V52H 1AE6L 3LEYL 4PJ9C 4X4YB 5JW5A 4GBXA 1MVUA 4TOYH 1ADQA 4ZFGH 2RAMA 5F70A 5BV7H 3I3EA 4LPCA 1AQDA 3DVGB 4R2GD 2WQRA 5E2WL 1KT2B 4KMLB 2AXGA 2OJZH 2OS7A 2X1XR 3ARTA 4UU9A 3BT2H 5LCVL 2FZ3A 2RJMA 1OP5K 2D31B 2YWZA 2J8UF 2WBJB 4BSWA 3NCJH 1G1CA 2OR7A 4S1RL 1UGNA 1MY7A 3N1GC 4TTDC 4BYHA 3QA3A 2B5IB 3HG1A 3VD4A 1N64L 3HZVB 5ANMB 2R2EB 1EVTC 5GS2D 3PHOA 3GBLA 5EU7C 4S1QH 4U1HB 5E08L 1KUMA 2UWEF 5MI0C 1F11B 2QSCH 1HSBA 2W07A 1FO0L 1QLRB 1J8KA 4Q2ZA 4YX2L 3CVIL 3HUJA 3VG0H 4QHNA 4WW1B 2VDML 3H9SD 4EBQH 5DURD 4PD4K 1CG9B 5CD3B 1I7UB 1IGIL 2R69H 3NGBC 3IDMA 3N9GL 1YYML 3LB6D 1MLBA 4NPYB 3WJLC 1W0WA 4OLUL 4ONGL 3VRIB 5C8JA 3MGAA 5FO8A 1I7ZA 5MENA 4KROD 1SJEB 1S7WA 2X1QA 4TNWF 4NQCB 4DK6A 1RSFA 5EUKB 5FUOH 3L3OB 3HNTL 5IW1A 2G5BB 3U9PH 3L9RA 2NY5C 5FKAA 3DBXA 1PYWB 4XNYH 4G6MH 4U4BA 2VDRH 5J12C 2Q76A 1LP9A 1YYLL 4R8WH 4PRDB 3ZDZE 1XCQB 4F80A 4D8PA 3WUWB 1Q0YL 4X6CB 1D6EA 2VN4A 3MLWL 4GAFB 4NRYB 4QTHB 1Y0LA 4YFEA 1WCBB 4WTZG 5EUOE 4Y4HD 1MCPL 5MERB 5HHXH 4RIRB 3QUZA 1FPTL 5BZDA 3QZWA 3O8XB 1T2QL 3S35X 3BZEB 4NDMB 3FN9A 1ACYL 2H2SD 2F5BH 3NOIA 4RWYH 1NGPL 3GMMA 1OAYH 2AW2A 4XBPA 2DWEB 5EZOH 4NP4L 2VN7A 5J13B 1BBJA 2DI9A 3NACL 1NFDB 1Z5LA 5C0IB 4XNZB 4ALAL 5T1MA 4XCFH 2QKIA 4WFGD 5EO9A 3L3JB 1V5JA 4P4KA 1RIUL 1JP5A 2VDKL 5D1QA 3MLUL 2EDJA 1LGVA 5FYKD 3V6OA 4LPXA 5I75B 2BERA 3RWGA 1Y18B 5I6XC 1UCBL 3PV6A 4UT9H 1EH9A 4WWKD 1IKFH 3BE1L 3MO1A 1N2RB 4XTRC 4LSVL 2APTA 2XZAH 4WUUE 5KVFL 4TPRL 1T0MA 3HNSL 4MB4A 2C1OB 1P7QD 3MBEA 3BKCH 4DKFL 4M5YH 3MA7A 1AO7D 4EI5D 1U91A 4HIJA 4DVBA 1ZT4A 3KPRE 2Q7NA 3FO2B 3LMJL 4OGZA 5DD3H 3SHSA 4CL7A 5EA0L 1JGVL 5TPWL 3AS3A 4MJ5A 1IEAB 2BHYA 4PJFF 1DBML 2X4OA 2VZVA 2BRQA 3GSWB 3QNXA 1AQKL 4JRXA 4JZJA 3DO3A 4Y5VC 5F89B 1FZMB 4DZBA 2X09A 4YHZH 1A1NA 1QVOA 4PUBL 3CSBA 5LVEA 4Y1AA 4V1DB 3V6FA 4PY8J 2VLKA 3T0BA 4W6YB 3RY6A 3RP1A 4LLQA 2WLYA 2A83A 2DMKA 2WSKA 4GKZA 2HLFD 4G9FB 4GRLC 3MCKA 3ZYJA 3BXNB 1G6VK 3H6JA 3S36H 4DFIA 4YHML 1BJ1H 2JLLA 2V9TA 4LSRH 4QY8A 2HJKA 1H3PH 3NAAL 5C0CB 1NCCL 4Z7WE 1P84J 1KEMH 5GGSA 3BO8B 1GOHA 3V7MA 2XG5A 3R06A 3VXTA 1CIUA 1BGXL 4WUKL 1JGLL 4WI3A 3JV4B 4ZTOH 4DW2H 3B9VA 1OTUC 3SDAB 4JGJA 3IRZA 1C5DA 4YPGA 3DPBA 2D7NA 4X5WB 5FOBA 2CJUL 1WIPA 1CGUA 1ZS8B 4FXLA 4FTVD 4P5KB 1DL7L 3VFTA 5E00A 5L2KA 3AM8C 4YXKH 2KQNA 5DD6B 4OIBA 4PREA 5IW6A 4IRSC 2R1XB 3MRPA 2CIIA 1CE1H 3GSRB 1DBKH 1VESA 1ZSDB 5F7LB 1PX4A 3W9EA 1K4CA 5D96B 3PGDB 4HC1A 1IAKA 4WI9A 1MCCA 4R4BB 4LRNH 3C6SB 4MNHA 4YHOL 3JV0A 2JB5H 4HWUA 1R6VA 1S7RB 3I50H 1QRKA 4LK4A 4HWZA 1JNLL 4AG4H 5JQ6H 4FNLH 1YEIH 5T1LB 4LSSH 2VLJE 4XRCA 1G7QA 2V2WB 1YDPA 5D7IA 1D5BA 1OSZA 4JFXB 4BA8A 1K4DA 1XGPB 2FHBA 2YXFA 4KDTA 1WZMA 4MAYA 4ZYKA 3VFSB 3OKEB 3TNNA 4H1LH 4K8RC 1EIBA 4XVJH 3GZKA 4ZXBD 5L6YL 3BH8A 5DC9B 2GT9A 3RGVB 3BPCA 5AZEL 5I8KL 5GZND 4EDWH 4ODVH 4G8EB 3G5YB 1S7XA 3KHOA 2OL3H 3MGTA 4HS6B 4P46A 3DVIA 4RGND 1I9RL 3W39B 3D39E 4JM4H 1YEDB 1NBZA 3B8SA 4PBVC 2R56H 1T22A 4X4MA 1Z6JT 3S3PA 5I1CL 3U46A 1J0JA 1MHPH 2QBWA 1H5BB 4UNTA 4K3EL 1DQDH 1GAFL 1YC7A 2AEPH 3U4BH 1QPXA 2A73B 5D70L 4UQ3B 4Y5YA 2XY1A 4R7DA 4JY6A 2HRPH 4QXTB 3X3GH 1TJGL 3MCG1 1FHGA 3E6FA 3PJSB 5CBEB 2D7TL 4L4TD 2VC2H 4X83A 2OM5A 1LEGA 5F3HA 2JJSC 5DUBB 4IJ3B 5BZWA 4JFEE 4L4VA 1NBVH 3RKDD 4LCWA 1QEWB 2IQ9L 4H26B 3C9NB 4G8FB 3VFNB 3SO5A 4JO3H 1ZEAL 2FGZA 3MLVH 5KSAD 1KIQB 5FGBC 2V9QA 4B7IA 2WBWB 5DR5L 3DO7A 1JZ6A 1QFHA 4NUGH 5KSVB 3VXQA 4NZUL 2VDLH 3QIBB 1D5MA 4WGWB 2VXQL 5D1XA 4LBEA 3I75B 4JQIL 3WO4B 1LEIB 4EDXA 5FA4B 4L1DA 2BSSA 1A22B 4WFFE 1MLCB 4DEPC 1UKQA 2CKBB 2A9ML 3EJYD 3IS0X 5E2UL 2B2XL 1N4XH 1AR1C 2NY0C 4CW1B 4NM8L 4A6YL 2B0SH 4HWBL 1CLYH 1NEZA 6FABH 4NO5B 2R4RL 1HCVA 3C8HA 2IG2H 3A0OA 3ARFA 3KG5A 1CT8B 1MFCH 3L3DB 4FXGA 5IOPB 2YEZB 1EEQA 3CU1A 1YEKL 1T7WA 3WDJA 1MWAB 1U3HD 4G6JH 1KPRA 4YDKL 1JBJA 1A6ZB 3JWOL 4P5TB 4UQ2B 2IBBA 3RBGA 4ODSH 1OCWL 1OHQA 2DS4A 1A6PA 3AU1A 4P3DA 4XNMB 1LK2A 4WFHD 4KY1L 3Q1SL 3QJFB 4AMKH 3T4YB 3DHJA 4BH7A 5B38G 1RZKC 3NPSB 1DUYA 1A7QL 2E9BA 4ODUA 5B3NA 1S7TA 4MGXA 4HCRA 3KLHC 1I9JH 3NFNB 4P23B 1CI5A 1YPZA 3KPNB 5FO9A 4HCRH 4QRSB 4C4KO 2BVTA 3IXAB 2HH0L 5L88H 2V2TB 3PP3H 2EE2A 2FYYA 3FB6A 4JFHE 2SEBA 3QDJE 5BRZA 3T0AA 3UTTB 1D9KA 3VWJD 5EOCL 4Y16B 1DTUA 2VZOA 1TJHL 1FNGA 3BUYA 1Q9KA 4HUUA 3TN0A 4HKXA 4K9EC 1A6VH 4G8IA 4KC3B 4R96B 1JTTA 3AXLB 4I0CC 1FYTA 3T2NH 4KK5D 1J05A 1G7IB 1DQTA 5JW3L 1TETH 1R0AL 4AEIL 2FO1A 4ZPTB 1K6QH 3C60B 3SKJL 4XHQA 4NWTH 1F4WH 3MOAL 1CVRA 5ALCH 3QNZA 2BVQA 1G9MH 1FG9C 3EYQC 4H25A 2CIKB 3CFDB 3QRGH 4M7KH 2VL5B 5DJCA 5C07E 1UJ3C 1QYGL 2X4TA 5E1HB 1WUNT 3FO0H 1DSFL 1DP0A 5J3HC 5JTWA 1Q0XH 4GOSA 3BDYL 5KAQG 3I6LD 5JPNA 4NOBA 1E6OH 3QI9B 4HPYL 1G7HA 3VG9B 1OM3L 4X5LA 2IJ0C 3MLYH 1OWWA 5KSBA 3TEUA 3QO0A 1U2CA 4POYA 5CAYB 4GMTL 4EUPG 5HGAB 4OB5H 3D0VB 2VLLA 2Y36H 2OI9C 5JHDB 5CILL 1JN6A 2PYFA 2X2YA 3M8OL 1RI8A 1A7BA 4FQIL 4PJEF 4FFZL 5HI3D 5I2IB 4AEHL 2XICA 3EIFA 2OSLA 5I71B 4HKBB 2NY7L 1EHNA 1L6ZA 4Z78A 3B2UC 3RNQA 1F6LL 5FCSH 3PDOB 4MSWB 4JLRB 2NYYD 2YUXA 2BFVL 3B3IB 2P5EA 2R8SH 4I1NB 1SJXA 2JIXB 1EO8L 1UENA 1RU9L 1T3FA 4N0YH 4NHCH 1INEL 5HTSA 2W0FB 4TUKL 4NHUA 2P46B 1JPSL 3FFDB 4PB0L 4P48A 1JWMB 4PJXF 1S9YB 4F2MA 1T7YA 3GHBH 3T1FA 3LKPB 5FYLL 3JV5A 3TH3T 2V5YA 4P2OA 2GCYB 4OD2B 1JNJA 5DS8B 2GJ6E 4Q9RH 1B3JA 3DX6A 1X4ZA 1LO3L 4RMQA 1EMTL 2X4QB 2YZ8A 4NFDA 3TCXA 1RIHL 1AKJB 4PJ7B 2VSDA 1I8IB 4XPGL 2BOBB 1Z0MA 2I5YL 4NKOA 5T5FL 3GMNB 3NFPA 4J3OC 3EYOB 4F58H 3TYGH 3ZT6A 1BHGA 1DVFC 3TPUA 1EHLL 1W0YT 5LQBH 4AEFA 4N9GB 4GXUM 1J8HD 2AV7A 4JKKA 4LLYB 4J3WA 4BZ1L 3PL6C 1M7XA 4R7NA 2OK0H 2NNAA 4Z9KB 2DQIL 4HLJA 4CMHC 5IJKA 4MVBC 3RZCA 3WN5A 4FABL 2DMBA 3OZ9H 3WJJC 1MELA 3LQAL 1X6LA 2YD1A 5DJXB 2YR3A 3T3MF 5KVDH 4WIQA 3QHZH 3RWHA 5AD0B 3NIGF 2X89D 3CMGA 2IALA 3KLAA 4QRRA 3CDGB 5HHOD 3TM6A 5CJBA 2QQNL 3WIIL 1E4WH 4GXUN 3V5DA 1P6FA 4ZSOA 3HE7B 3IU4L 1P2CA 4NWUL 1XIWA 1N0XH 3VJ6B 5JLZB 1LEKB 3MGOA 3LQZB 3MRQA 3VMNA 5KW9H 1OOAA 1PKQA 2C9AA 3MLTB 3HZYB 1GJIA 1YMHA 3H42H 3VGHA 5I0ZA 2WUCH 5K9OA 4NN5B 4YE4H 4R2GB 4OZIB 4D9QE 1I4FB 1I85A 2J8OA 2BVYA 4M61B 3CSPA 5ETUA 3QG6B 5IVXB 3NCYP 5KANG 2QQKH 2GJJA 1T4KA 1NGWB 4M3KB 3IVKA 4OD3L 2ADFL 1I8MB 3C09B 1HZHL 3V5KA 3PQYE 1YNKH 2OZ4L 4XX1E 4HV8B 2QV2A 1A02N 1BVLA 1CDBA 3BP4B 1E4XH 3HG1E 2GITB 4XC3H 4GQPH 5CP3H 5C6TL 3QHFH 4ZD3H 3ARBD 5CJQL 4QRUB 4MWFA 1MWAL 5KVEH 3OJDB 1DLFH 3KPRD 3TA3C 3O45B 4QRTA 1FSKC 1NC4A 3CFCH 5T3ZD 3BKYL 4G42A 4R3SA 3TJEH 2R1WA