4KVOE

The nata (naa10p/naa15p) amino-terminal acetyltrasferase complex bound to accoa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit nat1
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 44
structure length 153
sequence length 153
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvoE00
5EC4A 2G3AA 3QAHA 1PU9A 4KZTA 5HMNA 2BSWA 2G3TA 3D2PA 4QB9A 3DNSA 1IYLA 2OZGA 1M4IA 3P2HA 1NE9A 1M1DA 4M3SA 2AE6A 4MY0A 4MY3A 4ZBGA 3PGPA 1NSLA 4KOVA 5IV0A 2ATRA 3FXTA 5KTCA 2VZYA 3CXPA 4JLYA 1YVKA 4MI4A 5KTDA 1QSNA 1M44A 1R57A 3PZJA 3UY5A 1YGHA 1SQHA 3DR8A 2ZW7A 1KUYA 4UBRA 1MJBA 2OZUA 2D4OA 4QUSA 4U9YA 4RI1A 4XPDB 1YK3A 5I0CA 4NXYA 2R8VA 4IF5A 1V0CA 3DSBA 5JPHA 2ZPAA 3CXSA 4H6ZA 3S6FA 5H86A 2QECA 1B87A 4E0AA 2NMTA 4XPDC 3R95A 1Q2CA 3TO9A 4PSXA 4HNWB 1K4JA 2B5GB 1QSRA 2FIAA 2ZW5A 5HH1A 3EO4A 4AG7A 1N71A 4B5PB 4AVBA 2FT0A 3TT2A 1S7NA 2P0WA 1IYKA 3FYNA 5GCNA 2HUZA 4DNCA 4KOWA 4J3GA 4JXRA 3QB8A 4RS2A 2QIRA 2FIWA 2K5TA 2R1IA 2I79A 3WR7A 3G3SA 2Z10A 3R96A 2OB0A 3LODA 2JLMA 2OZHA 4OAEA 4KORA 2AJ6A 5ISVA 1YLEA 4B5OA 2GANA 5DWNA 1Z4RA 3GYAA 3R1KA 1WWZA 4YGOA 1Z4EA 1I1DA 4KOYA 4M85A 3ZJ0A 4KUBA 4CAXA 3S6HA 3TO7A 5J8CA 1FY7A 2ZW4A 3LD2A 3H4QA 2BUEA 2ZXVA 3BJ8A 2CNTA 4HNYB 3S6GA 5IX3A 3F8KA 4YRHA 4F6AA 1XIXA 1YR0A 4NSQA 4H6UA 3R9GA 2GIVA 4LUAA 4KOUA 1B6BA 2JEVA 4JXQA 3IWGA 1XF8A 5F49A 4I49A 3FRMA 3ZZIA 4UWJA 2DXQA 3W91A 3T9YA 2BL1A 2JDDA 5F48A 3VWEA 1KUXA 3D2MA 2PDOA 2B5GA 4LX9A 2R7HA 3S6KA 1MJAA 1YX0A 2G0BA 2VBQA 3GKRA 3TTHA 1VKCA 4GS4A 3I9SA 4AVAA 2R98A 3FIXA 4KLWA 3E0KA 2P6GA 2HQYA 4KOXA 4XNHC 1Q2DA 4AG9A 5FVJA 4B5PA 2Z0ZA 1S7LA 2B3VA 4QC6A 1TIQA 2ARHA 4U9ZA 3D8PA 2J8RA 2CNMA 4XPLA 4L8AA 1CJWA 2REFA 5IB0A 1U6MA 2CNSA 4NCZA 2PC1A 1VHSA 4CAWA 2H5MA 3FBUA 4X5KA 3MGDA 4E2AA 2B3UA 3C26A 3K9UA 4KOSA 1Y9WA 1P0HA 4JJXA 2VEZA 3TO6A 1MK4A 4FD5A 1BOBA 3DR6A 2IL4A 1RO5A 1LRZA 3D3SA 3FB3A 4R3KA 4II9A 4JD6A 2PR8A 4Y49C 1P4NA 3KKWA 3NE7A 2J8NA 4UWIA 3VWDA 4R9MA 4KOTA 4L89A 5H84A 3BLNA 4FD7A 1GHEA 1XEBA 1I21A 1WK4A 4AB7A 2Q4VA 3P2FA 4R87A 3PP9A 2VXKA 2Q4YA 2Y0MA 4CAVA 2FXFA 1RXTA 1L0CA 2RC4A 4XPKA 3EXNA 4FD4A 3SXOA 3SXNA 3BJ7A 3GY9A 2OH1A 2VQYA 4NEXA 2B58A 3B8GA 4KVME 4HNXB 2BEIA 5CNPA 1OZPA 4CRYB 2C27A 2Q0YA 2QMLA 4PK3A 1Z9UA 2B4DA 2Z11A 4CS0B 2Q7BA 4MBUA 4OADA 3T90A 3CXQA 2O28A 1PUAA 4XNHB 2KCWA 1IB1E 1M4DA 2WPXA 4BMHA 3JVNA 1YVOA 2VZZA 2PRBA 2EUIA 4R3LA 1QSOA 2Q44A 1S5KA 3W6SA 3G8WA 1UFHA 4PSWA 3TE4A 3TFYA 1NMTA 3F5BA 2PR1A 1S3ZA 5E96A 1BO4A 2B4DB 5C82A 1KZFA 1MJ9A 2A4NA 2I00A 2P6EA 4KVOE 5F47A 4R57A 3R9FA 3V8IA 1XE4A 3FNCA 4MHDA 4ONUA 2GE3A 4PK2A 4CRZB 4F0YA 2CY2A 2JDCA 1ON0A 4JWPA 4EVYA 4OLLA 4IUSA 4PV6A 4Y49B 5J8FA 1Y9KA 2REEA 2HV2A 2PSWA 4KVXA 4QVTA 1QSTA 3I3GA 2FSRA 1J4JA 4K30A 1QSMA 4E8OA 3JUWA 4AVCA 1S7FA 5F46A 2B4BA 1CM0A 2VI7A 5JQ4A 4YFJA 5KTAA 4KLVA 4HKFA 3EFAA 3OWCA 3IGRA 1KUVA 4NF1A 3TCVA 1S7KA 1Q2YA 1IICA 1IIDA 3SHPA 1M4GA 2FE7A 2Q04A 2J8MA 4UA3A 3DDDA 4FD6A 3TOBA 2F5IA 2X7BA 2ZW6A 2WPWA 1YREA 3W6XA 1Y7RA 1I12A 4ORFA 2D4PA 3N7ZA 3EY5A 5EBVA 4H89A 2FL4A 3R9EA 4MJ8A 4KUAA 1XMTA 2EVNA 2OU2A 2PQ8A 3TOAA 4U5YA 2P6FA 4QBJA 3RYOA 3EC4A 2FCKA 2FS5A 5DWMA 3F0AA 5C88A 1S60A
chains in the Genus database with same CATH superfamily
5EC4A 2G3AA 1BAVA 2ZEPA 3QAHA 1YMEA 1HEEA 3IIBA 3WABA 2PIYA 1R43A 1PU9A 2V8DA 4NJRA 4P10A 3RBUA 4KZTA 3IEHA 4CAFA 5HMNA 2Q4ZA 5DS0A 2BSWA 2G3TA 3D2PA 4QB9A 5K8MA 3DNSA 2EO8A 2CXAA 1IYLA 3NE8A 2IMOA 4NGSA 1OBRA 1JQGA 2OZGA 5HVGA 1M4IA 1CG2A 3P2HA 1NE9A 1M1DA 4Q36A 2OR4A 4R7MA 2PJAA 4FAIA 4M3SA 2AE6A 4CPAA 4MY0A 4OC2A 4PXBA 4MY3A 4P4FA 2AFWA 4ZBGA 1XRYA 3PGPA 2PRQA 1NSLA 4ZY0A 4KOVA 1XMBA 5IV0A 2ATRA 3FXTA 4AXVA 5KTCA 1ZG9A 3BI1A 2VZYA 2EBJA 3CXPA 4A31A 4JLYA 4KSIA 1YVKA 4MFPA 2GU2A 4MI4A 2ANPA 5KTDA 1QSNA 1M44A 1R57A 3PB9X 3PZJA 3UY5A 1GYTA 2V8VA 4DYOA 1YGHA 1X12A 1HDQA 1SQHA 3D67A 4BD9A 2AFOA 2PJ4A 1TKFA 3DR8A 2ZW7A 1LAPA 1M4LA 3VATA 2AFXA 1KUYA 2GREA 4UBRA 4UCPA 4NFRA 5HVFA 1MJBA 3KL9A 2OOTA 4B13A 2OZUA 3ISXA 2Q43A 3SJXA 2D4OA 4QUSA 4U9YA 4ZX8A 4RI1A 4A37A 4NJQA 4O23A 3MRUA 3LMSA 4XPDB 1YK3A 4C7HA 2G9DA 5I0CA 1BLLE 4NXYA 3KHXA 2R8VA 2PJCA 5EMIA 4IF5A 1V0CA 3DSBA 5D29A 2ODFA 2V77A 4H2KA 5JPHA 1XFOA 2ZPAA 3FECA 2PJ7A 5HVHA 2PJBA 1Q7LA 3CXSA 5JM6A 4H6ZA 3S6FA 4A30A 2WZNA 3KQZA 2PJ9A 5H86A 2QECA 4B11A 2CTCA 3KGQA 3D7DA 3TX8A 1B87A 4C68A 4E0AA 2NMTA 2F7VA 1EE3P 4XPDC 2ZEGA 3R95A 2V8HA 1Q2CA 3KQXA 4PSXA 3TO9A 4HNWB 4CYQA 1K4JA 2IQ6A 1AMPA 2B5GB 1CPSA 2VL1A 1TKHA 2PJ0A 3D7GA 2QJ8A 1QSRA 2FIAA 4KSAA 1HDUA 4TNUA 3QAYA 4IAVA 5AG7A 2J9AA 3BI0A 2ZW5A 3CPXA 2YGWA 5HH1A 4UEFA 2ZELA 3EO4A 2BO9A 5JGFA 1TF9A 1BPMA 4AG7A 1N71A 4B5PB 1ELMP 4P4IA 4AVBA 2QYVA 4FUUA 2FT0A 4YU9A 3B3WA 2ZEDA 3TT2A 1S7NA 2P0WA 1IYKA 1CP6A 2CTBA 3FYNA 1LOKA 5GCNA 5K8NA 2HUZA 4DNCA 1VGYA 2C6GA 4KOWA 4J3GA 4JXRA 4IHMA 2Z3NA 3QB8A 5G20A 4RS2A 3K2KA 2NSMA 2QIRA 2FIWA 2K5TA 2R1IA 2I79A 3WR7A 3G3SA 3IC1A 4CYPA 2Z10A 3NH8A 3S9NA 3KZWA 3GUXA 3R96A 3S9LA 2OB0A 4C2YA 2PJ8A 3LODA 4P4EA 4YWYA 2JLMA 2OZHA 4OAEA 4KORA 2AJ6A 5ISVA 1YLEA 2DF5A 2GANA 4B5OA 2C1CA 3D4UA 3HLPA 2PVWA 5DWNA 4GM5A 3PB7X 1Z4RA 4UFVA 4FBEA 3GYAA 4ONWA 4BINA 2AFUA 3R1KA 4PXEA 1WWZA 4YGOA 3PB6X 4A38A 3KHZA 1Z4EA 1I1DA 4NGRA 5G22A 4NGPA 4OC3A 4P44A 4KOYA 4R8FA 4M85A 4P4JA 4KUBA 3ZJ0A 1JWQA 4CAXA 3FH4A 3S6HA 3TO7A 3H8EA 1FY7A 2PJ1A 5J8CA 2ZW4A 3LD2A 3H4QA 4ZY1A 3PEIA 1AYEA 2BUEA 4HPSA 1ZO0A 1DTDA 4MXUA 2ZXVA 2Z3LA 1X10A 4LQ6A 2JEWA 3BJ8A 2CNTA 2XEJA 4HNYB 4B6ZA 3S6GA 3IJ3A 5CBMA 5JH9A 4UIBA 1XOVA 2DPSA 5IX3A 3D66A 2C6CA 3F8KA 2RB7A 4YRHA 2AFSA 4F6AA 1LANA 1XIXA 1YR0A 1IOFA 4M6HA 3CPAA 4NSQA 4H6UA 3R9GA 2GIVA 4MCSA 4LUAA 4M6IA 1YLOA 1H8LA 2ZEFA 4KOUA 3B7IA 1B6BA 2JEVA 4JXQA 3IWGA 3V38A 1XF8A 5F49A 4I49A 4ZYQA 2PJ6A 3FRMA 3N5FA 4MHYA 3ZZIA 4TWEA 3BXMA 4UWJA 2DXQA 3W91A 3T9YA 2BL1A 2JDDA 5F48A 3VWEA 1KUXA 3D2MA 5F09A 2AFZA 2PDOA 4R6TA 4CGNA 4MHNA 2B5GA 1CP7A 2R7HA 3JTKA 4LX9A 3S6KA 1MJAA 5LYIA 1YX0A 4P6YA 5HXDA 2PJ2A 2G0BA 2VBQA 3GKRA 3TTHA 5K8PA 1VKCA 3KI9A 3I9SA 4GS4A 4AVAA 1QQ9A 2R98A 3FIXA 4KLWA 3E0KA 3PFEA 4W9YA 4X3RA 2C6PA 5ELYA 4CGLA 3WC7A 2P6GA 2HQYA 1IGBA 1LAMA 4FWUA 4KOXA 4XNHC 4B12A 4F9UA 1QMUA 4OKOA 1Q2DA 4UEZA 3FVLA 1YW6A 5FVJA 3VARA 4AG9A 4B5PA 1Z8XA 5LYDA 2POKA 4K3NA 2Z0ZA 3NFZA 1S7LA 2B3VA 4QC6A 4UEEA 1TIQA 5A27A 4MFKA 1ZLHA 2O4HA 4MHPA 4JZ0A 1ZG7A 3SJGA 2ARHA 4U9ZA 3D8PA 4RUHA 3FEDA 4BBHA 3PB8X 4UF4A 1F57A 2ZOFA 2Q7SA 2CF4A 2J8RA 2CNMA 3IU1A 4XPLA 1Z8TA 2PJ3A 4L8AA 1CJWA 2REFA 1CPXA 1FT7A 5IB0A 3H8GA 4LQGA 1U6MA 1YSJA 2CNSA 2DEAA 2YNDA 2PJ5A 4NCZA 3WC5A 1NSAA 2PC1A 1VHSA 3B2YA 2H5MA 3RZAA 3FBUA 4X5KA 1F2PA 3MGDA 3TC8A 4CAWA 1TKJA 4E2AA 2B3UA 4UIAA 3C26A 3K9UA 3FEEA 1Y9WA 1P0HA 2F8HA 4KOSA 5AG6A 4JJXA 2VEZA 3TO6A 1MK4A 4A39A 1F2OA 4NGQA 2WYRA 2XEIA 4FD5A 1BOBA 3DR6A 3S9MA 4EWTA 3DGVA 2IL4A 3CDXA 1RO5A 1LRZA 2XEGA 2ZEEA 3D3SA 3FB3A 3LWUA 1DE4C 4OC5A 4R3KA 4A32A 4F9VA 4JD6A 2PR8A 4JYWA 1P4NA 4MFQA 2NYQA 3KKWA 3NE7A 4Y49C 4CGOA 2J8NA 1IU8A 2WSAA 2ZEHA 4UWIA 4B14A 3SI1A 3VWDA 3NH5A 4R9MA 4KOTA 1Z5RA 4OIWA 2PE3A 4L89A 5H84A 3BLNA 4FD7A 3D68A 3A9LA 4NGMA 4ZX9A 2Z3PA 1GHEA 2BCOA 2O53A 3PRTA 1XEBA 3PBBA 1I21A 1WK4A 5AG5A 4ZY2A 4AB7A 2Q4VA 4OMEA 1CBXA 3P2FA 4R87A 3PP9A 2VXKA 3IFEA 4MFZA 2Q4YA 3BHXA 5AGEA 2Y0MA 2HB6A 2FVGA 2YNCC 3IWWA 4WWVA 4CAVA 2FXFA 1RXTA 1L0CA 2RC4A 4XPKA 6CPAA 3EXNA 2I3CA 4PPZA 4A95A 4X2TA 4FD4A 3SXOA 3SXNA 3BJ7A 5LRKA 2YNEA 3GY9A 2JBKA 5LRGA 3PB4X 5CPAA 2OH1A 2RFHA 2VQYA 3B3CA 4NEXA 3KASA 2B58A 5AG4A 1A2ZA 4UCMA 3B8GA 4EMEA 4KVME 2EK8A 3GLJA 4HNXB 2BEIA 2Q51A 2PVVA 3RO0A 4C2XA 1UWYA 5CNPA 1CX8A 1OZPA 3FF3A 1PCAA 4CRYB 4X8IA 3IO1A 2ZOGA 3L2NA 1YQEA 5G21A 2C27A 1KWMA 1ARLA 2Q0YA 1Y7EA 2PIZA 2HC9A 2QMLA 3LACA 1FNOA 1Z9UA 4PK3A 3WT4A 4CGPA 3I1UA 1Z8LA 1VHEA 2B4DA 3H8FA 2Z11A 4UFWA 4C2ZA 4CS0B 4DJLA 5LYFA 4P4BA 2Q7BA 4MBUA 4DUKA 3D7FA 4OADA 3FX6A 3T90A 3CXQA 5J1QA 1AUGA 1Z8WA 3MN8A 2O28A 1PUAA 4XNHB 2KCWA 4OC1A 4F0XA 1IB1E 4UCNA 1M4DA 2WPXA 4BMHA 3JVNA 1YVOA 4C7IA 4CGMA 5K8OA 5D8NA 2VZZA 3SJFA 2PRBA 2EUIA 3JRUA 4PQAA 4R3LA 4F8ZA 1QSOA 2Q44A 1S5KA 2Z3OA 4Q7AA 4GXHA 5LRJA 3W6SA 3G8WA 3CZXA 1UFHA 4Z65A 4PSWA 4CYOA 4CAEA 5LYLA 3TE4A 3TFYA 2GLFA 2WUUA 1NMTA 3F5BA 1XBUA 2EK9A 2PR1A 1S3ZA 5E96A 1BO4A 2B4DB 3FJUA 4M6GA 5C82A 1ARMA 1Z2LA 1KZFA 1MJ9A 2A4NA 2I00A 4NGNA 2P6EA 4P4DA 8CPAA 4MCPA 3H5ZA 4KVOE 5F47A 3B3SA 4R57A 4Q38A 3R9FA 1LCPA 3V8IA 4A94A 1XE4A 2Z3MA 4OC4A 3FNCA 4MHDA 2Z3KA 2ABZA 2YNCA 4KS9A 4ONUA 5IB9A 4G1PA 2GE3A 2V8GA 4PK2A 4CRZB 1ZG8A 4F0YA 2CY2A 2JDCA 4A33A 5BWAB 1ON0A 4JWPA 4EVYA 5I4MA 4OLLA 3NA6A 7CPAA 4IUSA 4PV6A 4Y49B 5J8FA 1Y9KA 4MHZA 1PYTB 2REEA 3B3TA 4MCRA 2HV2A 2PSWA 2ZENA 4KVXA 3KR4A 4QVTA 4CYNA 1QSTA 3CT9A 3I3GA 2FSRA 4B10A 1XJOA 1J4JA 4K30A 4ZI6A 4II9A 1QSMA 4E8OA 3HUVA 2GLJA 4NGTA 3VH9A 3JUWA 4AVCA 3K9TA 2CIJA 3RAMA 1Y0YA 1YW4A 5THWA 1S7FA 5F46A 2B4BA 2QVPA 3GB0A 3RNZA 1CM0A 1ZLIA 2VI7A 3SI2A 2ZEMA 5JQ4A 4YFJA 5KTAA 4KLVA 3FMCA 4HKFA 4WJBA 3EFAA 1VIXA 2GFQA 3OWCA 3IGRA 4OC0A 3SI0A 1KUVA 3KR5A 4MMOA 4NF1A 3TCVA 3B35A 1Y0RA 1S7KA 1Q2YA 1IICA 1IIDA 3SHPA 1M4GA 2FE7A 2Q04A 3WC6A 3V7ZA 2J8MA 3ISZA 3DLJA 4UA3A 3DDDA 4FD6A 5G1ZA 4ZGYB 3TOBA 2F5IA 4UFXA 2X7BA 1VHOA 2ZW6A 2WPWA 1YREA 3W6XA 3IWEA 1Y7RA 4OP4A 1ELLP 1I12A 3NH4A 2IJZA 4ORFA 4MRIA 2D4PA 3N7ZA 4EFDA 3EY5A 4R76A 3B3VA 4OIDA 5A28A 2EWBA 1TF8A 3PFOA 3QNVA 1R3NA 5EBVA 2DPTA 4H89A 4P45A 2FL4A 3IU2A 4PXCA 3R9EA 3PBEA 4MJ8A 4KUAA 3T8WA 1IY7A 1XMTA 2EVNA 2OU2A 2PQ8A 1IOIA 2ZEOA 4PXDA 3TOAA 4MFLA 3D7HA 3GIUA 1TXRA 2XEFA 4U5YA 3SJEA 1RTQA 2P6FA 4MFJA 1LFWA 4RN7A 4QBJA 3RYOA 2JBJA 3EC4A 4MCQA 2FCKA 1BPNA 2PCUA 4A2ZA 2FS5A 2BOAA 5DWMA 2AFMA 3F0AA 4KSFA 5C88A 1S60A 4IK2A
chains in the Genus database with same CATH topology
5EC4A 2G3AA 3QAHA 1PU9A 4CAFA 4KZTA 5HMNA 2BSWA 2G3TA 3D2PA 4QB9A 3DNSA 2CXAA 1IYLA 2OZGA 1M4IA 3P2HA 1NE9A 1M1DA 4Q36A 4M3SA 2AE6A 4MY0A 4MY3A 4ZBGA 3PGPA 1NSLA 4KOVA 5IV0A 2ATRA 3FXTA 5KTCA 2VZYA 3CXPA 4A31A 4JLYA 1YVKA 4MFPA 4MI4A 5KTDA 1QSNA 1M44A 1R57A 3PZJA 3UY5A 1YGHA 1SQHA 3DR8A 2ZW7A 1KUYA 4UBRA 4UCPA 1MJBA 4B13A 2OZUA 2D4OA 4QUSA 4U9YA 4RI1A 4XPDB 1YK3A 4C7HA 5I0CA 4NXYA 2R8VA 4IF5A 1V0CA 3DSBA 5JPHA 2ZPAA 3CXSA 4H6ZA 3S6FA 4A30A 5H86A 2QECA 4B11A 1B87A 4C68A 4E0AA 2NMTA 4XPDC 3R95A 1Q2CA 3TO9A 4PSXA 4HNWB 4CYQA 1K4JA 2B5GB 1QSRA 2FIAA 4KSAA 5AG7A 2ZW5A 2YGWA 5HH1A 3EO4A 4AG7A 1N71A 4B5PB 4AVBA 2FT0A 3TT2A 1S7NA 2P0WA 1IYKA 3FYNA 5GCNA 2HUZA 4DNCA 4KOWA 4J3GA 4JXRA 2Z3NA 3QB8A 5G20A 4RS2A 2QIRA 2FIWA 2K5TA 2R1IA 2I79A 3WR7A 3G3SA 4CYPA 2Z10A 3R96A 2OB0A 4C2YA 3LODA 2JLMA 2OZHA 4OAEA 4KORA 2AJ6A 5ISVA 1YLEA 4B5OA 2GANA 5DWNA 1Z4RA 4UFVA 3GYAA 3R1KA 1WWZA 4YGOA 5G22A 1Z4EA 1I1DA 4KOYA 4M85A 3ZJ0A 4KUBA 4CAXA 3S6HA 3TO7A 5J8CA 1FY7A 2ZW4A 3LD2A 3H4QA 2BUEA 1ZO0A 2ZXVA 2Z3LA 3BJ8A 2CNTA 4HNYB 3S6GA 2DPSA 5IX3A 3F8KA 4YRHA 4F6AA 1XIXA 1YR0A 4NSQA 4H6UA 3R9GA 2GIVA 4LUAA 4KOUA 1B6BA 2JEVA 4JXQA 3IWGA 1XF8A 5F49A 4I49A 3FRMA 3ZZIA 4UWJA 2DXQA 3W91A 3T9YA 2BL1A 2JDDA 5F48A 3VWEA 1KUXA 3D2MA 2PDOA 4CGNA 2B5GA 4LX9A 2R7HA 3JTKA 3S6KA 1MJAA 1YX0A 2G0BA 2VBQA 3GKRA 3TTHA 1VKCA 4GS4A 3I9SA 4AVAA 2R98A 3FIXA 4KLWA 3E0KA 4CGLA 2P6GA 2HQYA 4KOXA 4B12A 4XNHC 1Q2DA 4AG9A 5FVJA 4B5PA 2Z0ZA 1S7LA 2B3VA 4QC6A 1TIQA 5A27A 4MFKA 2ARHA 4U9ZA 3D8PA 4BBHA 3IU1A 2J8RA 2CNMA 4XPLA 4L8AA 1CJWA 2REFA 5IB0A 1U6MA 2YNDA 2CNSA 4NCZA 2PC1A 1VHSA 4CAWA 2H5MA 3FBUA 4X5KA 3MGDA 4E2AA 2B3UA 3C26A 3K9UA 4KOSA 1Y9WA 1P0HA 5AG6A 4JJXA 2VEZA 3TO6A 1MK4A 4FD5A 1BOBA 3DR6A 2IL4A 1RO5A 1LRZA 3D3SA 3FB3A 4A32A 4R3KA 4II9A 4JD6A 2PR8A 4Y49C 1P4NA 4MFQA 4CGOA 3KKWA 3NE7A 2J8NA 4UWIA 2WSAA 4B14A 3VWDA 4R9MA 4KOTA 4L89A 5H84A 3BLNA 4FD7A 3A9LA 2Z3PA 1GHEA 1XEBA 1I21A 1WK4A 5AG5A 4AB7A 2Q4VA 3P2FA 4R87A 3PP9A 2VXKA 4MFZA 2Q4YA 5AGEA 2Y0MA 4CAVA 2YNCC 2FXFA 1RXTA 1L0CA 2RC4A 4XPKA 3EXNA 4A95A 4FD4A 3SXOA 3SXNA 3BJ7A 2YNEA 3GY9A 5AG4A 2OH1A 2VQYA 4NEXA 2B58A 4UCMA 3B8GA 4KVME 4HNXB 2BEIA 4C2XA 5CNPA 1OZPA 4CRYB 5G21A 2C27A 2Q0YA 2QMLA 4PK3A 1Z9UA 4CGPA 2B4DA 2Z11A 4UFWA 4C2ZA 4CS0B 2Q7BA 4MBUA 4OADA 3T90A 3CXQA 2O28A 1PUAA 4XNHB 2KCWA 4F0XA 1IB1E 4UCNA 1M4DA 2WPXA 4BMHA 3JVNA 1YVOA 4C7IA 4CGMA 2VZZA 2PRBA 2EUIA 4R3LA 1QSOA 2Q44A 1S5KA 2Z3OA 3W6SA 3G8WA 1UFHA 4PSWA 4CYOA 4CAEA 3TE4A 3TFYA 2WUUA 1NMTA 3F5BA 2PR1A 1S3ZA 5E96A 1BO4A 2B4DB 5C82A 1KZFA 1MJ9A 2A4NA 2I00A 2P6EA 3H5ZA 4KVOE 5F47A 4R57A 4Q38A 3R9FA 3V8IA 1XE4A 2Z3MA 3FNCA 4MHDA 2Z3KA 2YNCA 4KS9A 4ONUA 2GE3A 4PK2A 4CRZB 4F0YA 2CY2A 2JDCA 4A33A 5BWAB 1ON0A 4JWPA 4EVYA 4OLLA 4IUSA 4PV6A 4Y49B 5J8FA 1Y9KA 2REEA 2HV2A 2PSWA 4KVXA 4QVTA 4CYNA 1QSTA 3I3GA 2FSRA 4B10A 1J4JA 4K30A 1QSMA 4E8OA 3JUWA 4AVCA 1S7FA 5F46A 2B4BA 1CM0A 2VI7A 5JQ4A 4YFJA 5KTAA 4KLVA 4HKFA 3EFAA 3OWCA 3IGRA 1KUVA 4NF1A 3TCVA 1S7KA 1Q2YA 1IICA 1IIDA 3SHPA 1M4GA 2FE7A 2Q04A 2J8MA 4UA3A 3DDDA 4FD6A 5G1ZA 4ZGYB 3TOBA 2F5IA 4UFXA 2X7BA 2ZW6A 2WPWA 1YREA 3W6XA 3IWEA 1Y7RA 1I12A 4ORFA 2D4PA 3N7ZA 3EY5A 5A28A 5EBVA 2DPTA 4H89A 2FL4A 3IU2A 3R9EA 4MJ8A 4KUAA 1XMTA 2EVNA 2OU2A 2PQ8A 3TOAA 4MFLA 4U5YA 2P6FA 4MFJA 4QBJA 3RYOA 3EC4A 2FCKA 4A2ZA 2FS5A 5DWMA 3F0AA 4KSFA 5C88A 1S60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC4 A;  2G3A A;  3QAH A;  1PU9 A;  4KZT A;  5HMN A;  2BSW A;  2G3T A;  3D2P A;  4QB9 A;  3DNS A;  1IYL A;  2OZG A;  1M4I A;  3P2H A;  1NE9 A;  1M1D A;  4M3S A;  2AE6 A;  4MY0 A;  4MY3 A;  4ZBG A;  3PGP A;  1NSL A;  4KOV A;  5IV0 A;  2ATR A;  3FXT A;  5KTC A;  2VZY A;  3CXP A;  4JLY A;  1YVK A;  4MI4 A;  5KTD A;  1QSN A;  1M44 A;  1R57 A;  3PZJ A;  3UY5 A;  1YGH A;  1SQH A;  3DR8 A;  2ZW7 A;  1KUY A;  4UBR A;  1MJB A;  2OZU A;  2D4O A;  4QUS A;  4U9Y A;  4RI1 A;  4XPD B;  1YK3 A;  5I0C A;  4NXY A;  2R8V A;  4IF5 A;  1V0C A;  3DSB A;  5JPH A;  2ZPA A;  3CXS A;  4H6Z A;  3S6F A;  5H86 A;  2QEC A;  1B87 A;  4E0A A;  2NMT A;  4XPD C;  3R95 A;  1Q2C A;  3TO9 A;  4PSX A;  4HNW B;  1K4J A;  2B5G B;  1QSR A;  2FIA A;  2ZW5 A;  5HH1 A;  3EO4 A;  4AG7 A;  1N71 A;  4B5P B;  4AVB A;  2FT0 A;  3TT2 A;  1S7N A;  2P0W A;  1IYK A;  3FYN A;  5GCN A;  2HUZ A;  4DNC A;  4KOW A;  4J3G A;  4JXR A;  3QB8 A;  4RS2 A;  2QIR A;  2FIW A;  2K5T A;  2R1I A;  2I79 A;  3WR7 A;  3G3S A;  2Z10 A;  3R96 A;  2OB0 A;  3LOD A;  2JLM A;  2OZH A;  4OAE A;  4KOR A;  2AJ6 A;  5ISV A;  1YLE A;  4B5O A;  2GAN A;  5DWN A;  1Z4R A;  3GYA A;  3R1K A;  1WWZ A;  4YGO A;  1Z4E A;  1I1D A;  4KOY A;  4M85 A;  3ZJ0 A;  4KUB A;  4CAX A;  3S6H A;  3TO7 A;  5J8C A;  1FY7 A;  2ZW4 A;  3LD2 A;  3H4Q A;  2BUE A;  2ZXV A;  3BJ8 A;  2CNT A;  4HNY B;  3S6G A;  5IX3 A;  3F8K A;  4YRH A;  4F6A A;  1XIX A;  1YR0 A;  4NSQ A;  4H6U A;  3R9G A;  2GIV A;  4LUA A;  4KOU A;  1B6B A;  2JEV A;  4JXQ A;  3IWG A;  1XF8 A;  5F49 A;  4I49 A;  3FRM A;  3ZZI A;  4UWJ A;  2DXQ A;  3W91 A;  3T9Y A;  2BL1 A;  2JDD A;  5F48 A;  3VWE A;  1KUX A;  3D2M A;  2PDO A;  2B5G A;  4LX9 A;  2R7H A;  3S6K A;  1MJA A;  1YX0 A;  2G0B A;  2VBQ A;  3GKR A;  3TTH A;  1VKC A;  4GS4 A;  3I9S A;  4AVA A;  2R98 A;  3FIX A;  4KLW A;  3E0K A;  2P6G A;  2HQY A;  4KOX A;  4XNH C;  1Q2D A;  4AG9 A;  5FVJ A;  4B5P A;  2Z0Z A;  1S7L A;  2B3V A;  4QC6 A;  1TIQ A;  2ARH A;  4U9Z A;  3D8P A;  2J8R A;  2CNM A;  4XPL A;  4L8A A;  1CJW A;  2REF A;  5IB0 A;  1U6M A;  2CNS A;  4NCZ A;  2PC1 A;  1VHS A;  4CAW A;  2H5M A;  3FBU A;  4X5K A;  3MGD A;  4E2A A;  2B3U A;  3C26 A;  3K9U A;  4KOS A;  1Y9W A;  1P0H A;  4JJX A;  2VEZ A;  3TO6 A;  1MK4 A;  4FD5 A;  1BOB A;  3DR6 A;  2IL4 A;  1RO5 A;  1LRZ A;  3D3S A;  3FB3 A;  4R3K A;  4II9 A;  4JD6 A;  2PR8 A;  4Y49 C;  1P4N A;  3KKW A;  3NE7 A;  2J8N A;  4UWI A;  3VWD A;  4R9M A;  4KOT A;  4L89 A;  5H84 A;  3BLN A;  4FD7 A;  1GHE A;  1XEB A;  1I21 A;  1WK4 A;  4AB7 A;  2Q4V A;  3P2F A;  4R87 A;  3PP9 A;  2VXK A;  2Q4Y A;  2Y0M A;  4CAV A;  2FXF A;  1RXT A;  1L0C A;  2RC4 A;  4XPK A;  3EXN A;  4FD4 A;  3SXO A;  3SXN A;  3BJ7 A;  3GY9 A;  2OH1 A;  2VQY A;  4NEX A;  2B58 A;  3B8G A;  4KVM E;  4HNX B;  2BEI A;  5CNP A;  1OZP A;  4CRY B;  2C27 A;  2Q0Y A;  2QML A;  4PK3 A;  1Z9U A;  2B4D A;  2Z11 A;  4CS0 B;  2Q7B A;  4MBU A;  4OAD A;  3T90 A;  3CXQ A;  2O28 A;  1PUA A;  4XNH B;  2KCW A;  1IB1 E;  1M4D A;  2WPX A;  4BMH A;  3JVN A;  1YVO A;  2VZZ A;  2PRB A;  2EUI A;  4R3L A;  1QSO A;  2Q44 A;  1S5K A;  3W6S A;  3G8W A;  1UFH A;  4PSW A;  3TE4 A;  3TFY A;  1NMT A;  3F5B A;  2PR1 A;  1S3Z A;  5E96 A;  1BO4 A;  2B4D B;  5C82 A;  1KZF A;  1MJ9 A;  2A4N A;  2I00 A;  2P6E A;  4KVO E;  5F47 A;  4R57 A;  3R9F A;  3V8I A;  1XE4 A;  3FNC A;  4MHD A;  4ONU A;  2GE3 A;  4PK2 A;  4CRZ B;  4F0Y A;  2CY2 A;  2JDC A;  1ON0 A;  4JWP A;  4EVY A;  4OLL A;  4IUS A;  4PV6 A;  4Y49 B;  5J8F A;  1Y9K A;  2REE A;  2HV2 A;  2PSW A;  4KVX A;  4QVT A;  1QST A;  3I3G A;  2FSR A;  1J4J A;  4K30 A;  1QSM A;  4E8O A;  3JUW A;  4AVC A;  1S7F A;  5F46 A;  2B4B A;  1CM0 A;  2VI7 A;  5JQ4 A;  4YFJ A;  5KTA A;  4KLV A;  4HKF A;  3EFA A;  3OWC A;  3IGR A;  1KUV A;  4NF1 A;  3TCV A;  1S7K A;  1Q2Y A;  1IIC A;  1IID A;  3SHP A;  1M4G A;  2FE7 A;  2Q04 A;  2J8M A;  4UA3 A;  3DDD A;  4FD6 A;  3TOB A;  2F5I A;  2X7B A;  2ZW6 A;  2WPW A;  1YRE A;  3W6X A;  1Y7R A;  1I12 A;  4ORF A;  2D4P A;  3N7Z A;  3EY5 A;  5EBV A;  4H89 A;  2FL4 A;  3R9E A;  4MJ8 A;  4KUA A;  1XMT A;  2EVN A;  2OU2 A;  2PQ8 A;  3TOA A;  4U5Y A;  2P6F A;  4QBJ A;  3RYO A;  3EC4 A;  2FCK A;  2FS5 A;  5DWM A;  3F0A A;  5C88 A;  1S60 A; 
#chains in the Genus database with same CATH topology
 5EC4 A;  2G3A A;  1BAV A;  2ZEP A;  3QAH A;  1YME A;  1HEE A;  3IIB A;  3WAB A;  2PIY A;  1R43 A;  1PU9 A;  2V8D A;  4NJR A;  4P10 A;  3RBU A;  4KZT A;  3IEH A;  4CAF A;  5HMN A;  2Q4Z A;  5DS0 A;  2BSW A;  2G3T A;  3D2P A;  4QB9 A;  5K8M A;  3DNS A;  2EO8 A;  2CXA A;  1IYL A;  3NE8 A;  2IMO A;  4NGS A;  1OBR A;  1JQG A;  2OZG A;  5HVG A;  1M4I A;  1CG2 A;  3P2H A;  1NE9 A;  1M1D A;  4Q36 A;  2OR4 A;  4R7M A;  2PJA A;  4FAI A;  4M3S A;  2AE6 A;  4CPA A;  4MY0 A;  4OC2 A;  4PXB A;  4MY3 A;  4P4F A;  2AFW A;  4ZBG A;  1XRY A;  3PGP A;  2PRQ A;  1NSL A;  4ZY0 A;  4KOV A;  1XMB A;  5IV0 A;  2ATR A;  3FXT A;  4AXV A;  5KTC A;  1ZG9 A;  3BI1 A;  2VZY A;  2EBJ A;  3CXP A;  4A31 A;  4JLY A;  4KSI A;  1YVK A;  4MFP A;  2GU2 A;  4MI4 A;  2ANP A;  5KTD A;  1QSN A;  1M44 A;  1R57 A;  3PB9 X;  3PZJ A;  3UY5 A;  1GYT A;  2V8V A;  4DYO A;  1YGH A;  1X12 A;  1HDQ A;  1SQH A;  3D67 A;  4BD9 A;  2AFO A;  2PJ4 A;  1TKF A;  3DR8 A;  2ZW7 A;  1LAP A;  1M4L A;  3VAT A;  2AFX A;  1KUY A;  2GRE A;  4UBR A;  4UCP A;  4NFR A;  5HVF A;  1MJB A;  3KL9 A;  2OOT A;  4B13 A;  2OZU A;  3ISX A;  2Q43 A;  3SJX A;  2D4O A;  4QUS A;  4U9Y A;  4ZX8 A;  4RI1 A;  4A37 A;  4NJQ A;  4O23 A;  3MRU A;  3LMS A;  4XPD B;  1YK3 A;  4C7H A;  2G9D A;  5I0C A;  1BLL E;  4NXY A;  3KHX A;  2R8V A;  2PJC A;  5EMI A;  4IF5 A;  1V0C A;  3DSB A;  5D29 A;  2ODF A;  2V77 A;  4H2K A;  5JPH A;  1XFO A;  2ZPA A;  3FEC A;  2PJ7 A;  5HVH A;  2PJB A;  1Q7L A;  3CXS A;  5JM6 A;  4H6Z A;  3S6F A;  4A30 A;  2WZN A;  3KQZ A;  2PJ9 A;  5H86 A;  2QEC A;  4B11 A;  2CTC A;  3KGQ A;  3D7D A;  3TX8 A;  1B87 A;  4C68 A;  4E0A A;  2NMT A;  2F7V A;  1EE3 P;  4XPD C;  2ZEG A;  3R95 A;  2V8H A;  1Q2C A;  3KQX A;  4PSX A;  3TO9 A;  4HNW B;  4CYQ A;  1K4J A;  2IQ6 A;  1AMP A;  2B5G B;  1CPS A;  2VL1 A;  1TKH A;  2PJ0 A;  3D7G A;  2QJ8 A;  1QSR A;  2FIA A;  4KSA A;  1HDU A;  4TNU A;  3QAY A;  4IAV A;  5AG7 A;  2J9A A;  3BI0 A;  2ZW5 A;  3CPX A;  2YGW A;  5HH1 A;  4UEF A;  2ZEL A;  3EO4 A;  2BO9 A;  5JGF A;  1TF9 A;  1BPM A;  4AG7 A;  1N71 A;  4B5P B;  1ELM P;  4P4I A;  4AVB A;  2QYV A;  4FUU A;  2FT0 A;  4YU9 A;  3B3W A;  2ZED A;  3TT2 A;  1S7N A;  2P0W A;  1IYK A;  1CP6 A;  2CTB A;  3FYN A;  1LOK A;  5GCN A;  5K8N A;  2HUZ A;  4DNC A;  1VGY A;  2C6G A;  4KOW A;  4J3G A;  4JXR A;  4IHM A;  2Z3N A;  3QB8 A;  5G20 A;  4RS2 A;  3K2K A;  2NSM A;  2QIR A;  2FIW A;  2K5T A;  2R1I A;  2I79 A;  3WR7 A;  3G3S A;  3IC1 A;  4CYP A;  2Z10 A;  3NH8 A;  3S9N A;  3KZW A;  3GUX A;  3R96 A;  3S9L A;  2OB0 A;  4C2Y A;  2PJ8 A;  3LOD A;  4P4E A;  4YWY A;  2JLM A;  2OZH A;  4OAE A;  4KOR A;  2AJ6 A;  5ISV A;  1YLE A;  2DF5 A;  2GAN A;  4B5O A;  2C1C A;  3D4U A;  3HLP A;  2PVW A;  5DWN A;  4GM5 A;  3PB7 X;  1Z4R A;  4UFV A;  4FBE A;  3GYA A;  4ONW A;  4BIN A;  2AFU A;  3R1K A;  4PXE A;  1WWZ A;  4YGO A;  3PB6 X;  4A38 A;  3KHZ A;  1Z4E A;  1I1D A;  4NGR A;  5G22 A;  4NGP A;  4OC3 A;  4P44 A;  4KOY A;  4R8F A;  4M85 A;  4P4J A;  4KUB A;  3ZJ0 A;  1JWQ A;  4CAX A;  3FH4 A;  3S6H A;  3TO7 A;  3H8E A;  1FY7 A;  2PJ1 A;  5J8C A;  2ZW4 A;  3LD2 A;  3H4Q A;  4ZY1 A;  3PEI A;  1AYE A;  2BUE A;  4HPS A;  1ZO0 A;  1DTD A;  4MXU A;  2ZXV A;  2Z3L A;  1X10 A;  4LQ6 A;  2JEW A;  3BJ8 A;  2CNT A;  2XEJ A;  4HNY B;  4B6Z A;  3S6G A;  3IJ3 A;  5CBM A;  5JH9 A;  4UIB A;  1XOV A;  2DPS A;  5IX3 A;  3D66 A;  2C6C A;  3F8K A;  2RB7 A;  4YRH A;  2AFS A;  4F6A A;  1LAN A;  1XIX A;  1YR0 A;  1IOF A;  4M6H A;  3CPA A;  4NSQ A;  4H6U A;  3R9G A;  2GIV A;  4MCS A;  4LUA A;  4M6I A;  1YLO A;  1H8L A;  2ZEF A;  4KOU A;  3B7I A;  1B6B A;  2JEV A;  4JXQ A;  3IWG A;  3V38 A;  1XF8 A;  5F49 A;  4I49 A;  4ZYQ A;  2PJ6 A;  3FRM A;  3N5F A;  4MHY A;  3ZZI A;  4TWE A;  3BXM A;  4UWJ A;  2DXQ A;  3W91 A;  3T9Y A;  2BL1 A;  2JDD A;  5F48 A;  3VWE A;  1KUX A;  3D2M A;  5F09 A;  2AFZ A;  2PDO A;  4R6T A;  4CGN A;  4MHN A;  2B5G A;  1CP7 A;  2R7H A;  3JTK A;  4LX9 A;  3S6K A;  1MJA A;  5LYI A;  1YX0 A;  4P6Y A;  5HXD A;  2PJ2 A;  2G0B A;  2VBQ A;  3GKR A;  3TTH A;  5K8P A;  1VKC A;  3KI9 A;  3I9S A;  4GS4 A;  4AVA A;  1QQ9 A;  2R98 A;  3FIX A;  4KLW A;  3E0K A;  3PFE A;  4W9Y A;  4X3R A;  2C6P A;  5ELY A;  4CGL A;  3WC7 A;  2P6G A;  2HQY A;  1IGB A;  1LAM A;  4FWU A;  4KOX A;  4XNH C;  4B12 A;  4F9U A;  1QMU A;  4OKO A;  1Q2D A;  4UEZ A;  3FVL A;  1YW6 A;  5FVJ A;  3VAR A;  4AG9 A;  4B5P A;  1Z8X A;  5LYD A;  2POK A;  4K3N A;  2Z0Z A;  3NFZ A;  1S7L A;  2B3V A;  4QC6 A;  4UEE A;  1TIQ A;  5A27 A;  4MFK A;  1ZLH A;  2O4H A;  4MHP A;  4JZ0 A;  1ZG7 A;  3SJG A;  2ARH A;  4U9Z A;  3D8P A;  4RUH A;  3FED A;  4BBH A;  3PB8 X;  4UF4 A;  1F57 A;  2ZOF A;  2Q7S A;  2CF4 A;  2J8R A;  2CNM A;  3IU1 A;  4XPL A;  1Z8T A;  2PJ3 A;  4L8A A;  1CJW A;  2REF A;  1CPX A;  1FT7 A;  5IB0 A;  3H8G A;  4LQG A;  1U6M A;  1YSJ A;  2CNS A;  2DEA A;  2YND A;  2PJ5 A;  4NCZ A;  3WC5 A;  1NSA A;  2PC1 A;  1VHS A;  3B2Y A;  2H5M A;  3RZA A;  3FBU A;  4X5K A;  1F2P A;  3MGD A;  3TC8 A;  4CAW A;  1TKJ A;  4E2A A;  2B3U A;  4UIA A;  3C26 A;  3K9U A;  3FEE A;  1Y9W A;  1P0H A;  2F8H A;  4KOS A;  5AG6 A;  4JJX A;  2VEZ A;  3TO6 A;  1MK4 A;  4A39 A;  1F2O A;  4NGQ A;  2WYR A;  2XEI A;  4FD5 A;  1BOB A;  3DR6 A;  3S9M A;  4EWT A;  3DGV A;  2IL4 A;  3CDX A;  1RO5 A;  1LRZ A;  2XEG A;  2ZEE A;  3D3S A;  3FB3 A;  3LWU A;  1DE4 C;  4OC5 A;  4R3K A;  4A32 A;  4F9V A;  4JD6 A;  2PR8 A;  4JYW A;  1P4N A;  4MFQ A;  2NYQ A;  3KKW A;  3NE7 A;  4Y49 C;  4CGO A;  2J8N A;  1IU8 A;  2WSA A;  2ZEH A;  4UWI A;  4B14 A;  3SI1 A;  3VWD A;  3NH5 A;  4R9M A;  4KOT A;  1Z5R A;  4OIW A;  2PE3 A;  4L89 A;  5H84 A;  3BLN A;  4FD7 A;  3D68 A;  3A9L A;  4NGM A;  4ZX9 A;  2Z3P A;  1GHE A;  2BCO A;  2O53 A;  3PRT A;  1XEB A;  3PBB A;  1I21 A;  1WK4 A;  5AG5 A;  4ZY2 A;  4AB7 A;  2Q4V A;  4OME A;  1CBX A;  3P2F A;  4R87 A;  3PP9 A;  2VXK A;  3IFE A;  4MFZ A;  2Q4Y A;  3BHX A;  5AGE A;  2Y0M A;  2HB6 A;  2FVG A;  2YNC C;  3IWW A;  4WWV A;  4CAV A;  2FXF A;  1RXT A;  1L0C A;  2RC4 A;  4XPK A;  6CPA A;  3EXN A;  2I3C A;  4PPZ A;  4A95 A;  4X2T A;  4FD4 A;  3SXO A;  3SXN A;  3BJ7 A;  5LRK A;  2YNE A;  3GY9 A;  2JBK A;  5LRG A;  3PB4 X;  5CPA A;  2OH1 A;  2RFH A;  2VQY A;  3B3C A;  4NEX A;  3KAS A;  2B58 A;  5AG4 A;  1A2Z A;  4UCM A;  3B8G A;  4EME A;  4KVM E;  2EK8 A;  3GLJ A;  4HNX B;  2BEI A;  2Q51 A;  2PVV A;  3RO0 A;  4C2X A;  1UWY A;  5CNP A;  1CX8 A;  1OZP A;  3FF3 A;  1PCA A;  4CRY B;  4X8I A;  3IO1 A;  2ZOG A;  3L2N A;  1YQE A;  5G21 A;  2C27 A;  1KWM A;  1ARL A;  2Q0Y A;  1Y7E A;  2PIZ A;  2HC9 A;  2QML A;  3LAC A;  1FNO A;  1Z9U A;  4PK3 A;  3WT4 A;  4CGP A;  3I1U A;  1Z8L A;  1VHE A;  2B4D A;  3H8F A;  2Z11 A;  4UFW A;  4C2Z A;  4CS0 B;  4DJL A;  5LYF A;  4P4B A;  2Q7B A;  4MBU A;  4DUK A;  3D7F A;  4OAD A;  3FX6 A;  3T90 A;  3CXQ A;  5J1Q A;  1AUG A;  1Z8W A;  3MN8 A;  2O28 A;  1PUA A;  4XNH B;  2KCW A;  4OC1 A;  4F0X A;  1IB1 E;  4UCN A;  1M4D A;  2WPX A;  4BMH A;  3JVN A;  1YVO A;  4C7I A;  4CGM A;  5K8O A;  5D8N A;  2VZZ A;  3SJF A;  2PRB A;  2EUI A;  3JRU A;  4PQA A;  4R3L A;  4F8Z A;  1QSO A;  2Q44 A;  1S5K A;  2Z3O A;  4Q7A A;  4GXH A;  5LRJ A;  3W6S A;  3G8W A;  3CZX A;  1UFH A;  4Z65 A;  4PSW A;  4CYO A;  4CAE A;  5LYL A;  3TE4 A;  3TFY A;  2GLF A;  2WUU A;  1NMT A;  3F5B A;  1XBU A;  2EK9 A;  2PR1 A;  1S3Z A;  5E96 A;  1BO4 A;  2B4D B;  3FJU A;  4M6G A;  5C82 A;  1ARM A;  1Z2L A;  1KZF A;  1MJ9 A;  2A4N A;  2I00 A;  4NGN A;  2P6E A;  4P4D A;  8CPA A;  4MCP A;  3H5Z A;  4KVO E;  5F47 A;  3B3S A;  4R57 A;  4Q38 A;  3R9F A;  1LCP A;  3V8I A;  4A94 A;  1XE4 A;  2Z3M A;  4OC4 A;  3FNC A;  4MHD A;  2Z3K A;  2ABZ A;  2YNC A;  4KS9 A;  4ONU A;  5IB9 A;  4G1P A;  2GE3 A;  2V8G A;  4PK2 A;  4CRZ B;  1ZG8 A;  4F0Y A;  2CY2 A;  2JDC A;  4A33 A;  5BWA B;  1ON0 A;  4JWP A;  4EVY A;  5I4M A;  4OLL A;  3NA6 A;  7CPA A;  4IUS A;  4PV6 A;  4Y49 B;  5J8F A;  1Y9K A;  4MHZ A;  1PYT B;  2REE A;  3B3T A;  4MCR A;  2HV2 A;  2PSW A;  2ZEN A;  4KVX A;  3KR4 A;  4QVT A;  4CYN A;  1QST A;  3CT9 A;  3I3G A;  2FSR A;  4B10 A;  1XJO A;  1J4J A;  4K30 A;  4ZI6 A;  4II9 A;  1QSM A;  4E8O A;  3HUV A;  2GLJ A;  4NGT A;  3VH9 A;  3JUW A;  4AVC A;  3K9T A;  2CIJ A;  3RAM A;  1Y0Y A;  1YW4 A;  5THW A;  1S7F A;  5F46 A;  2B4B A;  2QVP A;  3GB0 A;  3RNZ A;  1CM0 A;  1ZLI A;  2VI7 A;  3SI2 A;  2ZEM A;  5JQ4 A;  4YFJ A;  5KTA A;  4KLV A;  3FMC A;  4HKF A;  4WJB A;  3EFA A;  1VIX A;  2GFQ A;  3OWC A;  3IGR A;  4OC0 A;  3SI0 A;  1KUV A;  3KR5 A;  4MMO A;  4NF1 A;  3TCV A;  3B35 A;  1Y0R A;  1S7K A;  1Q2Y A;  1IIC A;  1IID A;  3SHP A;  1M4G A;  2FE7 A;  2Q04 A;  3WC6 A;  3V7Z A;  2J8M A;  3ISZ A;  3DLJ A;  4UA3 A;  3DDD A;  4FD6 A;  5G1Z A;  4ZGY B;  3TOB A;  2F5I A;  4UFX A;  2X7B A;  1VHO A;  2ZW6 A;  2WPW A;  1YRE A;  3W6X A;  3IWE A;  1Y7R A;  4OP4 A;  1ELL P;  1I12 A;  3NH4 A;  2IJZ A;  4ORF A;  4MRI A;  2D4P A;  3N7Z A;  4EFD A;  3EY5 A;  4R76 A;  3B3V A;  4OID A;  5A28 A;  2EWB A;  1TF8 A;  3PFO A;  3QNV A;  1R3N A;  5EBV A;  2DPT A;  4H89 A;  4P45 A;  2FL4 A;  3IU2 A;  4PXC A;  3R9E A;  3PBE A;  4MJ8 A;  4KUA A;  3T8W A;  1IY7 A;  1XMT A;  2EVN A;  2OU2 A;  2PQ8 A;  1IOI A;  2ZEO A;  4PXD A;  3TOA A;  4MFL A;  3D7H A;  3GIU A;  1TXR A;  2XEF A;  4U5Y A;  3SJE A;  1RTQ A;  2P6F A;  4MFJ A;  1LFW A;  4RN7 A;  4QBJ A;  3RYO A;  2JBJ A;  3EC4 A;  4MCQ A;  2FCK A;  1BPN A;  2PCU A;  4A2Z A;  2FS5 A;  2BOA A;  5DWM A;  2AFM A;  3F0A A;  4KSF A;  5C88 A;  1S60 A;  4IK2 A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  2G3A A;  3QAH A;  1PU9 A;  4CAF A;  4KZT A;  5HMN A;  2BSW A;  2G3T A;  3D2P A;  4QB9 A;  3DNS A;  2CXA A;  1IYL A;  2OZG A;  1M4I A;  3P2H A;  1NE9 A;  1M1D A;  4Q36 A;  4M3S A;  2AE6 A;  4MY0 A;  4MY3 A;  4ZBG A;  3PGP A;  1NSL A;  4KOV A;  5IV0 A;  2ATR A;  3FXT A;  5KTC A;  2VZY A;  3CXP A;  4A31 A;  4JLY A;  1YVK A;  4MFP A;  4MI4 A;  5KTD A;  1QSN A;  1M44 A;  1R57 A;  3PZJ A;  3UY5 A;  1YGH A;  1SQH A;  3DR8 A;  2ZW7 A;  1KUY A;  4UBR A;  4UCP A;  1MJB A;  4B13 A;  2OZU A;  2D4O A;  4QUS A;  4U9Y A;  4RI1 A;  4XPD B;  1YK3 A;  4C7H A;  5I0C A;  4NXY A;  2R8V A;  4IF5 A;  1V0C A;  3DSB A;  5JPH A;  2ZPA A;  3CXS A;  4H6Z A;  3S6F A;  4A30 A;  5H86 A;  2QEC A;  4B11 A;  1B87 A;  4C68 A;  4E0A A;  2NMT A;  4XPD C;  3R95 A;  1Q2C A;  3TO9 A;  4PSX A;  4HNW B;  4CYQ A;  1K4J A;  2B5G B;  1QSR A;  2FIA A;  4KSA A;  5AG7 A;  2ZW5 A;  2YGW A;  5HH1 A;  3EO4 A;  4AG7 A;  1N71 A;  4B5P B;  4AVB A;  2FT0 A;  3TT2 A;  1S7N A;  2P0W A;  1IYK A;  3FYN A;  5GCN A;  2HUZ A;  4DNC A;  4KOW A;  4J3G A;  4JXR A;  2Z3N A;  3QB8 A;  5G20 A;  4RS2 A;  2QIR A;  2FIW A;  2K5T A;  2R1I A;  2I79 A;  3WR7 A;  3G3S A;  4CYP A;  2Z10 A;  3R96 A;  2OB0 A;  4C2Y A;  3LOD A;  2JLM A;  2OZH A;  4OAE A;  4KOR A;  2AJ6 A;  5ISV A;  1YLE A;  4B5O A;  2GAN A;  5DWN A;  1Z4R A;  4UFV A;  3GYA A;  3R1K A;  1WWZ A;  4YGO A;  5G22 A;  1Z4E A;  1I1D A;  4KOY A;  4M85 A;  3ZJ0 A;  4KUB A;  4CAX A;  3S6H A;  3TO7 A;  5J8C A;  1FY7 A;  2ZW4 A;  3LD2 A;  3H4Q A;  2BUE A;  1ZO0 A;  2ZXV A;  2Z3L A;  3BJ8 A;  2CNT A;  4HNY B;  3S6G A;  2DPS A;  5IX3 A;  3F8K A;  4YRH A;  4F6A A;  1XIX A;  1YR0 A;  4NSQ A;  4H6U A;  3R9G A;  2GIV A;  4LUA A;  4KOU A;  1B6B A;  2JEV A;  4JXQ A;  3IWG A;  1XF8 A;  5F49 A;  4I49 A;  3FRM A;  3ZZI A;  4UWJ A;  2DXQ A;  3W91 A;  3T9Y A;  2BL1 A;  2JDD A;  5F48 A;  3VWE A;  1KUX A;  3D2M A;  2PDO A;  4CGN A;  2B5G A;  4LX9 A;  2R7H A;  3JTK A;  3S6K A;  1MJA A;  1YX0 A;  2G0B A;  2VBQ A;  3GKR A;  3TTH A;  1VKC A;  4GS4 A;  3I9S A;  4AVA A;  2R98 A;  3FIX A;  4KLW A;  3E0K A;  4CGL A;  2P6G A;  2HQY A;  4KOX A;  4B12 A;  4XNH C;  1Q2D A;  4AG9 A;  5FVJ A;  4B5P A;  2Z0Z A;  1S7L A;  2B3V A;  4QC6 A;  1TIQ A;  5A27 A;  4MFK A;  2ARH A;  4U9Z A;  3D8P A;  4BBH A;  3IU1 A;  2J8R A;  2CNM A;  4XPL A;  4L8A A;  1CJW A;  2REF A;  5IB0 A;  1U6M A;  2YND A;  2CNS A;  4NCZ A;  2PC1 A;  1VHS A;  4CAW A;  2H5M A;  3FBU A;  4X5K A;  3MGD A;  4E2A A;  2B3U A;  3C26 A;  3K9U A;  4KOS A;  1Y9W A;  1P0H A;  5AG6 A;  4JJX A;  2VEZ A;  3TO6 A;  1MK4 A;  4FD5 A;  1BOB A;  3DR6 A;  2IL4 A;  1RO5 A;  1LRZ A;  3D3S A;  3FB3 A;  4A32 A;  4R3K A;  4II9 A;  4JD6 A;  2PR8 A;  4Y49 C;  1P4N A;  4MFQ A;  4CGO A;  3KKW A;  3NE7 A;  2J8N A;  4UWI A;  2WSA A;  4B14 A;  3VWD A;  4R9M A;  4KOT A;  4L89 A;  5H84 A;  3BLN A;  4FD7 A;  3A9L A;  2Z3P A;  1GHE A;  1XEB A;  1I21 A;  1WK4 A;  5AG5 A;  4AB7 A;  2Q4V A;  3P2F A;  4R87 A;  3PP9 A;  2VXK A;  4MFZ A;  2Q4Y A;  5AGE A;  2Y0M A;  4CAV A;  2YNC C;  2FXF A;  1RXT A;  1L0C A;  2RC4 A;  4XPK A;  3EXN A;  4A95 A;  4FD4 A;  3SXO A;  3SXN A;  3BJ7 A;  2YNE A;  3GY9 A;  5AG4 A;  2OH1 A;  2VQY A;  4NEX A;  2B58 A;  4UCM A;  3B8G A;  4KVM E;  4HNX B;  2BEI A;  4C2X A;  5CNP A;  1OZP A;  4CRY B;  5G21 A;  2C27 A;  2Q0Y A;  2QML A;  4PK3 A;  1Z9U A;  4CGP A;  2B4D A;  2Z11 A;  4UFW A;  4C2Z A;  4CS0 B;  2Q7B A;  4MBU A;  4OAD A;  3T90 A;  3CXQ A;  2O28 A;  1PUA A;  4XNH B;  2KCW A;  4F0X A;  1IB1 E;  4UCN A;  1M4D A;  2WPX A;  4BMH A;  3JVN A;  1YVO A;  4C7I A;  4CGM A;  2VZZ A;  2PRB A;  2EUI A;  4R3L A;  1QSO A;  2Q44 A;  1S5K A;  2Z3O A;  3W6S A;  3G8W A;  1UFH A;  4PSW A;  4CYO A;  4CAE A;  3TE4 A;  3TFY A;  2WUU A;  1NMT A;  3F5B A;  2PR1 A;  1S3Z A;  5E96 A;  1BO4 A;  2B4D B;  5C82 A;  1KZF A;  1MJ9 A;  2A4N A;  2I00 A;  2P6E A;  3H5Z A;  4KVO E;  5F47 A;  4R57 A;  4Q38 A;  3R9F A;  3V8I A;  1XE4 A;  2Z3M A;  3FNC A;  4MHD A;  2Z3K A;  2YNC A;  4KS9 A;  4ONU A;  2GE3 A;  4PK2 A;  4CRZ B;  4F0Y A;  2CY2 A;  2JDC A;  4A33 A;  5BWA B;  1ON0 A;  4JWP A;  4EVY A;  4OLL A;  4IUS A;  4PV6 A;  4Y49 B;  5J8F A;  1Y9K A;  2REE A;  2HV2 A;  2PSW A;  4KVX A;  4QVT A;  4CYN A;  1QST A;  3I3G A;  2FSR A;  4B10 A;  1J4J A;  4K30 A;  1QSM A;  4E8O A;  3JUW A;  4AVC A;  1S7F A;  5F46 A;  2B4B A;  1CM0 A;  2VI7 A;  5JQ4 A;  4YFJ A;  5KTA A;  4KLV A;  4HKF A;  3EFA A;  3OWC A;  3IGR A;  1KUV A;  4NF1 A;  3TCV A;  1S7K A;  1Q2Y A;  1IIC A;  1IID A;  3SHP A;  1M4G A;  2FE7 A;  2Q04 A;  2J8M A;  4UA3 A;  3DDD A;  4FD6 A;  5G1Z A;  4ZGY B;  3TOB A;  2F5I A;  4UFX A;  2X7B A;  2ZW6 A;  2WPW A;  1YRE A;  3W6X A;  3IWE A;  1Y7R A;  1I12 A;  4ORF A;  2D4P A;  3N7Z A;  3EY5 A;  5A28 A;  5EBV A;  2DPT A;  4H89 A;  2FL4 A;  3IU2 A;  3R9E A;  4MJ8 A;  4KUA A;  1XMT A;  2EVN A;  2OU2 A;  2PQ8 A;  3TOA A;  4MFL A;  4U5Y A;  2P6F A;  4MFJ A;  4QBJ A;  3RYO A;  3EC4 A;  2FCK A;  4A2Z A;  2FS5 A;  5DWM A;  3F0A A;  4KSF A;  5C88 A;  1S60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...