4KVOE

The nata (naa10p/naa15p) amino-terminal acetyltrasferase complex bound to accoa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
molecule keywords N-terminal acetyltransferase A complex subunit nat1
molecule tags Transferase
source organism Schizosaccharomyces pombe
total genus 44
structure length 153
sequence length 153
chains with identical sequence F, G, H
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvoE00
5J8CA 5GCNA 2VQYA 1CM0A 1Y9WA 2ZW5A 1V0CA 3WR7A 3UY5A 4F0YA 4LUAA 1MK4A 4KOYA 4PSXA 2VI7A 5HH1A 4JJXA 2B4DB 2EUIA 1CJWA 2B4DA 1M4GA 1Z4RA 1Z9UA 4AVBA 3TOAA 2HUZA 2WPWA 5E96A 2ARHA 1XEBA 3W6XA 4I49A 3S6KA 4E2AA 4M85A 4EVYA 4RS2A 4XNHC 5IV0A 2IL4A 3GY9A 2B3UA 4R3KA 1VHSA 4CRZB 1Q2CA 4PV6A 3JUWA 4MY3A 5F46A 4KZTA 4QB9A 5IB0A 4IF5A 1OZPA 4CAWA 2BEIA 2VZZA 2Z11A 3D3SA 4AG9A 3GKRA 4LX9A 3CXPA 5F48A 2G3AA 4ONUA 1NMTA 4UWIA 1Y7RA 5H86A 3GYAA 2B5GB 4Y49B 1I12A 4JWPA 1LRZA 4Y49C 1N71A 2Z10A 5FVJA 1IIDA 4KUAA 2BSWA 2OZHA 4XPDC 2PDOA 4AB7A 2OZGA 3I3GA 4CRYB 4H6UA 4OAEA 4U9ZA 3K9UA 2R7HA 1QSNA 1MJ9A 4L89A 2F5IA 4MHDA 4E0AA 4HNYB 1M1DA 2P0WA 2WPXA 4UA3A 2VEZA 2JEVA 1ON0A 1MJAA 4AVCA 2B58A 2PC1A 2CNSA 4FD5A 4XPLA 2KCWA 1Q2DA 5HMNA 1RXTA 1B6BA 4OADA 2PR1A 4FD4A 4FD6A 5JQ4A 4JD6A 3S6HA 3ZJ0A 2FE7A 4OLLA 1J4JA 4KVME 3FNCA 1WWZA 1KUXA 1SQHA 1M44A 4CAVA 3W91A 1GHEA 1XF8A 3C26A 3EFAA 4J3GA 4MJ8A 4JLYA 3DDDA 4JXQA 3S6FA 2AJ6A 4GS4A 2CY2A 4KUBA 2PQ8A 2FT0A 4PSWA 4AVAA 5CNPA 2I00A 3FYNA 1S7FA 2HV2A 4CS0B 3TFYA 3D2PA 2ZXVA 3VWEA 2GANA 1KUYA 3IWGA 1YGHA 5F47A 5IX3A 2PSWA 4R57A 3H4QA 1XIXA 1NSLA 2C27A 1BOBA 4U9YA 3R1KA 3T9YA 4X5KA 5F49A 2ZW7A 2REEA 4R3LA 5C88A 2Q4YA 2VBQA 2D4OA 3CXQA 4QBJA 1B87A 3CXSA 3OWCA 1TIQA 2HQYA 2O28A 2P6EA 2X7BA 4HNWB 3SHPA 5KTAA 1IB1E 4MBUA 1S7NA 2A4NA 2P6GA 4KOXA 2B4BA 3SXOA 1U6MA 1VKCA 1P4NA 1NE9A 5JPHA 4NSQA 1QSOA 4B5PB 2FIAA 2J8NA 1QSTA 3TO7A 2J8RA 4B5PA 4HKFA 5KTDA 4KORA 3JVNA 3P2FA 3QB8A 4QVTA 3R9GA 2JLMA 2G3TA 4YRHA 1IYKA 2D4PA 2Z0ZA 1PUAA 2R8VA 3EC4A 4R87A 3TTHA 1RO5A 1FY7A 2REFA 2GE3A 1M4DA 4H89A 4F6AA 2NMTA 4MI4A 1Y9KA 1MJBA 2OU2A 1QSMA 4CAXA 1YVOA 2ATRA 4XPKA 2Q7BA 4U5YA 2OZUA 1XMTA 3DR8A 3P2HA 2AE6A 4KOVA 2B3VA 1R57A 2CNMA 3KKWA 4JXRA 2Q0YA 4YGOA 1QSRA 3F8KA 2ZW4A 3TCVA 4MY0A 2FSRA 1S7LA 4II9A 2RC4A 2PR8A 2R98A 3MGDA 4HNXB 3EO4A 3B8GA 2ZW6A 1WK4A 1IICA 1KUVA 2VXKA 4H6ZA 4B5OA 3BLNA 4K30A 4KVXA 3TO6A 1KZFA 2QMLA 3R9FA 4KOTA 2JDCA 1YR0A 1S3ZA 4NXYA 3BJ8A 2Q4VA 2DXQA 4ORFA 3FBUA 3G3SA 5I0CA 2G0BA 2OB0A 3D2MA 2FXFA 4ZBGA 2FCKA 3R96A 3DR6A 3LODA 3F5BA 5EC4A 3PP9A 2FL4A 3G8WA 4FD7A 3V8IA 1S7KA 4BMHA 3E0KA 1S60A 1YK3A 2FS5A 3S6GA 3EXNA 5KTCA 1L0CA 1S5KA 1IYLA 2Y0MA 2BUEA 3FIXA 3ZZIA 3TOBA 3FB3A 3TE4A 1M4IA 4KVOE 1YREA 4XNHB 2FIWA 4KLWA 3RYOA 2Q44A 3IGRA 2OH1A 4NEXA 4IUSA 2QECA 2H5MA 3PGPA 3NE7A 1UFHA 3EY5A 1YX0A 4M3SA 4E8OA 2BL1A 2K5TA 4KLVA 4NF1A 2Q04A 3N7ZA 2CNTA 2JDDA 3BJ7A 2GIVA 3VWDA 3T90A 3D8PA 3TO9A 4RI1A 3W6SA 1YVKA 1YLEA 2I79A 4UWJA 2P6FA 4NCZA 3F0AA 3DNSA 4YFJA 5C82A 1XE4A 2R1IA 4DNCA 2B5GA 3R95A 3TT2A 5ISVA 3I9SA 3FXTA 4AG7A 4XPDB 1I21A 5DWNA 4PK2A 4L8AA 3PZJA 3DSBA 4UBRA 2ZPAA 5EBVA 3FRMA 4KOSA 4R9MA 1Q2YA 2EVNA 3LD2A 1BO4A 4PK3A 2VZYA 5J8FA 1Z4EA 4QUSA 2QIRA 4QC6A 3SXNA 1I1DA 5DWMA 3QAHA 2PRBA 1K4JA 4KOWA 5H84A 3R9EA 4KOUA 1PU9A 2J8MA 1P0HA
chains in the Genus database with same CATH superfamily
2NSMA 3PFEA 1YQEA 5J8CA 5GCNA 2VQYA 1CM0A 1DTDA 1Y9WA 2C6CA 2ZW5A 2ODFA 1V0CA 4NGSA 5EMIA 3WR7A 4A94A 2C6PA 2PVWA 4A38A 2YNCA 4CAFA 3CZXA 3UY5A 4F0YA 4MXUA 1ARLA 4LUAA 1MK4A 4KOYA 5K8PA 4PSXA 1VHEA 5LYFA 2VI7A 4MRIA 5HH1A 2GFQA 2BO9A 2PJ8A 2B4DB 2DPTA 2EUIA 4JJXA 3T8WA 5CBMA 1CJWA 4UCNA 2B4DA 4ZX8A 1Y0YA 1R3NA 1M4GA 1Z4RA 6CPAA 1Z9UA 2RFHA 2ZEGA 4AVBA 3KASA 3TOAA 2HUZA 4MFQA 2WPWA 2POKA 5E96A 2V8VA 2ARHA 1XEBA 4A95A 2PJBA 3W6XA 1LOKA 1ZLIA 4UFXA 4BINA 2ZELA 4I49A 3S6KA 3MRUA 4A39A 4E2AA 4M85A 4EVYA 3PFOA 4RS2A 4XNHC 4NGPA 4CGNA 1AUGA 2ZEDA 3SI0A 5IV0A 2IL4A 3GY9A 4C68A 2B3UA 2YNDA 4CYPA 4B14A 4R3KA 1VHSA 4OC3A 4CRZB 1Q2CA 4PV6A 3K2KA 3JUWA 3H8GA 3IWWA 4MY3A 5F46A 2Z3NA 4KZTA 4MCQA 4PXCA 4QB9A 5IB0A 2GU2A 2IQ6A 4IF5A 1OZPA 4CAWA 2BEIA 5HVFA 2VZZA 5JQ4A 2I3CA 1VGYA 2Z11A 3D3SA 4A30A 4IK2A 3CPXA 4AG9A 2RB7A 3GKRA 4NJQA 4DJLA 4ZI6A 3BHXA 3FECA 3IU2A 3CXPA 4LX9A 4MHZA 3WC7A 5F09A 1JQGA 4ONWA 3D7HA 3FEEA 2CXAA 2G3AA 3NFZA 5F48A 4B13A 3CT9A 4P6YA 4ONUA 4BBHA 5HVHA 1NMTA 4UWIA 2OOTA 1Y7RA 2Q43A 1CG2A 3BI0A 4P10A 5H86A 3GYAA 2ZEMA 1A2ZA 2B5GB 2XEJA 4Y49B 4P4EA 1I12A 4JWPA 2PE3A 1TF8A 1LRZA 3CDXA 4Y49C 1N71A 3PRTA 2Z10A 4B6ZA 1CBXA 3FH4A 3KZWA 2AFUA 5FVJA 3IWEA 2GLJA 1IIDA 4MHNA 4R7MA 3H8EA 4KUAA 1AYEA 4LQGA 5D8NA 2BSWA 2OZHA 8CPAA 4XPDC 2PDOA 4MCPA 5ELYA 4AB7A 2OZGA 3I3GA 2ZEOA 4CRYB 4H6UA 4OAEA 2ZOFA 3FX6A 4U9ZA 3K9UA 5IB9A 3I1UA 4P4DA 5LYDA 2R7HA 1QSNA 1MJ9A 4C7IA 4L89A 3KQZA 2PJCA 2GLFA 2F5IA 2F7VA 4MHDA 4E0AA 4HNYB 1M1DA 5J1QA 2WZNA 2P0WA 1YMEA 4KSAA 2WPXA 3FF3A 4UA3A 2VEZA 2JEVA 1ON0A 2XEFA 5THWA 3PB4X 4X2TA 5G20A 1MJAA 4OC0A 4MMOA 4AVCA 2B58A 3TC8A 3KI9A 4FUUA 4R6TA 4CGPA 1F57A 2PC1A 4P45A 1LFWA 2CNSA 4FD5A 4XPLA 2KCWA 2AFZA 1Q2DA 2Z3KA 2PJ9A 2PJ0A 3KHZA 3V7ZA 1RXTA 5HMNA 4C2XA 1B6BA 1VHOA 4X8IA 4OADA 1FT7A 4Z65A 4DUKA 2PR1A 4UFWA 1YW4A 4FD4A 3NH8A 3VATA 4FD6A 3K9TA 4UWJA 1Y0RA 2XEIA 4JD6A 4MFLA 5I4MA 4WWVA 3S6HA 2O53A 2FE7A 3ZJ0A 1BLLE 3QNVA 4OLLA 4X3RA 4R8FA 2PJAA 4GM5A 3PEIA 2V8GA 1J4JA 3KHXA 4GXHA 4KVME 1XBUA 3D7DA 3FNCA 1WWZA 2YNCC 3KL9A 4G1PA 4P4JA 5JM6A 1KUXA 5AG7A 3SJXA 1SQHA 1M44A 4JZ0A 3W91A 4CAVA 1GHEA 1XF8A 3C26A 3EFAA 4J3GA 4MHPA 4MJ8A 4JLYA 1BPMA 4PXEA 2ABZA 3DDDA 4NGRA 4JXQA 3S6FA 2AJ6A 4GS4A 2CY2A 4KUBA 3RAMA 2PQ8A 2FT0A 4PSWA 4AVAA 2JBJA 3JTKA 5CNPA 2I00A 3LMSA 1ZLHA 2AFMA 2PJ5A 1S7FA 3FYNA 4KSIA 3VARA 1Z2LA 2HV2A 4CS0B 3TFYA 3D2PA 4PXDA 2DEAA 4KSFA 2ZXVA 3VWEA 2GANA 4UCPA 1KUYA 2O4HA 3IWGA 3KR5A 1YGHA 1F2PA 4F9UA 4A32A 5F47A 2OR4A 4PQAA 2J9AA 5IX3A 4ZY1A 4NGTA 2PJ2A 2PSWA 3IEHA 2NYQA 3KQXA 4R57A 3H4QA 1XIXA 1TKJA 2JBKA 1NSLA 2C27A 4P4BA 1BOBA 4U9YA 3R1KA 3T9YA 4CAEA 3B7IA 2ZEEA 4X5KA 4EWTA 5F49A 2ZW7A 1M4LA 3D68A 3B35A 2REEA 3B3CA 4R3LA 5D29A 2Q4YA 5C88A 3S9NA 1UWYA 4F8ZA 2VBQA 2D4OA 2PJ6A 4PXBA 1LANA 3CXQA 4A37A 4OMEA 3SI2A 4CGOA 4KS9A 3DGVA 4QBJA 1B87A 3ISXA 3IC1A 3CXSA 3FJUA 3OWCA 5LRKA 1TIQA 4M6IA 2HQYA 2O28A 3SI1A 2P6EA 2X7BA 5AGEA 4HNWB 1Z5RA 3GB0A 3SHPA 5JH9A 2DF5A 5KTAA 1IB1E 2V8DA 4MBUA 1S7NA 2A4NA 2CTBA 2P6GA 1HEEA 2Z3LA 3D67A 4KOXA 5CPAA 4B11A 2FVGA 2B4BA 4UIBA 3RBUA 1CP7A 3SXOA 5G1ZA 1ZG9A 1U6MA 1VKCA 3NH5A 2PVVA 3SJEA 1Z8LA 1P4NA 1NE9A 2ZEFA 5JPHA 4NSQA 1QSOA 1X10A 2CIJA 2FIAA 3D4UA 4B5PB 2J8NA 1QSTA 3TO7A 4FWUA 4A31A 2J8RA 4MFPA 4B5PA 4HKFA 5KTDA 4KORA 4IHMA 3JVNA 3RO0A 4MFZA 3P2FA 4NGQA 5LYIA 1CPXA 4UEFA 4ZY2A 3RNZA 2GREA 1R43A 3QB8A 4QVTA 3WC5A 5K8OA 3IIBA 3R9GA 3BXMA 2JEWA 3SJGA 1Q7LA 2JLMA 2G3TA 3CPAA 2QYVA 3PBBA 4YRHA 1ZO0A 1IYKA 2D4PA 2Z0ZA 4PPZA 2EK9A 1PUAA 2EO8A 2R8VA 3EC4A 2Q51A 2BOAA 4R87A 4UEEA 4F9VA 3NE8A 3TTHA 1X12A 3V38A 4CYOA 3JRUA 5K8NA 2ZOGA 1RO5A 4MCSA 1FY7A 4M6HA 2PIYA 3WC6A 2REFA 1DE4C 3PB7X 3VH9A 2GE3A 3D7FA 1M4DA 3GIUA 4H89A 2AFXA 5AG6A 3SJFA 3TX8A 4F6AA 2NMTA 1YSJA 4ZX9A 3GLJA 1KWMA 4MI4A 4Q38A 5JGFA 1ZG7A 5BWAB 1Y9KA 1MJBA 4CGMA 2OU2A 5LRGA 1QSMA 1ELLP 2PRQA 1LAPA 1ZG8A 4M6GA 4UIAA 4CAXA 5LRJA 1YVOA 3FVLA 1TKFA 4YWYA 2ATRA 3D66A 2DPSA 4XPKA 2AFOA 4Q7AA 2Q7BA 4BD9A 3IU1A 1TXRA 1QQ9A 2OZUA 3FMCA 3H8FA 3NA6A 4U5YA 1XMTA 4UCMA 5AG5A 1XJOA 3LACA 3DR8A 3P2HA 1H8LA 2AE6A 2PJ4A 4O23A 3WABA 5HXDA 4KOVA 2Q4ZA 3LWUA 2B3VA 4Q36A 4EMEA 1R57A 2CNMA 1XOVA 3KKWA 4JXRA 2Q0YA 3BI1A 3QAYA 1CX8A 1QSRA 4YGOA 5A27A 4B12A 1LAMA 3F8KA 2ZW4A 3RZAA 2YGWA 3TCVA 4MY0A 2FSRA 1HDQA 1S7LA 4II9A 2RC4A 3H5ZA 4MFKA 2PR8A 4UF4A 2V8HA 5LYLA 2R98A 2CF4A 3MGDA 4ZY0A 4HNXB 3EO4A 3B8GA 1XFOA 2ZW6A 4TWEA 2C6GA 2EWBA 2PJ1A 2WYRA 1WK4A 1EE3P 1IICA 1KUVA 1Z8TA 2VXKA 4OKOA 4P4IA 5G21A 4ZGYB 4H6ZA 2CTCA 4K3NA 4B5OA 3BLNA 1GYTA 3B3TA 4K30A 4KVXA 1KZFA 1F2OA 3TO6A 2QMLA 5A28A 3R9FA 1NSAA 4KOTA 2JDCA 5DS0A 4OP4A 1YR0A 1S3ZA 4NXYA 3BJ8A 2Q4VA 1Z8WA 2DXQA 1JWQA 3IJ3A 4ORFA 3FBUA 3G3SA 5I0CA 1RTQA 2G0BA 2OB0A 3D2MA 1ELMP 4MFJA 4MHYA 4CYQA 2FXFA 4ZBGA 2FCKA 2PJ3A 2ZEHA 4CGLA 4NGNA 4NFRA 3R96A 3DR6A 3LODA 4FBEA 3F5BA 5EC4A 3PP9A 2G9DA 3N5FA 2FL4A 4FAIA 2F8HA 3G8WA 4C7HA 3S9LA 4FD7A 3V8IA 1S7KA 4HPSA 4W9YA 3KR4A 4BMHA 3E0KA 1S60A 1YK3A 2FS5A 3B3VA 4UFVA 3EXNA 3S6GA 4A33A 1L0CA 1S5KA 1IYLA 4OC4A 5KTCA 2Y0MA 2BUEA 4OIDA 2PCUA 2PIZA 1YW6A 3FIXA 3ZZIA 3TOBA 3FB3A 4F0XA 1M4IA 5K8MA 4KVOE 2IJZA 3TE4A 3B2YA 4WJBA 1YREA 4XNHB 4JYWA 2FIWA 3B3SA 4KLWA 3RYOA 2Q44A 4OC5A 1BAVA 3PBEA 3IGRA 3PB9X 2OH1A 4NEXA 1XRYA 4IUSA 1XMBA 2QECA 5HVGA 1TF9A 2H5MA 2C1CA 4P4FA 3PGPA 1PCAA 1TKHA 3NE7A 1UFHA 1HDUA 2WUUA 1VIXA 3EY5A 5G22A 1YX0A 4IAVA 4B10A 3IO1A 4M3SA 4E8OA 2Z3PA 2BL1A 2YNEA 2K5TA 3WT4A 2WSAA 4KLVA 2ANPA 4NF1A 3NH4A 2BCOA 1CPSA 1LCPA 2Q04A 2CNTA 2Z3OA 3N7ZA 2JDDA 3BJ7A 1ARMA 2GIVA 3VWDA 3T90A 5AG4A 3D8PA 3TO9A 4AXVA 2XEGA 4P44A 4RI1A 3A9LA 3W6SA 3D7GA 3IFEA 4H2KA 4RN7A 4YU9A 1YLOA 1CP6A 3KGQA 1YVKA 1IY7A 4LQ6A 1Y7EA 1YLEA 2HC9A 2I79A 2PJ7A 2P6FA 3GUXA 2ZENA 3F0AA 3DNSA 4NCZA 4A2ZA 2Z3MA 4EFDA 3HUVA 4YFJA 5C82A 3FEDA 1XE4A 2R1IA 4DNCA 2B5GA 3R95A 3TT2A 5ISVA 1OBRA 3I9SA 3FXTA 4C2ZA 4AG7A 2AFSA 4UEZA 4XPDB 4OIWA 1I21A 3MN8A 5DWNA 4PK2A 3L2NA 4ZYQA 1IOFA 4L8AA 1FNOA 3PZJA 3DSBA 4UBRA 2EK8A 1IOIA 2ZPAA 5EBVA 3PB8X 3FRMA 4TNUA 4KOSA 4C2YA 1IU8A 4R9MA 2IMOA 1Q2YA 1Z8XA 1BPNA 3HLPA 2EVNA 4RUHA 2HB6A 3LD2A 1BO4A 1IGBA 4PK3A 4NJRA 2VZYA 4CYNA 5J8FA 4R76A 2ZEPA 1Z4EA 2EBJA 3B3WA 2VL1A 4OC1A 2QIRA 2V77A 4QC6A 4QUSA 4OC2A 3SXNA 3PB6X 4NGMA 2Q7SA 1I1DA 2QVPA 3DLJA 4CPAA 1AMPA 2AFWA 5DWMA 3ISZA 3QAHA 2PRBA 1K4JA 4KOWA 5H84A 3R9EA 1QMUA 4KOUA 4DYOA 4MCRA 7CPAA 1PU9A 2J8MA 2QJ8A 1P0HA 1PYTB 3S9MA
chains in the Genus database with same CATH topology
5J8CA 5GCNA 2VQYA 1CM0A 1Y9WA 2ZW5A 1V0CA 3WR7A 2YNCA 4CAFA 3UY5A 4F0YA 4LUAA 1MK4A 4KOYA 4PSXA 2VI7A 5HH1A 4JJXA 2B4DB 2DPTA 2EUIA 1CJWA 4UCNA 2B4DA 1M4GA 1Z4RA 1Z9UA 4AVBA 3TOAA 2HUZA 4MFQA 2WPWA 5E96A 2ARHA 1XEBA 4A95A 3W6XA 4UFXA 4I49A 3S6KA 4E2AA 4M85A 4EVYA 4RS2A 4XNHC 4CGNA 5IV0A 2IL4A 3GY9A 4C68A 2B3UA 2YNDA 4CYPA 4B14A 4R3KA 1VHSA 4CRZB 1Q2CA 4PV6A 3JUWA 4MY3A 5F46A 2Z3NA 4KZTA 4QB9A 5IB0A 4IF5A 1OZPA 4CAWA 2BEIA 2VZZA 2Z11A 3D3SA 4A30A 4AG9A 3GKRA 3IU2A 4LX9A 3CXPA 5F48A 4B13A 2CXAA 2G3AA 4ONUA 4BBHA 1NMTA 4UWIA 1Y7RA 5H86A 3GYAA 2B5GB 4Y49B 1I12A 4JWPA 1LRZA 4Y49C 1N71A 2Z10A 5FVJA 3IWEA 1IIDA 4KUAA 2BSWA 2OZHA 4XPDC 2PDOA 4AB7A 2OZGA 3I3GA 4CRYB 4H6UA 4OAEA 4U9ZA 3K9UA 2R7HA 1QSNA 1MJ9A 4C7IA 4L89A 2F5IA 4MHDA 4E0AA 4HNYB 1M1DA 2P0WA 4KSAA 2WPXA 4UA3A 2VEZA 2JEVA 1ON0A 5G20A 1MJAA 4AVCA 2B58A 4CGPA 2PC1A 2CNSA 4FD5A 4XPLA 2KCWA 2Z3KA 1Q2DA 5HMNA 1RXTA 4C2XA 1B6BA 4OADA 2PR1A 4UFWA 4FD4A 4FD6A 5JQ4A 4JD6A 4MFLA 3S6HA 3ZJ0A 2FE7A 4OLLA 1J4JA 4KVME 3FNCA 1WWZA 2YNCC 1KUXA 5AG7A 1SQHA 1M44A 4CAVA 3W91A 1GHEA 1XF8A 3C26A 3EFAA 4J3GA 4MJ8A 4JLYA 3DDDA 4JXQA 3S6FA 2AJ6A 4GS4A 2CY2A 4KUBA 2PQ8A 2FT0A 4PSWA 4AVAA 3JTKA 5CNPA 2I00A 3FYNA 1S7FA 2HV2A 4CS0B 3TFYA 3D2PA 4KSFA 2ZXVA 3VWEA 2GANA 4UCPA 1KUYA 3IWGA 1YGHA 4A32A 5F47A 5IX3A 2PSWA 4R57A 3H4QA 1XIXA 1NSLA 2C27A 1BOBA 4U9YA 3R1KA 3T9YA 4CAEA 4X5KA 5F49A 2ZW7A 2REEA 4R3LA 5C88A 2Q4YA 2VBQA 2D4OA 3CXQA 4CGOA 4KS9A 4QBJA 1B87A 3CXSA 3OWCA 1TIQA 2HQYA 2O28A 2P6EA 2X7BA 5AGEA 4HNWB 3SHPA 5KTAA 1IB1E 4MBUA 1S7NA 2A4NA 2P6GA 2Z3LA 4KOXA 4B11A 2B4BA 3SXOA 5G1ZA 1U6MA 1VKCA 1P4NA 1NE9A 5JPHA 4NSQA 1QSOA 4B5PB 2FIAA 2J8NA 1QSTA 3TO7A 4A31A 2J8RA 4MFPA 4B5PA 4HKFA 5KTDA 4KORA 3JVNA 4MFZA 3P2FA 3QB8A 4QVTA 3R9GA 2JLMA 2G3TA 4YRHA 1ZO0A 1IYKA 2D4PA 2Z0ZA 1PUAA 2R8VA 3EC4A 4R87A 3TTHA 4CYOA 1RO5A 1FY7A 2REFA 2GE3A 1M4DA 4H89A 5AG6A 4F6AA 2NMTA 4MI4A 4Q38A 5BWAB 1Y9KA 1MJBA 4CGMA 2OU2A 1QSMA 4CAXA 1YVOA 2ATRA 2DPSA 4XPKA 2Q7BA 3IU1A 4U5YA 2OZUA 1XMTA 4UCMA 5AG5A 3DR8A 3P2HA 2AE6A 4KOVA 2B3VA 4Q36A 1R57A 2CNMA 3KKWA 4JXRA 2Q0YA 4YGOA 1QSRA 5A27A 4B12A 3F8KA 2ZW4A 2YGWA 3TCVA 4MY0A 2FSRA 1S7LA 4II9A 2RC4A 3H5ZA 4MFKA 2PR8A 2R98A 3MGDA 4HNXB 3EO4A 3B8GA 2ZW6A 1WK4A 5G21A 1IICA 1KUVA 2VXKA 4ZGYB 4H6ZA 4B5OA 3BLNA 4K30A 4KVXA 3TO6A 1KZFA 5A28A 2QMLA 3R9FA 4KOTA 2JDCA 1YR0A 1S3ZA 4NXYA 3BJ8A 2Q4VA 2DXQA 4ORFA 3FBUA 3G3SA 5I0CA 2G0BA 2OB0A 3D2MA 4CYQA 4MFJA 2FXFA 4ZBGA 2FCKA 4CGLA 3R96A 3DR6A 3LODA 3F5BA 5EC4A 3PP9A 2FL4A 3G8WA 4C7HA 4FD7A 3V8IA 1S7KA 4BMHA 3E0KA 1S60A 1YK3A 2FS5A 4UFVA 3S6GA 3EXNA 4A33A 5KTCA 1L0CA 1S5KA 1IYLA 2Y0MA 2BUEA 3FIXA 4F0XA 3ZZIA 3TOBA 3FB3A 3TE4A 1M4IA 4KVOE 1YREA 4XNHB 2FIWA 4KLWA 3RYOA 2Q44A 3IGRA 2OH1A 4NEXA 4IUSA 2QECA 2H5MA 3PGPA 3NE7A 1UFHA 2WUUA 5G22A 3EY5A 4B10A 1YX0A 4M3SA 4E8OA 2Z3PA 2BL1A 2YNEA 2K5TA 2WSAA 4KLVA 4NF1A 2Q04A 2Z3OA 3N7ZA 2CNTA 2JDDA 3BJ7A 2GIVA 3VWDA 3T90A 5AG4A 3D8PA 3TO9A 4RI1A 3A9LA 3W6SA 1YVKA 1YLEA 2I79A 4UWJA 2P6FA 4NCZA 3F0AA 3DNSA 4A2ZA 2Z3MA 4YFJA 5C82A 1XE4A 2R1IA 4DNCA 2B5GA 3R95A 3TT2A 5ISVA 3I9SA 3FXTA 4C2ZA 4AG7A 4XPDB 1I21A 5DWNA 4PK2A 4L8AA 3PZJA 3DSBA 4UBRA 2ZPAA 5EBVA 3FRMA 4KOSA 4C2YA 4R9MA 1Q2YA 2EVNA 3LD2A 1BO4A 4PK3A 2VZYA 4CYNA 5J8FA 1Z4EA 4QUSA 2QIRA 4QC6A 3SXNA 1I1DA 5DWMA 3QAHA 2PRBA 1K4JA 4KOWA 5H84A 3R9EA 4KOUA 1PU9A 2J8MA 1P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  5GCN A;  2VQY A;  1CM0 A;  1Y9W A;  2ZW5 A;  1V0C A;  3WR7 A;  3UY5 A;  4F0Y A;  4LUA A;  1MK4 A;  4KOY A;  4PSX A;  2VI7 A;  5HH1 A;  4JJX A;  2B4D B;  2EUI A;  1CJW A;  2B4D A;  1M4G A;  1Z4R A;  1Z9U A;  4AVB A;  3TOA A;  2HUZ A;  2WPW A;  5E96 A;  2ARH A;  1XEB A;  3W6X A;  4I49 A;  3S6K A;  4E2A A;  4M85 A;  4EVY A;  4RS2 A;  4XNH C;  5IV0 A;  2IL4 A;  3GY9 A;  2B3U A;  4R3K A;  1VHS A;  4CRZ B;  1Q2C A;  4PV6 A;  3JUW A;  4MY3 A;  5F46 A;  4KZT A;  4QB9 A;  5IB0 A;  4IF5 A;  1OZP A;  4CAW A;  2BEI A;  2VZZ A;  2Z11 A;  3D3S A;  4AG9 A;  3GKR A;  4LX9 A;  3CXP A;  5F48 A;  2G3A A;  4ONU A;  1NMT A;  4UWI A;  1Y7R A;  5H86 A;  3GYA A;  2B5G B;  4Y49 B;  1I12 A;  4JWP A;  1LRZ A;  4Y49 C;  1N71 A;  2Z10 A;  5FVJ A;  1IID A;  4KUA A;  2BSW A;  2OZH A;  4XPD C;  2PDO A;  4AB7 A;  2OZG A;  3I3G A;  4CRY B;  4H6U A;  4OAE A;  4U9Z A;  3K9U A;  2R7H A;  1QSN A;  1MJ9 A;  4L89 A;  2F5I A;  4MHD A;  4E0A A;  4HNY B;  1M1D A;  2P0W A;  2WPX A;  4UA3 A;  2VEZ A;  2JEV A;  1ON0 A;  1MJA A;  4AVC A;  2B58 A;  2PC1 A;  2CNS A;  4FD5 A;  4XPL A;  2KCW A;  1Q2D A;  5HMN A;  1RXT A;  1B6B A;  4OAD A;  2PR1 A;  4FD4 A;  4FD6 A;  5JQ4 A;  4JD6 A;  3S6H A;  3ZJ0 A;  2FE7 A;  4OLL A;  1J4J A;  4KVM E;  3FNC A;  1WWZ A;  1KUX A;  1SQH A;  1M44 A;  4CAV A;  3W91 A;  1GHE A;  1XF8 A;  3C26 A;  3EFA A;  4J3G A;  4MJ8 A;  4JLY A;  3DDD A;  4JXQ A;  3S6F A;  2AJ6 A;  4GS4 A;  2CY2 A;  4KUB A;  2PQ8 A;  2FT0 A;  4PSW A;  4AVA A;  5CNP A;  2I00 A;  3FYN A;  1S7F A;  2HV2 A;  4CS0 B;  3TFY A;  3D2P A;  2ZXV A;  3VWE A;  2GAN A;  1KUY A;  3IWG A;  1YGH A;  5F47 A;  5IX3 A;  2PSW A;  4R57 A;  3H4Q A;  1XIX A;  1NSL A;  2C27 A;  1BOB A;  4U9Y A;  3R1K A;  3T9Y A;  4X5K A;  5F49 A;  2ZW7 A;  2REE A;  4R3L A;  5C88 A;  2Q4Y A;  2VBQ A;  2D4O A;  3CXQ A;  4QBJ A;  1B87 A;  3CXS A;  3OWC A;  1TIQ A;  2HQY A;  2O28 A;  2P6E A;  2X7B A;  4HNW B;  3SHP A;  5KTA A;  1IB1 E;  4MBU A;  1S7N A;  2A4N A;  2P6G A;  4KOX A;  2B4B A;  3SXO A;  1U6M A;  1VKC A;  1P4N A;  1NE9 A;  5JPH A;  4NSQ A;  1QSO A;  4B5P B;  2FIA A;  2J8N A;  1QST A;  3TO7 A;  2J8R A;  4B5P A;  4HKF A;  5KTD A;  4KOR A;  3JVN A;  3P2F A;  3QB8 A;  4QVT A;  3R9G A;  2JLM A;  2G3T A;  4YRH A;  1IYK A;  2D4P A;  2Z0Z A;  1PUA A;  2R8V A;  3EC4 A;  4R87 A;  3TTH A;  1RO5 A;  1FY7 A;  2REF A;  2GE3 A;  1M4D A;  4H89 A;  4F6A A;  2NMT A;  4MI4 A;  1Y9K A;  1MJB A;  2OU2 A;  1QSM A;  4CAX A;  1YVO A;  2ATR A;  4XPK A;  2Q7B A;  4U5Y A;  2OZU A;  1XMT A;  3DR8 A;  3P2H A;  2AE6 A;  4KOV A;  2B3V A;  1R57 A;  2CNM A;  3KKW A;  4JXR A;  2Q0Y A;  4YGO A;  1QSR A;  3F8K A;  2ZW4 A;  3TCV A;  4MY0 A;  2FSR A;  1S7L A;  4II9 A;  2RC4 A;  2PR8 A;  2R98 A;  3MGD A;  4HNX B;  3EO4 A;  3B8G A;  2ZW6 A;  1WK4 A;  1IIC A;  1KUV A;  2VXK A;  4H6Z A;  4B5O A;  3BLN A;  4K30 A;  4KVX A;  3TO6 A;  1KZF A;  2QML A;  3R9F A;  4KOT A;  2JDC A;  1YR0 A;  1S3Z A;  4NXY A;  3BJ8 A;  2Q4V A;  2DXQ A;  4ORF A;  3FBU A;  3G3S A;  5I0C A;  2G0B A;  2OB0 A;  3D2M A;  2FXF A;  4ZBG A;  2FCK A;  3R96 A;  3DR6 A;  3LOD A;  3F5B A;  5EC4 A;  3PP9 A;  2FL4 A;  3G8W A;  4FD7 A;  3V8I A;  1S7K A;  4BMH A;  3E0K A;  1S60 A;  1YK3 A;  2FS5 A;  3S6G A;  3EXN A;  5KTC A;  1L0C A;  1S5K A;  1IYL A;  2Y0M A;  2BUE A;  3FIX A;  3ZZI A;  3TOB A;  3FB3 A;  3TE4 A;  1M4I A;  4KVO E;  1YRE A;  4XNH B;  2FIW A;  4KLW A;  3RYO A;  2Q44 A;  3IGR A;  2OH1 A;  4NEX A;  4IUS A;  2QEC A;  2H5M A;  3PGP A;  3NE7 A;  1UFH A;  3EY5 A;  1YX0 A;  4M3S A;  4E8O A;  2BL1 A;  2K5T A;  4KLV A;  4NF1 A;  2Q04 A;  3N7Z A;  2CNT A;  2JDD A;  3BJ7 A;  2GIV A;  3VWD A;  3T90 A;  3D8P A;  3TO9 A;  4RI1 A;  3W6S A;  1YVK A;  1YLE A;  2I79 A;  4UWJ A;  2P6F A;  4NCZ A;  3F0A A;  3DNS A;  4YFJ A;  5C82 A;  1XE4 A;  2R1I A;  4DNC A;  2B5G A;  3R95 A;  3TT2 A;  5ISV A;  3I9S A;  3FXT A;  4AG7 A;  4XPD B;  1I21 A;  5DWN A;  4PK2 A;  4L8A A;  3PZJ A;  3DSB A;  4UBR A;  2ZPA A;  5EBV A;  3FRM A;  4KOS A;  4R9M A;  1Q2Y A;  2EVN A;  3LD2 A;  1BO4 A;  4PK3 A;  2VZY A;  5J8F A;  1Z4E A;  4QUS A;  2QIR A;  4QC6 A;  3SXN A;  1I1D A;  5DWM A;  3QAH A;  2PRB A;  1K4J A;  4KOW A;  5H84 A;  3R9E A;  4KOU A;  1PU9 A;  2J8M A;  1P0H A; 
#chains in the Genus database with same CATH topology
 2NSM A;  3PFE A;  1YQE A;  5J8C A;  5GCN A;  2VQY A;  1CM0 A;  1DTD A;  1Y9W A;  2C6C A;  2ZW5 A;  2ODF A;  1V0C A;  4NGS A;  5EMI A;  3WR7 A;  4A94 A;  2C6P A;  2PVW A;  4A38 A;  2YNC A;  4CAF A;  3CZX A;  3UY5 A;  4F0Y A;  4MXU A;  1ARL A;  4LUA A;  1MK4 A;  4KOY A;  5K8P A;  4PSX A;  1VHE A;  5LYF A;  2VI7 A;  4MRI A;  5HH1 A;  2GFQ A;  2BO9 A;  2PJ8 A;  2B4D B;  2DPT A;  2EUI A;  4JJX A;  3T8W A;  5CBM A;  1CJW A;  4UCN A;  2B4D A;  4ZX8 A;  1Y0Y A;  1R3N A;  1M4G A;  1Z4R A;  6CPA A;  1Z9U A;  2RFH A;  2ZEG A;  4AVB A;  3KAS A;  3TOA A;  2HUZ A;  4MFQ A;  2WPW A;  2POK A;  5E96 A;  2V8V A;  2ARH A;  1XEB A;  4A95 A;  2PJB A;  3W6X A;  1LOK A;  1ZLI A;  4UFX A;  4BIN A;  2ZEL A;  4I49 A;  3S6K A;  3MRU A;  4A39 A;  4E2A A;  4M85 A;  4EVY A;  3PFO A;  4RS2 A;  4XNH C;  4NGP A;  4CGN A;  1AUG A;  2ZED A;  3SI0 A;  5IV0 A;  2IL4 A;  3GY9 A;  4C68 A;  2B3U A;  2YND A;  4CYP A;  4B14 A;  4R3K A;  1VHS A;  4OC3 A;  4CRZ B;  1Q2C A;  4PV6 A;  3K2K A;  3JUW A;  3H8G A;  3IWW A;  4MY3 A;  5F46 A;  2Z3N A;  4KZT A;  4MCQ A;  4PXC A;  4QB9 A;  5IB0 A;  2GU2 A;  2IQ6 A;  4IF5 A;  1OZP A;  4CAW A;  2BEI A;  5HVF A;  2VZZ A;  5JQ4 A;  2I3C A;  1VGY A;  2Z11 A;  3D3S A;  4A30 A;  4IK2 A;  3CPX A;  4AG9 A;  2RB7 A;  3GKR A;  4NJQ A;  4DJL A;  4ZI6 A;  3BHX A;  3FEC A;  3IU2 A;  3CXP A;  4LX9 A;  4MHZ A;  3WC7 A;  5F09 A;  1JQG A;  4ONW A;  3D7H A;  3FEE A;  2CXA A;  2G3A A;  3NFZ A;  5F48 A;  4B13 A;  3CT9 A;  4P6Y A;  4ONU A;  4BBH A;  5HVH A;  1NMT A;  4UWI A;  2OOT A;  1Y7R A;  2Q43 A;  1CG2 A;  3BI0 A;  4P10 A;  5H86 A;  3GYA A;  2ZEM A;  1A2Z A;  2B5G B;  2XEJ A;  4Y49 B;  4P4E A;  1I12 A;  4JWP A;  2PE3 A;  1TF8 A;  1LRZ A;  3CDX A;  4Y49 C;  1N71 A;  3PRT A;  2Z10 A;  4B6Z A;  1CBX A;  3FH4 A;  3KZW A;  2AFU A;  5FVJ A;  3IWE A;  2GLJ A;  1IID A;  4MHN A;  4R7M A;  3H8E A;  4KUA A;  1AYE A;  4LQG A;  5D8N A;  2BSW A;  2OZH A;  8CPA A;  4XPD C;  2PDO A;  4MCP A;  5ELY A;  4AB7 A;  2OZG A;  3I3G A;  2ZEO A;  4CRY B;  4H6U A;  4OAE A;  2ZOF A;  3FX6 A;  4U9Z A;  3K9U A;  5IB9 A;  3I1U A;  4P4D A;  5LYD A;  2R7H A;  1QSN A;  1MJ9 A;  4C7I A;  4L89 A;  3KQZ A;  2PJC A;  2GLF A;  2F5I A;  2F7V A;  4MHD A;  4E0A A;  4HNY B;  1M1D A;  5J1Q A;  2WZN A;  2P0W A;  1YME A;  4KSA A;  2WPX A;  3FF3 A;  4UA3 A;  2VEZ A;  2JEV A;  1ON0 A;  2XEF A;  5THW A;  3PB4 X;  4X2T A;  5G20 A;  1MJA A;  4OC0 A;  4MMO A;  4AVC A;  2B58 A;  3TC8 A;  3KI9 A;  4FUU A;  4R6T A;  4CGP A;  1F57 A;  2PC1 A;  4P45 A;  1LFW A;  2CNS A;  4FD5 A;  4XPL A;  2KCW A;  2AFZ A;  1Q2D A;  2Z3K A;  2PJ9 A;  2PJ0 A;  3KHZ A;  3V7Z A;  1RXT A;  5HMN A;  4C2X A;  1B6B A;  1VHO A;  4X8I A;  4OAD A;  1FT7 A;  4Z65 A;  4DUK A;  2PR1 A;  4UFW A;  1YW4 A;  4FD4 A;  3NH8 A;  3VAT A;  4FD6 A;  3K9T A;  4UWJ A;  1Y0R A;  2XEI A;  4JD6 A;  4MFL A;  5I4M A;  4WWV A;  3S6H A;  2O53 A;  2FE7 A;  3ZJ0 A;  1BLL E;  3QNV A;  4OLL A;  4X3R A;  4R8F A;  2PJA A;  4GM5 A;  3PEI A;  2V8G A;  1J4J A;  3KHX A;  4GXH A;  4KVM E;  1XBU A;  3D7D A;  3FNC A;  1WWZ A;  2YNC C;  3KL9 A;  4G1P A;  4P4J A;  5JM6 A;  1KUX A;  5AG7 A;  3SJX A;  1SQH A;  1M44 A;  4JZ0 A;  3W91 A;  4CAV A;  1GHE A;  1XF8 A;  3C26 A;  3EFA A;  4J3G A;  4MHP A;  4MJ8 A;  4JLY A;  1BPM A;  4PXE A;  2ABZ A;  3DDD A;  4NGR A;  4JXQ A;  3S6F A;  2AJ6 A;  4GS4 A;  2CY2 A;  4KUB A;  3RAM A;  2PQ8 A;  2FT0 A;  4PSW A;  4AVA A;  2JBJ A;  3JTK A;  5CNP A;  2I00 A;  3LMS A;  1ZLH A;  2AFM A;  2PJ5 A;  1S7F A;  3FYN A;  4KSI A;  3VAR A;  1Z2L A;  2HV2 A;  4CS0 B;  3TFY A;  3D2P A;  4PXD A;  2DEA A;  4KSF A;  2ZXV A;  3VWE A;  2GAN A;  4UCP A;  1KUY A;  2O4H A;  3IWG A;  3KR5 A;  1YGH A;  1F2P A;  4F9U A;  4A32 A;  5F47 A;  2OR4 A;  4PQA A;  2J9A A;  5IX3 A;  4ZY1 A;  4NGT A;  2PJ2 A;  2PSW A;  3IEH A;  2NYQ A;  3KQX A;  4R57 A;  3H4Q A;  1XIX A;  1TKJ A;  2JBK A;  1NSL A;  2C27 A;  4P4B A;  1BOB A;  4U9Y A;  3R1K A;  3T9Y A;  4CAE A;  3B7I A;  2ZEE A;  4X5K A;  4EWT A;  5F49 A;  2ZW7 A;  1M4L A;  3D68 A;  3B35 A;  2REE A;  3B3C A;  4R3L A;  5D29 A;  2Q4Y A;  5C88 A;  3S9N A;  1UWY A;  4F8Z A;  2VBQ A;  2D4O A;  2PJ6 A;  4PXB A;  1LAN A;  3CXQ A;  4A37 A;  4OME A;  3SI2 A;  4CGO A;  4KS9 A;  3DGV A;  4QBJ A;  1B87 A;  3ISX A;  3IC1 A;  3CXS A;  3FJU A;  3OWC A;  5LRK A;  1TIQ A;  4M6I A;  2HQY A;  2O28 A;  3SI1 A;  2P6E A;  2X7B A;  5AGE A;  4HNW B;  1Z5R A;  3GB0 A;  3SHP A;  5JH9 A;  2DF5 A;  5KTA A;  1IB1 E;  2V8D A;  4MBU A;  1S7N A;  2A4N A;  2CTB A;  2P6G A;  1HEE A;  2Z3L A;  3D67 A;  4KOX A;  5CPA A;  4B11 A;  2FVG A;  2B4B A;  4UIB A;  3RBU A;  1CP7 A;  3SXO A;  5G1Z A;  1ZG9 A;  1U6M A;  1VKC A;  3NH5 A;  2PVV A;  3SJE A;  1Z8L A;  1P4N A;  1NE9 A;  2ZEF A;  5JPH A;  4NSQ A;  1QSO A;  1X10 A;  2CIJ A;  2FIA A;  3D4U A;  4B5P B;  2J8N A;  1QST A;  3TO7 A;  4FWU A;  4A31 A;  2J8R A;  4MFP A;  4B5P A;  4HKF A;  5KTD A;  4KOR A;  4IHM A;  3JVN A;  3RO0 A;  4MFZ A;  3P2F A;  4NGQ A;  5LYI A;  1CPX A;  4UEF A;  4ZY2 A;  3RNZ A;  2GRE A;  1R43 A;  3QB8 A;  4QVT A;  3WC5 A;  5K8O A;  3IIB A;  3R9G A;  3BXM A;  2JEW A;  3SJG A;  1Q7L A;  2JLM A;  2G3T A;  3CPA A;  2QYV A;  3PBB A;  4YRH A;  1ZO0 A;  1IYK A;  2D4P A;  2Z0Z A;  4PPZ A;  2EK9 A;  1PUA A;  2EO8 A;  2R8V A;  3EC4 A;  2Q51 A;  2BOA A;  4R87 A;  4UEE A;  4F9V A;  3NE8 A;  3TTH A;  1X12 A;  3V38 A;  4CYO A;  3JRU A;  5K8N A;  2ZOG A;  1RO5 A;  4MCS A;  1FY7 A;  4M6H A;  2PIY A;  3WC6 A;  2REF A;  1DE4 C;  3PB7 X;  3VH9 A;  2GE3 A;  3D7F A;  1M4D A;  3GIU A;  4H89 A;  2AFX A;  5AG6 A;  3SJF A;  3TX8 A;  4F6A A;  2NMT A;  1YSJ A;  4ZX9 A;  3GLJ A;  1KWM A;  4MI4 A;  4Q38 A;  5JGF A;  1ZG7 A;  5BWA B;  1Y9K A;  1MJB A;  4CGM A;  2OU2 A;  5LRG A;  1QSM A;  1ELL P;  2PRQ A;  1LAP A;  1ZG8 A;  4M6G A;  4UIA A;  4CAX A;  5LRJ A;  1YVO A;  3FVL A;  1TKF A;  4YWY A;  2ATR A;  3D66 A;  2DPS A;  4XPK A;  2AFO A;  4Q7A A;  2Q7B A;  4BD9 A;  3IU1 A;  1TXR A;  1QQ9 A;  2OZU A;  3FMC A;  3H8F A;  3NA6 A;  4U5Y A;  1XMT A;  4UCM A;  5AG5 A;  1XJO A;  3LAC A;  3DR8 A;  3P2H A;  1H8L A;  2AE6 A;  2PJ4 A;  4O23 A;  3WAB A;  5HXD A;  4KOV A;  2Q4Z A;  3LWU A;  2B3V A;  4Q36 A;  4EME A;  1R57 A;  2CNM A;  1XOV A;  3KKW A;  4JXR A;  2Q0Y A;  3BI1 A;  3QAY A;  1CX8 A;  1QSR A;  4YGO A;  5A27 A;  4B12 A;  1LAM A;  3F8K A;  2ZW4 A;  3RZA A;  2YGW A;  3TCV A;  4MY0 A;  2FSR A;  1HDQ A;  1S7L A;  4II9 A;  2RC4 A;  3H5Z A;  4MFK A;  2PR8 A;  4UF4 A;  2V8H A;  5LYL A;  2R98 A;  2CF4 A;  3MGD A;  4ZY0 A;  4HNX B;  3EO4 A;  3B8G A;  1XFO A;  2ZW6 A;  4TWE A;  2C6G A;  2EWB A;  2PJ1 A;  2WYR A;  1WK4 A;  1EE3 P;  1IIC A;  1KUV A;  1Z8T A;  2VXK A;  4OKO A;  4P4I A;  5G21 A;  4ZGY B;  4H6Z A;  2CTC A;  4K3N A;  4B5O A;  3BLN A;  1GYT A;  3B3T A;  4K30 A;  4KVX A;  1KZF A;  1F2O A;  3TO6 A;  2QML A;  5A28 A;  3R9F A;  1NSA A;  4KOT A;  2JDC A;  5DS0 A;  4OP4 A;  1YR0 A;  1S3Z A;  4NXY A;  3BJ8 A;  2Q4V A;  1Z8W A;  2DXQ A;  1JWQ A;  3IJ3 A;  4ORF A;  3FBU A;  3G3S A;  5I0C A;  1RTQ A;  2G0B A;  2OB0 A;  3D2M A;  1ELM P;  4MFJ A;  4MHY A;  4CYQ A;  2FXF A;  4ZBG A;  2FCK A;  2PJ3 A;  2ZEH A;  4CGL A;  4NGN A;  4NFR A;  3R96 A;  3DR6 A;  3LOD A;  4FBE A;  3F5B A;  5EC4 A;  3PP9 A;  2G9D A;  3N5F A;  2FL4 A;  4FAI A;  2F8H A;  3G8W A;  4C7H A;  3S9L A;  4FD7 A;  3V8I A;  1S7K A;  4HPS A;  4W9Y A;  3KR4 A;  4BMH A;  3E0K A;  1S60 A;  1YK3 A;  2FS5 A;  3B3V A;  4UFV A;  3EXN A;  3S6G A;  4A33 A;  1L0C A;  1S5K A;  1IYL A;  4OC4 A;  5KTC A;  2Y0M A;  2BUE A;  4OID A;  2PCU A;  2PIZ A;  1YW6 A;  3FIX A;  3ZZI A;  3TOB A;  3FB3 A;  4F0X A;  1M4I A;  5K8M A;  4KVO E;  2IJZ A;  3TE4 A;  3B2Y A;  4WJB A;  1YRE A;  4XNH B;  4JYW A;  2FIW A;  3B3S A;  4KLW A;  3RYO A;  2Q44 A;  4OC5 A;  1BAV A;  3PBE A;  3IGR A;  3PB9 X;  2OH1 A;  4NEX A;  1XRY A;  4IUS A;  1XMB A;  2QEC A;  5HVG A;  1TF9 A;  2H5M A;  2C1C A;  4P4F A;  3PGP A;  1PCA A;  1TKH A;  3NE7 A;  1UFH A;  1HDU A;  2WUU A;  1VIX A;  3EY5 A;  5G22 A;  1YX0 A;  4IAV A;  4B10 A;  3IO1 A;  4M3S A;  4E8O A;  2Z3P A;  2BL1 A;  2YNE A;  2K5T A;  3WT4 A;  2WSA A;  4KLV A;  2ANP A;  4NF1 A;  3NH4 A;  2BCO A;  1CPS A;  1LCP A;  2Q04 A;  2CNT A;  2Z3O A;  3N7Z A;  2JDD A;  3BJ7 A;  1ARM A;  2GIV A;  3VWD A;  3T90 A;  5AG4 A;  3D8P A;  3TO9 A;  4AXV A;  2XEG A;  4P44 A;  4RI1 A;  3A9L A;  3W6S A;  3D7G A;  3IFE A;  4H2K A;  4RN7 A;  4YU9 A;  1YLO A;  1CP6 A;  3KGQ A;  1YVK A;  1IY7 A;  4LQ6 A;  1Y7E A;  1YLE A;  2HC9 A;  2I79 A;  2PJ7 A;  2P6F A;  3GUX A;  2ZEN A;  3F0A A;  3DNS A;  4NCZ A;  4A2Z A;  2Z3M A;  4EFD A;  3HUV A;  4YFJ A;  5C82 A;  3FED A;  1XE4 A;  2R1I A;  4DNC A;  2B5G A;  3R95 A;  3TT2 A;  5ISV A;  1OBR A;  3I9S A;  3FXT A;  4C2Z A;  4AG7 A;  2AFS A;  4UEZ A;  4XPD B;  4OIW A;  1I21 A;  3MN8 A;  5DWN A;  4PK2 A;  3L2N A;  4ZYQ A;  1IOF A;  4L8A A;  1FNO A;  3PZJ A;  3DSB A;  4UBR A;  2EK8 A;  1IOI A;  2ZPA A;  5EBV A;  3PB8 X;  3FRM A;  4TNU A;  4KOS A;  4C2Y A;  1IU8 A;  4R9M A;  2IMO A;  1Q2Y A;  1Z8X A;  1BPN A;  3HLP A;  2EVN A;  4RUH A;  2HB6 A;  3LD2 A;  1BO4 A;  1IGB A;  4PK3 A;  4NJR A;  2VZY A;  4CYN A;  5J8F A;  4R76 A;  2ZEP A;  1Z4E A;  2EBJ A;  3B3W A;  2VL1 A;  4OC1 A;  2QIR A;  2V77 A;  4QC6 A;  4QUS A;  4OC2 A;  3SXN A;  3PB6 X;  4NGM A;  2Q7S A;  1I1D A;  2QVP A;  3DLJ A;  4CPA A;  1AMP A;  2AFW A;  5DWM A;  3ISZ A;  3QAH A;  2PRB A;  1K4J A;  4KOW A;  5H84 A;  3R9E A;  1QMU A;  4KOU A;  4DYO A;  4MCR A;  7CPA A;  1PU9 A;  2J8M A;  2QJ8 A;  1P0H A;  1PYT B;  3S9M A; 
#chains in the Genus database with same CATH homology
 5J8C A;  5GCN A;  2VQY A;  1CM0 A;  1Y9W A;  2ZW5 A;  1V0C A;  3WR7 A;  2YNC A;  4CAF A;  3UY5 A;  4F0Y A;  4LUA A;  1MK4 A;  4KOY A;  4PSX A;  2VI7 A;  5HH1 A;  4JJX A;  2B4D B;  2DPT A;  2EUI A;  1CJW A;  4UCN A;  2B4D A;  1M4G A;  1Z4R A;  1Z9U A;  4AVB A;  3TOA A;  2HUZ A;  4MFQ A;  2WPW A;  5E96 A;  2ARH A;  1XEB A;  4A95 A;  3W6X A;  4UFX A;  4I49 A;  3S6K A;  4E2A A;  4M85 A;  4EVY A;  4RS2 A;  4XNH C;  4CGN A;  5IV0 A;  2IL4 A;  3GY9 A;  4C68 A;  2B3U A;  2YND A;  4CYP A;  4B14 A;  4R3K A;  1VHS A;  4CRZ B;  1Q2C A;  4PV6 A;  3JUW A;  4MY3 A;  5F46 A;  2Z3N A;  4KZT A;  4QB9 A;  5IB0 A;  4IF5 A;  1OZP A;  4CAW A;  2BEI A;  2VZZ A;  2Z11 A;  3D3S A;  4A30 A;  4AG9 A;  3GKR A;  3IU2 A;  4LX9 A;  3CXP A;  5F48 A;  4B13 A;  2CXA A;  2G3A A;  4ONU A;  4BBH A;  1NMT A;  4UWI A;  1Y7R A;  5H86 A;  3GYA A;  2B5G B;  4Y49 B;  1I12 A;  4JWP A;  1LRZ A;  4Y49 C;  1N71 A;  2Z10 A;  5FVJ A;  3IWE A;  1IID A;  4KUA A;  2BSW A;  2OZH A;  4XPD C;  2PDO A;  4AB7 A;  2OZG A;  3I3G A;  4CRY B;  4H6U A;  4OAE A;  4U9Z A;  3K9U A;  2R7H A;  1QSN A;  1MJ9 A;  4C7I A;  4L89 A;  2F5I A;  4MHD A;  4E0A A;  4HNY B;  1M1D A;  2P0W A;  4KSA A;  2WPX A;  4UA3 A;  2VEZ A;  2JEV A;  1ON0 A;  5G20 A;  1MJA A;  4AVC A;  2B58 A;  4CGP A;  2PC1 A;  2CNS A;  4FD5 A;  4XPL A;  2KCW A;  2Z3K A;  1Q2D A;  5HMN A;  1RXT A;  4C2X A;  1B6B A;  4OAD A;  2PR1 A;  4UFW A;  4FD4 A;  4FD6 A;  5JQ4 A;  4JD6 A;  4MFL A;  3S6H A;  3ZJ0 A;  2FE7 A;  4OLL A;  1J4J A;  4KVM E;  3FNC A;  1WWZ A;  2YNC C;  1KUX A;  5AG7 A;  1SQH A;  1M44 A;  4CAV A;  3W91 A;  1GHE A;  1XF8 A;  3C26 A;  3EFA A;  4J3G A;  4MJ8 A;  4JLY A;  3DDD A;  4JXQ A;  3S6F A;  2AJ6 A;  4GS4 A;  2CY2 A;  4KUB A;  2PQ8 A;  2FT0 A;  4PSW A;  4AVA A;  3JTK A;  5CNP A;  2I00 A;  3FYN A;  1S7F A;  2HV2 A;  4CS0 B;  3TFY A;  3D2P A;  4KSF A;  2ZXV A;  3VWE A;  2GAN A;  4UCP A;  1KUY A;  3IWG A;  1YGH A;  4A32 A;  5F47 A;  5IX3 A;  2PSW A;  4R57 A;  3H4Q A;  1XIX A;  1NSL A;  2C27 A;  1BOB A;  4U9Y A;  3R1K A;  3T9Y A;  4CAE A;  4X5K A;  5F49 A;  2ZW7 A;  2REE A;  4R3L A;  5C88 A;  2Q4Y A;  2VBQ A;  2D4O A;  3CXQ A;  4CGO A;  4KS9 A;  4QBJ A;  1B87 A;  3CXS A;  3OWC A;  1TIQ A;  2HQY A;  2O28 A;  2P6E A;  2X7B A;  5AGE A;  4HNW B;  3SHP A;  5KTA A;  1IB1 E;  4MBU A;  1S7N A;  2A4N A;  2P6G A;  2Z3L A;  4KOX A;  4B11 A;  2B4B A;  3SXO A;  5G1Z A;  1U6M A;  1VKC A;  1P4N A;  1NE9 A;  5JPH A;  4NSQ A;  1QSO A;  4B5P B;  2FIA A;  2J8N A;  1QST A;  3TO7 A;  4A31 A;  2J8R A;  4MFP A;  4B5P A;  4HKF A;  5KTD A;  4KOR A;  3JVN A;  4MFZ A;  3P2F A;  3QB8 A;  4QVT A;  3R9G A;  2JLM A;  2G3T A;  4YRH A;  1ZO0 A;  1IYK A;  2D4P A;  2Z0Z A;  1PUA A;  2R8V A;  3EC4 A;  4R87 A;  3TTH A;  4CYO A;  1RO5 A;  1FY7 A;  2REF A;  2GE3 A;  1M4D A;  4H89 A;  5AG6 A;  4F6A A;  2NMT A;  4MI4 A;  4Q38 A;  5BWA B;  1Y9K A;  1MJB A;  4CGM A;  2OU2 A;  1QSM A;  4CAX A;  1YVO A;  2ATR A;  2DPS A;  4XPK A;  2Q7B A;  3IU1 A;  4U5Y A;  2OZU A;  1XMT A;  4UCM A;  5AG5 A;  3DR8 A;  3P2H A;  2AE6 A;  4KOV A;  2B3V A;  4Q36 A;  1R57 A;  2CNM A;  3KKW A;  4JXR A;  2Q0Y A;  4YGO A;  1QSR A;  5A27 A;  4B12 A;  3F8K A;  2ZW4 A;  2YGW A;  3TCV A;  4MY0 A;  2FSR A;  1S7L A;  4II9 A;  2RC4 A;  3H5Z A;  4MFK A;  2PR8 A;  2R98 A;  3MGD A;  4HNX B;  3EO4 A;  3B8G A;  2ZW6 A;  1WK4 A;  5G21 A;  1IIC A;  1KUV A;  2VXK A;  4ZGY B;  4H6Z A;  4B5O A;  3BLN A;  4K30 A;  4KVX A;  3TO6 A;  1KZF A;  5A28 A;  2QML A;  3R9F A;  4KOT A;  2JDC A;  1YR0 A;  1S3Z A;  4NXY A;  3BJ8 A;  2Q4V A;  2DXQ A;  4ORF A;  3FBU A;  3G3S A;  5I0C A;  2G0B A;  2OB0 A;  3D2M A;  4CYQ A;  4MFJ A;  2FXF A;  4ZBG A;  2FCK A;  4CGL A;  3R96 A;  3DR6 A;  3LOD A;  3F5B A;  5EC4 A;  3PP9 A;  2FL4 A;  3G8W A;  4C7H A;  4FD7 A;  3V8I A;  1S7K A;  4BMH A;  3E0K A;  1S60 A;  1YK3 A;  2FS5 A;  4UFV A;  3S6G A;  3EXN A;  4A33 A;  5KTC A;  1L0C A;  1S5K A;  1IYL A;  2Y0M A;  2BUE A;  3FIX A;  4F0X A;  3ZZI A;  3TOB A;  3FB3 A;  3TE4 A;  1M4I A;  4KVO E;  1YRE A;  4XNH B;  2FIW A;  4KLW A;  3RYO A;  2Q44 A;  3IGR A;  2OH1 A;  4NEX A;  4IUS A;  2QEC A;  2H5M A;  3PGP A;  3NE7 A;  1UFH A;  2WUU A;  5G22 A;  3EY5 A;  4B10 A;  1YX0 A;  4M3S A;  4E8O A;  2Z3P A;  2BL1 A;  2YNE A;  2K5T A;  2WSA A;  4KLV A;  4NF1 A;  2Q04 A;  2Z3O A;  3N7Z A;  2CNT A;  2JDD A;  3BJ7 A;  2GIV A;  3VWD A;  3T90 A;  5AG4 A;  3D8P A;  3TO9 A;  4RI1 A;  3A9L A;  3W6S A;  1YVK A;  1YLE A;  2I79 A;  4UWJ A;  2P6F A;  4NCZ A;  3F0A A;  3DNS A;  4A2Z A;  2Z3M A;  4YFJ A;  5C82 A;  1XE4 A;  2R1I A;  4DNC A;  2B5G A;  3R95 A;  3TT2 A;  5ISV A;  3I9S A;  3FXT A;  4C2Z A;  4AG7 A;  4XPD B;  1I21 A;  5DWN A;  4PK2 A;  4L8A A;  3PZJ A;  3DSB A;  4UBR A;  2ZPA A;  5EBV A;  3FRM A;  4KOS A;  4C2Y A;  4R9M A;  1Q2Y A;  2EVN A;  3LD2 A;  1BO4 A;  4PK3 A;  2VZY A;  4CYN A;  5J8F A;  1Z4E A;  4QUS A;  2QIR A;  4QC6 A;  3SXN A;  1I1D A;  5DWM A;  3QAH A;  2PRB A;  1K4J A;  4KOW A;  5H84 A;  3R9E A;  4KOU A;  1PU9 A;  2J8M A;  1P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...