4KVPA

Human p53 core domain mutant v157f
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRFRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kvpA00
4AGPA 5AOKA 2AHIA 2X0UA 3QYMA 3US1A 4AGOA 4G82A 2FEJA 1EAOA 2RMNA 2YBGA 1GZHC 4XR8C 1E50A 3EXJA 3WTWA 3US0A 2J20A 4AGNA 5A7BA 1YCSA 3VD1A 2XWCA 3D07A 4IBQA 3VD2A 5AOIA 1EANA 2IOIA 4L0ZA 3EXLA 3ZMEA 4KVPA 3TS8A 3Q01A 3WTVA 3WTYA 4AGQA 2BIQA 4IJTA 3WTSA 1UOLA 3KMDA 4GUQA 4IBVA 4L0YA 3Q06A 3D06A 2ADYA 4L18A 3D08A 2J1XA 5AOLA 5KBDA 4LOEA 1HJBC 5ECGA 4GUOA 1HU8A 4AGMA 2BIPA 5LGYA 5AOJA 4IBZA 2GEQA 1TUPA 1HJCA 1IO4C 3WTUA 2ATAA 5AOMA 4IBTA 2J1YA 4QO1B 1CO1A 1GZHA 2H1LM 2IOOA 2IOMA 4HJEA 1T4WA 2BIOA 2BIMA 3WU1A 3IGKA 4LO9A 2WGXA 4AGLA 2X0VA 3Q05A 5LAPA 4A63A 1CMOA 4MZIA 1LJMA 5ABAA 2PCXA 4G83A 5G4OA 2P52A 2J6WA 3D0AA 4IBUA 2J1WA 2VUKA 1EAQA 4IBYA 3QYNA 4IBSA 4LOFA 2MEJB 2J1ZA 3IGLA 3WTTA 2J21A 4IBWA 1TSRA 3D09A 1H9DA 4MZRA 2XWRA 3KZ8A 5G4NA 2OCJA 3D05A 2AC0A 5AB9A 2X0WA 1KZYA 3WTXA 3VD0A 2BINA 5G4MA 5BUAA
chains in the Genus database with same CATH superfamily
4AGPA 1VDGA 3LQAH 4OJAA 1AHMA 1UB5A 4Z7QF 3WUWA 2NUTA 5JW3L 4HJ1A 4LMQE 4E9VA 4A55A 3DTDA 3BWSA 4XI5C 2KZBA 4A7GA 4QY8B 2E9JA 2K6ZA 4OIBA 4M1CC 1SGKA 3LZFH 2FB4H 3BAIA 4NO5B 1WCQA 3VFPB 2ZF8A 4G8FB 2XU9A 3NN8A 2JELL 5FA3A 1A1OA 1PD6A 3A4FA 4ZUUA 5JIQA 1MREL 5DHXB 1G43A 4HGWA 2DKSA 3ORJA 4PHXA 4HK3N 1I8LA 2A6DB 2FL5B 3DIFB 2NYYD 2WP3O 3IJYB 3QPXL 2VQUA 2EICA 4QCIB 3EJPA 3QQ4A 3WS3A 2H47C 4PRHA 5TGBB 5EC2A 5IFJA 4WSGA 3RX7A 4GKNB 2V9TA 1JK9A 5H2BB 5D93B 5E99H 2YPLD 2YA1A 1E8ZA 2GBAA 2WM0A 3RY4A 2QPDB 3QDMB 5HHVL 1BBDL 2G3MA 4YK4B 2L3BA 3AG2B 2HYMA 2WXGA 2EVGA 4NXSA 1YC7A 3DJRA 4DP6X 5E6ID 5I18H 2OR9H 4WFFE 4S2SA 2P7TB 5D1ZA 4LNRA 3ZDYE 4LO9A 1GRWA 1TCRA 4B9FA 1DBAH 1OSPH 4X6FA 1ZDSA 3ULSA 4HA1A 3KJ6H 3OKOB 4MJJA 3FB7A 4HJTA 3P0VH 4NKOA 5HYJB 1XD0A 5PAZA 2Z7ZA 1X5JA 5FYJE 1P1VA 2L7JA 1A25A 3CFDA 2GT9B 5L8JB 2CA4A 3D8MA 2WQWA 4Z7UF 4AV4A 4E5XG 5IB5A 2OCFD 1MEXL 1MNUH 2MHAA 4BCXA 3L3OC 1H3PL 2JKRM 1F4XL 3ZSSA 3ZDYF 3MODL 1CICA 5F7UA 3RNKA 1E4XH 4MLIA 3PHAA 4D94A 4UILL 2I25N 2EDDA 2MOVA 2CBQA 5F1OB 4UTAL 2GJRA 4Q6KA 4Y4KC 1TFPA 1DANT 1YEJL 1KYFA 2V6HA 4XCFL 2ERJC 4FYTA 4KQ0A 1J11A 5T5NF 3G9AB 4GG6B 1RH8A 4M7ZC 3WIFB 1FIGH 2KERA 1NGQH 2ORBL 4I5BA 5ESAA 4N8VG 3V8CA 2EUXA 2X9WA 5DEFA 1FNFA 3HE7B 5HYQA 3GS4A 5HHQB 1U8HB 1W0WA 2ZKHL 5BS0A 3ILEA 2FO8A 5ISZD 4A6YA 4OZGB 4AQEB 4D0BA 1IGTA 3L3DA 5DUJA 4XMZA 4F1ZA 5K9OA 3NSYA 4Z5RB 5MEOB 3D07A 4K7PX 3LY6A 1CGVA 3EOTH 1B4JH 3LRMA 4XXDB 3N3EA 3ZVVA 5AW5B 5C0EB 5ELIA 3I84A 2UZXA 1EDQA 1XL4A 3FAWA 1X9LA 5EF2A 5IOPA 5DUMH 2JB5L 1URZA 1QW8A 4HOXA 3RG1C 3ZDXF 1KBBA 4B9PA 3EYSH 4FFVD 4L4VE 4L9DA 4XAKE 4JZNA 1MCRA 2B5IC 1GXEA 2BOCA 3QIBC 4OF7A 2PPAA 4HUKB 1H5BB 4B6ZA 2R8SH 2ARJQ 3PWUB 3GC3A 4XWGL 2NSMA 2FJHB 4JHWL 2BM3A 3QRGH 5ESQB 5ALBH 1M42A 2ZWSA 5IHUL 3BH8B 4PJDF 1X5GA 2A73A 1DE4B 4EPSA 3I2CL 5ID0A 3RY6A 3FZUC 3QEGH 5EOQH 1IGIH 4LSVL 4YXHH 5F7HA 5FUOL 4LCCA 4OSUL 5HYSA 3HG1D 3EH2A 1F90L 3P2TA 2NRDA 3NSJA 3MRJA 2WBWB 5BPPA 4I18C 5DZ9A 5HPOA 1LK2B 3IGFA 2G0KA 3D0VB 3FQWB 2QLVB 4MXVF 1Z3GL 1AOHA 2HFFB 4R7NA 1N6QH 3GUFA 1TTCA 1NOLA 3HFFA 3LSOA 1D5XA 3RA7H 5GGTH 2ZSVA 1KCSH 1WZ1H 1F3RB 1G94A 2QZQA 4LSQL 1OGAD 1DP0A 4JKPH 5DQJA 2B4CC 2VSDA 4XBPB 1IFHL 2CO3A 2WBJD 5D7LD 2LOEA 2CK0H 4FRWA 4MNHB 4F8QA 1DCLA 5LCVL 5TE7L 2OYKA 3VWJD 3RWDB 5FHAH 2WLLB 1N19A 1Z5HA 3NIFB 2VDOB 2D7TL 4MKTA 1CU4H 4NN7C 4MMYB 4OF8A 4EUPB 4LVNC 1A8ZA 2H3KA 2W07A 2NYYC 1DFBL 4ZUTA 4WCYL 5HYSG 3GK8H 4LHUD 2CLVB 1ZIBA 2NY1C 2FLMA 1ZRUA 5J6GA 1AD0A 2X2YA 2A6IB 4L1DA 1FGNH 1UZ8A 4FHKA 5AAMC 1SDAB 1N10A 1G7MA 4PRBB 4HPOH 2PW2B 4FZEL 4TSAL 2R1WA 1M4KA 2WC7A 1D9KA 3WO4C 2CR3A 3BISA 3MRMB 4LLVA 3ROOA 4TMPA 1P7BA 1NFKA 5DZJA 3RWEB 1BVOA 2EZ0D 1JJUA 1GAFL 3FH8A 3HLKA 2NTSP 1TF4A 4WFGE 5F70A 4CN4A 3BQUB 1YEIH 3SDYL 1KN4H 3MTXA 5I30L 3B4NA 5J11C 4IDJL 3RHWF 1A7PL 1S9WA 5DQDH 3MNVB 3QWNA 1KJ3H 2KLRA 4JM2F 4XC3H 4HXAL 5AD0B 3ALPA 4OLUH 2UXVA 4HUUA 3MJWA 3VXTB 2X2IA 1E30A 3U46B 5CLYA 3OF6A 1MF2H 3UG4A 1WJ3A 1RZKC 3PQYB 1NH6A 4FQ2L 4OGYL 4XPGL 3OQRA 4MTMA 5LB1A 3D08A 1K3ZA 3KJ4C 2P5WD 4XB8A 1KT2B 2H0JA 2R4SH 4P9HC 4N9OB 2C1PB 2ALAA 1KFAH 2FO4A 5SWZD 2WPGA 2PR4H 1HAUA 2DWXA 2XXFA 4DN4H 5TDNA 3BPCB 3WHXA 5DYOA 5FYJH 1G84A 1CL7L 1TZ8A 5FDWB 3OV6A 3BSGA 4I4WA 1Z9PA 5D2NA 3P4MB 3NA9L 3GMOB 4HZ1A 2YPLE 3TIDB 4FI7A 2HKFL 5CM1A 1SVZA 2WY3B 2H9GA 4A7VA 5DI8A 4UQ2B 3TFBA 5KSBA 4AQ1C 3PXLA 2AJSL 3CZEA 4TNEA 3L4UA 5AZ2L 3BMVA 1GC1L 5I1LB 1DVFD 5F0JB 3KHQA 1JE6A 1HN1A 3FU7B 4HSCX 3UAAA 4DQOH 2WWMD 4XNXL 3X12A 2BS8A 1E67A 4DSYA 1S7UB 3EF4A 5T3ZL 2CLRB 2CNYA 5JHDB 1XL6A 5AVRB 5C6PB 4KZEL 3T0EB 5EWIH 4NZJA 3BVXA 5IMLA 2JLPA 1UZ6F 5KS9F 1DFXA 2C9SA 3HTLX 5IREA 1QBBA 3HC0B 4DUXA 1U6AL 3FMGL 4QR7A 4S1SL 4P3WA 4H25A 1WA2X 2AJVL 2BZ7A 5HY9A 2GC7C 2X9XA 3EJQA 3NSCA 3WKMH 2YBRB 4Z7WE 1PSKL 1JWUB 4EMZA 2VDPL 1CFBA 4LSRL 5CEYA 3EYOA 4CILA 1CFTA 4MB3A 3ISYA 4R96B 5HVFB 4YNYB 2A1WL 1DJZA 2VMFA 3HS0C 4M4RB 1BA9A 3VYPA 2WLHA 4NHCH 4Q9QH 3N5AA 2J5LC 1FC1A 1FFOA 2TSBA 5T1DH 1WZAA 4N0UB 4GLRH 2WJ7A 1JRHI 1WFJA 5L7XH 1HQRB 3QJSB 4PU2A 4A7SA 3KPSB 4H8WL 2Z34A 2IBZY 4WTZG 1U8IA 5EU4B 4BFIB 3UC2A 3CDFA 1T22B 5PCYA 4QGYA 4N1EA 2G2RB 2GJJA 4JPWL 4Z7WF 2W81C 5K9KB 5GGVH 3WEOA 3IT8D 4OV6F 1AS8A 3EKCA 2C4FU 5I0XA 3G9VA 2Y7LA 3BQVA 4AY0A 2A74A 4PHZA 1EO8H 5LBSH 1QAWA 2YLKA 4F27A 3QQDB 4LSPH 2D4FA 4HGKC 5F7KC 4YDKL 1PMYA 4R4NC 2G3ZA 1MJ8L 4GO6B 3D4GA 1LYQA 1ZHKA 2GI7A 5HHMD 3WL9B 1HHKA 2Z31B 3PJLA 4L3CA 3N91A 3KLSA 4OQTA 1FF5A 3W1ZA 2IANB 3QARA 3AWGA 3KXFD 1ZHLB 5ICUA 3VXRE 2QSCL 1CDIA 4U1MA 3SE3C 5DRWA 2EDOA 4KROB 2ZUUA 4DW2H 2VDNH 3KYOA 4WKZB 5EEWA 3TA3D 4R7DB 5ITFA 2FEDC 3TL5A 1BD2E 4F7TB 2WBJC 1SEQL 2AZAA 1H3VA 2FUQA 1UWXH 1ECZA 3HRPA 4KDVA 4U1KA 1IAIH 1I8MA 4FXKB 5IVXB 4AH2B 4XZ4A 4FXGB 2ID5A 3VWJC 4Q9CA 1QBAA 1NCIA 4HKBA 4JFTA 1NM9A 1YN6A 3SDDD 3QJFA 1OARH 4PRIB 1NDMB 4H1LG 3AY4C 2DM2A 4KKNA 4K3JH 4HCRA 5AYQA 3IBEA 4N3UA 3WDIA 3IGKA 1FZJA 2W38A 3S4SB 1A4CA 5CFHA 1AIFB 1VZHA 4DF9A 4WU5A 4AENB 5EBWB 3HG1E 1M1SA 2NTFA 2OMNA 2WCGA 4P2YA 4JFEB 4H1LH 3IF1B 1Z3RA 1QD0A 4K5PA 3EDEA 1MCSA 2NW3B 3D0AA 1HI6A 3CLFH 1QPKA 3ATDA 2JJSC 1FAIH 1WAAA 2WKGA 4NYLB 2YWYA 3MLPA 3T5WA 4JY5L 4PW9A 1JGDA 4ZD3L 5I5JA 2EZ0C 3RKDD 3SDCA 4NZ8A 4L4TB 2G4GA 1D5IH 2VDPB 3U0TB 1N12A 2XNAB 5ACLA 5I5IA 2ICEA 1M71B 1EZLA 2DQTH 2ADIA 3FH5A 4HFUL 3DA0A 4QOKE 4BELD 5C3TA 3D51A 1HCFX 1ZV5A 4NDMB 2NUPB 1RK0A 4RMVA 2R27A 4KAQH 4BK5A 4PBDA 3SYPA 4XVUD 4HS8L 3CDZB 1D7CA 4BYHA 4G7RB 5EORH 2H4EA 1E4KA 2B4CH 5I1EH 1P1ZA 3LRGA 4G43A 1WO2A 1LO2L 3IM1A 4KTEH 3CCHB 4YHKH 3U7WL 2XY2A 4QHLA 1NGYB 5CIPH 3U4EB 2WOYA 3SYQA 2IPUG 4JDZA 1UCBL 4FTVD 3CHPA 4LLUA 4JFXB 4ZO6A 3AQXA 4S1QL 1A6TA 1DUZA 3H0TB 3LDBB 5DEZA 1TYRA 4DOHE 3MJGX 3EBAA 3EUUA 5FB8A 4G71B 1SMAA 2FJSA 4MJHA 4LSDA 2MRYA 3SBQA 4Q4EA 3TH4T 5C1MB 1TU2A 1DVFC 2ZOUA 4G7SB 1HH9A 3JTTA 2FCBA 4OQTL 1DZBA 5C0RL 3WTSA 2G60L 3QIWB 4X6DE 1NCCL 4XNUH 1CQYA 4MD5B 3SZ6A 2JV6A 3GBML 3VDBA 3I9AA 1FNLA 1F4AA 1H0DB 2R0ZH 4ISVA 2MH4A 4PAZA 3UC0H 5I0VA 4P05A 4YPGB 2BP0A 5ADPL 4FKHA 4KXZI 5C0BD 3SKJH 4ZPTB 2AF2A 4HIHA 4JQVC 1XGRB 5ISZA 2YAPA 3BVVA 1JZEA 1UT2A 3CFQA 4JQXC 1M6OA 1Q0XL 4BFNA 3P11L 4YVUA 1PKQA 4L0PB 1MAKA 3MQIA 5SWZE 1MFVA 5GS3A 3Q13A 4HCRL 1ZT1A 3FQRB 4WHTA 1RZKH 5F44A 3QR1A 3U82B 3GD1C 2VLRB 1VPOL 3SPVB 4NP4L 1M53A 2R1XA 4K5MA 3PHOB 1N64L 3X3FL 4ZQTA 1S5IL 4URTB 3ZUNC 1J5OL 1TZOA 1GJUA 2OTUB 1IBFA 4P2RE 4OCYH 3AU0A 3PRZA 1T03L 3VW3L 1QP1A 1GJWA 1HESA 3NCJL 4M6MH 3EOAA 3L9YA 4ZAKA 4ZYKB 3RLSA 1UJ3C 3ZKQD 2LABA 4U1LB 5C0GA 2QADB 3QCVL 2O72A 3B2VL 3GS7A 3CIAA 1R75A 3OWEA 2ED8A 5D71H 1U4FA 4BKSC 2B2XL 4WK0B 4CBPA 1JV5B 3GMPB 1JZ5A 1YNLH 3WI9A 4G1MA 2V7NA 5IWLA 4M7JL 3Q9QA 1LWHA 2BS71 3NOIA 5HDWA 5B8CC 3SBWC 2PTTB 4JO5A 4L5FE 5SWQA 1WWBX 3SPGA 2VN5A 2Q3XA 3EFFA 3NFNA 5I17B 5FYJU 4J27A 3L95A 3C60B 3H1ZA 4FJYA 4EN3D 4XN4A 3RL1B 25C8H 1L7IL 2W0FA 1LDPH 4B5EA 2WXQA 1K2DA 1B6DA 4GQ9L 3R19A 4QAWA 2YA0A 3G5XA 5GRYA 4K2UH 2OCJA 3LV3A 3BHBB 4RRPA 1GY2A 1IM3B 2WMPA 4TM9A 1F18A 1KZYA 4LKXB 5I1CL 5EPMA 2RQEA 1IGML 1EZVY 1IBZA 1WEJL 3T0XA 5HGAB 3B1UA 3MJ7A 2ROXA 1NMCC 3GMMB 3RDTC 1U58A 3ULUL 4XVJH 4I0PD 1OGAA 1CFMA 4XMLL 2AJYL 5CLZA 3IDGA 1PVHA 1TTGA 1U95B 3P69A 2BMKB 2X89D 3ATAA 4YDVA 2WQSA 3TNNB 2BY0A 2P80A 3OTTA 3SDDC 1KB9J 1XB8A 3G5VB 3VXOA 1X5LA 5HHOB 1QA9A 2VNCA 4LCIL 5DHYA 4ZFOB 1CBVH 5CNHA 3J27A 1U8PB 4MWFA 4PJBE 4WFED 3ETBJ 4ZO7A 5AW9B 3X13A 4ZQKB 3LH9A 2RGSA 4LHUA 3F5WA 5DVMA 2WVVA 3BVNA 1UD5A 6FABL 4JZJC 2ZYRA 2GC4C 4HP5A 4XAWL 2NNAA 1ZVNA 5C09B 2EECA 2XWZA 3A5VA 2E4TA 4RRPG 2NY3C 3HZVA 4IOIB 1MN4A 5JMOC 3PWJB 5ITBL 2R29H 3TVMA 2MQCA 4YX2H 3NVQA 4YBQC 2ZJSH 5E70A 3HMWH 1MCJA 5D6DC 2GJ6A 2P45B 4HLJA 1FSKB 5AOMA 3TH3T 2YQ2A 4PGDB 4F91B 3K1DA 1YMME 2FWOA 2MCAA 1I9JH 2XKSA 1A9EA 2YQGA 3VFMB 4MA1C 4XVUC 4K71C 3LZRA 3U1PA 2H2SD 3PWVB 4A68A 1KCVL 3BUQA 4NKDA 4G59C 1OOWA 1UYWH 4MA7L 4JO8A 2BSCA 5DRXA 5EBMB 3VFGH 3GEFA 3QEHB 2DQIH 4GW1B 5CFAA 1XIWB 2B3IA 3OLDA 4L8BA 5FGBA 4ELMA 1JFQL 4LHUG 5L88H 2A6JA 1BPVA 2MPVA 2GIXA 4WI9A 2J2ZB 1J0JA 3ZX1A 2PYFB 1FNEA 4HIXL 1JHTB 2P5WA 4YEFA 4RRPM 2AITA 5E6SB 1TPXC 3QXVA 1N0XH 3BFQG 3BIAX 5C8JA 1EHLL 3PDGA 5CGBA 3ZY7A 1JD9A 1TSRA 2YSTA 3MFFB 4N0CC 3DX6B 4BKLA 4NUPA 1KELL 2UYLA 3M88A 3DUHA 4H40A 4HZLA 1QNIA 4Y5YC 1E7UA 3RX5A 2I7OA 2AEQL 3EADA 7PCYA 3F12B 4WDIB 2FATL 4KUZL 5EA0L 2J71A 5IK3B 2F53B 5EIIG 3G6JE 1R0AL 5JQHC 1MCPH 1CPUA 2CJ3A 3W0WB 1CGXA 3O4OB 4UYQA 5HYJD 4OZIA 2OK0H 1MHCB 4N90E 3BPOC 1XGQB 2EIZA 3VI4A 4Q14A 3OKMA 1UH2A 2KDGA 3MRNB 2BJMH 4OFQA 5GIRA 3BOVA 2HKHL 3O2VL 3C08H 3VNZA 5D7SL 4ELKA 3PXHA 1PLCA 4OCRL 5J1AB 3QQ3B 3S5YA 5MI0B 3BSZA 1UEYA 4NRXB 1YECH 4FTVE 3EYUH 3MNWB 3Q5OA 3G6JF 2F58L 2TRHA 2AV1A 3FU9A 5HD8C 5INDA 1XV8A 3BZEA 2VDRL 4LQFH 4U4IA 5HHNB 4TNVK 3E6FA 2OTPA 2EEFA 3UZQB 4IS6A 5GS0L 3OR6A 2Y06H 1DBBL 3AITA 2IFGA 4TUOB 4S1DD 5DZNA 3UH8A 1IV8A 1BZ7B 3LNIA 3BAWA 1E65A 4L0YA 1URIA 4ZX3A 4IRSC 3FSZA 2N0KA 3HE7D 1MFBH 1PU0A 5IROA 5JHLA 2GK0B 2QKIB 3INOA 1RZGA 1OIOA 1K8DA 4ERSH 1M6UA 2XUWA 1IGYB 2WLKA 3DUUB 5A3ID 4DN3L 4O02H 1NANI 3JBG7 5ADOL 3FYEB 3QHZH 3PAYA 1IEBA 1T04A 3TJEH 4L9LB 1G9NC 5TDOA 3UEQA 2F8IA 2OQJB 1MWOA 3SGDI 4YHNA 4R7XA 2A77L 4LRNH 1P7KA 3ENEA 2AABL 3GXIA 4N0YL 5JHAA 1YZZA 3FUNA 1MHHB 2FBRA 2YPVL 2ZE0A 1AGBB 1OCOB 5MHSE 3LZLA 2X4PB 1Z5LB 5HI3C 3RQ3A 4WTXA 2IPTL 3KXFA 1CR9H 5D96C 4PJEA 4MVBC 2CRYA 3V0JA 2IG2H 2YPKA 1R5VA 3B43A 1ONQB 2VR3A 4UT9H 2EDYA 2CHZA 3PG2A 3H8NA 2JB6A 2DQMA 1ZTXE 2GSIA 3QUXA 2DQHH 4I0PC 4ZJ9A 5LNEA 3TA3A 4F1SA 3CVDA 3IJ9A 1KGIA 3VI3B 4JN1H 4WUUA 1PLAA 4S0TD 2YXVA 4L8CB 4U0RB 3P2BA 2E7HA 5E8EB 1PZDA 4K7PY 5BQDA 1IKNA 3HE6B 3QWQB 1I8IA 4IRJD 5AVYB 2FX8H 2AXGB 1WTGT 4HKXB 4MB4A 5JUEH 1OB1B 1YNTA 3RX9A 2HT2D 5JZ7D 1B0WA 3EGSB 4OJYA 3BSHA 4K5LA 4K3HA 2Y1YA 4KO9A 2N1TE 1HHGA 3BN9C 3O6MH 3PIQB 1OSZB 1HILB 2W9EL 3S37H 4XN9A 5LWYH 1VADB 4GSDL 4P4RB 5T1KD 5CP3H 1NTDA 3F7KA 4G6FB 1I1YB 3BVDB 1N70A 3J8F7 1Q0YH 3KCWA 4WENB 2BINA 4EZJA 4FQLL 3N43F 5FGCB 4BK8A 2WVTA 2JQMA 3HI1B 4HPYH 5BV7L 5KVFL 3FN9A 1Z66A 3Q43A 3UBFA 4TOYL 1M2OA 4ZPVA 3BUBA 3BSZL 1RSYA 5LG1A 1OQXA 3UPCA 1GYWA 1SPDA 5IB1B 1HSAB 3DOSB 2AFNA 3VFOB 1XF5A 3RYMA 3VD2A 1E6JL 4QTFA 1S9YA 4HCGA 2O6FA 2VRQA 1U8CA 3AT8A 4OM1L 3ZGIA 1A02N 1JG9A 4J3VA 4FFYH 3V10A 5ICZB 3HNTL 1DYZA 4Z78B 3UBXI 3X1FA 3AQYA 3WD5L 2HLFD 1QZ1A 1RZJL 3IVKA 3K72A 3KLAA 2NX5A 1YSOA 1KTLB 1ZEAL 4OI9A 4BD4A 3CBKB 4AM0B 4Z7VA 5HI4C 4CSSA 4XPTL 4L2YA 3D69B 2CXKA 3CSTA 4XH2A 5JPMB 1DO5A 2C9PA 3KPOA 2OBGA 3NJKA 2H6PA 2BH0A 3CH1A 1FVEB 1MFAL 2I60L 3EG9B 3PNRB 4KY2A 1I3GH 5IB3B 2DJ4A 1I3RB 1UD8A 4LQ1A 4U1SA 3QCUH 1X7QA 4NZTH 3RGHA 1BQHB 2C4XA 3KW8A 1T5KA 3RIFK 4WHYG 3IFOB 1E0OB 5C86A 4LT7A 2BC4B 1X5XA 4X8XA 3W2DL 3ARVA 5KYWA 4LEXH 2H1LM 1QFWL 1JRHL 2DI8A 3CK0H 3BPLC 1TO5A 4WLCA 4A2HA 2V37A 4Y2OA 3QUYD 2VZ3A 4RFEB 5JORA 2D7NA 5T33H 3DV6A 1IC7H 1PTZA 2FK9A 1UTDA 3UJTH 5GGQL 4IJ3C 1CMOA 3PQYD 1BDYA 4OJFL 4E36A 4WAFA 4MJ6A 3VCLB 2WIIA 4OFKA 5IGXL 4KMLB 1KACB 1OM3L 1J1PH 5C0BA 4WIQA 1DBML 1OTUD 5IV2B 4F92B 4MA3A 4HU8A 2AQTA 4XBGB 5I5RA 3LKQA 1NSNH 1YDPB 2G3NA 1WFTA 3FTSA 3WNIA 3ZYOA 1ZT4B 2XA8L 4X80L 2OZ4H 1R1CA 2P8LB 3GSRB 4GQRA 5CZVH 5CEZL 5J3HD 2J8UA 4BH8B 4LEBA 3QDME 1NAMH 1BZQK 4KVNH 1XBRA 1AIZA 4CU6A 5BCAA 3KL3A 4NQQA 3TPUB 3GTNA 4APXA 3PWNA 3MPCA 3AGVA 1YO4A 2DM7A 3HZMA 3QJRB 4UV4H 3HE7C 2ED6A 4LLQA 3VRIA 1JGVL 2QDWA 3H9HB 5BW7A 1G9EA 3NH7L 2BNRB 2OMXA 4G5ZH 4MFHA 3GIVA 5KBMA 2F61A 3T0ED 3T6WA 4ECNA 3WFDL 5FGSA 1YJDL 3SYOA 3U7AA 2VXQA 4LGPB 4U1NA 1RFDL 1JPEA 4XHQA 3VD1A 3ILPB 3DHMA 5TH2B 1KYOK 4X6BA 3U9UB 2PO6B 3PPEA 4KQ4H 2BNQE 3TO4B 2FQGA 2RFXB 4K0OA 1FN4A 4JRFA 4H88H 4PRAA 1MQKH 4RMQA 2JJTC 5GSVA 4B7IA 4EN3A 3PV6B 2O5XL 4G42B 3TS8A 2CRZA 3DGDA 3NACL 1J8HE 1GZPB 3OMZA 4WZ9A 2VQTA 1UXWA 1KTDA 2B59A 3NAAH 2AK1L 2ZCKH 2BVEA 4QTHB 4P5TA 1H5BC 1S9XA 1PCSA 2E9GA 4AV5A 4UYPA 2A5UA 3JTBA 3WFEL 3NEOA 3X1EA 5IR1B 1NEZB 1OOAA 2DIEA 4BSWB 3PGFL 1T21A 3HLAA 3EDJA 4GUOA 2OR8A 5CS7A 1A6UL 4X8GA 1T20B 2RIKA 1HXMB 1HTYA 1WFUA 1KIRA 1W0VB 2DWEA 2X89A 4BDVA 3P77A 3HEIB 4NN5B 2C3VB 4LCYA 3RPIB 5BZXA 1J0IA 4KBPA 5IVZA 1QI3A 1K9TA 2HT2C 5JZ7C 3VRLE 4U7MA 2AMUA 2CXGA 3ZL1A 4OKVA 5IT2L 1MAML 5IHLB 3FDWA 4U6YB 3FCBA 1OCWH 2YEQA 2XQBL 2VM4A 3V0VA 3AXLA 1IGCH 4BH7A 2YD7A 2Z31D 2GITA 2H3NA 3RI5F 2IAND 2Z8VC 4OTXH 5SV4A 4F37F 5JPNA 2XWDA 1I1AB 2HMID 3QDGA 1SBSH 2Y4SA 4KROD 5J1TC 1REIA 4J6RL 1YEHH 1QLRB 5CGYD 3VG0L 4YHYC 1QLFB 4RMSA 1PAMA 4CL7A 5F3BB 3LIZA 4L23A 1N4XH 4LPVA 4K7PL 2AJUH 4RQQB 4J5VA 3BAXA 5D5MB 1RIHH 3VFPA 4ONGH 1PNDA 3WKYA 1OAKL 3G6AB 4O4YH 2MPAL 1PY9A 1YPZA 1LLAA 1HHJA 2DS4A 3H85A 3I50L 3C5ZB 3OVUB 4U05A 1JS4A 1HHHA 3MRLB 3NGBB 4JM0A 3VGEA 2LR4A 1D6EB 3OKLB 1MI5A 3KYMB 3ZHKA 2QGBA 3PHQA 2HH0H 4D0DB 4XNDA 1INDH 4CKVX 4LEEA 1ZGLP 1TEYA 4EEEA 4GH7B 1CURA 2SEBA 4O58L 4GMSL 5FWRA 3U6XS 4MCNA 5I73C 3SDAB 5F9WB 1PEZA 2E59A 2R69L 5TGBA 3E8UL 3LKOB 3OG6B 4U49A 3HCVA 2XI9A 2VXQL 1TZGL 4XO8A 4H2AA 5J12C 2JKJA 3BE1L 3EBHA 2FUTA 2VLMD 4L4TD 2VABA 5DJZB 2G5RA 3BQUC 3BT2H 1KXVA 3C2SA 35C8L 4QRUA 3FT3A 5FKPA 1HZHH 2IH8A 4WY7H 4ZS7L 2R0LH 2XZAL 3NRQA 4JO2L 4B0MM 4OZHB 2Q2EB 3GDBA 3BZ4A 3FK3A 4HIIB 3S3CB 3L3IB 4DEPB 4M8UA 2E56A 1E3XA 4XNQB 4AMKH 4GQPH 2K9UA 5HYJA 2M8XA 3AZUA 2IQAA 3V0FA 1FZOA 4TUKL 4F2MA 4PLNC 4HUXB 5KANI 4RBPK 4GKZB 3CXHJ 2KUTA 3KPRD 2KZWA 5I76A 3OJ2C 2XKNB 1HEJC 1FLRH 5D1QB 2YK1L 4FMFA 4PBVC 4EXPX 2IAMA 4PIRF 1A5FH 2GCYB 5H4ZA 4FP8H 5J3HC 2VDML 1HCVA 1DQIA 1X6LA 2CGRH 2Y23A 3O4LA 1MCOL 3HN5A 1CO1A 4G70B 4AUYA 3SJVA 1KG0B 3E0GA 2EIEA 2Q0ZX 4C54A 4X7SL 5AW3B 2IQ9L 3TOPA 3WKNA 2P46B 3REVA 1FYTB 3A22A 3V0DA 3UZVA 4A7GF 4YSSA 3UJIH 2X0VA 1CICC 4EO5A 3QIWD 1WHPA 4XN2A 2BXZA 1LTXA 2PABA 3NJIA 2F68X 4D9LH 2NY5C 3S35X 3T0EC 4QXUL 4YLCA 1HX0A 1BFSA 3LIZL 5HHQA 1I7RA 3L4ZA 3IJEA 3QAZB 3ARBA 4HHWA 3L4CA 5D4QA 3GSUA 1I8KB 4Z5RA 3L9EA 2CMRH 3FTUA 2ZOLB 2VZUA 2Y5EA 2VN7A 4HIEA 4IQHA 1YQVH 4UB0H 1CFVL 1A64A 2VZSA 4XP6H 1P4BH 1XGPB 2WSPA 3BUPA 4NC2B 4U1JA 4ZUVB 4NEHB 5K39A 4AIZB 2VLRD 5IIEB 1NA8A 2EE3A 4JFUA 3P0YH 2WAQA 3PAVA 1NEPA 3Q1SH 2J73A 3D39B 1DSYA 4OJCA 1MFCH 4NUGL 1QYGL 1WVZA 1I9EA 1U33A 4R5XA 2YKLL 2X0WA 5L4JA 4FKKA 3CZNA 2QADD 4E41A 1NUGA 4IHBA 1MCCA 3AFLA 2CBMA 2YMOA 3PWUA 3S98A 5I1DB 4XCEB 5JHDE 2CKNA 4XP9H 5D7IA 4AT6B 1M05A 1NWPA 1PY0A 1DE4A 1ZTMA 2LAGB 2DD8H 4IRJA 4U2ZA 3FO0H 1UGKA 3W38A 1JZIA 1LGVA 5HHXL 1M7DA 1X5AA 3E9TA 1DCEA 2FIKA 3U48A 3WIHH 3O6KL 1EVTC 5JIDA 4NN6B 4GRWE 4PY7B 2G2NA 3EH5B 3C5JA 5T1KA 1JYWA 1IM3D 4QRQB 2HFFA 4C56B 2N7BA 2P24A 3IJSB 3RY6C 2JSFA 3LRKA 3OGCA 5KYUB 1AY1L 2B0SL 1NINA 4FE9A 3UYPB 2AERT 1PIFA 4X0NA 2ZX9A 1Q1JL 3IDNB 3UTZB 3T4AB 2VDMB 3TBBA 1HJBC 3QPXH 3KPSE 4FXKC 3LPPA 1Y7VA 2YAMA 3AUVA 4DTGH 1G5GA 2QR0B 3NQKA 4HJ0D 4NLAA 1W16A 4UQIM 3DO7B 2F18A 4MNHA 1TVHA 5A43C 3KVDD 2WTRA 1BAWA 2WLLA 2DAVA 3HC3H 3CU7A 4EDXA 4EOWH 3GPSA 4LOVA 1BLIA 5HHVH 3ZTDC 4EUPA 1SLWA 3G04B 2G0LA 3MNZB 2DLEA 3HPLA 4OBSA 3L3GB 3W81A 4OCWL 2CLVA 5IB4B 1AP2B 3NCCB 2EUZA 3FCSA 4HIJB 4X6CE 5LAPA 3AG4B 5DJCB 3UX9B 4X5RA 5CILH 4N2FA 1BCIA 4HDIA 5B4MD 3RFZB 2G2PA 4POUB 1JDDA 5C09D 5GS1B 1OTSD 1OEZW 4PJAB 2IANE 5DFAA 4YGVB 3U2SA 2VLKB 3QORA 3B56A 5A40E 5I1GL 2QPSA 2YWZA 3CFKA 3STZA 3S97C 1NFDA 5GRWA 1JI1A 4B53A 3UBXA 3GJFH 4X5XB 3RVTC 3N0PB 4X6CF 1MEXH 1RJYB 2NZ9C 1MCLA 3ARFB 1H3PH 3GMNA 5IVXE 3OKDB 1DQTA 5B7FA 1A66A 3MNVA 4DVRL 4KZDL 1U3HD 1W72A 4H8WC 2YRPA 1D5ZB 5C0DB 4PRIE 2OMVB 3EGXB 3QUYA 5C0AB 1KPRB 1J1OL 3BP5A 3N40F 2IWEA 4UTAH 1GA2A 3WJLC 1NLDL 4EUPG 5LG6A 2O61B 1NGWA 2XG5B 1B3JA 1XIWD 1YEJH 4R7LA 4LLMA 4XP4L 5T3ZE 1RUPL 4XCFH 1G7LA 4PJCB 5EZLA 3RTQA 5IJBC 2WNKA 5LO7A 2DM3A 2WWKO 1BM3H 4JFEE 4UWQB 3MLXL 4LPWA 3WNLA 2VDOH 4JFYB 5LXGL 4TLSA 4PMEA 3LDBC 5FV2A 4JFSA 1DQJB 4DGVL 1ED3A 2DY2A 3RZCB 3S8GB 1Y18A 2ZKHH 2MTAA 3O6LL 2IWGA 5AOZA 4A7UA 1R3JA 4HU2A 1AZUA 1RHFA 4PCTA 2FHBA 1UM4L 1XCQA 4OVVA 4CU7A 1RL1A 1PQZB 2VQ1A 2W80C 3X3GH 4PGZA 2BOBB 2NW2B 5DURB 3M7FB 3QIWC 5EF3A 2X4SB 1NWOA 2F53D 1OAZL 3E6HA 2VN4A 3ULUD 3AREB 4MBRA 4X98B 1KNOB 3KBHE 5HGHA 1AQDA 3FBQA 3W0WD 5I66A 2DBLH 4PWIA 5F97E 2YD6A 4FYRA 1S7UA 3LKNB 3SDXB 4Z7AA 2X1QA 3KWWA 3MJ8A 2VT0A 1DQDL 2ENSA 2X44D 3OC8A 2IH1A 4L3EB 1ETB1 5A16B 2J8HA 5LGYA 1NCDL 4S1RL 1NCOA 2DPKA 3GNMH 4NJ9H 1DJHA 1FHGA 2JMRA 3NZHL 1EDYA 4HLZG 4OT1L 4XOEA 5D7HA 1SXCA 1FFQA 4JHWH 2DICA 3DPBA 2YBRA 3T2PA 3CDGB 1QEXA 1UURA 5AUMA 4ZFZB 4M4RA 2BY1A 4HLZH 5FUOH 15C8H 1RURH 4OSUH 4Y2LA 1FZMA 3BP6A 4H8PA 2QADC 3OHMB 2PCXA 1JNHB 1BVNP 1S7TA 4IU2B 1RJCA 1JPGA 3V6FA 3H4FA 2G2RA 4O5LL 3AM8C 1T7YA 2CBTA 2DTSA 4ORGA 4UOZA 1I7UB 5IB2A 3MRRB 4E9TA 4YHZL 4QF1A 1Y1DA 1DQQA 2QQLL 4GAJL 1IL1A 3P54A 2AP2A 1KFGA 3FT9A 2UUDK 1JXGA 2JJWA 1QUNA 2Q7YB 3C60C 3UTSB 3EIFA 1HCZA 1W72L 3QQDA 2XSKA 3CMOL 4W9ZA 3VXSD 1OAUL 3QR2A 3BUIA 2NY5H 3VWKC 3HUJB 4KC3B 4P2OC 4FNLH 3V5KA 3V95A 2Z31A 3IAQA 5LCVH 5TE7H 2VLRE 5E5MB 3ZLQC 4B27A 1WIPA 3D05A 3STLA 2D7TH 3HR6A 2XV6B 3AAZB 1M9WA 4DEWA 4OFVA 1DFBH 3KH3A 4WCYH 2PCPB 1TQBB 1XH0A 2XWBA 4PJ7A 2VERN 5KSBF 1RZIB 1R5IB 1SDDA 2XKUA 3IFPA 3MXWH 5E8NB 4F7TA 4JG9A 1YVLA 4UDTB 3BH9B 5BRPA 1DJIA 4HJ0C 4RETB 5TQ0H 1I1FB 2VSKB 1P6FA 3HE6D 5T5FA 2QQKH 3V52H 1RZ8B 4AH2A 2EKJA 1ACXA 4AK1A 4APQA 2CIIB 5C97A 2PCFA 4RMBA 3T09A 3ZQXA 1TZAA 4L0ZA 2PXYA 5F1NB 3WEBA 3TESA 4P23B 3HNVH 3QWOA 3RHWK 1Q9OB 1TJHH 1GAFH 3CVCA 3MA7A 4KZ0A 3S4SA 2Y07L 3SDYH 4NQXA 5F96H 2QGEA 4O2CB 5B4MC 2ZUXA 3H4HA 5AZEH 4G6FD 4ALAL 5C7XH 3IF1A 4HK0A 2APXA 4M48L 3ETBF 4IBVA 4GO9A 2VL5A 4CADB 5GISL 1D5MA 2YMTA 2F54A 5DUPL 3V4LA 4M61B 4J3OD 2PW1A 5C0FA 1BW8A 4KI1A 2IDQA 1F6AB 3F7QA 4AEIL 4AE0A 1LQSR 4FQ2H 1CG9A 4DGYH 4JCMA 1FSKC 4Y5VB 3TO2B 2R83A 3DVNA 2EXYD 4PGEA 4OFDA 1NUFA 1R33A 3A6OA 3VX0A 1LO5A 5AB0A 1IO4C 3IWVA 4LCWB 1ZVHA 4Z3FA 2BVPA 5I1KL 3V5DB 4JKMA 4V1DB 2QBWA 2XPGA 4NDMA 1VERA 5HHOE 5IHZA 1TFHA 2BVQB 2UY7B 1U93A 3NA9H 2AV7B 1PY4A 5KUKA 1UWGL 2WXNA 5BQ7B 1F4YL 3A21A 3S4SG 2ICEC 2AJSH 3DXAB 3E2HB 3PUCA 3CFMA 4FYSA 4N2NA 5JDJA 5JO5A 2O93L 3RWIA 3TX4A 4XNZB 3KPRA 3P9MA 3MCKB 2EUVA 4BK5C 4F24A 5C3LD 3M1OA 1AHWC 3GM8A 4JFXA 1CF8L 1W15A 4WEEA 4HWZB 1KWKA 1SQMA 3F84A 4H5SB 1E4KC 2CRIA 2E6QA 3VUAA 3DROB 4KNUA 5D8JL 1SY6H 4HUNB 5ACZA 3APFA 1XH3B 1NCJA 1HL5A 4LAJH 2EIDA 3KPNA 2ENJA 5DHDA 4IHOB 4S1SH 2EYTA 2XWXA 3SCMA 5E9DE 4WEBL 5C0IB 2F2HA 3ULUC 3MYJB 1MRDL 1SYSA 5EBGA 4OZFB 2DDQH 5AKRA 1N68A 1T5XB 3F00A 2VDPH 2Z91B 2XVBA 3DVGA 3DYOA 3LEXB 4LSRH 4FQ1L 4GRLC 4NLHA 3AABA 4FFTA 3CFCL 1WAAE 3GTTA 2HLAB 4YBLB 1JHLL 3RWGB 4LLAA 2BWIA 2D31B 5E00A 2ODIA 1VKXB 4TVPL 1U91A 1XGRA 5T3XL 2FJFA 5ES4B 2H1PH 4DHLA 4WO0A 4Z76A 2XOTA 4CVWA 2Q76B 5KW9L 3NCBB 1ORQB 5FOJA 4JKKA 3DRQA 2XWJB 4J3TA 5HYIA 4E9WA 2FR4B 4D7BA 1H6UA 3U2JA 3FQRA 4QRRA 1DEDA 3OPZH 3ILQD 1BGXH 2DWSA 3MRCB 3ZMNA 4ZUSA 2CJUL 4GYBA 1WAAF 4JCWA 3PHOA 2F74B 2LU5A 4PY8J 3QEUB 4OLZL 2OTUA 4PVMA 2VR5A 3V55A 5DZPA 3SY0A 3W5NA 2Q9OA 5LAXB 3BAYA 2QKIC 3GZKA 1FG2A 2BNRD 3DTXA 4KK9D 3ULUE 2WKLA 4FHBD 4BGDA 4LPCA 5DDHB 1CD0A 4BZ2H 4PJ8B 4N2AA 3L6FA 3OZ9L 4K15A 2IBGA 3VDAA 2WQ8A 4F9PC 3GMPA 3TT3L 3HR5A 5C0CD 4HEME 4XXCC 1F0LA 3FTVA 4L9LC 3T6QC 1C16A 1UFGA 3EYQD 3GB7A 5AVTB 2O5ZH 2NY0B 5T8IA 2WZ5A 4PRDA 1T83A 2PO6D 4ODTL 3TO4D 3UO1H 4X83A 4MAYA 1NMAL 1ZLWK 5JHBA 2VR9A 1EEZB 1I1RA 1CXLA 3CN3A 3V7MA 1E9QA 2EO7A 2VC2L 4MNQA 4BEIA 3AB0B 4PM1A 4Q74A 3SKOB 3UTTB 1NGZA 1A9BB 3NJVA 4NQCA 5F0MB 1LK3H 3ZR5A 4H0LC 4WNSA 3AW5A 3GEWB 3T77A 2V0AA 1QATA 4PWKA 2D7QA 1JYVA 3CVHA 1FZKB 4M93C 1UG9A 3GMMA 43CAB 4U0RC 3RUGB 5E2VH 1A14H 3BRGC 4NZDA 1T66D 5IHHA 1S7XB 4L8SA 3TPKA 1LE9A 4H0GA 4X6EB 3RWHA 1X5IA 5L4FA 1JZDC 3IXAB 3WHE0 2HJKB 1NCWH 4J28A 4Y7OC 4PD4K 2I5YH 3KS0J 4ZD3H 1A3ZA 2XIIA 3PJNA 3QJQB 4B7LA 3VE0B 2Z93A 2XQ0A 1FV1B 4Z3JA 3I3DA 8FABA 3IRZA 4ZQKA 4JHUA 2QGDA 1XSIA 3JT2A 4HFUH 4IGBA 3QDJA 4NSKB 1ZA3B 1J8SA 4W9JC 4R0LB 1QVOA 2BFVH 5C09A 1DTUA 4HZAA 3C5SB 3FUIA 5IQ7H 4XO3A 1TYEB 4U3SA 1RK1A 4XBMA 3C8HA 5GRJL 3DHJA 4AXWB 2EXYC 1IMHC 4JPVL 4AL8H 4NO3A 5I1JL 3U7WH 5GS0C 1K5NA 3OKKA 4ETYA 3WLBA 3QO0B 2JFCA 1MJ7L 3V0HA 1SN2A 1QHOA 4AWJC 3H9SA 2ZG2A 1LEIA 4M43L 4GW4B 3QUZB 2E8ZA 3C5ZD 1YNKL 4MXWH 1U3HA 4S1QH 4GQQA 4I85A 1E43A 3D87B 4BGLA 4FLQA 3TVMC 1K4DB 3WCYA 1D7FA 1B0GB 1F00I 3HC4L 4XVTL 3PFUA 5ANMB 4JNXA 1LE5A 3UTPD 4YHLL 3ARDA 5B7MA 2FIRT 2VLLB 2EDLA 5JPMC 3ZZSA 3SDAD 3JV0A 2DYPB 1KTKE 1A6VL 3GLEA 1JHTA 1QWNA 2NY4C 2ZTBA 1AZRA 2FH8A 1NCCH 2A7BA 3GRWA 4NO0B 4IOSD 4Z0BL 1MH5A 1S7QB 4HMEA 1JNLH 1P5UB 2OSYA 2AMGA 4L2LA 4XCNA 2VE6B 4O9HH 3BZ5A 3MFFA 1GGIL 3VJ6B 2P3YA 2R2HB 3II3A 3LH8A 1N59A 1EO7A 3L1EA 5JYLA 3LXCA 1R5WB 4HMCA 1E5ZA 1X7TA 3OLGA 1EXHA 1A7NH 4O2EB 3VH8A 2MCG1 4N2EA 5EU3A 1SYVB 2F53A 4AX3A 1PX3A 3KWVA 1NC4B 5DJ2B 4AE1A 3B2MA 4K7FB 3W0WA 3TBSA 1BHGA 2VDKL 3SQOL 4DKEH 3CVHL 3K6FA 2C9QA 4RMRA 3ZIYA 1YYLH 4FNUA 2B7DT 5F7FA 3O6FB 1J5OH 1BJMA 3MRNA 4Y2DA 5GXBB 3WDHA 4EKJA 2Z4QA 1T03H 5D1QD 3SE8H 3VW3H 2YARA 4V11A 4P0DA 3G5ZB 3WFHA 4DVBB 3D3VE 3H3PL 1I7ZB 5J1AA 2YD2A 3LKRB 3QCVH 2CAKA 2OFQA 3C8KB 4PJ9A 4OCMC 3FOLB 4MMZB 5M7QA 1WP6A 4KHTL 2Y7SA 4NOBA 3MNWA 4NRXA 5FUZH 5TE4H 5J8OA 1CD8A 5HJ3A 3B83A 4TQEH 4R2GB 3H7BB 4HK3J 1IC5L 2YEZA 4M7JH 1A6AA 3C8DA 1N5YH 3QXDA 4DZ8B 1FYTD 5AW2B 4NI3A 3ZKXC 5BV7C 2BRRL 2CD0A 5EN3A 4UIKL 2EVHA 1FL6A 1KSRA 5JIIA 5AB9A 4J2XA 4NM8L 3OX8B 3PYCA 5INCA 4F80A 2W9DH 1EVUA 3D18A 4GQ9H 3VFRA 5EU7C 2GK0A 4L1LA 5LNGA 2WQAA 3RVUD 2APVA 3FCTB 1NOFA 2X09A 1IGYA 1PZAA 2EDMA 4JFOB 4QJ3B 4BFJA 3OJVC 1BVKB 4XMXA 3VGFA 1OAQL 4YMPA 4I2XB 5IQ9A 2NQCA 3V6OC 3ULUH 1RZJC 2R56H 4ELMF 5KBLA 3VFUB 2WLMA 3TO4C 4PCSA 4HJJL 1UT1A 2AJYH 3UAEA 1OWWA 1AGFB 3VXSA 1A6WL 4Z77A 4ZMTA 1XEUA 1OPGL 1CFSB 2ZCLL 4XCCL 1T89C 2HFEB 3RVWC 1L9TA 3Q01A 3D39D 1W2KT 2PKDA 4D9RE 1WBYA 3QZPA 1XR9B 1EMTH 2HJLA 4M7LH 3VTMA 3WEXB 3S88L 2LTQC 4YR6A 1NDGB 4DEUA 2RCSL 1ZGLB 4X99B 3CFEB 5KVFE 1GS6X 1T66C 5D72L 3IGUA 2OS7A 1PZSA 4XAWH 1PJWA 2X4UB 4XO5A 1TTUA 4L8CA 3ULVL 5IM7A 4PQXA 3K4DA 1DQVA 2FD6L 5IVNA 2W0PA 3HE6A 1AKJA 5DJ8A 4M3HA 3SSGA 4M6NH 4OZIF 1U8MB 2Y6TE 4MJ5A 4PTUA 3KPLB 3VI4F 4PJ5A 2FZ3A 1G7HA 3JV5A 1BIIA 4AYFA 5KVDH 1E3ZA 4DP8X 4FNTA 2NCMA 5E2TL 2XJKA 5I6NA 3T1FA 3V6OE 3U6RA 3W9EA 5J9PA 3FQ4A 1X5KA 1KY6A 4GI6A 1I1AC 4C56D 4BM7A 1QQDA 5IUCA 1AOZA 3BUTA 2XPZA 1ET7A 1T7VA 5D7JA 1AO7E 2DTMH 1KCVH 3X1GA 2BP8B 4FZ8H 4N28A 4E42A 3R0MA 5JW4R 3FFDA 3HB3D 1SRDA 1QSEA 2F1BA 1JK8B 2EYSB 2E9BA 1UM5L 1JFQH 3D34A 3N9GL 2HG5B 3MV9B 2DRUA 2DWDB 2XV3A 4G5AA 2A83B 4WO4B 4HIXH 5EUOA 3QZBA 1VRSA 2J21A 1BEXA 3DBXB 3C5ZC 3M6DA 4Y16B 1J5CA 1SOKA 3NGBC 2VL4A 2BVYA 2RR3A 1EHLH 5GSRA 4UI2A 4WI5A 2CHWA 3CHRA 4YIQB 3EFOB 1LO4H 4YXLL 4WWKB 4MJ2A 1VJSA 3QNZB 1KELH 4P2QA 3L81A 4R83A 5L9DL 1YJDC 3SDAC 4PVLA 1QEWA 5F9WC 3AROA 1MFUA 3MOAL 5J13C 4HHAB 4WI0A 5D6CA 4WUUE 2O5NA 5I6XB 2QTEA 1QLEL 1JPFA 5D9SA 4UUJB 1GMIA 2NYKA 1KWGA 1M7UA 1ND0A 1R0AH 2VLKD 4O51B 3W39A 2IO5A 3EG9A 5JXAL 3ZDZE 4J3OG 4Y8DC 3F85A 5AVVB 3ABZA 3ABKB 2AZUA 3DVIA 3EO9H 4PJEF 5CEZE 1E8XA 3WFBH 1FBIH 4KNQA 5MEQB 3ML8A 2WYTA 4G6KL 3ARFD 3O2VH 4JJHA 1ICTA 5DFVC 3UGUA 1V55B 4DK6A 4G80A 4P4KB 4MGXA 5C0AD 2GSGB 3ZKNC 1YEKH 3ZZQA 4XOAA 2GHWB 4OW6A 3NFSH 4H8UA 2WWOA 3BIKB 1O75A 1CFNA 2KHAA 4HBCH 5GHWH 1J5IA 3D5OF 1YNTF 1MW3A 1DBBH 2A9NH 4J2QA 3ZE2E 2ALWA 3KPQB 3RBGA 4LDLB 4JHZA 4ENEC 1U8LA 3Q3GA 1QR1A 3MROA 4JDTL 3HG4A 2XN1A 2PYEA 2BIPA 5FO7A 1CXFA 5I6PA 1CLVA 2XBTA 3PGCA 3RZCD 5LN8A 4W4NA 3DX8A 2FVNA 2H8PB 1BP3B 5FYLD 3T8MA 5MEND 1BQHG 3BJ91 3K3QA 1KYUA 4RVBA 4EZMA 1GOGA 3MLRH 2AQNA 1Q9WA 2OYMA 5ADOH 3QQ9C 3ZE2F 3P4NB 3TPUA 5ID1B 1HHIA 1L9RA 2NX5E 5DRNB 4YHIA 3REWB 4OZHE 1X5ZA 3MRIA 4Q0XL 3PP3H 2BSTB 4PP2A 5HDQL 4BSVB 2PMZA 3ARED 1A7RL 5DVPA 1FE8H 3M45A 2R59A 4JDVB 4N0YH 1PX4A 1LJMA 3H9HA 12E8L 1CB4A 3VFTA 1IGFH 2YPVH 2EH8L 2IDTA 4JG0H 4NQEA 4OB5L 2Y5TB 5GZND 3RVUC 4U1GC 4AIOA 2WZAA 3QAZC 1K8IA 4L3ED 5CJXA 2Z7YA 5C0CA 2P48B 4MBOA 4QTIL 4FQCL 5EC1A 2CKBL 1S8DB 3PWPB 3T9WA 2HRPL 4Z7VF 4I3RH 1U8OB 2NDFA 3GQFA 4CN1A 4DGUA 1WA1X 2RFXA 4G9FB 4KV5F 3JZYA 4LARH 2Q8BL 3LKPB 3PV6A 3PXJA 3S0PA 4IIQB 3KLHC 1PGRB 2M26A 4RAVB 1GZPA 1JZFA 1ES0A 1QLEB 5IB2B 5FCUL 4Y4FB 2Y5QA 1OGTB 5C2UB 4QTHA 5H37G 5KYNA 1IZJA 1G7QB 3VXUB 5ESVA 3QFJB 1NZRA 3QXUA 2H2PD 2XZQH 5DWPA 2HFGH 3C6LD 4GSDH 4JN2B 4Y1AA 5BXFB 4OV5B 4ZXBC 2CH8A 1HKFA 1NBZB 3IDYC 1Z9SB 3VD5A 3I6GA 1V7NL 1W0YT 1W0VA 5H37H 2J8UE 3H2PA 2AI0L 5HGDB 4TKWA 1V54B 2DMCA 3RPIA 4CSPA 3MRQA 1MY5A 3UTSD 2EYRB 1N0LB 5JOPE 4QD2E 5ETUB 2DQUH 4NN6C 4Q2ZA 5F6IB 1N26A 5IHWA 4JG5A 3VXQB 4GG8B 2V9QA 4OM1H 5I8OL 4L29A 4GEJA 2LV4A 1CWVA 3QPKA 3HNTH 3S35L 1AS6A 1FL3A 2IFFL 3MN8A 4GSXA 4MDJA 4W9IC 1KIPB 1ZT7A 1F5WA 1SHWA 2J8UF 3C2AL 4K3DH 3T4AC 1RZJH 1E9PB 3TIEB 3QJZA 1DJYA 1QLFA 3FFCB 1ZEAH 3FF8A 4PWEA 4Y9GA 4B9CA 5EO9A 5E08L 3GJEB 3TV3H 3LIUA 4QRBA 2CPCA 4OVUA 4HUVA 3IDXL 1NEZG 2C26A 5HI5D 4JO4L 4F58H 3LB6C 2H26A 1MFAH 5AALA 2XQYG 1KLFA 1C5BL 4RZCB 1KB5A 3STBA 3ZU8A 1PDKB 1ERNA 2JLLA 4ZK8A 3KYMA 3QWRD 4ZOAA 4XCYB 4ZO9A 3P2DA 3APDA 2EH7H 1ROCA 3L3JB 3US9A 5CBAA 3RFZC 3W2DH 1WAPA 2W92A 3SKMA 1E28A 1QFWH 5GS1C 4NT6B 1IBGL 3DX4A 1OT1A 2WXIA 3X14A 3OC5A 4WWNA 4XPHL 4Z3GA 1QO3A 1HH6A 1PG7H 4QXTA 1NLBH 3KVPA 3H9YA 4NBYB 5CJOL 4C56E 2FAUA 2YGVA 1RAMA 3PGDA 1TDQA 5HGBB 5KOVC 3RNQA 2EDBA 1ZLVH 4ANWA 3HKFA 4FL4B 3ARFC 1LP9A 4LNVA 1LDSA 1KYOJ 5CJQL 4LCWD 5C08D 1TNMA 1OD7A 4N26A 4KOBA 1PAZA 2EXWD 2MFNA 4KK5D 4V1DD 4PBWD 2WYZA 1WGVA 4NQTA 3L1GA 4FQHB 5KSUB 3VSUA 1P4LA 4MNGB 5DYFA 4XNQA 4QRTB 4I13B 3D85B 2H32A 2P26A 3DXAD 4AW7A 1E4WL 4HUXA 3CSBA 4Q9RH 1UA6L 4GKZA 2X2JA 4JPKH 2DQ6A 1E27A 2XKNA 3U4BL 2AHIA 1P6WA 2WNGA 3MZGB 5KEZA 5D1QA 2K8MA 5AVZB 1DVYA 4HWUA 4PJAE 2RQ8A 1JGVH 1H3GA 4XOBA 4EI6B 2P49B 3CFJB 3BAJA 3BMWA 4FG6C 5DR5L 3BEWA 4RGNB 2NPLX 3HG5A 3II1A 2P5EA 3W9DB 2PCYA 2X42A 3IS0X 1XTMA 3ZRCC 1YJDH 5JA9A 4HWBA 3M17B 2BSRB 3DBSA 4JLRA 1KG0A 3U7YH 5A2IH 4FQQB 1R3HA 2OYLA 1RFDH 2GFBA 2JCCA 2ILLA 4HMDA 4KOCA 3I9GL 3MLSL 4JVUA 1MVUA 4EJ1C 2GJZA 5BRZD 5IKCB 4MMXC 1A0QL 2IAMC 1JTTA 4NAJA 4BHUI 3CFBB 4M9PA 3CSGA 1C12A 4NX0A 5GZNC 3VGDA 1YPZF 1WFIA 1XGUA 3C5XA 2OMUB 3WJMB 1QFPA 3UYRL 1FNGB 3CFIC 2AK1H 4PJCE 1UCTA 4NM4L 2O6CA 1OGSA 2WXKA 4OD2B 1A21A 4ODXA 4P9MH 5IP4A 3WFEH 4XMVA 4FOMA 3SN6N 3PGFH 1G7JB 1X3DA 2JXMB 3EJRA 4PEEA 5E9AA 4QT5B 4XZUA 2F5BL 4F3FB 5IIEA 4AIZA 3GI9H 4B9YA 1FRGL 5FOBA 4AKQA 5BZDB 4KGLA 4GXUM 4NKMB 1NCBH 4NQSB 1BECA 2BPBA 3ARBC 4OGZA 4R84A 3J2PA 3OKNA 2OL3L 3ZO0A 2BWQA 1MWAL 5H35B 1AQKL 4KPHL 1CD1B 4DJMA 4F37K 3EF7A 1JF1B 4C83B 3QI9C 4PJ8D 2VH5L 3QUHA 2C7FA 4LSUH 1AQHA 4KH9A 2WQXA 2R51A 1ML0A 3SD2A 3S36X 3J7HA 4L37A 4DCQA 2A0LD 3VXMB 2NY0D 5DK0A 3OLEA 2C1OA 4W4OA 4UNVA 2MKLC 1DQKA 1H15A 4EIGB 5LDSA 4UDUA 1UB6B 1G4RA 1F86A 2XN9E 5C71A 1AI1H 3BXNB 4M62H 2JKLA 3T1WA 4RDQF 2XX0A 1IZKA 1OAKH 2NLJB 3LKSB 1KIQB 4F9LA 5HJGA 1PZCA 4N2BA 4EF3A 2IV9A 3ZTJH 5L6YL 5ICXB 5KYUA 4G6AC 3V4PL 3UYPA 3PP4L 3D1MC 2V3DA 5EUKB 1MCNA 1ZHBB 2J72A 3RE0A 3UTZA 2LU7A 1UKQA 2J56A 1BJ8A 4GMSH 3NSXA 1R3KB 3S3DB 1KXQE 2R69H 4Z3TA 3E8UH 1G1CA 5FHBL 4LKCB 4HWBL 3C6EA 3MNMA 5F6HJ 5DA0B 4P23C 5AW6B 1BFVL 4KJQD 1KC5L 3MUJA 4RMWA 4X4ME 3BE1H 1UKSA 2ESVB 3GXFA 1YRKA 3GSVA 5K9JH 3MHZA 3BD3A 4POYA 2AK4B 4NWUL 1FVDA 1FWXA 1SOQA 3UTSE 4ZFFA 4KFZC 4U7KA 4ZS7H 2XZAH 1HL8A 2BIQA 2F7OA 4E41E 4Y19B 1AR1B 3NK3A 1O6SA 1TITA 4YUEH 1INEL 1S3KL 1EAPB 2X4NA 2FYYB 3P3TA 3KBFA 1J0KA 5IFAL 1CDJA 5B7EA 3ZE0E 2ADJB 3MLYL 1RPKA 4L18A 4TNWF 2F1AA 1LO3L 3CV5A 4Y1TA 5D7IE 3ZKMD 2VLKA 3NIDE 4R3SB 3QFDB 1HWWA 2V5YA 4HF5H 3QUMA 1KEGH 2VW7A 3NIGF 2I7SA 4UZGA 2XZZA 7PAZA 4M1DL 4O2FB 1PYWA 4TQ8A 1RJZB 2EXWC 4KK5C 2GUOB 4PSRA 5KVEL 1G1OA 1Q1PA 1M7IB 4GKSB 1CFQA 1V3MA 3QUZD 5FKAB 2HVBA 3D48R 5E8OB 1MWAB 4QRAA 5I0ZA 3HBGA 3FU5A 5ECJE 5F71A 4ELDA 4R5TA 3ZE0F 1UA3A 2VDMH 4XX1E 5C0DA 4AM0Q 4JO1L 1MCOH 1RLBA 5D7IF 2WJ5A 1OTTD 3NIDF 5GGSY 3F7LA 1FORH 1JIBA 4DP4X 4LASH 5DZLA 4BCYA 2IWFA 2IQ9H 3IMVA 4XNZC 2OSLB 2LLNA 5EULV 4U6VH 3IJHB 2DYPD 5CWSB 4XMKL 3CZGA 5DEGA 3BWUC 2H45A 4X9BA 3FO9B 1XF3B 4NO0D 4JE4B 4TL4A 4XTRC 3L3KA 3QDAA 4MZ2A 2QT6A 4ES8A 3RZCA 1V5JA 3BWZA 2GJPA 4YAQA 5F1IA 4FMVA 2BP5M 5MENA 1ZSDB 5DGQA 1AGEB 2A6KA 3ERXA 5J5EA 1UQSA 1PQZA 1MUJB 1FC2D 5T1LB 1IIKA 5E1AA 4QHNA 3RZWA 1UACL 3ME0B 5FO8B 2ZOWA 2HPOA 2Q8AL 5D7EA 1CN4A 2X4SA 1NIDA 1XGTA 5DC0A 1S46A 3C6SA 3ZDYB 5F9JB 1NC4D 2VMEA 2XXMB 5EZPA 4WUKH 2AANA 3O2DL 3QAQA 4OD3H 3N0AA 3O6FD 2WUBL 2G9KA 3KPMB 1P7HL 3MGTB 4NUGH 3OMAB 1NFDE 1K4CA 2YKLH 2YD0A 5AW1B 4UZSA 4A2MA 3IMWA 3TWCL 4DAGL 4OGXH 2ATKB 4AYBA 2AQ1A 3ZE1F 1IJNA 2WZPD 4DP2X 4AV0A 1JVLA 1DVXA 3FQUB 5K69A 4PGBA 4ALAC 1HDMA 2IOIA 1CUOA 4AC4A 5IEKB 1S9KC 4R2GD 1NCGA 5EU6A 5A1AA 1VCAA 1Z7JA 1X9QA 1BPLB 1NFDF 4KDTA 4NP9A 1EUUA 4P2AA 1L9SA 3A6CL 2EDJA 3O6KH 3MA9H 4PJ8C 5FYLH 1NPNA 4WW1B 1JNHA 3P9LA 4P57B 1EGJA 3C6LA 3NZ8B 4TTDD 2YGPA 4BCZA 4DPAX 1I7UA 2ZONA 3KLLA 4Y9CA 2A0LC 3TJHD 2B0SH 2DQFA 1JVKA 3OZKA 1VF5C 2NY0C 2WINA 1J5DA 4MKMA 3AS2A 5BMFL 3ZDXB 2ATPB 4HH8A 2FT7A 2Q87A 1VZIA 4G7YH 5B38B 3HAEA 3T8VA 3BKMH 5DO2D 4ADGA 3HUJA 3AB0C 2X1XR 1PNCA 2X5PA 1QASA 1WZKA 4KHXL 3VQMA 2CALA 3H6JA 5E5MA 1NCNA 1JGUL 4BWWA 1CYXA 4PJDB 1T5WA 2OSWA 1J86A 1ZJAA 2FSEA 3U9PL 1HQ4A 3DMMB 5GGSA 2IALA 1JWMB 4JQIA 1WBXB 4OBRA 1IBHA 1XCXA 1FI8C 1P9MA 3R06B 4MDIA 3LQZB 5F93C 4K55A 4TULL 4KKCC 4KKPA 4IU3A 4RX4D 1CLZL 4UDTA 3DX9B 3M7OA 1TMQA 1A4JB 3L7EB 1V3KA 1JL8A 1T1XB 4X0KB 1T1YA 3IDIB 4BUQA 4KJQC 1RZ8A 4MD0A 1JPSL 1C5CL 1SJVA 5I2IA 4QEGA 2CDGA 2ZPKL 4J12A 5I0YA 3DOHA 5JW4Q 1L6PA 3LXBA 5HYEA 5E1GA 4OLXL 4ZO8A 3F7YB 5GJSH 2VRAA 4JRYB 1I7TA 4F57L 1Y6MR 5KOMC 4DVRH 2VDQL 4PVNA 3DJZA 1E9OA 2OJZL 2CLZA 2PXYC 3ZKMC 4Q97A 3UTTE 4RFOL 4BXSV 2XG4B 5AWNL 4FJ6A 1F6AA 2HJFA 4ANXA 2AJXL 4XP4H 1RUPH 3FN0L 4NPYB 4Y5VA 3MV9D 1GZHC 4HFWA 1ZIAA 4WO4D 3K0WA 5F7MC 2J20A 2LAAA 3MLXH 1R3IL 5C08A 1UVQB 2UWEA 2XICA 2XWCA 3L48A 2EXSA 4TS6A 4Y16D 3AG1B 1GGYA 4LAQH 1KDIA 1I9IL 1ZV2A 4K9EL 1EH9A 2E7MA 5AVSB 3WN5B 1OTTC 3P4OB 5D70L 1QI4A 4WWKD 1NFIA 3JUYA 4PJXA 2AV7A 2ZNWA 4XNAA 5D2LA 5JOEA 4AGQA 3UJJH 5AFAA 4XPBL 1T7XA 1IM9B 1EGJL 3TP4A 1YN7A 1H3UA 3OHXA 3IKCB 3LZQA 1CIDA 1FDLL 1OAZH 4TVPE 1D6VL 1YUHB 4DKFL 2BO0A 5T3XE 4FQPA 1UZGA 1P5UC 2VISB 4JM2B 4NFDA 1CDGA 2NQ3A 1SJHA 4NNYB 3EYVA 1HU8A 1FFRA 4GW5B 4F7KA 2HT3D 2Z8RA 1EA9C 1GGBH 1DQDH 3PL6D 3MC0A 3ARSA 1U30A 2B15A 4HWZA 3O81A 4GEIA 1EBPA 1OAXL 2Y7OA 4Y5XB 1S7VA 3NJHA 2EIBA 3HRZB 4UF7C 4PJ7F 2LW3A 4IHOA 1NCDH 5AAWA 4HX1B 4RGOH 4OCSL 1DEEA 4ZRGA 4KMTL 4P4KD 3SGEH 3B2DC 1CZ8H 2FBJL 2YOAA 3V0AC 2E3VA 4LU5H 4P5MB 2BIMA 4W9KC 3HVNA 1A8JH 4NQDD 5BRZA 4NNXB 2HX7A 1DQML 3S2AA 3RGVB 5IG7B 4ETQB 3FHQA 2Z91A 5IEHB 4JQIL 4NZUH 4JFDA 4ES9A 4OUOA 1LILA 3DK0A 5CIPB 4A67A 5TQ2L 1N8ZA 2R23B 2F5AH 3L3HA 4WNQB 3WE6A 2V2TB 4NN7B 1YA5A 3MRGB 1TTRA 4KTDL 3SCMC 4LVNB 2EACA 2VLJD 1A3RL 5F89B 1ORQA 2NY7H 4Y9BA 2NY1B 2YXWA 3AADB 3MJ6A 3UFIA 2FWSA 4PV9A 4WK4B 4EQ2A 5KBNC 3TH2T 5C07A 4NKIL 4WV1A 2ZX7A 4R2GC 4CVZB 5BNXD 2MMXA 1RCYA 4YHZH 4HKZA 3VG9C 2FYVA 4GAJH 1ROWA 2MQ0A 5EZIL 3RU8L 4BHUA 2VDQB 2VXVH 4MJIB 2EEXA 2L04A 4NCC1 2R1YA 4J3SA 2ZKMX 3TBTB 3M1BB 3HNSH 5LGJA 1GPOL 1JZ7A 3H53A 1KBPA 4OFYD 4TTDC 5DDHA 3UDWC 1XXFC 2APWA 5D7KD 5ALCL 3TJHC 1BX2A 4N2DA 5L2KA 2LU4A 3UPAA 3US1A 5I74C 1E4JA 3GSNB 4CGUB 3O3EA 1J0YA 4OZFH 3BWAA 2OMZB 1MELA 4FHJA 1RUMH 1U4EA 3PWPD 4R97B 2K4AA 2EQDA 1TQVA 1HXYB 3LPOA 4I3SH 1F11B 2A4ZA 4EVNB 1UOVA 3O9WA 4YQXL 3DNKA 3DRTB 1RIVH 4FF9A 4UM8A 5FO9A 3CE1A 4Z7WB 1DN0B 2KC0A 1XCTB 2G4EA 3TBCA 1M56B 2EDXA 3F3HA 4Y4FD 3SKOA 3WMPA 4FLSA 5ACMA 4ZMYA 1A9BA 3B1TA 5D1XD 3B8SA 4HEPG 5EZOL 2VO8A 4G3YH 3VXUD 3L2MA 3QFJD 4LRIC 3D06A 1NCAH 1RVFL 3MO1B 5DMKA 43CAA 3RL2A 4TVSa 4KX7A 2EKSB 3RUGA 32C2B 3CPLB 4ALAH 4AQ1B 1N3NB 3FTYA 1Q94B 2EIJB 4M48H 1UWXK 1DL7L 4OY9A 4QRSB 3MJ9H 5CINL 5GISH 5DUPH 3U0PB 4QRRE 5KYYB 3FYIB 1XGZA 2JJUA 4Y89A 2J55A 3K7UA 3KS0H 4I2XE 3FO1B 1GGCH 3UROR 2NNRA 4PGCB 1JCKA 3FFOA 4KVCL 4BFOA 3EBGA 4WSJA 1NBYB 3FB6B 2YMXH 1ACCA 4LDCA 1GGTA 3MLTA 5I1KH 1JNNL 2APBA 2CDEA 3LJ3A 1HAWA 1MFDL 3TFKC 1ZVSA 4K23L 3NCYS 5CLWA 1ZA6B 4MZIA 3MTRA 4OIFA 3GMLA 3C5SA 4NGHH 4Q52A 3TEYA 2YRLA 3VXRB 4M5YH 5IMOB 2V9UA 1UWGH 5EU5B 4AEHL 3FFCD 4TSCL 1XZ0A 2DH3A 5F7DA 4LFHD 4AXWA 3GSOB 3ZTEA 2KBGA 4M6AA 3B9VA 4IGBC 1BD2B 3FQTA 5IESH 2Z35A 5FDYA 3QO0A 3GIZL 5DC4B 2WANA 1OLZA 5DD3L 1YY9D 4YDIH 4JB9H 4OM0H 2VZOA 4K3GA 3JVGA 3QUZA 3BP4B 5I8CB 1CF8H 1JGLL 2JKXA 4HS3A 4R26L 4JGNA 4MNQE 4XNMB 4NO2A 1TT6A 4ODWB 4PRPB 3O8XB 2COVD 5EMYA 1KLGB 3CBRA 4Z8FH 2K45A 3BP7B 2QV2A 4H2CA 3LN5B 4WGVB 1OAJA 3EGDA 5EOTB 3ZMRA 3TTYA 2MWCA 1ACYH 1KBGH 2XFXB 1MRDH 3MX0A 2XYBA 2HT3C 4FQ1H 2GHZA 1SM3L 2PWGA 1MHEB 1T4KB 1EERB 2X4RA 4KKAC 3FNKA 5LNDA 3RWFB 3K2KA 2VE6A 1JHLH 5CLTA 2AEWA 3NFPB 4GAFB 3ARDC 3HS8A 5F7EH 1ZJBA 3TM6A 4TVPH 2YD3A 4N2MA 5DA4A 1EEYA 5DJYA 1NOAA 1IKFL 5KW9H 2VXSH 1NGPL 2QHRL 2IPUK 4P4KC 1R5WA 2JNZA 2A9BA 4EIZC 5JW5B 3LQMA 3MV8A 4QOKB 1BV8A 3GSXA 3D0LB 3QDJE 3UZEA 3VD7A 2DMGA 1I85C 5DEJA 3B34A 1UWFA 2M1KA 2VJ0A 4W9DC 5DJ2A 1TQUA 3I75B 1ZK9A 4R90L 4NZRL 3D85D 1LO0L 1MOEA 1TTFA 3FCGA 5I1IL 4FQIL 1G87A 1VFOA 4Z7NF 4KUCF 2ADYA 3IYLW 2X28A 3S5LB 1OK0A 3G5ZA 4DVBA 3SOBH 5FW8A 5MERA 1LQBC 3H9SE 3K2UL 2P47B 1E2WA 3T8XB 2E8YA 1UOKA 4MMZA 1HWGB 1E4XI 3BUYB 4NUQA 1T1ZB 4RGND 4Z23A 1WS7A 3OZ9H 5LUMA 5I9QB 2RHEA 4PD4J 1TUPA 3BO8B 2HUEA 3TT3H 3MACL 3GGWA 5DD6B 3ZL2A 2OW6A 3OZLA 4Y2DC 1X5FA 4PRNA 1J8KA 2VCOA 2R2BB 1ZLUK 3ECQA 1UC6A 5LLIC 4KTYA 2XN2A 3T6XA 4QLWA 2ITDB 2WWNA 3OJDB 3LRSB 1N7ML 1W6WA 2HWZL 3E1F1 1FFPB 1JN6A 5CSZA 1NMAH 1RIUL 1S9VB 5J56B 1WC7A 1A3LL 1IAKB 3N40P 4JHAL 1WSST 2ZXGA 2VC2H 1F8TL 3U0WH 1EAQA 3FCTA 4DO4A 4JFOA 3ULVE 5GGUA 2QEJA 4GY4A 4H20L 4TTGA 4Y8AA 3UPRA 5EDSA 5GS2H 4JREC 2GG1A 1Y0LB 4PJGA 4Q56A 1U36A 3BZFB 1PL3A 4NCC2 4IIQC 3U1QA 4PBXA 1NIEA 2NR6C 3QUKA 2PTUA 2B1AH 4MCZB 3FHEA 4Y4FC 1KOAA 3MR9A 1FVCB 2DQDH 5C2BL 1A4KB 5K33A 3ULVF 1S78C 3WEXA 2PPEA 4OKDA 2V3FA 4P2RB 3QEQA 4QWWD 2FBOJ 4QHMB 1KJ2B 2OPCA 3GKWL 4MYPA 3V5HA 1DJXA 2IJ0C 1EDHA 1UH3A 3A0OA 4I9WE 4YSTA 5TE6L 1ORSB 4YFLI 3V6ZB 5KYXA 4ZNCD 1VESA 3B3IA 2QELA 3WXWL 1UM6H 4NFCA 1F4HA 3VXMD 1MXGA 5E6UB 5GRJH 3U1SH 3KPLA 2ICWB 1YQ2A 3LPGA 4XP5L 3LMJL 2VIRB 1MJ7H 2XPYA 5AYTA 5J6HB 4YDNA 4GXFA 5DS2A 4G9FE 4M43H 3RY5A 1VGKB 4RNRA 4HKJB 5E2UL 4RGMC 3FTGB 1YNKH 3NUKA 2P28B 2D03L 4ONHB 3VGBA 2MCPL 3FT2B 5IBLD 4LLYB 4HUWB 1Q9LB 3Q2LA 4TN9A 4MB5A 4MS8D 1TVBB 5JNYB 1LEKA 1S2EA 3UADA 2MNWA 4KDWA 1JK8A 2X38A 1DN2A 2MIZA 3BD4A 3OMIB 3MV9A 2DWDA 3Q6GL 2DB8A 3VMPA 1YY9C 5JTWA 5KVGH 2XY1A 4J8RA 4P48A 5SWSB 3QXAA 2EC9U 2X1WL 4X2UA 2UV3A 4HIPA 4KRPD 4Y16A 4LMQI 4KK8D 3TC9A 4Z0BH 4ZFQA 3ZOAA 3DHPA 1XR8B 4IRZH 4ZW8A 2ESVD 5IJKA 4U6HB 3G6DH 1F4WL 3LH2L 5BVJB 1P2CB 2NNCA 1RKRA 1RUAL 1GGIH 4YIQA 4CC0A 1QFUL 2B1HL 5I23A 1MJUL 3ISWA 3I3BA 5E95B 3E8VA 3KNBB 4Y19D 4IKNA 1E5BA 1TZHA 2AEOA 5CJ8A 3UAFA 3H9ZA 1JWSA 4PJHA 1VACA 1QBMH 3I9IA 5KSAA 4N0FA 3IDUA 1MRFL 1HYRC 2ZICA 4KJPC 4ZTPH 4PSPA 4CVUA 3RPKA 2P8MA 4GIPD 1AGCB 1II4E 3N55A 1NGXB 3SQOH 3T71A 4FL4C 1HSBB 3QULA 3MZTA 4QRFA 1SHMA 4XMPL 5E2WL 3PL6A 3FFCE 3QIUA 2MEJB 4PJ5E 1ZGLM 3DETD 3T0AA 4LCVA 1F6FB 1GYCA 5EBLB 4JPIB 3EBIA 3P0GB 3H3PH 3RDTB 1NMCB 1EWHA 4WI8A 4G6JH 3FUMA 3MLZH 1S6NA 3TNMB 5EDXA 1YMMB 1QSFE 5DHVA 3MRHA 1TKWA 3QG6B 4JJ5B 4NQDA 4F7MB 4FAAB 3MRPA 5IMKB 5FYKL 2CE6A 4QLRA 2FECL 1IC5H 4UU9B 5FK9A 1QSEE 4W9GC 1S7RB 1OE3A 4IEFB 3KPQA 1IFRA 2BRRH 1XX9C 5A2CA 4M3KB 4CN6A 2VLJA 4UZUA 4P06A 2JH2A 3IMTA 5CD5D 1S7WA 5CCKL 4RGNC 3S3BB 3GMQB 5LGHL 4XC1H 1KPUB 3LS4L 1MHPH 3QG7H 1YG9A 5DD0H 4QYOA 1IC1A 3OAUL 1IAOA 5AKTA 4YC2C 4J3OF 3FB8A 1YEDB 4DGWC 3V4VL 4FNRA 4P2QE 3T3ME 3ARGA 1F97A 4U1IB 2ED7A 1CLOL 5DRNA 2OTWB 4UQ3A 3REWA 4HJJH 5GZOC 5ENWB 2BSTA 4M1CD 3LNDA 5EUOF 2DQCL 1OPGH 1QNZH 3MV01 2ZCLH 4XCCH 4OFYA 1RU9L 3G6JB 3GSWB 3LHPL 4AYDC 1G7IA 4AKPA 5KBKA 2A4CA 1BJ1J 1W9XA 2J1XA 3B7SA 4K71B 5I6LA 4C58B 3QQXA 5FYJD 3WOVA 4MQSB 3S88H 1T0MB 2J88L 4WU7B 1C8PA 2BDNH 3T3MF 4EI5C 1U8KA 3PWPA 4GXVH 5GRUL 3BVTA 1SHXA 4JHBA 1FH2A 4CW1A 4JM4H 2KYIA 2CUIA 3SQBB 4KJYB 3SKNA 4OLVH 4RGNE 4KO6A 1TPXB 3CZFB 3ZL4H 2R9HD 3M8OL 5LBVA 1ZWIB 3UL4A 3NABL 4PB9L 5ICYA 2GTZA 5EV7A 1G6RA 2NQDA 4GLRI 4AGLA 5D1XA 5E2TH 2HAZA 3VXUA 1X4ZA 1IQDA 2D7OA 4Y5YB 3DTUB 5IHBA 3QH3A 1VGEL 1Z0MA 2V17H 1UXSB 3MRBA 3O3AA 5GGRY 5C9JA 3CG8A 1X6NA 4PTTB 3SD5A 3V0GA 4HXBL 2QMJA 2ZIDA 5EN2A 2X9ZA 3HI6H 4LCUB 4LGSB 1GYAA 1A1NB 2Q86A 3JQOB 1FO0A 1JPTH 2EDNA 4KGJA 5SX4H 4I1NB 1DVSA 4F2EA 3BPOB 4FFZH 4CNIA 5E1IA 5ETUA 3N9GH 4CJ1A 4PREA 2OJEB 3IFLH 3QZWB 2R0WH 3VXQA 2KZKA 1JZ2A 4GG8A 3QNYA 2MCMA 1ET8A 3T2QA 5DJ0B 4BQ6A 1IGJB 4F7PB 5I8EB 2X70A 2DW5A 1MIMH 4MS8C 1TNNA 2L7QA 3DMMD 3QO1B 1MVYA 1KIPA 4JUTA 3Q8CA 5DQ9A 4ZI8A 4N86A 2H0PA 1IQWL 5L9DH 4PYHA 4XAKD 1G9ML 3MOAH 3BDYH 3OXRA 4MX7A 2NY2B 3GBDA 1IAII 1QLEH 2RB8A 3AC0A 3DSFH 3FQXB 4J4PD 4IRSB 1SVCP 3QBTB 1CLYH 1EANA 1P69B 2A9ML 3VXME 2YQ3A 4YHPB 1XF2B 4YDLC 1WRFA 1A7QH 1ILSA 1IEAB 2PETA 2OMWB 5IUSA 2WV3A 1AR1C 1NPJA 4JRYD 3L3JA 1RERA 3EO0A 4QXVA 4JBSA 1R6VA 3WNOA 1Q72H 4JL1A 2HVJB 4PV8B 4ODVL 5IW6B 3IU4H 5E8PA 1N18A 1KPVB 2ZG1A 5HP5A 1DUYA 5I5MA 1SEBA 1IBBA 3KYKH 5KN5B 9PCYA 4LEOA 5BJTB 4QXGL 5I8KL 1JCVA 3O41A 4NC1C 3DURA 5TDPA 4NAMA 3S36L 3DETC 1NBVL 5ABDE 3HJ0A 3KYNA 4LFHG 5E0QA 4M6OH 5D96B 4DZBB 4M00A 3IS1X 5DSCB 2VXUL 4YXKH 3AWFA 4JDTH 1TTBA 2ZAHA 2ATAA 1T6BX 1VB9A 3S37X 1G7PB 2G30A 4CMHB 2C3WA 4HVBA 5J1SC 4AEEA 1AQ8A 5HDRA 1G6RL 1R24A 4TUJB 4Z7QE 1XB6A 5EO1B 4GRMB 1MLBA 2AK4E 2PTVA 2IMMA 3SYCA 3FZUD 3ECBB 1IM9D 4ZSOB 3VU2A 2J43A 4Q0XH 1VFAB 2YC1B 5HDQH 2B39A 1A7RH 2JWYA 3K71B 3WN6A 3MRKB 1FO0L 2ZD0A 5HHPA 4B9GA 4PP1C 2EH8H 5JIHA 4OB5H 3F58H 1KJMA 2V8MA 1M7XA 4GFXA 1ZS8B 1R47A 2Z92A 4FQXB 3PNWB 1N2RB 4D0CB 3FT1A 4QTIH 1INQB 4NC1E 1H3WM 1C8QA 4JANA 3FSWA 4WFGD 1H9DA 3WXVH 2ZXAA 3CUPB 2D9CA 3SZKC 1PZ2A 1R3LA 5KTEL 5IMMA 2DI9A 3LEVL 5IKCA 5C70A 1AACA 1F3JA 1FFNB 3B9KC 1U2CA 5JIKA 3VAEA 1VZGA 2W65B 1XT5A 1VLXA 1BZDA 2DJSA 3ARTA 3MOBH 4JG1L 1Y6KR 2OMUA 4I88A 4P04A 1FH5L 3WJMA 1XEDA 1H8LA 3KR3L 1B9KA 3TZVA 4P46B 4MD4B 3F04A 3MBEA 5MP6H 4HC1L 3SO3B 2NY1D 4UQBA 3RRQA 1PPIA 4OD2A 4E5XA 3VFSA 2H3XC 2DF3A 1LXMA 4LF3B 3FH7A 2WQUA 2EDWA 4QT5A 1TZIB 4C47A 1MPAL 2R9HC 2Q6WA 3IDJA 4LVOC 3B5HA 3LQAL 3ZHNA 5DJXB 3UYOD 4IMLA 4N6RB 1Q0EA 3LCYA 1LP9F 4Z7UE 4JDEB 3DGGA 4N9GB 3JV4A 1JF1A 2Z1PA 3G5YA 3CC5B 1KGWA 3LRHA 1F56A 4X4XB 2FB4L 3BPLB 4N8VA 4PLKC 3BEVA 1P5VA 3C2AH 2LFEA 3SIKA 4NB7A 1LD9B 3COOA 3B6SB 4IJ3B 4OIAA 1BFOA 5JOFA 3S96B 2JCCE 4G9DB 1HJCA 2J6EH 1FJ1A 4OAWB 2ICES 1KYDA 1C5DA 4LBEA 4WW2A 4YSRA 1SJEA 1T3FA 4PCYA 4P3DB 4UT6H 2BNQB 2IOOA 3NTCH 1F42A 4MQ7A 5HSFA 3DMMC 1LNUB 1BYOA 2Z64C 3TU6A 3IETA 1Y07A 1A6ZB 3RILA 4RISH 3P73B 1FIEA 4OF6A 1J8HB 1FCGA 3T4YA 5ILTH 3Q2CA 1U8QA 4OZ4B 2W5PA 4YZFF 2YAOA 4G8GB 4XHJD 5E99L 5ICXA 2OXGA 3ES6B 1HYSC 3O11B 4UQAA 2VJXA 1DDHA 2JCCF 1YC8A 3UAJD 4Q6IC 3D30A 2EABA 2HT4D 2MOGA 5ANHA 3ZJAA 5AKSA 2Q3AA 1JZJA 4J4PC 5I18L 3K6SA 2OR9L 4HULB 3TBWB 5KJ4A 4KZCA 4I48A 4OLYL 5CJOH 1B90A 3FJTA 4K5NA 5KVEE 1DBAL 1OSPL 1RV6X 3NSDA 43C9A 2ESVA 2VW6A 2B20A 4YO0A 3P0VL 4D8PA 3ZDXE 1XFPA 4G8IB 5FM4A 3GHEL 5CJQH 4X8CA 1IAMA 4L1SA 1QRNE 2C8NA 3CFTA 3S34H 5GGTA 3RX8A 5I1AB 1O7SA 4C8XA 2W95A 3BRFA 4PJDE 3Q2VA 2IGFL 4Z0XB 3VXRD 5IBTH 4JAMB 2F7RA 3NZUA 4OD1L 1BF2A 3R4RA 5KAQG 2Q10A 4AYSA 1AXTH 1GTFA 2O6EA 1OW0A 3BCDA 4J1UA 4A04A 4FQJL 3MRDB 2WVUA 1BD2D