4KVPA

Human p53 core domain mutant v157f
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRFRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kvpA00
1HJBC 4A63A 4IBUA 1E50A 3IGLA 3IGKA 2AC0A 5G4MA 2XWCA 2PCXA 5BUAA 4L18A 2BIOA 2FEJA 3D08A 2IOOA 5LGYA 2RMNA 3D05A 3US0A 2H1LM 4LOFA 3WTXA 4G82A 4AGMA 3VD0A 2J21A 2MEJB 2J20A 4KVPA 4XR8C 3US1A 3WTSA 1HJCA 2OCJA 4LO9A 4IBWA 4IBTA 3WTTA 2J1ZA 3Q06A 3WTWA 1CMOA 5A7BA 1CO1A 2ATAA 2J6WA 1IO4C 1TUPA 5AOMA 3WTUA 3VD2A 5AB9A 3KZ8A 5G4NA 3ZMEA 5AOKA 3WTYA 2XWRA 1EAQA 2BIPA 2X0VA 2YBGA 1T4WA 4GUOA 2BINA 2X0WA 4AGPA 2J1WA 3Q05A 2WGXA 5ABAA 4MZIA 4MZRA 5AOJA 4LOEA 4AGLA 1LJMA 1EAOA 4IJTA 4L0ZA 2IOMA 3QYNA 3WTVA 2ADYA 2IOIA 2BIMA 2J1XA 1HU8A 3QYMA 2AHIA 5ECGA 2BIQA 5G4OA 1KZYA 5KBDA 1YCSA 3KMDA 4QO1B 1TSRA 2P52A 4L0YA 3WU1A 4GUQA 1GZHC 1EANA 4IBZA 3EXJA 4IBYA 3EXLA 4IBQA 1UOLA 5AOIA 3D09A 4G83A 4IBSA 1GZHA 5AOLA 4AGQA 3Q01A 2J1YA 4AGNA 3VD1A 4IBVA 2X0UA 3D06A 5LAPA 2GEQA 4HJEA 3D07A 4AGOA 2VUKA 3TS8A 1H9DA 3D0AA
chains in the Genus database with same CATH superfamily
1OB0A 1AXTL 1EDYA 4PJXA 1JZ4A 3QHFH 3BLKA 1E50A 5CP3A 1ETA1 5CWSA 3VMPA 3KL5A 4MB5A 5MERB 4RGND 4Z95H 2B39A 5HXMA 3MLZH 3RA7L 3S3CB 1OGAB 5D2LF 4LSQH 1ZLVH 3I84A 1PEWA 3VYOA 1LE5B 5EOCJ 1OTSC 4GG6F 4CA4A 5L2KE 3EYUL 3CFNA 2AKRB 4OCWH 4PJBE 1IBZA 3WTSA 1WFNA 4GSDL 1HCZA 1P6AB 3KYOB 4K2UL 3Q43A 3SQBB 1DQLL 1BWWA 3OZLA 1JNNL 3BSZH 3DETC 1YVLA 1UQSA 1A9EA 3T8XB 1MWAB 3MDJA 1PLBA 3FYIB 1U21A 2BSDA 5F9DC 3WIHH 3ZTNH 1YECL 2G0LA 3A6OA 3M17A 3TN0B 3TNMB 2N59A 3JV4B 4LSVH 3FQUA 4I18B 3U7YH 4CADA 1P84K 1P5VA 4QOKD 1VESA 4C59B 3FTGA 4JG1H 1A1MA 1DFBL 5GRVL 4HXBL 2VAAB 4W9DC 4KZCA 3EJYD 3RUGA 3MREB 4AH2B 4FLSA 5ANME 5CJ5A 2GHZA 1KZQA 1EPFA 4R4ND 2FSDA 4HZLA 4LAJH 2WXPA 3VG0L 1ID5I 2VQ1B 4Y5XB 3NCCB 3MJ9H 3FPYA 4DP0X 2BFGA 2W07A 4TUKL 3LKSB 5T5FH 5T1KB 4XZUB 3GHBH 3RVXD 4CC1A 4DOHB 3DUUA 1D5BA 3MV8E 3W9DB 5LQBH 4JKWA 4M93B 2F1AA 2WCPA 3D6GA 5A2AA 1NEZA 2FZ3B 4JG9A 1QLRA 1B0IA 3EHBB 3Q9PA 1ZE3C 4N2EA 1IE5A 3Q2NA 1SF3A 2IPTH 3I9GL 4UAHA 1GC1L 5AW4B 1X7QB 1XAKA 4FLOA 1I31A 3TBYA 1FL6A 3OSKA 4OF7A 5CCKH 1FYTA 4GG6B 1P7QD 1S78C 4JRXA 5T8IA 3VSVA 1EHAA 2XYCA 4P2QB 3NT0A 4Q2ZA 1UH2A 3D2UB 1V3JA 1M7XA 5E8DL 1U8NB 2VR8A 4Y4HD 3OB0H 4JQXA 2APVA 3I9AA 5DJ6B 2IDQA 5DLLA 5FS5A 3HE6B 4URKA 1KTRL 2BFVH 4L9DA 3QUXA 4IJ3C 4AG4H 3K2KA 4FNTA 4TOYL 4WGWB 4EKJA 4PRNA 4NQVA 5EU4B 1J7VR 5CCGE 4O2FB 3RWDB 4U7MA 3BVUA 3N1GC 1ZOXA 4KK5C 4OJCA 4TUJB 5FYJE 3U83A 1MNUL 5HTSA 2ARWA 3V6ZB 1T1WA 3N6YA 1RY7B 4JM0A 5L6YL 3TASA 3FTVA 4D9LL 1IFRA 3P3TA 5F3BA 2OMTB 2HUHA 5T1JA 1G1OA 4L3CB 4R2GB 4HUUA 3GJEB 1C9SA 4PRPE 4FQ2H 5EBMA 2Z92B 2RQEA 3LKNB 4QHLB 3MX0B 1PIGA 4WTZA 3FB7A 2WQUA 1TEFA 2GSMB 4PJHB 5ESAB 2D4FA 4DP8X 2QSTA 1PD6A 3UBXI 5A2JH 4TLSA 3GMQA 4X0KB 4UQ9A 2EDJA 2H9GB 3V0IA 5IM7A 3DGGA 3UACA 5AAWC 1KLFA 2EH8H 4Z7UF 1OCRB 5TK2A 3RGVC 3WFEL 4AQ1C 4DPBX 1GCFA 2B3IA 2OFQA 5EU6A 4ZMVA 3GPSA 2AAVA 2VLJB 1BPLB 1E4KC 3FHAA 5F89A 1NFDF 1ZK5A 1A0QH 4PVMA 4JR9H 4ALAL 4CSSA 4UT7H 3I50L 1DSFL 4ZDHA 4GMSH 2A6KA 2MCMA 2XFGB 3I3DA 4NQTA 1ZIBA 3L4UA 2VDOL 2X3AA 3LJ3A 2FEDC 2X2IA 3QZOA 4KQ4L 3S8WA 1IGML 1C7SA 3LVEA 1NA8A 2ZX8A 3R06B 3MV11 4XZ4A 4KJYA 1J9QA 2OK0L 3ARFB 3QVAA 1G0YR 2F5AL 1CF8H 3MJGX 5E51A 2IH3B 5KVGH 1JWUA 2Q2LA 4X4XA 4PJ6A 3I75A 4MB3A 3EBAA 2JIXB 2A9MH 3IDYB 5DHMC 5BZWB 1WFTA 3HG4A 3GSUB 1IAKA 1QSZA 3NIDB 4GQRA 3AADB 1U3HA 4UTBH 3DC0A 3UCRA 4J12A 4OCYH 3K71A 3GMPA 4OCXL 5I0XA 2XOTA 2EDYA 4AX3A 4XC3L 2NQDA 2X3CA 3D4GA 2DZEA 3UG4A 5DA4A 5DUPL 1C5BH 4DUVA 2VR9A 2YZ1A 1CB4A 3BZDA 4IBSA 5CU9A 5A40E 4LZKA 3HG1B 4U1JB 1CFNA 1CYGA 2ZP9A 4HAGA 1DZ0A 2I26N 4LB8A 3FU9A 3IDJB 4I2XA 3IXTA 2H8PB 1N2RB 4JMXA 4NQDD 4ANKA 4OZHA 3MVSA 3DJTA 3EKCA 1U3HC 4B95C 4QUOA 4X98B 3MODL 3WIFB 1QA9B 4FA7B 3QR0A 2FBJL 2E7HA 1KWGA 4G1MB 3VMNA 1ZLSH 4PUBL 4QXTA 1T2QH 4K8RL 3T65B 3ZE0F 1AR2A 2E7DA 2YA1A 3PAZA 5JOPD 1I4FB 3IFLH 5C0BE 1MXDA 1NZRA 1NFDB 5MHSE 3TOPA 1E5YA 3FUIA 5DUJA 1N26A 4NAJA 1E4JA 4UYPA 4BELD 2XT1B 5CHNB 1J5IA 3KPSA 4KJQD 3HRPA 4TRPL 4OF3A 4PTUB 2N1KA 3EO1B 1RZKL 1ZT1B 4ZS7H 3AAZB 3QWOB 3JTTA 4J3TA 2OX5B 5IBUB 4R7NA 2YQGA 1LO5A 4M00A 5F3FA 3VI3F 2AAAA 2QPDB 4FTVD 4ZAKD 4FQXD 5IGXH 1KIRA 1WFMA 1TNMA 4DCQA 5IJCC 3GFUA 2HVKA 3Q3GB 4R8WL 1N5YL 3R8QA 3WJMB 1K6QL 4JQIH 4LKCA 4AT6B 1CTMA 3ECWA 2ICWA 1UC6A 1FLRH 4LNVA 2CM5A 4LLDA 1MJJB 2AXJA 3CFJB 3DV4B 3HS0A 4G8GB 1AQHA 1KCKA 4ONGL 5I1EL 3L9RA 4H26A 1XGYH 2FK9A 1TVHA 3TJEL 2XA8H 4HIIA 2DIAA 4KY1L 3WD5L 3MXVH 4P49A 4WSJA 5DQ9B 3MRJA 1GMEA 3PV7A 1MXGA 4PI0A 4YL4A 3D87B 4FULA 1ET8A 3MV8A 4X8CA 2XQBL 3ZYOA 1A1OA 4BK5A 5IR1A 1HL4A 2C9XA 1IT9H 2EYTB 1CTOA 1CXFA 5KSVA 2NW3A 3SDCC 1PKQE 5KG9B 2Z4QB 2W81C 4XBEH 1P4BH 2F9BT 5JOFB 4UQDA 1G7HA 4MFHA 3HS0C 4PLJD 2EO7A 2KKQA 4LQ1A 1FWXA 2G4GA 4A7TA 1IIIA 3PV6B 2CO7B 3IAGC 2X4QA 5HDRA 4H44C 4ORGB 5ACMA 5KSAA 4HOWA 3ZE0B 3HFFA 4HKBB 4BFGA 5JDSA 2E8YA 1J88A 3IKCA 4TNVK 4BK5C 1MFAH 4B7IA 4TQEH 3X13B 2AV7B 2LGNA 2WLIB 5F9JB 2W9EL 4Z7OE 3B7SA 1K2DB 4Y16D 2WIIA 3UGXA 3MRMB 2VLKE 5LCVL 3SCMC 3LNDA 1J86A 2PYFB 2VW4A 3ILQD 1DVQA 4A68A 2ENYA 3QDHA 5MENE 3GO1L 5KSAC 4YQXH 2WBJC 1Q0EA 4AL8H 3QQXA 3CSYA 1GIGH 3EBGA 3O4LE 4DN4L 3QBTB 3S5LA 5GS2D 4BFBD 4PB0L 1G7MA 4XPAH 5B38B 3D34A 4ELDA 3N43F 1MCPL 3DYMA 4PJCE 3ME0A 4BE6A 1LO3H 1B0RB 3HMXL 3TJPA 5AYUL 5A2BA 3WXVH 5EZOL 3CMGA 1T0NB 3IWUA 3TEXA 4EI5A 1YNKL 5D1XE 2PCFA 2B59A 3HVDA 1HEZA 2G60H 3HFMH 3FQ2A 2CHDA 3MGOB 4N8VG 1R17A 2A73B 1JMXA 4IRZL 1RUML 1ZLDA 3GEWB 4J3WA 4P3CL 5E00A 2XWEA 6FABL 2GEEA 5KBNC 5J3HC 3F85A 4XNZC 1QASA 2K4WA 3BPCB 1C5DA 1VA9A 4YIQA 2ARJA 5E2VL 1WHPA 2EDXA 3QUYA 4WGVB 4YXKL 4YDVA 1S7TB 1A14L 3MLTB 4N6QA 1RZJH 3QUGA 3G6JF 3OB0K 1YYML 3MN8A 3DTDA 5FUZH 5HHPA 3NCYS 1IB5A 1CBVL 1NGZB 2UZYA 1NC2B 4L9LA 4JE0A 4K73A 2E74C 3RFZB 2XY2A 4F1ZA 3FH8A 3P3UA 4N0FA 3S8GB 3DTXB 2VL5A 2CDGA 1S7SA 2DQTL 3M46A 4Y5VB 5E9NA 2VSDA 3QUYC 3STZA 3GIZH 5IHWA 3NAAH 5JXED 4BFIB 3QEQB 3MU3A 2C3VA 4FYRA 4HBCL 3T2NH 4KUCD 4F2ME 2PW1B 5DUBA 3VXOA 3FONB 1BQHG 2X9XA 1R3IH 2P5EB 3PQYE 3TV3H 3FU6A 4G7SB 4ODWA 3SDAD 3QIBD 2HRPL 3N43B 3FRUB 2W0LA 4L9LC 5GS0H 1NWPA 1B0GB 3EJSA 5FFGA 3VDBA 3NFPA 5DVNA 2JE8A 4QRTA 4N8UA 2EIZA 4DPRA 4LPXA 2MFNA 3WDHA 3MV9D 5TK4A 3VWJD 1JV5B 5CJOH 3OVUB 1KC5L 4EDXB 1BZQK 4UT9A 4QXUL 2EYRA 2QLVB 3DX0A 1NIFA 1OSPH 3SB3A 4E9RA 3MUGA 4XTRC 3CVCA 3IDMB 2Y4SA 2WWMD 4MA3B 4RFNC 4IIQA 3UTZA 3T4AC 1DBAH 3ALPA 3KL0A 4UTAL 1E5AA 3Q8AA 3M1BB 2ISDA 2E6QA 3ILDA 2R2EA 4KK9D 4ZYKA 2VZSA 1MFCH 3KPPA 1G84A 3T08A 3A6CH 3QIUB 1ACYH 3GNMH 1A4JB 1F4AA 1NGQH 1I3UA 2JELH 3CFKA 4WZ9A 3RB7A 2AJUH 4IBVA 4QGYA 4ZUUB 1R3KA 2I5YH 3WUWG 4WW2A 2X44D 4MMXB 2OSWA 4O2EA 4EUPH 3UBXB 5E8NA 1XL4A 4MDIA 2AK1H 2IJ0C 4B3EA 5FO9B 3C6EA 4U1IB 3UYPB 3RWEA 5EU7C 5BS0A 1LILA 4D3CL 4G80B 3F84A 5D2NB 4DH2A 1XB6A 3L4XA 4XOBA 5DR5L 1D5ZB 4JDEB 4X5WB 3ARVA 4WW2C 1DBJL 4MJID 3RTQA 1Z5HA 2Z91B 3H7LA 1K8DA 3NGBB 2FEJA 5JXAH 2DQIH 4JY4A 3ARYA 4LSSL 3EJRA 4YEEA 2KLSA 1HHGA 3MA9H 4KNTA 5LBVA 2M8XA 4L4TD 4G8EA 5JIQA 5EO9A 4U2YA 4HD9A 3NIFE 3ZQ9A 5K9OB 1RP9A 1XIWD 3K6SA 3FSOA 1D5XA 2Y25A 3IFNL 4P2RD 3HBQA 4NKIL 1BG1A 4X6DA 1CYWA 1E2VA 1HC1A 3U2SB 4Q4IA 5J9PB 1OGAD 5E6IB 5E7FA 4KNSA 3MLPA 3MFFA 3WO4C 5KYYB 1IC7L 4JW3A 4LLVB 1FPTL 1S9XA 1VLXA 1JZHA 4X4KA 1F41A 2OXHB 1I53A 3GI9H 1N5AA 4PJ7A 3JXAA 2FAUA 5DDHB 3QAQA 4G8IB 4WEBL 3X1GA 2KPNA 4XOEA 5FK9A 1U8LA 1A2YA 1I8LC 3NIGF 2ADGB 3H9SB 1FG9C 3HEIB 3O81A 5FFLA 2J6EH 3HC3H 2VSCA 2F1EA 5ICYB 5KS9E 1QR1B 3O3DA 2ZWZA 1QSEA 2HLEB 3LSOB 3PP4L 1HH6B 4P04A 3WSQH 4TTGA 3C60B 2ORBH 3P9MA 3QXWA 5GRJH 3TN0D 1KENL 2CCLA 2DIJA 4ADGA 4S1QL 3MCKA 4ANWA 4BQ6A 2UYLB 3OKMA 2ZYRA 2ADJA 4NPYB 4PJCA 3BH4A 2BVOB 2I60H 3SO5A 5JHDB 4DQOL 1TZ8A 2BOBA 2EE0A 2JQZA 1B4JH 1FNGA 4RGNE 4TNWK 3ZT7A 2GYSA 5D71H 5JORB 1KFAH 3IFOA 4D9RD 1ZANH 3UJTH 4MSWA 1R47A 4BQCA 2YJLA 2DMKA 1FNSH 2EDHA 3VVWA 2CIKB 1TNNA 4I77L 3QO0A 1ZV9A 4L5FH 4L2YA 4KI5D 4LLMB 2QEJA 1R0AH 4AEFA 3DK2A 5T1KD 4CDGC 1M6OA 4WFHE 1TETL 2Q3ZA 3TIEB 4ZTEA 3K6OA 2OXGA 4NP4H 1HOEA 2ID5A 4E9XA 1KYUA 2Y3AA 3HCVB 3EHBD 3L2LA 5D1XC 5KN5A 2JQAA 4WAFA 3FN9A 3PXLA 1I3GL 4LRNH 1UWXH 4DERA 4TVPD 5IBTL 4LIQH 4P2QD 3TYGL 3ZDZF 2GJPA 1NLDL 1ZS8B 3D2UD 1IKOP 3W11C 2E47A 4KXCA 3O2VL 1ZMYA 1VB9A 2ATPB 3GLEA 3IGLA 3GUTB 4QOKE 3HE6D 1NGWB 4XB3A 2R29A 1J10A 1IFHL 3WDJA 1E5ZA 2BSEA 2FT8A 3C5XA 1UXLA 1XV8A 1KLUB 4Q9BA 5JA8B 3L3GB 1G1YA 2QKSA 4XHJD 2D03L 4S1SH 3KWWA 5C0JA 5IB2B 2OSXA 1JF6A 1GZQB 4ONFH 1SXNA 4DK6A 5HHXH 4A2LA 5JQ6L 2ATKA 4WWKB 3VI4E 1BECA 3QCUL 4UQ2B 1RIHH 1S2EA 2WLMA 3BYYA 4R2GD 3MGTA 4WLCA 3SKOB 3FQNB 5DRZB 2EZ0C 5TGBB 3P77A 1QHPA 5H8DA 1C12B 2X2JA 2JK5A 5D7LB 5AZEL 1G7JA 4JFUA 3BAKA 4GO9A 3MJ7A 1C1EH 4MCMA 5AKTA 4GAJH 2YEQA 3TF7C 1K8IB 3ZR6A 5CGTA 3WLBB 1UADC 1P7HL 4K15A 4N87A 1RJLB 4X42A 2NY0B 3KXFB 5AYQA 4H4NA 3U4BH 3FAWA 4M7LT 5LBSA 5TQ0L 4APXB 1CDIA 1FO0L 4Z0XB 3GRWH 1TZIB 4Q6IC 3M7OA 2DTMH 2ZAGA 4NQCB 3IFPA 3VA6A 2ENQA 3D33A 2AERT 2MOVA 3ES6A 4KX9A 5C0IB 2GJZA 2CLZA 5GGRA 4PREB 5HI3D 2WQXA 4L37A 1MUJB 3RIAF 2E86A 1RLWA 2COQA 1F45A 3N3EA 2GTQA 1ZSDB 2QKIB 2CCWA 3ZDZB 1CT8B 4JANA 2FYYA 1MCLA 3L54A 4QTHA 2EXYD 1T5WB 2CRIA 4JFZH 3EIFA 3O6MH 3MV7B 1SJMA 4QJ4B 3ARFD 3F7VB 4O00A 5E2UH 1QFHA 1CE6A 1KLGA 4R96A 2HA1A 1GZHC 2BZCA 1NFKA 2XZQL 4LASL 3U9UB 3AWEA 5FHAH 1PQZB 3UZEC 3QDAA 2VDKH 4WKZB 4YGVA 3U6XS 3V52H 2JIXD 3CFDB 5BRZE 4LDOB 2F5BL 2KZWA 5C6WH 3QG6A 5EU3A 1RCYA 3ABMB 3U30B 3CE1A 4RMTA 2IC2A 4HV8B 3JWNH 4D0CA 5I1JH 3LRMA 4QT5A 5EA0L 5EV7A 3SDYH 4S1DD 2A2QT 4N0RA 1U33A 5GGTA 1S7RB 4WK2B 4FG0A 1YC7A 3V4VH 3H9ZA 4D7PA 3HG1D 4NRXA 1CGYA 2E76C 3TS8A 5HP5A 4RGOH 3L6FA 1DBBH 4MHHG 1G9EA 4Y4FA 2EJ1A 3DSNB 4KO7A 4C54A 3VFVB 5JIDA 4D0DA 1Q90A 1J12A 3SPCA 1KPVA 4RDQG 4U1HA 3D08A 4ATWA 4NCDA 4MKMA 4LPVA 1G0DA 4PG9B 4BE5A 1JZ6A 4DEPC 1VCBC 1HHHB 4BIKA 4FQLH 3US0A 3ZQWA 4EXPX 5GGSY 5INCA 3HHRB 5E7BA 3MRBB 2MCPL 1QWHA 2VDLL 3M8OH 4PTTB 4POZC 4Y4FC 5IY5B 5CZXC 3ZE2B 2DWEB 4JDZA 5LWYL 1UWGL 3GXNA 3CZEA 5FECA 1WAAA 4LVNC 4XXCA 2DH3A 4XC1L 1HSBA 4FFZH 3OLEA 4KZEH 5I17B 1Y18A 3UEZA 3D18A 3C8HA 3A4AA 1ZTXE 5DO2C 5BVJA 3IDNA 1BWMA 1G9ML 4HWBL 1HHKA 2YGNA 1RULL 3CFBB 2OYPA 4NQDE 4N1HB 4O58L 5AL0A 3HMWL 1OGPA 1MCOH 1WA2X 1DBML 4G8GD 3NZUA 4HH9B 4JFDB 3K4ZA 1JZDC 4XGZA 4XXCC 2YRPA 3BLPX 2GIYA 1XB8A 3FTWA 5CIPA 4N0YH 4WU5B 1Q1PA 2VQUA 2A74B 2WINB 1MEXL 5E2WH 1SJVA 4U7SA 1YHPA 5JOPE 3GMLA 1I7UA 2R4RH 3T0AA 4RGNC 4PLOB 1KZYA 1U6AH 4PI2A 5C08B 1I9IL 3U25A 3BKML 4CVZA 3B3IA 2A4ZA 4XBPA 4HGKC 3S8FB 1QFWH 1OL0A 2H47C 1P7BA 2IADB 2QGDA 5ITBH 5IB4A 3LVTA 4NRZB 2BNRB 1JN6B 1VFMA 5A3ID 3FTXA 3S2AA 1U8KB 2DLHA 3BLBA 3QFJA 3CZJA 5BO0D 2X4OA 4FTVE 5F8QC 3W3BA 3NPSC 1CE1H 3P4OA 4BHUA 2VXUL 3ZE1F 4IOIB 1E27A 4ZFZA 4XMTA 3W37A 1F4HA 1DL7H 4PLKC 1YEKL 4GW5B 2JXMB 4B41A 4N2BA 2FD6H 5CFHA 1T3FB 3ZDYF 4P2AA 2Y72A 3SOBH 3QQ3B 3SODB 2R2BB 2EEFA 4WNQB 1IILE 4K9EH 2W0FB 5LAPA 2CE6A 3N44F 3CHOA 3EJQA 3VI4A 2CKBB 3V4UH 2ITFA 3EYFB 1BZ8A 3WEMA 1MOEA 4P57A 4Z0BH 3UP6A 3FOLB 4EN3A 5L0QB 1KBVA 1XF5B 2NUTB 2D3NA 1G1KA 2Q9OA 3B56A 2AMUA 1ZA3B 2CALA 1TJHH 4KHTL 4XO5A 7PAZA 1SOSA 2ILLA 4OR1A 5AD0A 4R4NC 1JHKH 1E5UI 4UV4L 4H1LB 3SY0A 2YAEA 5KJ4A 1KIPA 1AD0A 1P7QA 2CGYA 2F74A 2IOOA 2V6HA 3F04A 3QUMA 4KKCD 1U41A 5HGHA 5KSUA 9CGTA 3DO7A 4WUUA 1SLXA 5I6MA 3HN5A 1BFVH 3Q2LA 2DWSA 3RVXC 4Y4HA 5AW6B 4F8OA 1ND0B 4TKWA 3JT2A 2QTVA 3ARBB 4ADJA 2C4FU 5K5YA 3RI5K 2BVPB 1GAFH 1Y0LA 5F1IB 4OLUL 5TF1H 4ZFOA 1GA2A 1ZWIA 2BCKB 1DQML 1UWXK 2FIKB 2J6WA 4WJKB 5DHVA 3NA9L 3P9LB 5J13B 4UDUA 3WFBL 3RHWF 1R5IA 3PL6D 2DRUA 2GSIB 1X5AA 1SXCA 4Y4HC 1QFUH 1RUQH 2BXZA 4CNIB 2JTYA 3LKPB 3SYPA 2YC1B 1EAQA 2VDLB 2OTPA 3ZE1B 3T6XA 2HLAB 3O45A 4UT6H 1EDQA 1KCVL 4GW1A 3MCLH 4DUWA 1VGKB 2APFA 4Y8DC 3ZDYB 3CHQA 5EZLA 3B2VH 1RUAL 3K80A 3ZL1A 2WWKT 4AM0A 3QEQD 1Q0YL 1SN0A 3QDJA 4KXBA 4KXAA 4WWID 3FO0H 4I89A 2WWNA 1JPGA 1JZJA 1U8JB 2OSYA 2P5ED 1F4XL 1SHXA 2Q5BA 2XWXA 5K9JL 4NN7B 3VXNA 4MD0B 4AMWA 1GCYA 3KYMA 1AD9B 3D4CA 4YVUA 1BLNB 2ZSVA 5KYXB 3ABZA 1DZBA 3IXAB 2G2NA 3WYRA 2KZBA 4CW1A 1MSPA 2Y2YA 2ZXGA 3MRQB 1L3WA 2HTLD 1GGBH 1QNIA 2XV0A 3KS0H 2W91A 3NPZB 4I9XA 3ISRA 4QXVA 5IT2H 2TRYA 4UDTA 2J8UB 4PJAE 3AQDA 1AS7A 1MJ8H 5HYIA 4WO4D 3EG9A 1E7UA 4JHWL 3FU7A 1SEQH 1IKFL 1INQB 1F11A 2H6OA 4RESB 1JE6A 3GDBA 4XP6H 2XTJB 5E2JA 4PY7A 5EUOF 5JQHC 4XCEA 1FNFA 1SXSA 2X12A 2VERN 3NN8A 2YKKA 3IJYA 3QIUD 4G5ZH 4QRQB 3RU8H 1M7DA 3VTMA 3RPKA 4HCGA 2R0KH 1T03H 5SWSA 3CFQA 3OHXB 1HYRC 3TJHD 4IDJL 4JO8A 4DF9A 5C0EA 4XN4A 4XCCH 3QJRB 2HJFB 1T5KA 3PWNB 5DSCA 3LD8B 3A4DA 1AH1A 2G5BB 3MV9E 4GI8A 1KYAA 5JHLA 5KYUA 1RZPA 1HDMA 4YHMH 1W91A 3WLWD 5JLZB 5J6GA 5JPMB 1OALA 4L8CB 4AYID 2VXQH 1I9JL 1VACB 2JSFA 5IG7B 1C16A 4LEXL 1INDL 3LKOA 3W2DH 1I3VA 1JERA 4ZS6D 2XVGA 5IBLD 2OL3A 1PZ2A 1U92A 1MQ8A 2P48B 1IQWH 2ZXCA 3P30H 1MREH 3N40F 4N0UE 3ZSSA 5FCUH 1YNLL 4K3EL 3PHQA 1IGCL 5E6ID 2DM2A 3TZVA 4P5SA 1N6QL 5AKVA 3ZSTA 3HJEA 3HUJA 4KJWC 1BEYL 3ILEA 4NZ8A 4WQOA 1IAOA 4JFOB 5J4MA 3EJUA 5JW4M 2D3JA 3B8YA 4X6CB 4FHKA 5A2CA 4GQ9L 2R23A 1KCSL 1VSCA 1AMYA 1MDTA 4UQ3A 2GABA 4AZ8B 1RMFL 4EI6B 1BF5A 1P1VA 5F7HA 1FHGA 3H9SD 4BM7A 2G2RA 4MJIE 3TZVC 3ZOAA 5I0YA 1UJ3A 3ARDA 5ESQB 5EF2A 1FRGL 2NY5H 5IK3B 3C60D 3EYSH 5KBMA 3IJSB 4DW2L 4JEGB 2UVEA 3EO0B 3E6FB 3SPHA 4LT7A 4YDLB 3GSQA 3HS9A 1U8HA 4L4TE 3ALWA 3T1WA 3IS1X 1BOYA 3MZGB 4DKTA 5JHDD 4C4BA 4P2RE 3JWOH 4HPHA 4MBRA 1BDYA 2YBRA 3GTNA 2FECL 3APNA 2OV0A 2Y5TB 3CMOL 3K1KC 4R4BB 5JNYB 2H3NA 1OGAE 3O2WH 4H25B 4JJHA 3I6KB 2K8QA 4Z9KB 1BREA 1UJ3C 1WZKA 3UC0L 2VMFA 2V2WB 3PNWB 4KKQA 3H7BB 5F7EL 2GFBA 3CSTA 4KV5F 4PJAF 4WW1A 5EOCL 4C4KT 2WSDA 1JG9A 2JKRM 4FLRA 4PJ5B 1HI6A 2DI8A 1TVDA 3RWCA 3P3SA 3CV5A 3OHMB 3WCYA 4JHAL 1A7RH 3OMNB 2AJVH 3KDPB 2FTAA 2WTOA 3RZCD 4EVNA 2FBRA 3ATAA 2ZPKH 1IC0A 2QDWA 1E4XH 5F9WB 5C8JB 3RVVD 3WEAA 2O30A 4OD2A 4Q0XH 4NJAH 2DAVA 4Y2DA 3PNRB 4LCYB 3Q2WA 5GZND 2ADIA 3FH7A 5IEKB 1FVEB 3OWEA 1OWWA 2B7DT 5I1DA 3P0VL 4GT7A 4HWEL 3CDGB 2CNYA 2QQLL 1TQCC 4HS6A 1MJUL 1NM4A 1R5VA 2X7LA 2NCMA 2OCJA 3A6BL 4TS6A 3ESOA 3QJOA 1GHFL 3OKLA 3N06B 1XF3B 1TJMA 3Q0HA 4U1KB 5EN2A 1QNZH 4D9RE 1BVOA 3VXSA 5ERWB 1RZ8B 4P9ML 4Y2DC 2A77H 5L4FA 2Z0BA 4ODVL 3KS0J 1RJZA 2QV2A 4WWKD 3A4FA 3TONA 3QFGA 4HW6A 1NWOA 4P2OA 3QHZL 2X40A 4KI5E 1RP8A 1KEML 3CH8A 4J3OD 5CD3B 3ISWA 1UVQA 5I1HL 1BBJB 1AG6A 5MEQA 2WUCH 2J88L 1MCQA 3FCSB 4GQQA 4AUJA 3LZFL 4DOHE 4TYUA 4HC1L 1DJHA 5D7LD 1LVEA 2XYBA 1T4WA 3DSFH 3EGXA 3TA3A 4CAGA 3MYZA 4KX7A 4RFEA 2VDQH 4JJ5B 5EC1A 3BUIA 2FJUB 4M7LL 4YN3A 1CGUA 3FB8A 4NN6B 4R3SB 1YUHA 2MTPA 3S97C 3ILPB 4TVPE 2NY0D 3G5VB 3KXFD 3TBVA 2H6PB 4XMWA 4P2OC 4P2QE 3AJ7A 1YPZA 5C0RH 3WS3B 3OPUA 4EEEA 3UAJA 5K39A 4WTXA 2V7HB 5KVFH 4NT6B 1NSNL 3DYPA 1F2XK 4NQCD 4KTEH 3QXTA 5EULV 3N0AA 3SDXF 4YK4B 5IIEB 3H9HB 4M5TA 1E28A 5GZOD 5KVMC 1HAWA 1IBFA 2Z31B 5GRUH 5JXEA 1SYVB 3BEWA 3VFWB 3P2TA 4OZGF 1YY9D 3C09B 2PCYA 1MFMA 4OFDA 4S2SA 2R29H 5H37G 3A22A 3H2WA 1Z3RA 3CBJB 5HYJB 1O6SA 4IQHA 4L4JA 3UAJC 1M4KA 2F2HA 3RJQB 3MV7D 3O8XD 1IARB 4Z77B 1XCTB 2GT9A 5EOQL 4LBEA 3SO3B 2V5TA 4L8SA 3E8VA 4PJHE 5JXEC 3G6AA 2LABA 2C7UB 1OZTG 5C2BL 4ZOBA 5EDXA 1AHMA 4P2CG 2BXYA 1G5GA 4JREB 2ICES 1U3NA 2Z35B 3NZSA 3UZQB 2FT7A 2AC0A 4YL9A 3PP3K 4S0TD 1XH2A 2NPLX 3K81A 5HGBA 4YHOL 5IW6B 4L8SC 4PGCA 1UYWH 2D7MA 4A2FA 3VWJC 5DJXB 1DVZA 2AP2A 4JJOA 4M1GL 4XPBL 4HFUL 3BZ5A 2H1LM 1KV7A 4KKNA 5HDBF 5A16A 1S9YA 4PSRA 2VRAA 3QORA 1I7ZA 2CDEA 1SVZA 3BKJL 5CINL 2Y23A 1MIMH 2DW5A 3S3DB 3T2LA 1TENA 1G4RA 1CR9H 1AP2B 3CVIL 4OZFA 5ESVB 4RX4A 4MD5B 3SDXB 1OGTA 4M6OH 1QBLH 1AMXA 1VIWA 4K9JA 4Q56A 4TF4A 2AXWA 3CN4A 2DJ4A 4NKMA 4HGWA 5DK0B 1S7QA 4P2YA 4FXGB 4XO3A 1M57B 3Q8FA 3NIDE 3WTYA 1KBWA 3C9NB 4MJIA 3QHFL 2JJUA 3VFRB 4OFYA 2DTSA 1LTXA 4R5XA 1RI8A 1WZAA 5JW4Q 3IKKA 3CFUA 1UOWA 3D1MC 2R15A 4Z95L 5BZDB 3DHPA 1F97A 3MLZL 1R75A 1AC0A 4AENA 5DFWH 2BWQA 1LJMA 3HG1E 3LN4B 4LSQL 4MS8C 1WJ3A 3MRRA 3CXFA 1LE9B 5C9JB 1EXUB 5BQDA 5FF6A 4LP4A 5MERA 4OCWL 4HLEA 4KKBC 3VXQA 4DESA 5KUKA 5GGTH 1Z9SB 3HR5B 5FOBA 1MCCA 4ZUSB 3BISA 3BPLB 5AW3B 5IVZB 5DI8A 4OJFH 1CD1A 4QHKI 1LE5A 3UEQA 3DBSA 4NAMA 1ZHLB 4HFWA 4A1RA 4EXKA 4YPGB 2IALB 5EOTB 5J1AB 3BSZL 5I6NA 3WU1A 1S9VB 3CDCA 4MKTA 3UL4A 3KYOA 4YO0B 3APMA 3SQBA 3WIHL 3QYCA 1Y07A 3ZTNL 4OTXH 5C08D 3NA4A 5E6YA 3U7YL 4LSVL 4FI6A 3VFPA 5F7DB 3RURA 2C9QA 1MW3A 5I1LA 4M7KH 2WYIA 4J3SA 4BSVA 4FA8A 4JG1L 4LEBA 2BNRD 4HSCX 3NABH 3O3UN 3BIBX 3KEHA 3TN0A 5SWZB 2ZUVA 4J3UA 4K94C 2EKSB 1O0VA 3UABA 4I18A 5HYFA 5L2JA 4ZPVA 1NPJA 1CI3M 3L3IB 4GRWB 4ELMF 4AGOA 1A25A 1IZJA 5TE7H 3RGBA 4DTGH 2ESVD 3MJ9L 3CU1A 3GRBA 4AH2A 3H9YA 2YLKA 3UJJH 4LCUA 5T5FL 4YE4L 3GHBL 3FT2A 4HUVA 5LQBL 4F20A 4QHMA 4WNSA 4AYBA 4XX1E 4UF7C 4PJEB 3TN0C 3QCVH 5F72S 3DGDA 3LKSA 4I18C 3EOBB 5T1KA 4F37K 3CN1A 2IPTL 1CD0A 1HQRA 5CCKL 3OQRA 4WO0A 5I0WA 1CGXA 4TNVF 3CBRA 2K3TA 2FZ3A 4B6ZA 5D2LA 1YY8B 3OKKB 1AVAA 3WE6A 5IV2A 2Y1VA 2D7PA 4GG6A 2FWUA 2BFVL 3BUQA 4Y5XC 1J5HA 4AG4L 4Y2NA 5JHMA 4OD3H 4P2QA 4KI5C 2EILB 3NH7H 4G6FB 3V9FA 2Q10A 3H56A 5JO5A 3GYRA 3CDZB 1DVFA 3QE5A 4M93C 1P69B 3ARBD 4M6AA 5D7SH 1JJUA 3RWDA 2FJHB 4DFHA 4V2CB 1CFTB 2F8OA 1SYSA 1Y1DA 3ET9F 3NP3A 4JPWH 4FQ2L 4ATTA 3E1F1 5I28A 1OTUD 4NPKA 1QTYT 5AOJA 2PP9A 4AKOA 1TZHB 3MOQA 1IGJA 2PW2B 3G04A 1HXMB 4IBLT 4ZQKB 3TX4A 4L3CA 4ORZC 5TDOB 1EBPA 3GJEA 4NRYB 3TESA 3HE6C 4JN1L 1MCJA 1A9VA 4HKJA 2Z92A 5EFIB 4MAYB 3LKNA 4YSOA 3TEZA 3GS0A 4XHJC 4C47A 2EH8L 1R4XA 1RFDH 4NBXB 3N91A 1NGPH 1XEUA 1YYLH 2G3ZA 5ESAA 4L29A 5F0LB 4F1SA 3ZHKA 4ZTOH 5JMOC 2P52A 3TIDB 1R34A 4ZSOB 3PWUB 3RL1B 1OW0A 3S36X 3KYNB 4NLHA 4R2GC 1A0QL 4JR9L 5CP7B 2XCMC 5LDSA 3IRCA 2VIRB 4UYQA 5FUCE 2J73A 4GMSL 2M1KA 1TLKA 1THCA 1NUNB 2VLJA 1V5JA 3GUFA 2NX5B 2FJGB 1F6AA 1DBKH 3L3HB 3C6LD 3VG9C 4E0RB 2EH7H 1OW0C 3BWAB 1CF8L 3WNIA 5KVGL 1EH9A 4WI9A 2V3DA 2X4NB 2EIMB 1USQA 3ZHFA 3ARTA 1FNEB 3JBG7 1I1AA 4WIQA 3BDYH 2A9ML 3ARFA 3QG7H 2CO6A 1KDJA 2XTJD 3INUH 3IU3B 4UTBL 4RIRB 4OCYL 4JM2F 5HI3C 3CFMA 3KLAB 3U1PA 2C1OB 1TMCB 5FO7B 4RA0C 4HSQA 2JIXA 3QISA 3DKHA 1C5BL 2BVYA 3GSUA 2ZCZA 2VNCA 2X53A 3OJVC 3QEQE 2C9AA 3AUWB 1KOAA 4WI0B 4XRCA 4BGDA 2I9LB 1HN1A 3SGEI 2EXYC 2EABA 2P5EE 4OGZA 3T6QC 3TBTB 4ZUVA 4GKZB 1CN4A 2PPAA 3ARFC 1FBIH 4N22A 4WY7H 5DZ9A 5CJQH 4XNUH 1EAPA 4TUUA 5KEZA 3AMLA 5D93B 1RIUH 3EH2A 2LU3A 3FJTA 1ZLSL 1A5FH 1RZGB 3IDYC 1T2QL 5CUSH 4IS6B 1N2RA 5EZJB 4DPAX 3O9WB 2IIJA 3U0TB 4PHXA 1NBVH 1QA9A 2LLNA 4GB9A 3IFLL 4P5RA 4Z7UA 4MXVE 4S1DC 1PF3A 4FC3E 2D7NA 4D94A 3FH5A 2TRHA 4H0IA 5GJTH 3KGUA 1AZRA 3HI6H 5DEJA 3TWCH 4JB9H 1NFDA 4ZS7L 4CSZA 5K9QI 4R7XA 3DX4A 5IMOB 3RLSA 5AUMB 4KQ3H 1II4E 5CHNA 3GHPA 3GXDA 2Y1ZA 5IGXL 1OF0A 1IAIH 3FBQA 5TQ2H 4PTUA 2VLLA 4BH8B 1U8MB 1ZT1A 5L7XH 3QWOA 4JQIL 4KC3B 2VR4A 2TSAA 1QSFD 1GC1C 4P3DB 3HAEH 2XG4B 1FLRL 3EJTA 4HP5A 4JY5H 3JUYA 2GBAA 3Q3GA 2W94A 3WJMA 4BZ1H 4JVPA 5C7ZA 1XGYL 3GSNB 3QIWB 2AJXH 4IOFD 4B9YA 3EYQD 2AQTA 1FGNH 2PCPA 2XA8L 4M5YH 2YXFA 4KXDA 4OW6A 1JRHI 5GGVH 3GJFA 4BWTA 3MXVL 1TKWA 1E42A 3DV4A 4G8GA 3ETBJ 3P69A 4YSDA 4AEIH 2ED9A 4ODHH 1IT9L 1ZJAA 2FATH 1ZT4A 5EEXA 2QSQA 1EZVX 3T5WA 4XBEL 1P4BL 5AVQB 5DQ9A 4AWJC 2EUZA 1EJOH 5IBUG 5LGKA 5AW8B 2VN6A 2F8VA 4Y5YA 4K55A 1GYVA 3KNBB 2K0RA 1LK2A 3GXTA 5KG9A 1ZSHA 2BLFA 4PM1A 2WNWA 5F1OB 1MFAL 3TP4A 3PV6A 4H5SB 4TQEL 2CO7A 3IAPA 1A4AA 2P8MB 3TCLB 4ORGA 1ETZA 5DS1A 2FX8H 1J0KA 4X8GA 1ZRUA 5C0FB 2HX9A 1KIUB 4XX1G 5AZ2H 4PCTA 4XMZA 2C8NA 1B6DA 4GP5B 4PJ5D 1QUNB 4U6YB 1E3XA 2AV7A 1G7QB 4W9LC 4Y1SA 2ED6A 5F9JA 5DEGA 4YQXL 4AL8L 4NZRH 1GIGL 1K2DA 1TPXB 3CIQA 5T5NF 1M71B 2WUBH 4RVBA 4XPAL 4GAAA 3H9SE 2H32H 4E5XG 1XSKA 1ZVYA 2JF1A 1IM9B 3RKPA 1OK8A 2EE9A 4ALAC 1JGDB 1MHEB 1VEPA 1LO3L 2X9WA 4ACPA 1H3XA 3VI3A 3VGAC 3WXVL 1FDLH 3GKZA 2FRGP 2CDFB 1ET5A 3IM1A 4OFVA 5E6SB 4YDNA 1HKFA 2G60L 3HFML 3OJDB 1XD1A 1F8TH 5JHDE 2OA9A 4NQEB 2WXQA 1TZOA 3RX9A 4MB1A 3QSKB 1D2PA 4O02H 1JZ8A 4HVBA 4XO8A 1KN2H 2OBGA 4NCC2 3S3PA 4MNQA 2XZCH 3FN3A 1XGUB 4EPSA 4F7PB 3AACA 4GW4B 2A73A 1A7PH 2VMEA 5IHZB 3OAUH 5AAMC 3FCTB 3HNSH 2XQYK 1RZJL 2BVQA 4R7DB 3BN9D 5B38G 1JL8A 1XH3A 1YMMD 4PGBB 2LTQB 2VDRB 4ZRGA 1CDBA 1MAMH 2XA3A 1XMEB 4LCWB 5FUZL 1AZNA 1XBDA 5IQNA 4PG2A 1UA6H 5I5JA 4KKCC 1RPUA 4UIMB 2CBMA 1T21A 2UVFA 3U4EB 2DQMA 3VRJB 1GMIA 5BOJA 1VZGA 2CPCA 3BP6A 2PPFA 1GSKA 2F0CA 3BFOA 1ANUA 3GIZL 3NAAL 3H6AA 1NC2A 1JHLH 3FT3B 4GKSB 5AOLA 5D1ZI 3Q01A 3T2NL 3CHSA 1DVYA 4NB7A 2XLLA 4K8RC 4NZJA 4AGNA 2YOCA 1R3IL 3DTXA 3TV3L 4AIZB 2YOAA 3ZMRA 4U1NB 2WCGA 2Z31D 4FLQA 1HCVA 3NQIA 5GS0L 3SQRA 3HE7B 2GJ6D 4R0LB 5EBLB 4E9TA 4L2LA 5CJXC 4HIXH 3FONA 1NCBH 1MVUA 2RA1A 3WMPA 5EEVA 4GXVH 2QVMA 5HYJD 3B7RL 2IH9A 5CJOL 2HVJA 4KKLC 3P54A 1MHHB 1RZKC 2PPCA 2HB0A 5D7LE 2DMHA 1OSPL 1NAMH 2A6IA 4OLVH 4Y5VC 1FVDB 5G4MA 1JV5A 1GTFA 2XN9A 3L9YA 3GSRB 4NNYB 3HJ0A 1FZKB 1T5XA 4BK4A 1NKRA 1G7LA 2D31B 4EDXA 1DBAL 2BCMA 2CO3A 3KXFE 1ZVNA 5FO8B 1M05A 1MFCL 3B2DC 2B4CH 3KPNB 3A6CL 5FV2A 3R1GH 1V7MH 1ACYL 4LSPH 3GNML 2JELL 1NGQL 1QTSA 4NQCE 4LXFA 4JX0A 2WP3T 1N18A 2AJUL 4N3TA 3MNWB 2I5YL 3M1BA 4Y9EA 1N6VA 1TCRB 3BVVA 1UM4H 2GPZA 4GAYB 3QIUA 1A4JA 2AK1L 4RWYH 1FZOA 1QRND 4K3DH 1MFUA 1KB3A 3G6JA 4XP4H 3REWB 1MRDL 3QCTH 4AUUA 1F56A 1DLHB 4FMVA 5JW5B 5LCVA 3MV7E 4AE1A 1CICB 1TTGA 3FCBA 4EKXA 2CXKA 3F2LA 4GIAA 3P02A 1OP4A 4X8JA 5I5RA 3CPLB 3Q2VA 3QIUC 2B0SL 3OG6B 5JXAL 2DQIL 5D2NA 2EDLA 4JUSA 5I0ZA 2OMVB 3MA9L 3HMXA 1UD4A 4RAHA 2GUOA 2Z91A 2PPEA 3HTLX 2IOIA 4MMXC 3TJHC 2HX8A 1BQUA 5J57B 5GPRA 3DWTA 3BSHA 3IJHB 4UUJA 3QXDA 2JQMA 1OAKH 1YJDH 1OGSA 1R3JB 4MJ4A 3UBXG 3RYMA 2X6AA 2XIBA 4ZUTB 4XNBA 5GGUB 3G08A 1ODUA 5K9OA 1A6TB 3F12B 5D2NC 5FCSH 4YSAA 3NJNA 4ZXBA 2B1HL 3G5XB 3PLYA 1JXKA 2YAPA 2Q20A 2YPVH 1G87A 3GI9L 3S4SG 1HL9A 5DWUH 5KYYA 1A1NA 3NGBC 4RMUA 4LLVA 2WY3B 5D4JA 5DMKB 3WE1A 1HWGB 5E9DA 2HXAA 5E95B 5T3ZH 1BHGA 2VT0A 2ZWSA 3BD3A 3FU8A 2J6EL 5DDHA 4U6XA 7PCYA 2A6JA 3HC3L 3UC2A 4JRLA 3S3SA 2PWHA 3WSQL 4OZFH 2ORBL 5GRJL 1OP3H 2ZKMX 1SJHB 5E6IC 3IMWA 2XWTA 1UZ6E 2JWYA 2HLFC 4KUZH 2OMYA 1H3PH 4HD5A 2G30A 5B1AB 5B3NA 5LGHH 5ICYA 2I60L 3ZE2E 3DJ9A 3LSOA 4HAFA 4I85A 4W9ZA 2HFEA 2NRDA 4JFYB 4O2CB 1B4JL 1BM7A 5F8RC 5SWZD 2WKOF 3FFDA 4HJJH 5D71L 5FW6A 1KFAL 1ZANL 3UJTL 1MRFH 2LE9A 2XQ0A 1XO8A 3PDGA 4ZTPL 1FNSL 4LNRB 4OD1H 4PWIA 2CK0H 3ELQA 4KI1A 3CN2A 2BZDA 4GSRA 3DX1A 2AGJH 2WVVB 2NY3B 4L5FL 2JCCE 5FA4A 1R0AL 1N10A 4M5SA 3QJZA 2K45A 4EBQH 5CEZD 1FYHB 1VRSA 3F7KA 5EO0B 5LJYH 2CIKA 1BVLB 4NP4L 4BINA 1AGBB 2CSPA 4LOVA 4QR7A 3ATDA 4LLMA 2XVLA 1XR8B 1SHMA 1BVNP 1R1CA 4JNXA 1H0DA 1YN6A 3MLYH 2XTLA 4KK8C 5HHMB 3GRGA 2QSCH 4LRNL 2EVIA 1RU9H 2BNUB 3PWPD 4LIQL 3RVTC 2ZOWA 1A6AB 1DJIA 1JXGA 5HI5D 4XX5A 4HETA 1OAZH 3U6RB 4UTAA 3VFSA 3ZDXF 1T0MA 1T0PB 1QZ1A 4G6AD 5B8CB 1T20A 2BNRE 1UA7A 4D0BB 1ZS8A 2FSEA 4NWTH 1AKJB 2VXVH 3BDBA 4G6FD 5I76A 1NDMB 4S1SL 4F7EB 3ULVD 1P4LA 2YPLA 2WV3A 1EK3A 3O41B 4ONFL 4ZMQA 3RPBA 3V0JA 5HHXL 3V6OA 4QIRA 2ESVE 4ZX6A 1J8HB 4XMLH 4F7MB 1SLUA 1RIHL 2HKFH 1H6UA 2ZUQB 4P4KB 1KGWA 3GS7A 1XXFC 4F7CB 4AEHL 5IB2A 5IMMB 1GZQA 1L9MA 4GI9A 5GZNC 4WWKA 2H0FA 12E8H 3IBEA 1C1EL 4P5TB 4WU7A 3OG4B 4GAJL 1E9QB 3SKOA 3FQNA 5TGBA 1DLFH 4IBZA 1HYSD 1G94A 3V6OC 1XGRA 4MAYD 1P4IH 3U4BL 2BSRB 3UTPD 5F6HI 2MJWA 4K3JH 1XT5A 2UZIH 3VDCA 1XGTA 3OC5A 4MQXD 3GTVA 2E7CA 3GRWL 1TTUA 2DTML 4WWKC 4UNUA 4FFWC 3EGDA 4E41A 3BFQG 5IJVA 4MWFB 5IHBA 2IQAB 4J3OC 1IEHA 4HS3B 4CVUA 4LSRH 1N12A 4GEIA 1AJ7H 1TZIA 1QPXA 2FB4H 3QDGB 3AY2A 2X2HA 4J3OG 2JKJA 2PNDA 4C55A 3O6FB 3D0AA 5I8KH 3IE4A 4KMQA 1A7OH 1U8QB 1MUJA 1WUNT 4HU2A 4M4RA 5AVSB 5GZOA 4JFZL 4H88H 3O6ML 2NY0C 1ZSDA 4MX7A 4JFEB 5E2UL 3F7LA 1VADB 1KY6A 1U93A 3NACH 1NOAA 2MQ0A 4FS0A 3VGDA 2AXHA 2J72A 1LP9F 5DGQA 5FHAL 1OPGH 3OGCA 1T5WA 3GWJA 2GCYB 2VDKL 3V52L 2YXMA 4XO4A 3D05A 1QG3A 2FO8A 1AGEA 5I66B 3FTSA 2MEJB 4JRYB 1E7VA 4B0MM 4NQQA 3L3DA 1ROWA 5JQIB 1PQZA 3ATFA 3H0TB 2VL4A 1D9KB 4N6RB 5GZOC 5I1JL 4BFOA 3SDYL 4WKZA 3T71A 3CFDA 5JYLA 2ITDB 2RD0A 4XWOC 1CO1A 1PNDA 3V4VL 2MQCA 4HV8A 4F5CA 1IBBA 3QT2A 1LWJA 1VZHA 5ICZB 1RZIB 2AVFA 4RGOL 1S7RA 1DBBL 2G4EA 3WO3B 1BP3B 5SV4A 3LNIA 4AVJA 2V9UA 5J12C 2H0EA 5BZZA 1IEBA 1DJYA 3CHRA 4MQTB 5CEYA 4CJ1A 3U30C 3O9WD 1FGVH 4GH7B 2CWRA 2J8UE 1QFOA 3DSNA 3S96B 4FQLL 2DWTA 4ABVA 2F7QA 3SE6A 3VFVA 1J0JA 2ENPA 2V5MA 5ES4B 1UQSB 43C9B 1PZ5A 1X9QA 1A9EB 3FQWB 4MGXA 1SUJA 4PG9A 1U3JA 3QC6X 4JO2H 3QNXA 3M8OL 2XTJE 5E56A 2NXYB 3QJSB 2KERA 3QJVB 3UXFA 1EBAA 2F19H 3FQ1A 3M17B 4ZPTA 1IAMA 2LVEA 2EKJA 3MRBA 4CADB 2ZQKA 4R4FH 4FFZL 4KZEL 4PVLA 5DYOA 1BZ9B 3FTGB 4KDTA 1OARH 2XXGA 1A1MB 2MNJB 3PJSB 2Z4TA 2DWEA 4JBSA 2VLRA 3RUGB 5TE6H 3Q1SH 5KWYC 2CH8A 1OF2A 4KRPB 5DJAA 4LGSB 1HNYA 4HK0B 5I17A 1XCWA 1FVCA 1OP5H 1MCOL 4UINH 4FN0A 4XNQA 3POHA 2IGFH 2X4SA 4JM4H 2W07B 4G70B 3MUHL 3CFBA 3X1EA 3NJMA 3QQ9D 3FF8A 3T6VA 3DUUB 4N0YL 4KDTC 1VAHA 2IBZY 1PDKB 1YZZA 5E2WL 4DT2A 4LU5H 4J7RA 4Z78A 2ETWA 2R4RL 1NEZB 4JFDA 1YN7B 1U6AL 1QLRB 2E27H 5AVYB 1QFWL 2WINA 5KANI 5ITBL 1FL6B 1F90H 3QZPA 4ZMNA 1FYTB 3KBHE 4YDMA 2PCXA 2ZXWB 1PX3A 1T7WA 1D6VH 3OWRA 5C08A 1FO0A 4RSVA 3FT1A 4PWFA 4OV6F 4QTFA 2ED8A 4NM8H 4N24A 1F3RB 1CE1L 3SJVB 4CVWA 4ZMYA 2WZ6A 3N9GH 3QUXB 4QF1A 2Y7QA 3CG8A 5AVXB 4PRNB 4NQVB 3GLAA 4NRZA 1P0SE 1JN6A 2KZKA 1DL7L 1QSFE 1IJNA 2FD6L 1AE6H 3C8KA 4FI7A 1T1WB 4X6CE 3SOBL 1FORH 3D0LB 2L0DA 4R5VA 4IOIA 4K9EL 5E99H 1DANU 4XXWA 1OP3K 5F3BB 1A47A 4J8RA 2VDKB 4PJIE 4W4NA 3AU0A 1T3FA 3V4UL 2VSKB 1T1XB 4Z0BL 2R2BA 1IM9D 4WNQA 4BFRA 1TQSA 2W0FA 4N8PA 1TJHL 1V7NH 3RWJA 4YOKA 3UDWC 4NKOA 3EYFA 2Y69B 4E9WA 5KAQG 1JHKL 4GMTH 3D51A 4FYTA 3GMQB 1AS8A 5EUKA 1ZA3A 4XXWC 3DRQA 4RRPG 5IM7B 3IGFA 3DIDA 2JTDA 3PY9A 1BFVL 1CLCA 5IKCA 3WTVA 4YDZA 5EU5A 4G8AC 1MCNA 2BERA 5K59E 4FI8A 1O5DT 4OJEH 3GQFA 3X14A 5F89B 2V2TB 4KK6D 4IRSA 1B9ZA 3P1VA 1GAFL 2BOCA 5TF1L 4ZDHB 2A6KB 2A0LD 2WVUA 1ITCA 3GSWA 4OF0A 5L0QC 1XB3A 2EVHA 1ND0A 4PJ5E 4X9FA 3LRKA 1KGXA 4GINA 4G7VH 5F1IA 3FQ4A 1ROCA 4IOSD 1QFUL 2P5WA 2WO3B 2AVGA 4WFED 4LCWD 3P9LA 1E4WH 1I9RH 2YR3A 4IRSC 3K4DA 4UT6L 1BYOA 1JWUB 2GSIA 3MCLL 4I87A 3I75B 4H1LG 4EIZC 3D3VB 5AEAA 4GRLA 2DYRB 2Q2EB 3IRZA 3EOTH 3B2VL 3BVWA 4MCZA 1VFUA 3GK8H 1Z7JA 2O6EA 1X5FA 4R7VA 3ARBC 4XVTH 1U3HB 5IEHA 1EGJA 4HJEA 1FIGH 3K71B 3GMPB 5FYJH 2H26B 3TPUA 3FO0L 4ONHB 3D07A 5I2IA 1VGKA 1R33A 1SM3H 3BVDB 1A7BA 1WPCA 4MQ7B 2ICEB 1E9OB 5T1DH 3UAAA 1DQKA 2YAHA 3HE7D 4OM0H 1WS8A 4HWBA 4KH2A 1W0VA 4UM9A 1U8JA 2UZPA 3WEOA 3E3QE 3IXTB 4KFZC 4OZHB 4F27A 1GGBL 2E0PA 5IT2L 2K6ZA 1MLCA 1FC2D 1BZDA 1AD9A 3UO8B 1BJ1H 3ZHNA 3BX7C 2KYIA 1YMME 3IXAA 3OXRA 1MJ8L 3CFTA 3TH2T 4EOWH 3KWUA 1SEQL 3VAEA 4X5RA 4HULB 2PP8A 2C3HA 3L5XH 4IEFB 3QDMD 4PJFF 2DOCA 4XP6L 1G9MC 2VMCA 2W0PA 1WQVT 3NCBB 3QC5X 1ADQH 3GSVA 4XN5A 1XH1A 4NN7C 1X9UA 1INQA 4G5ZL 3RL2A 2XZAH 2D9CA 3KPSB 3RU8L 4JO3H 2BK8A 1A6UH 5D5MF 2R0KL 1T03L 3JTTB 4ENZA 1NL0H 4R7NB 1LO5B 2EUWA 4XCCL 1ZDSA 3MLUH 4DO5A 1KIRB 3ASOB 4DCQB 2X0WA 2GJ6E 3V55A 4Y4KD 4PJIF 3LH2H 3ZU8A 4MZIA 2WLZA 2IWKA 4WK4B 3OHXA 5E5RB 3VFGH 1AC6A 2AJYH 2ICWB 4YHML 1CICD 1H15B 2XTJC 4LLDB 3VXRA 4HHAA 3SZKC 2W1NA 2BIQA 2VXQL 1RIVH 3DA0A 1TVHB 2DQHH 4CGUB 3W2DL 1I8MB 2NSMA 1QQDB 4UQIM 1QHOA 3QQ4B 4OCLC 5CM1A 5EEYA 5HI4D 2EDWA 1CGTA 1T04B 3AMKA 3JYCA 5FKPA 3N5AA 5IR1B 3OHXC 1FFPA 5DK2B 4L8CA 3P30L 1IQWL 3OGOE 5BCAA 2J5WA 2NW3B 2HSIA 1MREL 2TAAA 3LCYA 4OUOA 4OFKA 1A4BA 1G7HB 4M29A 5FCUL 4OLZH 3LD8C 2GVYA 3DX2A 4UZSA 3VD4A 3QARA 2X4QB 3V7AE 3PCYA 3RGHA 1V05A 5IHHA 4I1RA 4JZOB 2YA0A 1T7YA 4M9OA 5JDSB 5KVEE 2B5IB 4B96A 2Q6WB 3MOAH 1QRNE 5JPMC 1VFBA 4X99B 5J8OA 1YDPB 2X1QA 5T1LD 1JXDA 4F92B 5AVUB 5DLMH 3ULSB 4WI8A 5CN2A 3AM8C 2YO3A 2PO6B 4QXGH 5EUOA 1JCKA 4E9LA 1QW9A 1NBZB 3B7TA 3DRTB 2NY5L 2XU9A 3EYSL 1ODAA 5LCVH 2UV3A 1OCZB 4PN6A 3CZLA 4LHUA 5C09B 3WNPA 4UBDD 3F5WA 1KCLA 3JWOL 2Z7WA 5IK3A 3IJSA 3TTSA 3EO0A 4EI5B 3VCLB 5GRVK 2WWOA 2PCFB 2B59B 1UD5A 1AAJA 3O2WL 3Q13A 5HYSG 2Z3FA 1TJGH 1KUMA 3T3ME 4GIOA 4YDKH 4IOFC 2Q3AA 4XPFH 2N7BA 3FDWA 4MHHI 3QWRD 2Y5TA 1CD9B 1GW0A 4QWWC 4PU2A 5I71B 4W6YB 4Z8FH 2HAZA 3I6KA 2RB8A 2FWLB 5I5MA 5CFAA 3L5JA 1CGWA 2WAHA 1LMIA 2NR6D 4OGQC 3AREA 1Z6JT 1A7RL 3CN3A 3PNWA 2AJVL 2ARJB 4YDLC 4YIQB 3VB8A 3H7BA 2D2OA 4YDVB 3AXLB 1EO5A 2ZPKL 3MBEB 2VUYA 1E4XL 1UKTA 4PFEA 4ODUA 5HHMD 1CFQA 4Q0XL 4NJAL 3ZTJG 2WZPD 2RAMA 1RK1A 2XKNA 5D7HA 3VD9A 2PTUA 2UZYB 4K3GA 4L9LB 2IOMA 2O5XH 2PF6A 3EH3B 4PR5B 4C56B 1CCZA 4LGRB 5IEKA 2VL5B 2CDGB 1S7SB 2EIEA 3HBGA 4UIKH 1AKJD 2WQSA 1RD6A 5DUMH 1TYRA 1EIBA 1QNZL 2E7MA 2C3VB 4GRWE 5AB2A 1KYOJ 4EI0A 4G42B 2A77L 1IRAY 4Z7NB 1SZNA 3CZFA 2YPKB 4CMMA 2M2DA 1EUTA 1BJ1J 4ODWB 1J8HD 4AJVA 1XF3A 3WHXB 1CWVA 1EEUA 1S7UB 5F9WC 2WUCL 5CEZE 1QHQA 3RX7A 4QRTB 2EIZB 3JUZA 1VF5C 3DSFL 5DVMA 4PJEE 3GJFK 1ECZA 2VDQL 4WEMB 1BBJA 5E4AA 2EAEA 2EYRB 4J5VA 3HI1B 4HHWA 2C4FT 1DN0A 2VDNH 3IEAA 3PWPE 3ECQA 4BSWA 2BNQB 2IV8A 2WIMA 3F58H 4YVNA 4IIQB 3UTZB 4JJ5A 5DHXB 5C0RL 2IXQB 2BP5M 5KVFL 4QNPE 1B3JA 1CGVA 4ZYKB 4CN4A 2MPVA 3ILPA 4WWNA 2R2EB 4KTEL 1GRWA 1A4CA 3G5VA 2AQ2A 3NSCA 4L0PB 4AW4A 3FQRA 3LEXA 4HLZG 2WKGA 2BP8A 5GRUL 3ULVE 2IV9A 2ZD0A 3AG3B 1R3KB 4WW2B 3SOTA 3L5WA 3QDGD 4P3WA 4O2EB 4AKPA 2CPUA 3OF6D 1GVIA 4NN6C 1SYVA 3VFWA 5DT1H 4XNAA 4JFED 5ISZA 1EEZA 5T33H 5BS0B 4KKPA 2FNWA 1LNUA 3UJIL 4AV0A 5HYJA 1N9PA 3QB7C 3K0YA 3Q2CA 1MFNA 1XCTA 3RTQB 4BHUI 1BAFH 5F7KC 2KQMA 3WO4B 4YK4C 4JRYD 1OTSD 1PX4A 4FQIH 4JY4B 3UTPE 1D9KD 3VXTB 2Z31C 1R5WB 3AWFA 1CPUA 1YAIA 4YHLH 4UU9B 3C09C 1DBJH 4ZOEA 3QEHA 1L7IH 4LL9A 1E90A 2X5PA 4W6WB 2YSTA 4P0DA 4ZSOE 1HWWA 1H3WM 3U9WA 3K6SB 5AFAA 1KYOK 1UYWL 2J1WA 2YJQA 3P3RA 4H0LC 4FXTA 3VTAA 2AQNA 4DP9X 3QNZB 1DSYA 2YS4A 4J28A 4B3VA 3UZQA 1UCTA 3L4WA 3AGWA 1UWEH 4P23B 2FLRT 5I0DA 3MFFB 3ZHLA 3SO3C 5IW6A 4P4RA 2Y0SA 3ATEA 3WKMH 1QMUA 2J1XA 2BHYA 1MIML 4JO4H 5DA0B 1CR9L 1J9CT 3LPFA 5KBDA 4PJ7B 4M43H 5DYFA 1OSZB 4M1CC 2UXFA 4M6OL 4X7CC 1QBLL 1CXHA 4PS4H 5FK9B 4DKEH 4EN2A 2XV2A 4JREC 1A2YB 1AP2A 5ESVA 2Y24A 5CLXA 2ICCA 5E4IA 5E8EA 4EJ1C 1TZGH 4PWGA 2PYEA 5K1JA 3SDXA 2HPOA 2NXYD 4J3XA 4PJGB 3O3DB 1JTOA 2J1YA 5LKNA 2B2XH 3SYCA 5DK0A 4OZGA 3V7AG 3EAKA 3MCKB 5C0ND 3OKMB 3C9NA 5DEZA 4CDHA 2BOBB 3H54A 4NN5B 2GEQA 1FNGB 2GTWA 1KJ2H 4FQHB 4KRPD 2QR0B 1XSOA 3IFOB 1U4EA 3PABA 5GGTL 3O11A 5D7EA 2SEBA 1XX9C 3NJJA 3OAYH 3LN4A 3V7MA 3OJ2C 1LE9A 1S78D 2XV6B 5KSBF 3II2A 3VVVA 2IDTA 4FXGC 2IPUK 4HUWA 3L08A 3HR5A 4HC1A 1AHWA 4CUCA 4ZUSA 3D12B 2LAAA 3WFHB 2OXGB 1ZHLA 3FKUS 3JVGC 4OTXL 2OAAA 3VGGA 5CZVH 4YPGA 1J0ZA 2F8XC 2IALA 3FB5A 1BD2B 2RTTA 4GRMA 5EOTA 5J1AA 5GGRY 1AGFA 4KK5D 5E08H 5DZJA 2E59A 4L3AA 1FYTD 4BWUA 3KPRB 4M7KL 5E1HB 5CSZA 2QDVA 3K7UA 2Y22A 1NMAH 3NABL 5BUPA 5FM5M 3TBCA 2H0JA 3BPLC 5F7DA 4IRJA 3QUXD 1HNFA 2YGOA 3HNVH 1MI5B 5TE7L 4DTGL 3T0DA 5SWZA 3KWWB 1UTDA 3B2MA 4MYWB 3S0PA 3HC0B 1AQKL 3QQDA 1IFHH 2ZWNA 4AIXA 5GS1A 1GOFA 3BD5A 4J6RH 4LL1A 3TCTA 4DSYA 1AZZC 2VLMD 5B39A 3QCVL 3X3FH 1R24B 2QL1A 1MNNA 4MZ2A 1ZKAA 4LOEA 1W8EA 3L8QA 4HEPA 2JK5B 2JJTC 2FGWH 1G7JB 5JQ6H 5IQOA 1SDDA 4IK7A 1CBJA 1N64H 35C8H 5G5DA 4BH7A 4LAQH 4YLQT 2APXA 4WI7A 3JZ7A 4BK8A 3EOBA 1MW2A 4Y19A 3B83A 5ABZA 5GS1C 3TT1H 4QD2E 4YLBA 4N9GB 4OD3L 4BRJA 1PLAA 2KC0A 3IFPB 1TG8A 2HH0H 4HIJB 1KB9J 4WFFD 1T1YA 2GJZB 3UYRH 5GGRB 1NPNA 5D7SL 5E5UB 4L37B 1E2WA 1KCUH 2C9PA 3LXCA 3BAEH 4JPWL 3K46A 2FYYB 3CDFA 1BMGA 2FR4B 4YR6B 4QMEA 4HIEA 2QVTA 3HPLB 2CRYA 3HG5A 3O3EA 1JFHA 3TL5A 4F15B 2O72A 4R96B 3LQAH 4G6AC 8CGTA 2OYKA 5DGRA 1WGVA 5B1JA 1JZ5A 1FFOB 2FHBA 3P73B 4N5EC 3DHUA 4PRIA 1KTKE 4YGVB 4ZQKA 3PWLA 5ENWB 1RFDL 1PZBA 5TDOA 1NGPL 1YYLL 3QG6B 5EU3B 1ZGLP 5HGDA 5EB9A 4ZTOL 4HOXA 5EFIA 1U3HD 3ROOA 3BEVA 4BZ2H 2DMGA 2W65A 4P5KA 2X1XR 4QT5B 2A9AA 2GK0A 4Y9CA 3T3PB 3K8KA 4YGAB 2ZAIA 3ETBF 4W9HC 2VDMH 1ZAGA 1H19A 1J1OH 4N2GA 1CDJA 4X5LA 3RAJH 1SOXA 4ZSOA 2KUTA 4NRXB 4NSKB 2JJSA 3BH8A 1A6VH 3FO9A 4K71B 1E43A 1DBKL 1W8OA 3L6FB 4PS3A 4UQAA 1PFOA 4DGUA 4A7VA 4MAYC 3WEXB 4Y4FB 5D70H 5HDOA 2EH7L 2J12B 2NX5A 1TQUA 1X5LA 1HE8A 2Z65C 1DQTA 4X7TA 2FJGA 3IETA 4U1HB 4MQXC 2NZ9D 3BSZA 1K4CB 4WFEE 4ZFOL 4L3EA 4LCWE 3BDYL 1QBAA 3QG7L 4HS8H 1EEQA 5E94A 4E0RA 3WIHA 2UWEE 3INUL 3KW8A 3FO2A 2JJSC 4YDJB 3WKYA 4CC0A 3L45A 4PGDB 2DF3A 4PJ9A 4J27A 1FNEA 2V9RA 4PIRF 3Q05A 4MJ5A 3KPSD 2HKAA 5EHFA 3WFCH 4KITB 1B90A 1UD3A 4XVJH 1OSEA 5IQ9A 4JDZB 4RIRA 5FECB 1KB9K 3KLAA 2C1OA 5FO7A 1HSBB 2BJMH 2OKMA 1W0YT 1V8HA 1FBIL 4WY7L 5CJQL 1PCXA 3D18B 4XNUL 1EGJH 4F8NA 3D52A 4WI0A 4X6FA 3IDNB 1KTBA 3MJ9A 3G3LA 3BUBA 5MI0B 4HEMA 5T5FA 5SWQB 1A5FL 2YAMA 2RQ8A 2Q1EA 5FYLE 3S48A 4MA7H 3AXHA 3CC1A 3FSZA 1NBVL 4H13C 4ANVA 4XGZB 3IPFA 2ZG1A 4MASA 3TU6A 5CIPB 1Z9PA 4O58H 3FRPA 3GZPA 4IS6A 5EZJA 5GJTL 1NUFA 3EFFB 4U6HA 3QDME 1Z0NA 4MRBA 4KRMB 3TBWA 3U0TA 3GMLB 3HI6L 3UTOA 2VXTH 5A6MA 1I7UB 3TWCL 2ODHA 4JB9L 1UACH 3FSVA 2VKXA 1D6EA 4CVZB 1TR7A 4XBPB 3U7WH 1TU2A 4KQ3L 1IZKA 1LWHA 4QTIH 5TJWK 4LSTH 5IB4B 2RGSA 4YX2H 4FZ8H 2XACC 1IAIL 1PG7W 5D93C 5TQ2L 4F2EA 1DQVA 4WJG3 5DZAA 5L7XL 5IMOA 1MKFA 2NMSA 3O9WC 5AUMA 3RBGA 4ELKB 4HMDA 3L4YA 5HY9A 5CSGA 5C0BD 3SBQA 3UTTA 4JY5L 3LDBC 1E27B 4ZFZB 3WHE1 4L1SA 4BH8A 1U8MA 1L6ZA 4QRBA 4BZ1L 2DL2A 5CILH 4OU3A 2GI0A 2YGQA 2CUIA 4JG0H 2B8OT 2HRGA 2AJXL 2Y3NA 3D4YA 1F13A 4FXKB 1KELH 4M5YL 2PO6D 5GGVL 1AZBA 1DO6A 4P59H 2VITA 4HT1H 2DV6A 1OO2A 5HHOA 5BW7A 1Z2KA 4AEIL 4B5ZA 4ODHL 2FATL 3QIWA 4P57B 1B3IA 1X5JA 5DD5H 2R4SH 4EN3B 3WTTA 1A3RH 1EJOL 3NUKA 4PJDB 5DURB 3GKWH 5C09D 5J3HD 1KXQA 5EDSA 5AD0B 3QJXA 1DFXA 5A7EA 3WBDA 2KH2B 4O51A 1ZTXH 4FQQA 1WCBA 3FF7A 3KJ6H 3OAYK 4PYGA 4EI5D 3MLWH 2A7BA 3BWUF 2GBVA 3B9KB 4LP8A 5BW7C 1EFQA 3F7QA 2DD8H 5HGHB 4MA8H 2N7SA 3QIWC 1F3DH 2IAMB 2VRQA 3PUUA 3QQ9C 3GS4A 3VE0B 2FDBP 2FX8L 2EDTA 4HCRH 5AZ2L 3QH3A 4TTDD 3GLDA 1N67A 4OZIB 2R1WA 4H5SA 4QDGA 3LNFA 2YFOA 1KCWA 1Y0LB 1ZLEA 4ZFOB 5I75B 1BQSA 2YGPA 4NZRL 4K7PH 3UPRA 3BW9A 2WUBL 1KIUA 4EIBA 2B20A 2EDQA 4FKEA 3FFCB 1R5IB 5EZIH 2WCSA 2UXTA 1QUNA 1AO7A 1G7QA 3RY6A 2WO2B 4QJ3B 1RZQA 1HINH 4AW7A 1E65A 1FDLL 2DI9A 3MCYA 4G11A 3KDMA 1JV2A 3K91A 1IM9A 3O45B 3RIAK 4UTBA 2AQ3A 1F8TL 5HYEA 3PGCA 3VXMA 4CBZA 5EZLB 4GO6B 4IDLA 3PGDB 4NQUA 3BQUA 3RNKA 1CFSB 1DVUA 1PYWA 4O02L 5F7NC 1OOAA 3MNZB 2P46B 1KN2L 3OJDA 4Z7WB 1NIAA 3CLEH 3FXIC 4U3SB 1TPXC 2DBLH 4XTRD 3FHEA 2GG1A 2DQDH 4MJ6A 3VJ6B 4NQEA 3VXNB 4FFVC 1A7PL 4MNGA 3ZTCC 1JOIA 1IFGA 4A2DA 3KYMB 3OAUL 3HNSL 5D8JH 4M8RA 3H8NA 5AG9A 3QFDA 2B1AH 2ZSVB 3K6IA 3ZZLA 3QZWB 3ULUF 1XGUA 3KWTA 3BN3B 4CW1B 4MQSB 4F7PA 4OJDH 5IREA 1IKNA 3GBMH 1MAML 3DIFA 4UDTB 4I5BA 3FCTA 1UA6L 2VQ4A 4XCFH 4CC4A 5HHME 3S88H 3KLLA 3CZKA 3RWHA 2I69A 4JPIB 3CN0A 2BNQD 3EDJA 4WHYG 3FU7B 2G9HB 4QI3A 2X38A 4YDIH 1F11B 4LCWA 4LBAA 3BPNB 1E9PB 4M1DH 1JHLL 1W72H 3E2HC 4I7ZC 3U4EA 1UM5H 4X7SH 1IKNC 1E30A 2A0LC 3QJHB 3IJYB 4TULH 4PBDA 4LO9A 3HAEB 1LHZA 3MLVH 4CC4C 2XC8A 3U6XA 5CBAA 4GKSA 1Q9KA 1JD9A 4HJTA 4JQIA 4HIXL 4NDMA 1MRCH 1NCBL 3IMSA 1J8HE 4GXVL 2NNAB 1GY1A 4U1NA 2VUOA 1N70A 5C7XH 1KGIA 3UPCA 4LLYA 4K7FA 1QO3A 5AB9A 1BVNT 1U3ZA 1T80A 3HE7A 5ID0A 4DK5A 5BS0D 4U05A 4KJPC 1BJMA 1NAML 4OLVL 1HDMB 1MCWW 4GT0A 5C6TH 3DOHA 2LV4A 1MHHA 5DU7A 5J6GB 3FUEA 3RTQD 1YNTF 4FOMA 4NEHB 4U1MA 4AQOA 5KBPA 1C16B 3LKOB 5JDJA 5EF0A 4FCAA 2B4CL 1FVDA 4NO0A 1CFBA 3HN8A 3Q5OA 4NNYA 1JPFB 1WEJH 1V7ML 3GSRA 4LSPL 4S10A 3HE7C 5AENA 3N42F 2FLMA 3NG5A 4AV5A 2OL3B 4PH8A 2XRAH 1EVUA 1N4XH 3OX8A 5IFJA 3C5JB 1UM4L 3K6FA 1PG7H 5AW2B 1WIPA 2BHZA 1TTRA 5IJBC 1TVBA 5H4ZA 5LNEA 5JIKA 4RWYL 3QDGE 4K3DL 3TZVB 2W9DH 5H37H 4XP4L 3RZWA 1T7ZA 4AVHA 4B53A 3DPDA 2VDPB 3QCTL 2EEAA 3F65A 2WM0A 3FUJA 4AM0Q 4GAYA 2N0MA 1IAOB 2P49B 3G5YB 4WF7A 5IVOA 4JFEE 2YUZA 3AB0B 4YBHA 5MEOA 2R23B 3AUVA 4HIHB 4AMXA 5FLUA 4UQ3B 1S6NA 2BY2A 5FGBA 1C08A 4IMKA 2Z9TA 1PZCA 1ZGLM 4PVNA 1XSJA 3KLQA 4QRPB 5C9KA 2E3VA 4JRYE 3L9BA 3ARDB 1IC5H 4NGHH 4UV7H 2BRQA 4PJXE 2BIHA 3GSQB 1F3DJ 1OAKL 3DUSA 1YJDL 4O02B 4IBUA 2JV6A 2J2ZB 3B9AA 4AL8C 1S3RA 2B08A 3T0EB 5FGBC 1N19A 3DJRA 1BFOB 4P46A 2YBRB 4IMKC 4ZMLA 1TTCA 1KJVB 4ZW7A 1CICC 3G5WA 3IJHA 3QZNA 2H3NB 2YPVL 4G6KH 3G6DH 2LAGB 3JZYA 5DWUL 5GGUA 3HHMA 1TYJA 2EP6A 3T04D 1DCLA 3BJLA 3SEPA 3VH8B 3F12A 4CILA 1K85A 2FX7H 3G5XA 4L23A 2GFBB 4O4YH 4WW1B 5T3ZL 4FYQA 2DEYX 3UC0H 1MJ7H 2LLGA 1EHNA 4DWHA 3M86A 5FO8A 1S5IL 4PMFA 3NSYA 4FKKA 5IJDC 2D9QB 3B9VA 4EVNB 4S0HA 2P8LB 4KUZL 1CXLA 4AVKA 3CX5K 4MRCA 4Y2DB 5I1IH 1H3PL 3KPRD 5DJZB 4OGAD 5LGHL 4FJ6A 5AOKA 5FR3A 1DJXA 5L9DH 2LU7A 2WMPA 4PRHA 5I6KA 2FUTA 5I1DB 2X6VA 4HJJL 1RZJC 1SJHA 1BZOA 1QX1A 4HS6B 5I9QB 3J2PA 2X3BA 1BZEA 1I75A 1MRFL 1R5VB 2AI0H 2X7LB 1I1YB 2ZWLT 4ODXA 3V79C 1MI5D 2IDCA 2RALA 4LSUH 3RUGE 4NM4H 4OD1L 3RHWK 2CK0L 3OKLB 5D7KD 5EN2B 3VFMA 1SXAA 2CJUH 4N86A 1NCGA 2AGJL 1IU1A 5F3HB 3ROLB 3VXSB 1IBDA 2CUAA 5IVXF 3BKYH 4NI3A 4EBQL 1TFPA 3A23A 1RJZB 4X4MA 5E1QA 2N1TE 3IU4L 4Z18A 2ZYHA 1QVOA 1DP0A 4X7DC 2L8AA 5MEQB 1UVQB 2JNZA 4WI3A 2WVVA 5IFAH 3IWVA 1Z9NA 2JFCA 4UBDC 3MLYL 3HNTH 3EGXB 3CXHK 3NCEB 1GYCA 4H8VA 2QSCL 1KBPA 5D7JB 3TA3B 1RU9L 4JKNA 4RFEB 5D7IF 1BVLA 1EV2E 2Y1AA 3F62A 4IBYA 4JY6A 5GS0C 3FB8B 1BVKA 3MCG1 1YUHB 3ZVVA 1OAZL 4IYKA 3QRFM 1FYTE 1SLVA 5HJ3A 1L0PA 1S4IA 2NY3C 4NWTL 5K39B 5ILTH 2VXVL 3UYOD 4PB9H 2O6CA 2YGVA 3K6NA 5KBLA 4F93B 3TVMA 4K94H 1URIA 2R2CA 4D0BA 4EUPA 4EO5A 4A2HA 1E28B 4XMLL 1NIBA 1EFXA 3BEWB 4TSAH 2HKFL 2QHLA 1ORSA 4F7EA 3M1CA 4JUTA 1KNOA 4AV4A 4KGLA 3U1SL 1MCDA 4Z7QB 1MWAH 12E8L 1W15A 2VLME 4L1LA 4P4KA 2ZCHH 4DVBB 2Y07H 4S1RH 1DLFL 2AITA 2GT9B 3A67H 2C9VA 3A21A 5B8CC 5B7FA 4LFHD 3B4NA 4Y1TA 4AJYV 4AXWA 3S36H 1P4IL 1MCWM 4P5TA 4K3JL 4F7TA 1C7TA 4DGWC 2UZIL 3BMWA 1XEDA 1S3KH 2NNFA 5T3XH 2BSRA 2O26U 4QCIA 4YSPA 4P4KC 2HFTA 2AK4B 2ZUQC 1L0YA 4NQSA 1JDDA 4LLAA 3MSPA 1QATA 4LSRL 3T2PA 1AJ7L 5HGBB 4WFFE 2FB4L 3JV6B 4XNYH 2KDGA 2QGBA 3DVGA 4ZMPA 3V5KA 4MWFA 4P5TC 1W6LA 4PY8J 5I8KL 3MRHB 3E9TA 2UXVA 1A7OL 2AZAA 4L4VB 5JHBA 3KE0A 1GJWA 2EE6A 2VC2L 2AEOA 2R1XA 3OJMB 4H88L 5A16B 2WN3A 2R27A 1BM3H 5BXFA 3QORB 1I7ZB 1WTLA 2GI7A 4POZD 4Y4FD 5HVWA 3AC0A 3O6FA 4KTYA 3NACL 5DFVC 2A38A 3TPKA 4OZFB 4TVPH 3OF6A 4OF8A 1U8QA 1OPGL 2DMCA 4UOZA 5ANHA 4L0ZA 4EQ3A 2J6EA 5FYKD 4PCKA 1Q9OB 3SIKA 1VADA 1JYVA 3A3YB 3D85B 1QD0A 5FB8A 2YFNA 5J5EA 4NKMB 4Z7VF 2NW2B 4HCIA 4N90D 3KPOA 1S7QB 2GCYA 4F58H 4Q14A 4M3KB 5INDB 3TXAA 3MRLA 2ZKXA 1R3LB 5DQJA 3WY4A 3O6FC 1KYDA 5I66A 5PAZA 5TPWH 3TEUA 2J7LA 3H0TA 3GSXA 4N6RA 4KMLB 3O6LH 1NCCH 4HGMA 2CBQA 4AENB 3SPJA 2Y6TE 1OANA 2ITDA 3JTSA 3SGKC 3MRRB 5I0VA 2VW6A 5JR1H 2GIXA 3G7TA 5FF6B 3JV0A 3BWSA 4I2XE 1I8KB 3TT3H 3VXQB 5F1NB 4OZHE 1RZIA 2I7OA 3OB8A 5ICZA 1HHJA 1L9TA 4XPGH 5FOBB 4KO5A 5EN3A 4U31A 5DI8B 1FGVL 1CD1B 1LEIB 5EO1A 3SDDA 1EA9C 4HJGA 5DJ8A 2WNKA 1D9KC 3ARXA 2VJ8A 4HFWB 2OQJB 1H3VA 4Y9FA 2F7IA 3MLXH 3D25A 4XP5H 3P4NA 3KYKH 1J0IA 4Z3FA 4JO2L 3NDYE 4D2NA 2PKDA 6TAAA 3VQMA 4LGPB 2A83A 4LVHB 2A5UA 1UFGA 3EDKA 3S96A 1CQKA 5A6IA 1WG3A 2F19L 4PLKD 3DURB 1BG9A 2CLRA 4I1NB 3WS6A 43C9A 3FQWA 2AJ3B 2Y5QA 3VFPB 3KPSE 1DR9A 2KBGA 2QQQA 3NVQA 2YD1A 3NCWA 4R4FL 5HYQA 5I1LB 2BS8A 4BSVB 3OAZH 3ULAB 2PXYB 1OARL 1WUZA 3H6JA 2X42A 2OTUA 2VN3A 3BP4A 3QFJD 5DWPA 5TE6L 3Q1SL 1J05B 4ZFGH 1KIQA 2XBDA 5E6RB 4ZPVB 3VRIA 3KG5A 5IB1B 1BZ9A 2WXFA 1LP9A 4UINL 3BKCH 4FE9A 3PJSA 1NAKH 2VB5A 2IGFL 3DROB 5C07B 4JM4L 4HG4J 3WS6C 3FQTB 4WSGA 2ZYIA 4LCUB 2YZ8A 3OLGA 2XHNA 3VTTA 4HPOH 2WXJA 3UOAB 4HK0A 2NXYC 3FT2B 3MYJB 1NANI 4HUVB 5JIPA 4LU5L 4QHMB 3ZO9A 2V0AA 2AQRA 4LMQE 2E27L 5AZUA 1BZ7B 1AQMA 1J1PH 1MZYA 3HIZA 4YE4H 5C0NC 1CIUA 3LN5A 4U6VH 2XBZA 3P2DA 4EN3D 1PDKA 1HQRB 3LRSB 3WKNA 4OI7A 1F90L 1UA3A 4BCXA 5DURD 1SJEA 1E40A 1D6VL 1YN7A 4KRPC 3DMMA 5D2LB 2HTKD 3GRWA 1MFDL 4NM8L 3LRGA 1FZJB 5IV2B 2CNZA 3I9PA 2B16A 3N9GL 1UEMA 4W1TA 4OFIA 1XVSA 4WUUD 2CR0A 1ZLUH 1MPAH 1L0XA 4A2GA 1JD7A 5KZCB 2RR3A 1AE6L 3QJUB 5JO5B 2AS5M 1WSST 1DVFB 5IROA 3SJVA 1FORL 3NCMA 3RB5A 5E99L 2A9NH 3WNMA 1TSRA 3GT6A 1SYSB 1WCQA 1RH8A 3FYEB 4HXAH 1NEZG 3FTYA 3CSPA 3EXLA 3D0LA 3FFCD 4RCAA 4P05A 1IGJB 3W0WA 1EJ6A 2WQWA 3G04B 4HPYH 3SGJA 2YAFA 5DRWB 1V7NL 4JQXC 3NK4A 1TMQA 1F18A 1T1XA 5IROC 2OSLA 1VZIA 1YA5A 4HKJB 3QUXC 4GMTL 3VU2A 1EO8H 2X87A 5C92A 1Z0MA 3X1NA 1LMKA 1ACCA 1QAWA 3V8OA 1JNHA 3H4HA 5EWIH 4L29B 3ERXA 4JN1H 3POCA 2DQJH 3EW3B 2IMNA 3V4VA 3K1DA 5F96H 3QDJD 1OVZA 3VG9B 1UXSA 3TH3T 3ZL4H 4BUGA 2EACA 4Z76B 3IMTA 2IDSA 3LH8A 3NZHH 3SGJC 1XMWA 5H94B 4LDLB 4HG4K 2JKWA 5BUAA 3AT0A 1A4KA 3JWNC 1UB6A 5FGRA 2ZT9C 4PJBF 5EEZA 3KVQA 2V2TA 2FT6A 4G7VL 1F6AB 2ZWYA 4W9GC 2D73A 3T0BA 3WY2A 2Q7AA 2VABB 4WTZG 2ZX5A 3WKQA 4ZG1A 3ZKMD 1F1AA 5D55A 1ILSA 4OI9A 1E4WL 1I9RL 4I13B 5C0AA 3MMEA 2DB8A 4FFTA