4KVPA

Human p53 core domain mutant v157f
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
194
structure length
194
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRFRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structures of oncogenic, suppressor and rescued p53 core-domain variants: mechanisms of mutant p53 rescue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kvpA00
2IOMA 2MEJB 1CMOA 3WTWA 2J6WA 1EAQA 5ABAA 2OCJA 5G4OA 4G83A 3WTYA 2J1XA 2BINA 4AGLA 2PCXA 2YBGA 3D08A 2J1ZA 4IBUA 4GUQA 5AB9A 2BIPA 1H9DA 3WTVA 3EXLA 2X0WA 3IGKA 3VD0A 4LOEA 4A63A 1IO4C 3D06A 2AC0A 4AGNA 1YCSA 1KZYA 4AGMA 3US1A 4LO9A 1EANA 2P52A 4KVPA 1UOLA 2XWRA 5AOMA 2FEJA 3US0A 3VD2A 4IBZA 3D05A 3D09A 2X0VA 4IBTA 5ECGA 1GZHA 3Q05A 4XR8C 4AGQA 5LAPA 2BIQA 4G82A 4IBWA 2VUKA 3WU1A 3TS8A 1T4WA 4AGOA 4L0YA 2WGXA 2BIMA 3ZMEA 2IOOA 5AOKA 4L0ZA 2GEQA 5AOJA 3WTXA 4L18A 3Q06A 1GZHC 4MZIA 5A7BA 5KBDA 5BUAA 1HU8A 4MZRA 4AGPA 3KZ8A 3QYNA 4LOFA 2J20A 2J1YA 1TUPA 3EXJA 2J21A 2BIOA 3WTSA 2RMNA 3QYMA 1CO1A 5LGYA 4IBQA 4IBSA 2AHIA 2XWCA 3D07A 1EAOA 1TSRA 3WTTA 5G4MA 2H1LM 4IJTA 2IOIA 3VD1A 4IBYA 2ADYA 4IBVA 4HJEA 1HJCA 2ATAA 3IGLA 2X0UA 3KMDA 1E50A 1LJMA 3Q01A 5G4NA 3D0AA 4GUOA 5AOLA 4QO1B 3WTUA 1HJBC 5AOIA 2J1WA
chains in the Genus database with same CATH superfamily
4JRXD 3L5WB 1YC7A 1HYSC 2WQXA 3ZGIA 1J87A 4XHJD 1XF1A 3MNZB 5KOMC 4M00A 3SDDC 2HZHA 1F4WL 5DZ9A 2WCPA 5I1GH 4KDVA 3DOSA 2MSPA 2GCYA 5IVXF 1IBGH 3DX2A 3UTTE 1CFVH 4NO0B 3HC3L 4OGZA 4G6KL 4XPTL 1MJ7H 4J4PA 3WXVH 3K6NA 4KZDL 4UAOC 1JI2A 1TQCB 4R5TA 4YHPB 5DI8A 2YPKA 4L8BB 3BKCL 3QHFL 4UYQA 1PZAA 3NIDB 2IC2A 4LSVH 2ZUQC 2ZUVA 5IB5B 6FABH 2VWEE 3N5AA 3CXDH 5D6DA 4BH7A 1ZLWH 2GK0B 4FS0A 4GOSA 5D7LD 5IMKB 1ODUA 1MJ8L 3WEXB 3LS5H 3LRLA 1YCSA 1V10A 1Q0XH 2EEAA 2A6DB 2KHAA 5IHUL 3F6JA 1Y7VA 2X7LA 2RALA 4NBZB 1P7QA 3DRQA 3EYSH 3RVTD 5KSAB 3DKHA 3K72B 4JJ5B 2DZEA 3VU1A 1KTDB 1I3RA 4XCEA 5TH2A 2UZYA 5KAQF 1HOCA 2BS71 4JDZA 4WK4B 3I2CL 1CC3A 4AGQA 3H7LA 1BYOA 3CE1A 2DWEB 3IDNB 5FYKH 3SGKC 1QWNA 4JKNA 4NQXB 2E7LC 5DK2B 1JRHH 3VFPA 2OMZB 2C9XA 1LEKA 4OD1H 3BPCB 3V4VL 1KJ2H 1U95B 5EBMA 4ZS6D 1L9MA 4U3HA 1E6OL 4WKZB 5F1SA 1J5IA 4QTHA 4M1CC 2D7OA 1SEBB 3MI6A 2GTZB 1ZVNA 3HNVL 5SX4I 1P2CB 2BVYA 5FF6B 3WI9A 2EXWC 8PAZA 3B7TA 1LDPH 3QZPA 4J6IA 1R4XA 3I84A 1P4LA 2X4TB 1P9MA 4M4RB 5DF0A 4Q6IB 1JVOA 4GG6A 1QSEB 2CLVA 1W0YT 3BKMH 4P5SA 1INEL 4YO0A 5FCUL 2F7RA 4YOKA 3DPBB 4GKZB 4OIFA 5J11C 1I9EA 1CDCA 2X09A 4M7ZB 4DNLA 1PLCA 2FSEA 4JREC 4V33A 2DQTL 3U4BH 2A38A 4N8VG 1RJLA 1T7WA 3QG7L 2VQ1B 3GBML 1ACYL 2GIMA 3DJ9A 2YRZA 1IGTA 2NY0C 2IQAB 4Z7QE 4IU3A 3CZNA 1AFVL 4KO6A 5DJ0B 1QSZA 1PG7H 1ADQL 1E50A 5JR1H 2I25N 5AG8A 3VFGL 5IMLA 1U8LA 1KYOK 4JMNA 3G6JF 1A6WL 3QUZC 5AZEL 1FNEA 2Q20A 1CG9B 1F45A 3MGOA 3TURA 1G87A 1JMXA 5DD0H 5TQ0L 5BXFB 3SZ6A 3RIFF 4TQIA 1CK0H 2G9HA 2J6EL 2OFQA 3DIDA 2ERJB 3BAJA 5C0AA 2EXTA 4IBUA 5AFAA 1UA6H 1A7RL 4HLJA 4LASL 4NZUL 2DQDL 4RZCB 1GGCL 4YIQA 3J2PA 5IM7B 2F1AA 5GJTH 2AK4A 3D87B 2LLNA 4G9DB 5CBAA 3BRFA 1FUNA 2GJRA 2O5NA 2BS9A 2HTLD 2UY6B 1XIWC 3T4AC 2R2CA 1B4LA 2FIRT 5ENWB 3D69A 4PW4A 4XNUL 4CKVX 4J3VA 3RJDA 5I82A 2WSKA 2NT1A 4PLKD 1XF4B 4N2MA 5SWZB 5KBMA 3MUUA 4GY4A 5DRZB 1HAUA 4I18A 1JERA 4UUJA 3QQDB 4GQRA 5I1GL 1IBGL 1CFQA 1RJCA 4Y5XA 3ZGHA 5LWYL 3EDKA 1CFVL 2FQDA 1TTUA 3GBLA 1VAHA 2X0VA 1OM3H 4LLQB 5D1QA 3HA0A 2ICEB 5IB2B 1XTMA 3U25A 3KYKH 1XCQA 3TS8A 3GUTA 2PTTB 1BAFH 2HFEA 2WGXA 6FABL 3O2DH 4GPVA 2ZCKH 3ZKMD 4WU7B 3DSNB 3DUSA 3MUZ1 4F80A 4NQCE 4FQXD 4A2DA 4FKEA 1TR7A 2DMHA 3IYLW 3F7YB 3Q6FA 4MJ6A 1G9MC 4JKMA 4R0LA 5IHWA 3SD2A 2ADJB 3WAJA 2KYIA 5DFWH 2APVA 1EEYB 4K07A 1IB5A 1KPRA 2W65A 5AB1A 3PWPA 4S0HA 4HV8A 1X5KA 4XAWH 3W81A 1L9TA 1QD0A 2GT9B 4ETYA 3KGRA 4G8GD 5B3NA 3ARFA 4FULA 2JJWA 4OI9A 3Q2WA 4I87A 4UM9B 5JHDD 3FL7A 4X6DA 2PPDA 3N50A 5FYKL 3CX5K 3KBPA 4G70B 1NQBA 4EE2A 1JRHL 1AIZA 1KPUB 3NA9L 2WXOA 4HC1A 1T7ZA 4F15C 3NIGE 4PR5A 3U4EA 2EDMA 1OGAE 1URLA 5HGBA 3B8YA 3U9UA 5HHQA 1S9VA 5IG7A 3KWWB 4DVRH 1HHJB 5HJ3B 1ZHLB 1CD9B 2ZX6A 3U6RB 1S5IH 2WVUA 1SDYA 3KD4A 3T3PF 3IJSB 1ZKAA 4UB0L 3VYOA 5ISZD 1D5XB 2IG2H 1B6DA 2XBZA 2AV7A 3RDTC 1J8HB 4D8PB 3TOPA 5C2UB 4Y1AD 5D1XE 1QNIA 5JYLA 4ZT1A 3TT1L 4NRXB 1ZMYA 2WQWA 5FUCE 4DHLA 3N1FC 3ULUC 3ECUA 4Q9RH 4HDIA 4JRXA 3U4BL 3CUPB 1IC4H 1IEHA 2O6PA 5D7IE 4ODXB 3EF7A 4Q4EA 3PHQB 4DEPB 3RWCB 4IOFD 4JAMB 1JZDC 4HUXA 1RZPA 2C7FA 3P4OB 1EXUB 3S35X 1ZE3C 2DRUA 1X9LA 1BQHG 1S3KL 2V9TA 5FA4A 4JCLA 4F5CA 1N0XH 3KLAA 4J4PC 1K4CA 4FQ2L 5EU6B 1FL5A 1J1PH 5AW8B 3WKQA 4LCCB 2OBGA 3D2UB 2DF3A 1CT8A 3WHE1 2E59A 4RFOH 1BQSA 4LPWA 3C5SA 4PJDE 1KYAA 2NYYD 5DD0L 3VNYA 1TTFA 3ZL4H 2FD6H 3LV3A 4JHBA 1OWRM 1OO2A 2ZOLB 5D6DC 2ZX9A 4QRSB 3WGVB 1I3UA 4U1IA 3OKNB 3CVDA 4NEHB 5CP7B 2IDFA 5TJWK 4WRLA 3F5WB 1FNGA 1ZIBA 2DWDB 2X41A 5J1AA 3ZTJH 3MKKA 1F3DJ 2YD3A 2PN5A 1S8DB 4N85A 3G9VA 1DBJH 3APFA 1G1CA 4PB9H 3EFOB 4RFEA 5GGSB 3HTLX 1UVQB 1BXXA 3FOMA 3VDCA 2GEQA 2BJMH 4R4FH 2WUCH 4TXVB 1FZOB 3MAWA 2K0RA 4KOCA 4KOBA 4L1TA 5IVZA 4JZJA 2QL1A 3GSVA 3KXFB 1X44A 2WOBA 3PPSA 1IGIL 4YQXL 4BV1A 5C0EB 3B2PA 1CLCA 3HR6A 4HFUH 3VE0B 3GMQA 4PJGA 3BQUB 3GB7A 4HW6A 3MV8E 3QCUL 3M46A 5HY9B 3N06B 4ZMAT 5AUMB 3G04B 4KUCD 4O2FA 4WHCA 2EACA 4OLXL 1OM3L 1T22A 3BVTA 3MBWA 2CDGB 4JVPA 1X4YA 3KYKL 2PO6A 2P5WE 3UO8B 3ME0B 5FM5O 1DLFH 3BKYL 1E5BA 2B1AL 2IPKA 3HBQA 2EIMB 4WI8A 1P9MC 3RIFK 3CU7A 1CLZL 5D1ZA 2VKXA 2AI0H 2ADYA 2B08A 3AABA 4YHLH 3Q5TA 4AKOA 3M07A 3E6FB 5AW4B 1S9YA 4DUVA 4FEIA 5EC1B 4C58B 3OKKB 2APBA 3BAYA 3JV0A 4R26L 3ZLQC 3FTVA 3AS2A 3P4MB 1CLYH 4B53A 4BELD 3D34A 3ZQXA 4H1LH 4MZ2A 4E41E 3KPMA 4FE9A 4H1LG 2Q8BH 5J6HB 3OXRB 2Q86B 4WO4A 5F1IB 3RFZB 5CGMA 3BT2H 3Q2VA 4QCIB 4D7BA 5GRJH 4K0OA 1NGPH 4LP4A 4X4YB 2IMMA 1A21A 1P84K 1NJ9B 4UZUA 5GJSH 2BSED 5KW9L 4CVZB 1P4UA 4G71B 5E4EC 2QJDA 3JV6B 2Z3FA 3PJSA 3WIIH 3L81A 3FO0L 4AJVA 4HLEA 5D96C 1IIKA 4J28A 3C60D 3ECBB 4NO3B 3VGAB 1MWAH 4X9HA 2G60H 4HS3A 4RSYA 1UQSA 2BVOA 2VKWA 3OXSA 1EEZB 2IG2L 4M3KB 4QHNA 2D7TH 5CCHE 4GP8B 4KRMB 3X3GL 2OL3A 1O7DE 4Z7NF 1DBAL 2DN7A 2YN5A 4J39A 1NKOA 3TL5A 1T2QL 3TCXA 4J27A 2YAOA 1KBGH 3IM1A 3ZTNH 1T66C 2BWQA 1A0QL 3QAZB 2P80A 3RUGA 2FHCA 2O61A 4LQ1A 3P2BA 1H15A 1NM9A 3F7KA 5KVFH 2ITFA 2JCCF 4HU2A 4I18C 1YEIL 2E27H 5HHMD 2Y5EA 4ADJA 1FFOA 3ZMEA 1N6VA 4P2RD 4HKBA 4Y5XC 3TCLB 3ZE1E 3EFDH 4I8DA 4IOIA 4WHYH 3ISYA 4PJHE 4WI7A 3H53A 4LP5A 2XOTA 3GSQA 4U6TA 2RGSA 4WHYG 5TE7H 1HZHH 5D1QC 2Y22A 2BW5A 2FH8A 4EI6B 3MRIA 1CICB 2ZWSA 1KXTA 1JGDB 2G5UA 4PV8A 2O1AA 3PS6A 5HHXL 1HIML 5LGHL 4RFOL 4TSBH 1E27B 4X42A 5FCSH 3HFML 3IPEA 2EDEA 3MXVH 3ZL4L 2FD6L 3AREB 2AJXH 4KDTA 3ZYZA 3SDXF 3GSNA 4J8QA 1ACCA 2O4EA 2R9HD 3GS4A 4R2GD 3FT4B 3S96A 3HG1B 1DJXA 2VITA 4LIQH 4MDJB 3U2SA 4NJAH 3OKMA 4UANA 4UV4H 4KV5E 3BP5B 1WCBA 1ET5A 4R0LC 2R0KL 4IBQA 3DX6B 3LIZH 3GM0A 3RU8H 4G80A 4N2HA 4I0PA 3UBXI 2HWZH 4YAQA 2Y2WA 2WUCL 3ARFC 3HHMA 3MNVA 4PJ9A 4WU5A 1UG9A 3NMEA 3WNLA 4MAYD 1CDYA 4HJGA 4Y2NA 2ITDA 2NY3C 1NGYA 4H8WH 3PP4H 1B0GB 3B2VL 3RWJA 4M8QB 2KPWA 4QXTA 1TZ8A 5T3ZD 4JFPA 5AW2B 3MGTB 1NIFA 1M7DA 2V5MA 3F84A 5DQDL 4AIOA 4JQIA 5JPMB 5I9QB 2XYCA 2ZOKA 4YSPA 1DLFL 2AXGB 2JFCA 5DVKA 3VXQA 1V55B 1H6FA 3MROA 4FFYH 4FFWD 4S0TD 5CXPA 2N7AA 3LNIA 5DQ9B 5KS9E 5IR1B 2GITB 1ORSB 2BH0A 3L4XA 5CN3A 3EYOA 1SJVA 4MQXC 1LVEA 5IHLB 4UDUA 4MJIA 4PGZA 3BN9C 5TDPB 4ZUUA 2NUPB 4GP5B 1DQLH 3L3GA 1WD8A 1CLYL 2CK2A 2YKLH 1G1KA 1HI6B 2CNZA 4KUZL 3GKWL 3LKQB 4JO2H 1MJUL 1YMHB 1IILE 4KXZH 1R5WA 1E5AA 2HJFA 3BT2L 5CJQH 5GRJL 4I3GA 3T09A 5IQOA 3OGOE 3VD9A 1XF3A 3DRTB 3TP4A 2N0MA 2COVD 2CO1A 3CHOA 4NKMB 2DI7A 3ZW3A 1ZT7B 5J6GB 1MFUA 1CYWA 1A7PH 3VQLA 1JPTH 1QPXA 4OUOA 1MWAL 2C3HA 3HUJA 2G60L 4U1NA 3AGVA 5MI0C 3L3OA 5IWLC 4BZ2L 4F7CA 1A1OB 4XX1G 1BGXL 1IAII 4G11A 5EZLB 4QTFA 4WJKB 4FG6C 4S1DD 4TUUA 3K4DA 3WNNA 4JPVH 3TYFB 4KX7A 2X4OA 5E4AA 1UGNA 4UQ3B 4UT9L 1ZT4B 2ENYA 1Z7JA 4O9HH 2QSTA 1TQTA 2Y9RT 4QXUL 1S3RA 3ZTNL 1IAMA 4V1DB 1BZ9A 1UZ8B 2ADIA 4JZJC 4G8FA 4JN2A 4X99A 3K91A 2J8HA 2XN1A 4D0BB 5LGYA 3I6LE 4K7FA 5EDSA 5KVFL 4AT6B 4B95C 1PZBA 5BV7C 3EFDL 2VL5A 5IVXA 1MVUB 3FB6A 4XO4A 2ED9A 3FSWA 4MJ5A 2GW5A 3ES6B 2W95A 4XBEL 1BZOA 4BK4A 2FNWA 4HD9A 2PO6C 3ZHKA 2CALA 5AOLA 1TKWA 4NAMA 4ZOEA 4CUCA 3Q8BA 5LQBL 4XBPB 4WZ9A 3TBWA 4K8RC 4OLZH 5D1ZC 3GSWA 4P9HL 4CSSA 3F12B 2FZ3A 1TZGH 1KGUA 4UV4L 4GEIA 4U3XA 1YEWA 1WF5A 5I19H 3NZHL 3EADA 3VACA 4AVJA 3POCA 2RHEA 4G1MB 3VJ6B 4F8PA 2ZJSH 5FYJD 2HWZL 1K4DA 4NNPH 5D2LF 4YLCA 4EUPH 2R51A 4DEWA 1DUZB 1R3LA 3VRLF 4AW7A 4EUPG 4LESA 1FFRA 1YN7B 4PGCB 5E6UB 2BY0A 3MJ9H 4KH9A 3TYGH 4PY7B 4ESKA 5HTSA 4IRJA 4NWUH 3P9LA 4WO4C 2VLJA 2VZOA 2YGVA 5FM5M 3UXFA 4RAVA 2FHFA 4H8UA 2ZYHA 1QLEB 3BUIA 4DFHA 3N40P 3D51A 3LHAA 2AC0A 1AG0A 1EIBA 2WZ0A 4QI3A 4U7SA 2YQ2A 4XOEA 2XETA 5D2NE 3JWOC 4OZGF 3FUDA 4U2ZA 2NSQA 3C60A 3SE6A 2Q3AA 3BVNB 3MV7E 1OP3H 3TZVB 4PRPB 4ZX6A 2KLRA 5MERB 2E9WA 4MNGB 3VXUE 3HI5L 4HIPA 4KXCA 3U1PA 1ASOA 4BWWA 5LXGH 3EDEA 4QEGA 2JIXD 4XO5A 5A16A 4F7PA 2AKRB 4FRWA 1WV7T 3Q2LA 1ERNA 1DQLL 1HTYA 4UNTA 4PRIE 1PCSA 1SM3H 1W72H 1SF3A 1JPFA 5H2BA 3VQ2C 3R06B 4RWYH 2EYRB 4IQHA 3VRIA 1EDHA 4EJ1C 5GS2H 1H0DA 2Q7YA 4OLYH 4R6UA 5CU9A 3V0JA 4B27A 1NEUA 2Z35A 2JXMA 2WLYA 5CJQL 5HVHC 4ZX3A 4G43A 5DHVA 3C8KA 2JWYA 3QIWB 5INDB 2D03H 3G6JA 4GRWE 1PNDA 1FGVH 3A4EA 5AAMA 1XT5A 1WBYB 2CDEA 3F58L 4FHBD 3HZYA 1JPTL 2MFNA 2LLLA 4XVTH 2AQQA 1YYML 4KDTC 4N8PA 5ICYA 4Z7QB 2DKUA 2DY2A 3ZO9A 4AUYA 3KPLA 4JFYB 4L3EE 1WH0A 1I31A 3Q01A 5HI4C 4UILH 3CMOH 1KYUA 3QULA 4AUJA 4I0PC 1BJ1J 2QVTA 1E30A 4PBVC 3ASWA 3MJ6A 4XWGH 1UB6B 1XSOA 3BEWA 4C56E 3E9TA 4PUBL 1F58L 4PJ9C 3RGHA 3FQNA 3S37X 2YEQA 1NKRA 5CP3H 3WL9B 2AJ3B 2IPTH 5GIRA 5EO9A 4HT1L 4DTGL 4JL1A 1KGCD 2XWZA 3FFCD 1KXQE 1ZV5A 4X6BB 3K5SA 3NFPA 5F9OH 2HP4A 3SE3A 1FNSH 4ZFOL 5CEYB 3NH7H 3FRPB 1BAGA 1F3DH 2X0WA 1U41A 2WLIA 2XWTB 3K2IA 1EXGA 1XH0A 4E9QA 1E5ZA 4ODSL 4Z3IA 5TDOB 5BS0A 3D06A 5JPNB 2AMGA 1L0XA 3D3VB 4EDXA 4AENA 5B39B 2IGTA 3O41A 2R7EA 3OKEB 5L9DH 1I1AD 32C2A 1TZGL 2EDOA 1OANA 4KROC 1WG3A 4BZ1A 5JDSA 3IXTA 3UYOD 3VWKA 3GI9L 4R9HA 4WI0B 1OOWA 2HT3D 2J8UF 5F21B 4ZUSA 3IGAA 3L7FA 1PEWA 1OSPH 1C7TA 4NNPL 1N67A 4XR8C 1FNFA 3ZYJA 3RWDB 3B34A 3N2JA 1SY6A 1FJ1B 1R3IH 3FN0H 1IJ9A 3DMMA 4H7VA 3QUGA 4NWUL 5CCJA 4PLJD 1HNGA 4BSJA 4NQCB 5GSRA 3QJQB 4WTZA 4FI7A 4QOKD 1A1MB 1RI8A 4Y9GA 3SYPA 3FOLB 4LLUA 3BPOC 2XX1A 4G5ZH 4MBOA 5GRVL 1Z2KA 1HU8A 1YMMD 4LMQE 1EVUA 4LVOB 4N0FB 2NYYC 5DYOB 2XY2A 4GKOA 1CL7H 3F6IA 1B9KA 5EU7C 4DKTA 1WBZB 3GSUB 1TEGA 4HA1A 3CDZB 4LP8A 1CDGA 1NEPA 2RMNA 3L3OC 1KXVA 1NOAA 2PTUA 1QHQA 1UFUA 2XSKA 3ML9A 2CIIB 3QC6X 5A2JH 1Q0YH 3LRGA 1Q9LA 2PYED 3IMVA 3NEOA 4KKAC 3V4PH 1NFIB 1EJOL 5A6IA 1YNTF 3GSOB 2OPCA 1OGAB 3T1FA 3UZEA 3GC3A 4CVXA 2Y24A 2GSGB 2DQIH 1ETB1 2WIIB 2HKFH 1K8IA 1JK8A 1Q9WA 1HILB 1W72L 4ERSH 5IUCA 5MHSE 1KPVB 2ZE0A 4W9CC 1USZA 2WXRA 2XWJB 4A7QA 3ZTEA 3BEVA 1NFDA 2G2RA 2GBUA 2E76C 4OLYL 4NENA 4YE4L 1Y6MR 5CAYB 3HZMB 1F1GA 4JJOA 1G6RH 3JV4A 4AZ8A 3SDAB 1RMFH 2CO3A 1XV8A 1PF3A 4KAQH 1AQHA 2VISA 1J18A 3MNWA 2IXQB 3VXPA 2YUVA 4ZFQA 5I0YA 5H37H 2NDFA 4JO4L 3AQDA 1FGVL 4HIJA 1AO7A 3D08A 1CDUA 2CR0A 4UM8B 4FL4C 1I8KA 4N86A 4YR6B 5DC9B 5D7IB 4TLTA 1MW0A 3O11A 5F9WC 4JZOA 2R1XA 3CCHA 1E4WH 3PHOB 4NC0B 1RURL 2OMXB 2D2OA 2C26A 2X9ZA 4UOJA 4UILL 4KZCA 5B21A 3BZDA 3CMOL 3GJFK 2ENSA 3TA3A 2AERT 5BW7A 4YZFF 3DBXB 2ZYRA 3UJJH 1QOKA 1VFOA 1QSFE 5E6SB 25C8L 3EHBB 3T2QA 2QGBA 2DQ6A 3TO2A 3VXMB 3QORD 1DE4A 3VAEA 1DJHA 5FECB 2A4EA 3QPQC 4XXDB 5AOMA 5LBGA 4IRJC 4G8AC 1PYWB 1PD0A 3VFSB 5L2KA 3SCMB 4DN3L 3VXSE 1ZD6A 3GZPA 4XMPH 1WC7A 1RY7B 3TM6A 1IM3A 1G84A 4FXGB 5F9OL 4RX4D 2X2HA 3RPKA 4ODWB 2YA1A 4CMMA 3ULVH 2QT6A 4XVSL 5CLWA 4ZMPA 4Z7VF 3P0YH 3QZWG 2GI0A 1KUMA 3NH7L 3T0WA 1MI5A 1N4XL 3C60C 1T20B 4P4KA 5E8NA 1KJ2A 3S8WA 1DJGA 1XB3A 4FQJL 4ONGH 1GCYA 4DP9X 5L88H 1HHHA 5L9DL 5HDBF 4WI5A 2BVPA 1S9XB 1NC2D 4L3FA 1QQDA 2P4AB 1O9ZA 3LH9A 1YAZA 3M1BA 5DTFA 2J1YA 2Z4QA 1TYRA 2IDCA 3GMPA 4XCFL 4YBLC 4DWHA 5HYSB 1JV5A 3T0DA 3ULUE 3X1EA 5I6NA 4ZPTA 1XH3A 2P5WB 3QDJE 5FUZH 4DQOL 2OCFD 1U33A 3FN0L 4OZIE 3H7BA 1MH5A 4HISA 2JTYA 2Q5BA 4N8VA 4Z76B 4QJ4B 1TMCB 3DBSA 1ETJA 3X11B 1AXSB 1KFAL 1AQDB 1TZIB 2OTWA 3H1ZA 3MRJA 4UYPA 4WEUD 5IB4B 5JHMA 4UQ2A 5GRZA 1EFQA 4G7QB 4MZ3A 3H4HA 2F1EA 1CFNA 1HQRA 2AJVH 2BSCA 2JB6B 4WFED 2AAAA 2AEPL 3PXHA 5AAMC 3D18B 4GKSA 2X38A 4ZMOA 1IMHC 1P5VB 1VADB 3O9WB 1WJ3A 2PCPB 1A9EB 5E8EB 3QDMB 1IU1A 2VUYA 1FO0B 1ADWA 1JNNH 4WW2A 4NIYE 4Z0XA 3VI4F 3ZZ1A 5F93C 1VKXB 4TQHA 3COOA 4IHBA 1V27A 4PY8I 1U30A 4R3SB 3OR7A 1AGBB 2VDKH 5CD5D 1HOEA 3W0WA 5GS0H 1T21A 5IVNA 3MLUH 3C08L 5I75B 4N2KA 5IOPA 3EYFB 2BNQD 1G94A 1C7SA 3C5JB 1A2YA 2DQIL 4JM2B 2Y2YA 2HKFL 4IKNA 2CO6B 2FEDC 4PVLA 3G5YA 2JB5L 2ZKHL 5DFAA 2A9ML 1H3VA 5I6XC 1U8QB 2X2JA 4NQSA 1QBAA 2F53A 3LDBB 1O6SA 5HYIA 1G0YR 2JCCA 3IBOA 3KPNA 1MHHA 5EC2A 1RMFL 4NNXA 3FFDA 4KAQL 3P0VL 5IQLA 1BMWA 3ESMA 3SE3C 1M71A 4BHUA 5C3IA 1E9QB 3ILEA 2GYSA 4KJQD 3FT3A 2LW3A 5BQ7B 1KB5L 3WEAA 3FQUB 2HVJA 1PSKH 3NOIA 2ENQA 4JFTA 3D85D 1S9WA 3QQXA 5D7JD 4M5ZL 1FG2B 3NQKA 2CBMA 2R23A 1MIEH 3QWNA 5AOZA 2KL6A 4L4TD 1E4WL 4DCQA 3H0TA 2B15A 3SDXA 3RQ3A 1WWCA 4GG6E 3II2A 5FLVA 3O0RL 2G0KA 3V4VB 4FFVD 4NO2B 3ZE1B 1EAPB 3U0PA 1R24A 3O2DA 3VWKC 3P73A 4EOWL 4LEOA 4MHHI 1XAUA 4OV5A 4JE4B 1ECZA 1HKLH 2V2WA 4WSKA 3NSDA 4L23A 5E2UL 4YSDA 2N1TE 3NJVA 5DRWB 1BJ8A 1I7ZA 2KZ1B 1AQ8A 2V3FA 3DMMC 3WFHB 4JLRA 2RB8A 4JFED 4J1UB 5ID1A 1WUZA 3ZZLA 5HD8C 1TFPA 2CLRB 4PJIF 3PV6A 1DYZA 2WXIA 4GO8A 1YMMA 2IDQA 3IE9A 3P0YL 1LP9B 5ERWB 1OTUC 2MHAB 1B2WH 1MREL 2NY6C 2VMFA 4XPBH 3KLHC 5PAZA 1DJZA 3OLDA 2PCFA 4GSQA 3WYRA 4NKIL 3TN0A 3ATDA 1RVFL 1V3JA 1KXVC 1SHMA 3SPCA 5L88L 1HHKA 5DXWA 2AEIT 4GBXB 5D9SB 1T1XB 1H8LA 5E6IB 5C0AE 3A5VA 3BHBB 4J23A 5B1AB 1DVSA 1KY7A 3QWQB 3R4DA 4Y1SA 3UTPD 3UZEC 2AK4E 2FH6A 3TA4D 1ILSA 1IAKB 8FABA 3CXHJ 4DF9A 4P5TA 5FUZL 4ENED 1NICA 1B88A 9PCYA 2NSMA 4BFOA 5EULV 1U8MA 4J8RB 4AIEA 4NSKA 2HLFD 1ZA3B 3M86A 5I66B 4FEMA 4NJ9H 5KS9B 1VPOL 1OF2B 1MCLA 3I9GL 3QJFA 3IB4A 5DUMH 1GIGH 3V4UH 3EOBA 5I18H 1WZAA 4G42A 1BEXA 4N0CD 1JGVH 4WFHE 5T5NG 5T33L 5D1QE 1BOYA 1UZ6F 5T1JA 3BPNC 4LVNC 2KI6A 3GDBA 4CDGC 3JWNH 4QRUB 1RJYA 4OI8A 2EH7H 3ARVA 5FGBA 3IKKA 1GC1L 4KMTH 4KRLB 2H3KA 1JNNL 4KO7A 4PRBB 1IEBA 1MW3A 4I3RL 3ZDYE 3TA3C 5BW7C 2VDKL 2AQ1A 5CLYA 3QORA 3UGEA 3F7VB 1K5NB 1CFMA 4M5YH 5T5FH 2NRDA 5KTEL 3JTTA 3PWPE 4WNQA 1LL1A 4K55A 1T4WA 1ZVHA 4RMQA 4Y0GA 5EIIG 5FIEA 1HQ4B 2QVFB 2B5IB 4TQEL 3PL6B 3CDYA 4MS8C 3C09B 3MMEB 5CFAA 4LEEA 2E3VA 2YXMA 5JQ6L 1G7PA 3MUHL 2NOYA 3S98A 4BWUA 2VXSH 4MKMA 4FQHA 5EZJB 4G6MH 4P4KC 5IQ9B 3CSPA 1BJ1H 4YXKL 3U0WH 4OJYA 3H9SB 3QI9A 3NTCH 2G30A 4GP4B 4N2FA 4UAHA 4J3OF 2NW2B 4X6EA 2MWCA 3C12A 1GOFA 4TVPH 4FNRA 4LHUG 3GK8H 3QUKA 2J7LA 2B2XH 3QR0A 1FZKA 3ILQC 5DJDA 3RWEB 1T4KA 2EYSB 4YDIH 3KHQA 3LKPA 2WXPA 1G7QB 5HDOA 1MCHA 1D9KA 1JGLH 3NRFA 4FJYA 4BFIA 3B1UA 1HKLL 5CIPH 3QJUB 5D2LA 1EO7A 2GJZA 4JRXE 1JK9B 3D0AA 5F72S 5AD0A 4K94L 1B3IA 2ICWB 3QEHA 1S7UB 1YY9C 4ZSOA 5GGTH 3FYEB 4LSTH 2VQUA 4F5CE 3BT0A 3LN4B 4N4YB 3NJIA 5ESQB 3SQRA 1MPAH 1SVCP 5FGCB 3PWNB 5AYQA 5JORB 2QGCA 3QQ4B 1INDH 3QNFA 4N8CH 3KWUA 2H41A 2VR3A 3LEVH 2F19L 2R4SL 3NK4A 1B2WL 5L6YL 1VFAB 2WBXA 4XPBL 4UIMB 1MCWW 3PQYD 4EN2A 1T1ZB 4OCYH 2V9RA 4DO5A 3L7EB 1SN2A 5LN4A 4WW2C 2H0EA 4X0KB 5FM4A 4DFIA 1MHEA 1DDHA 3I75A 4P2YA 3GMRA 1PDKA 3L9EA 1JZEA 1MWAA 3CJJA 5HVGB 1SOQA 2KZWA 3L5XH 3JTSA 4KU1A 1P5UB 4FG2A 5D2NB 4AY0A 3ETBF 3ZSTA 2UYLA 4YGVA 2MOVA 3FT2A 3O4OC 3N6YA 2Z65C 1OCZB 1RIHL 2I5YL 2HB0A 2DW5A 2DB8A 3EF4A 4MA7H 3MV7B 1PZ2A 4NQDD 4P9MH 5DRNB 3W39A 4AL8H 4CU8A 4YDVB 5KSBE 5KYWA 3IDJA 1W8OA 2YMTA 3HE6B 1H5BA 4N25A 4PJGE 4NJ9L 3U6XS 5I8CA 1RFDH 4HHAA 4CMHB 4X6FB 4W4NA 4Z0BL 5FEBA 1A65A 1WA2X 3GZQA 5MEPA 4Z3HA 5C0DB 2BRRL 4GW1B 3V0IA 5A2AA 4HBCL 2RQEA 4YBQD 3X3FH 2DYPA 4PRIB 1X7QB 3D0VA 4X5XA 1OTSD 5GSVB 2IADA 5K59F 1MCOL 2WBJD 3L3DB 4A6YL 4OD3H 2D3LA 5DUBB 4X5LA 2GFBB 5I74B 1HZKA 3QQNA 1F41A 2Y1ZA 2EEXA 3CU1A 1A25A 2AJUL 3GFUA 3BP4B 3O45B 3PFQA 3LN5A 1FNAA 3CLWA 4M5YL 4NT6A 4AQAA 4UAOB 5T5FL 5C09A 3FB8B 4GRWB 3PWLB 3DVFA 3LIZA 1WBXA 2YSSB 2ADFL 5HGAB 1TQBB 1UWGL 3LXAA 5DJ2A 2YJLA 3AB0B 4JFEA 4E5XG 3P1VA 4JK0D 1JZGA 2ARJQ 2RH0A 2BCKB 5AWNH 4UIKH 1X6LA 3IGUA 1OCWH 5A2KH 1AC0A 4HJEA 4B6ZA 1HJCA 1JZ5A 4PGJA 4L3EB 1CN4A 1ZT1B 2K3HA 5AB2A 3D30A 1T5WA 3OG6B 1A7NH 3QK0A 3WHE0 1QVOB 4MQTB 4MB1A 4GLRH 5T3ZL 3IDMB 5F3FA 1MFVA 5IQNA 1AGFA 3DIVA 1GGUA 3FT1A 3MVSA 1REIA 2CBTA 5C0CA 4KQ0A 1Z3GL 4C56B 1NUNB 3U0WL 4K7PH 3C9NB 4J3XA 5I1HL 7CGTA 3QS3A 4CJ0A 3TN0C 4X8CA 5F7FA 4Y2DB 3ABLB 2DDQL 1C16A 3VTTA 3TO4C 3KS0H 2OJEB 2LTQB 2H6UA 3GK8L 4TULH 3SJVD 4PY8J 2P5EB 3V6ZA 5DO2C 1WISA 1SZNA 1EHNA 1XX9C 2DM3A 2YN3A 4FFYA 1BHGA 2Z9TA 1MEXL 1LTXA 4CBPA 5CUSH 4DO6A 4KNTA 5INCB 2KQNA 2OZNA 3UBFA 2J8UA 3KPQB 3OV6A 5EUKB 4P5TC 3EGXA 1P6FA 4RQQA 3OZLA 1CWVA 3KPRB 1KGJA 4YHOH 2J56A 3RILA 2GY7B 4QTIH 1CTOA 3KPOB 5DA0B 4G9FD 4JY5L 1J7VR 1Y1UA 3E6HA 1BXUA 1G0DA 1Y0LA 3IVKA 3GYRA 5HDQH 4ZDHB 1I9JL 1AZVA 4FX5A 4Y4HA 5D5MF 4AW4A 1KV3A 1MLCA 3HPJB 1N8ZB 2BXZA 2W9EH 1INDL 1FNLA 3G7TA 1BQLH 3REWB 1NFKA 2AV1B 4JANB 3LH8A 4NNYB 1ASPA 5CJ8A 4NUMA 1XF5B 2E75C 1S7QB 3VI3B 4BFFA 3TBTA 3DVGA 5FGBC 1LEIB 2YPLD 1KEMH 4OCYL 2QQKL 3GNML 1BQHB 1QPPA 3MLTB 4AIXA 4Q52A 4P59H 3AS3A 4HZ1A 2C1PB 1Z9SB 2FEEI 2EDKA 4DW2H 5BRZB 3NFNB 5EO1B 3U36B 4L18A 3QJHA 1D2PA 2MKLC 4HUNB 1YNTA 4KK8C 3Q44A 3VX0A 2X4PA 4C47A 4G8GE 1T3FB 4MNQD 4PTTA 2FQFA 4ZW7A 2NMSA 3RPIA 2B20A 3EO0A 1JE6A 1SUHA 3EBAA 4GI8A 4P9ML 3KZ8A 5JHDE 1OOAA 2BIOA 3FW6A 1DCLA 4RIRB 3FQXB 1UURA 1RFDL 2B1HL 1DVYA 1JAEA 4PP2B 3CVHL 5FFLA 4MAUL 4MDIA 1DVZA 3UZQA 1OAXH 4XP1H 3X3FL 5F7UA 2J2ZA 3MJ8B 3QI9C 5LN8A 4UT7H 5ISZE 3WO3B 3ARBD 3MRHB 1RD6A 3UG4A 2VW6A 1JOIA 3H9ZA 4OD3L 4B41A 4ZW5A 3HI1B 1NBZA 1B0RA 2NTSP 4OFYA 1UGKA 2OSYA 3V0VB 4XVJL 1AP2A 1FN4B 3FMGH 1T1YB 2YD6A 1D9KC 4HJIA 4U4BA 1QHOA 5FYJL 2CIKA 2OM5A 1MVYA 2RJMA 1OGTB 2OSLB 2QKIA 5ITFA 2QLYA 1A6UH 3MLRH 2HYMA 1IJNA 5IEHA 3QNXB 3EYVA 4JRYA 4H0IA 4Z3GA 4Z7OE 1BP3B 2R4RL 5I1IH 2A9NL 5SWQB 2FBRA 4H8QA 1ZLUK 4KMLB 5AWNL 4IKIA 2VABA 2XTJD 4XNQA 4KI5C 5DEGA 5JA9A 2VDNL 2A6IB 3MJ9A 1A7NL 4YSTA 5J56B 1FRGH 1QSFB 3ZL2A 2IAMB 2FJFB 2C7UB 4Z7VA 2B77A 3PQYA 3AUVA 4K7PL 3KEDA 4HXBH 2P52A 4RSVA 4KNUA 4YUEH 3QIBD 3SDCD 3NIFE 5EU7E 3TU6A 1H3XA 3HUJE 5CJXA 5K5YA 1JNHA 3BPLC 5T3XD 3K46A 1DQDL 1MAKA 3V6FA 4N2LA 3VXSB 5IBLC 4NQTA 3NACL 4J3OD 1MJJB 4B9FA 1SJXA 2RR3A 3HB3B 4MMZB 3TJHC 2FYYB 4MSWB 3LAFA 5LNEA 3UBGA 4F15B 3I9AA 5TGBB 4XNXH 4F9PA 1XGPA 5C0FB 3LZFH 3S5LG 5CUSL 1OQOA 1S7RA 4TM9A 2Y23A 5F89A 4FLSA 4LCIH 3RWFB 4PWGA 3V9CA 5F96L 4M8UA 4YHOL 4QTIL 4PBWD 3GPSA 4Q56A 4AYFB 3O3AA 2DQMA 1G7LB 2MTAA 2N4IA 5AVZB 5KYYB 3ECVA 1H5BC 1NCUA 1J48A 4LDOB 4NLAA 2WP3T 3C5ZD 4M6MH 1MCDA 3HJ0A 2DTML 1N59A 3BZ5A 5IVXE 5FO7A 5IFHH 4NERA 5MEND 3FTWA 4AXWA 1QA9A 1DN0B 1AYOA 2W9EL 5T1LD 3VXOA 2DBLL 4P2AA 3SOTA 2J21A 4UOW1 3Q48A 2ZF9A 4QRPB 1M2OA 4DAGH 2V17H 2WBJA 1I7UB 2AXHA 4QHUA 4DK6A 3LQAH 4HGMA 4LZKA 4AEHH 3VI4A 3WBDA 3OF6A 1T83A 5DZJA 5LXVA 2JNZA 3QUXD 6PCYA 3TGXA 5CWSA 1FAIL 3ZX1A 3O6FA 3LPGA 1KLGB 4K5MA 3DGGA 4IBVA 3S3CB 3H2PA 3ZKSD 4R7NA 4OJFL 1LD9A 2Y3AA 1CD1A 1U8PA 3QNZA 2BHFA 1ZDQA 2VIRB 3UTSA 2EE3A 3DO7B 1XCXA 1FDLH 5AL8A 2JK5B 4JE0A 4F92B 4UQAA 3ZE0B 2VLJE 1HSBB 1HWWA 3BH9A 2ZG3A 1N5AB 3AT9A 3TASA 5KSVA 2IH3B 2CBQA 4L0PB 3ZT7A 4PRAB 2IQ9H 3DRQB 3N43F 5I30H 3QXAA 4WI4A 2AJYH 4H8WC 4MXVF 1Q94A 1T7YA 3T9WA 3BUQA 2JKLA 1HHIB 1Z3RA 2D73A 1A4AA 2VLKD 1OAXL 1RUQH 3GSRA 3MLZH 4G1EB 4XP1L 2EDQA 2XZCH 4O02H 2LVEA 4JPWH 4UT7L 3GRBA 3TTYA 4Y4FD 2ZX5A 4UZSA 3WIFB 2A73B 3U7AA 3S88H 4TNEA 4OFKA 4YE0A 4NQUA 2E5EA 2XUWA 3VSUA 5J1TC 1O9WA 1QBLH 4DK5A 1ND0B 1FZJB 4TRPH 4QTHB 4E9YA 1J11A 5BVJA 4AK1A 3PP3H 5IVOA 4XMTA 4E9RA 4AE0A 4AV4A 1OK8A 3RFRA 5J12C 4EXPX 3AC0A 1BZ7B 3MLRL 2DLEA 4OAWA 4HG4J 5HHME 3NGBC 3L95A 5LAPA 2P45B 4PGDB 3GZOA 2GJ6A 2YC1A 4DP1X 4Q2ZA 4FCHA 1R9FA 3VTAA 3IXAA 5EORH 5ACLA 2NZIA 4Y4HC 2XIBA 3VFTB 4POUB 3FZUC 3C75A 4JCWA 1PVHA 3VNZA 4G7YL 1BXAA 1UWEL 2QSCH 2JE8A 5DD6B 3L2MA 3G6JE 5E8OA 2P3YA 1BFVL 2AW2A 5ADOH 4YHNB 4YUEL 3TF7C 3L16A 4P5MB 4BDVA 3C6LB 3SKMB 1X5GA 2V2TA 1S9KC 1OXYA 4ODBD 4ZUWA 4JDTH 2VDLB 1TUPA 1GKOA 3QXVA 4U1SB 1I3GH 1A22B 4CA4A 3SKOA 1I3VA 5EG6C 4E42A 1A9BA 2F54B 4FZEH 5IMLB 3DGCR 1BBJB 2NCMA 5DJZB 3CDGB 4OZHA 4P23A 2I07A 1TXKA 4JFVA 4QT5B 1MRCH 1E8YA 3RNQA 3V9EA 4AH2A 3TC9A 2W94A 3ARDD 3QRBA 3V4PA 5FKPB 2BSSA 2H1PH 2AITA 3BO8B 1UADC 1MY7A 1ZA6B 4L8SA 1BVKA 2YSTA 1L3WA 4PYHA 4ZNEA 4M61B 4JO3H 2F8IA 2L0DA 3K8LA 4N8UA 5JDJA 2DWYA 3BDBA 4XO9A 4XXWA 4L3AA 2XWXA 4ACTA 4K3JL 3WHXB 1BZEA 5F3BA 4G6AC 2IOMA 2X2YA 1SXBA 2AQSA 1E4JA 1G6RA 1FYTA 2XPYA 1JWUA 1XSKA 3B3IB 5GXBB 1A4JA 2XACC 5E70A 2XX0A 3QISA 5FO8A 3ARBA 4DAGL 2ZZUT 3T0AA 5I5JA 5BS0E 4Z6AT 2VDQL 1DQJA 3LQAL 5H37A 3LKRA 3RVWC 5M7QA 1FH5H 4WWKB 4ZXBD 2HUHA 3HRZA 4PJCF 4UUJB 3VGBA 1CFQB 4Y5XB 2JKJA 4ZTEA 2C34A 5HGHA 4ZFOB 3RL1A 4MD5A 5ESAA 5H4ZA 4KK5D 1F90L 3BP7B 1KLUA 3D5OF 2F18A 3LJ3A 3GXDA 3AWFA 2FT7A 1DBKL 2QKIC 3S8FB 5BZDA 1QLFA 3FCTA 4ZTPH 1TLKA 1AKJB 2IO5A 2Z31A 3L8QA 4OH2A 4QXGH 3N42F 3RX8A 2HFFA 2IWFA 2CM6A 1ORQA 3IJ7A 4M1DH 3U7YL 1VFBA 1NGWA 4LRNL 1ZGLB 1E40A 1I1RA 1PPIA 3ZDYB 2BP0A 1D6EB 4ZOCA 4MJ6B 3MRNA 5EBWA 2N59A 2Z7ZA 2DWXA 2IQ9L 2NX5D 4QO1A 5KJ4A 4EUPB 5I30L 1ES0B 3LSOA 1OHZA 1IC7H 4JKLA 5I6OA 5PCYA 3SDCA 2D2CC 1NCNA 4EIZC 1MQ8A 3QZWA 4KPHL 4W70A 1BVNT 2B39A 2ORBH 4TQPA 3T3PE 1TVBA 5CJXC 1BSIA 3ZKXC 1AR1C 5F7EH 1O7VA 2O5YH 1Q1JL 2OMYA 3P9MA 2V5SA 3T6XA 4NQVA 2MOGA 3V5DA 4Z7WB 5KG9B 2DLGA 3NJLA 1AQMA 4KK9C 4KO5A 3BZFB 5I2IA 3SYAA 1ODAA 4TN9A 5E8DL 4F9PC 2MCG1 2YPVH 2ZOUA 3GI8L 4PR5B 1TJHH 2QFRA 2CMRH 1QBLL 2OYMA 2WN3A 4S1SH 4TRPL 4BUGA 5CZVH 1HSAA 3EDJA 1G7JB 2ALWA 1T6BX 3AU1B 2NR6A 5GRWA 1H6EA 5E2VL 2K3TA 4P46A 2WVTA 3TPUA 3O0LA 3IU4H 4XMVA 2E7CA 3MRBB 3D52A 3W11C 1F56A 3L6FA 4MS6A 1D5MB 4MA8L 2RTTA 4F8QA 3Q6GH 3HZVA 1PCXA 1AGEA 2Z93B 4CADA 1NGXB 1SXCA 1W72B 2NY4D 3QC5X 2JF1A 4DIXA 2JJUA 4JRXB 2HT4D 2FX7L 1ETA1 2WBJC 1RK1B 4KQ4L 3TV3L 4YSUA 1JXDA 5KVEH 5HJGA 4PG2A 1RUPH 3FU8A 5D4JA 3CQQA 4JDTL 1OEZW 1T83C 1FL6B 3MXWH 3MA9H 4QXVA 1R75A 1U4EA 3O6FC 5FYJE 4OSUH 4KHXL 3ESVF 3E3QC 1GGBH 3QPXL 4WI2A 4Y16D 1MRCL 2CHXA 4BA8A 1I9RL 1CT8B 4LARL 4FABH 5I6KA 1QO3A 3BIKB 3HBZA 1RPUA 2V3DA 3IJ8A 5D7LB 4GKLA 4OVUA 5GPRA 5L2KE 3E9UA 4HAKA 1UOVA 4JO3L 5MI0B 3R7QA 2EDYA 3QRFM 3NBNA 4BSVB 2G3MA 3D1MC 4KBPA 3HHSA 4MVBC 5ALBH 2VO8A 2J57A 3BVVA 4HEPG 1F4XH 3RX9A 2XWBB 2ADGB 3D4CA 1MI5E 5ITBH 4CL7A 3LMJL 2MNJB 3DSFL 4HKJB 4Y5YB 5KSBB 3GSVB 4LT7A 5ICZB 2NNCA 1MUJA 1K8DB 4JPIA 4KJPD 5AVSB 4A2MA 4IYKA 3M1OA 4XNDA 3BE1H 3NJGA 5I16B 4YHIA 2HAZA 4X8JA 3F7LA 3OKLA 2HVKB 2WVSA 5JIMA 2K8MA 4MA1C 12E8H 3CFJB 5DK0B 1DQVA 2IPKB 4DP0X 4LK4A 3CFNA 4OCRH 4MCYB 3CPUA 3PAVA 1MCPL 3ARXA 2C1OB 3UAEA 4RBPH 3HRPA 2W07A 3HKZA 4FMVA 4J3BA 4DN4L 4XC1L 4FQ1H 1N10A 5GZOD 1FYHB 5FM8A 4UQCA 1KBKA 1IC7L 5J13C 4FTVA 1O75A 4GAJH 3TVMC 1YEHH 4PS7A 5HYJA 3NDYE 5MP6H 1TJGL 2ORBL 1Q38A 2I9LA 1RIVH 3KPMB 5IW1B 1XD0A 4FD0A 1M3IA 2DQCH 4GW4A 3AQZA 4WCYH 3P2DA 1G0XA 1ETZA 4P3WA 3W0WE 1TJHL 1XGQA 2CMRL 4P23C 2D3NA 4S1SL 1AS7A 1AZRA 4PVBA 4Z7NE 3QUYD 3WNOA 1EBAA 4QY8B 4NS0A 1S5HB 4G8IA 5CZVL 4UTAH 2EIEA 5F6HI 4NQQA 3GIVB 5E4OA 1UCBL 1AD9A 1CGVA 1KGCE 1UQSB 1QRND 3IU4L 4LNRB 2F53E 1OB0A 4UQEA 1GR7A 2XICA 2JCCE 4KKBD 3M7FB 2EUWA 4XXWC 2XG5A 4KTEH 1KIRB 1MIML 1OAJA 3SPHA 1IKOP 1ML0A 4RDQF 4Q8BA 2EJ1A 5D5MA 2ZP8A 5DWPA 2R15A 5AB9A 4U6YA 1OARL 5IKCB 3SGDI 2WZ6A 1GYCA 3CFUA 5IHZB 1B4JL 1QYGH 2AQPA 2XDHA 2XN0A 1MW2A 5K9JH 4D9LL 3AADB 4H5SB 2O61B 5KVEL 3QEUA 4ZXBA 2BY2A 4NX0A 1EVTC 3UC0L 2HLAA 3HRZC 4GAYB 2GSMB 3U30C 4WTQA 3SDXE 3VFOA 3FTGB 2G5BA 5EB9A 1DUYA 1ZOXA 1KB5B 2FBOJ 1OCOB 3JUYA 4N28A 3GSQB 3ZY7A 5AEAA 4XPHH 2XN2A 4AMKL 3MRIB 3QFJA 3UBHA 1QR4A 2UZXA 4XNZB 1GZHA 3OMIB 1L6ZA 3GTTA 2Z31C 5EDXA 2P8MA 2EIDA 4OKVA 3W37A 2ZOOA 4FQXB 1JYVA 4R7LA 1PLAA 5DD3L 4QOKE 2WXNA 2W81C 2XKNB 2BOCA 2VITB 4L29A 2W88A 2NX5A 1L6XA 3MFFA 1JPGA 1GH7A 2HFGH 1YMME 1NUDA 5ALBL 5K9KA 2X2IA 3JYBA 2A6KA 4MCNA 1A47A 4BINA 4G8GB 4TUOA 1NANI 2DLFL 1FV1A 3FULA 2FL5A 4JFFD 3KG5A 4KNQA 3PGCA 3Q13A 2MQ3A 5DA4A 5JHDB 5T1KD 5H94A 4N0YH 5CJOH 2WXLA 5DLMH 4LKCB 5F9AC 4KVCH 3EJZC 1KB9J 4NGHL 5AZ2H 3QYMA 2ITDB 2YQ3A 1C5CL 4LHUA 1B90A 3FO1B 4QHMB 3T71A 3TH4T 3V7AG 3UTTD 2NR6C 4KRNA 2O5ZL 4P46C 5ISZB 4NOBA 2CUMA 2EIKB 3B3BA 4ZFFA 3WTUA 2XVGA 4Y1AB 3G5XA 1BOGB 1NBVL 2X6BA 2JKXA 5IJDC 2IV9A 2QPUA 2W0PA 1XD1A 1L9OA 4FQ1L 1GSKA 2NY2C 5GGTA 4NUGH 2AS5M 3DDGA 2YIHA 3MOAH 4XHQA 3P3YA 3L3GB 5IMOB 3B5GA 1EAJA 2O93L 3SPJA 1FFPA 5IF0A 4KKRA 2C9UA 2BP5M 2VR7A 2Y06H 1PD1A 4JFOA 4PG2C 5MP6L 5IUSA 3NJFA 1YUHA 1RIVL 3L4ZA 3TBSB 3AG2B 5KOVC 1R5WB 1UM6H 2DJSA 1D7CA 2X4SB 1J0JA 4CW1B 2OMWB 1IM9D 4WCYL 4BRVA 2FCBA 2KERA 5DFTA 1RZKH 5HHPB 4F57H 4J7RA 1IGFL 4LSSH 3FB7A 4M43H 1DVFA 1XF3B 3GHEH 1UH4A 4JFDA 4PJEF 1FFNB 3LEYL 1TYEB 3MHZA 4AGMA 4OLEA 5GS0C 1EV2E 3MJ7A 1TNMA 3KYNA 3NIFB 3HC2A 3HUJB 4U1NB 2IAAC 5E6YA 3WNKA 1JVLA 2ETWA 2C4FT 5HDRA 1A14L 1W0VA 3O8XD 4PHXA 1XBRA 4L37B 2ALAA 1KWGA 4HUWA 5A40E 3CFEB 1JWMB 4TNWF 2CXGA 3O6KH 2WC7A 4YHKH 3TONA 4F2FA 1RHFA 2AJSL 4P3DB 1Y18B 3H6JA 3KVDD 2XWDA 5K9JL 1GHFH 2E4FA 4XC3H 4YC2B 4YLBA 3S8GB 2Y25A 4EIGB 4G8FB 4M6OH 5I17A 3CZUB 4XGZB 1J05A 1GY1A 1BF8A 2WWNA 2ZPKL 4X9FA 3UBXA 4S1RL 2VM9A 1EFXA 5G5DA 2DL9A 1IQWH 5IVXB 3L4TA 4XWOD 2YK1H 4K15A 5I28A 2PMZA 3LB6D 4ONHB 4Q4IA 3EOAA 4QRQA 2CJSA 2ZKXA 5HI5D 3TF4A 4RGMB 2JKSA 1FE8H 2J8OA 2IFGA 1QNZH 5D2LE 2E56A 3VRLE 3NJMA 4KJWC 3PREA 2WV3A 5C0GB 2AHIA 3TBWB 4CVUA 4ZSOE 1U8OA 2VDOL 1UOWA 3FU7B 4AEFA 3FQRB 1S7SB 2R69A 1SLVA 3SE8L 4M48H 4WFEE 1TVDA 2HFGL 3VCLA 5CEZH 2C9PA 3BRDA 5EWIH 3NPSB 4Y19D 4BEIA 3BSZA 4JB9H 5G4NA 5EEXA 1A6TA 2BO0A 3IF1B 2XV6B 1MRDL 1E5UI 2ZG1A 3FQ2A 4XT1C 2P7TA 1QP1A 4WUUB 4GUPB 3WTWA 2WYHA 2M83A 3K2UH 4QF1B 2APTA 3OMNB 1A3RH 5DLML 5T3XH 3ZO0A 1JPSH 4MXWL 4PIRF 1KTJA 4NB7A 4B9CA 4AQEB 3BVWA 1IGJB 4EQ3A 3VH8A 3IFOB 2IANA 4YWGH 4M6NL 1OCCB 1YEKH 1FZMB 2L04A 2YMXH 1RZGB 2QBWA 2VUOA 3BI9X 3WNIA 4LQFL 4BXSV 1YQVH 3C60B 3OJMB 1PZ5B 3HG4A 4HOXA 3L9RB 3TNNB 1GZQA 4FXTA 5DJCA 1ZY9A 1F11B 2QFPA 5DJ6B 3FB5B 5E2WH 2UUDH 5DRXB 4TPRL 2YWZA 1NMCC 2W80C 1Z5LB 4KRPD 1BECA 4NKOB 1JJUA 3WFCH 3GMOA 4L3CA 1DLHB 1S7XB 3G5WA 1EANA 3MV11 3KYOB 5D70H 1U9KA 4NUGL 1KOAA 4JEGB 3QZOA 3H42L 4HIXH 3AXIA 4EQ2A 2IDSA 3CFCH 4PI0A 3L48A 4APXB 4NP9A 4PJXF 4W9JC 3BXNB 3DUUB 4U0RB 3RX7A 5EFIA 4BKTC 3RTQD 1WZ1L 1M9WA 4F33B 2UXGA 5IEKA 3STLA 4P2RB 3JWNC 2ZG2A 2IBZY 1F6FB 1UM6L 4GAAA 5IFJA 4H25B 4RMVA 1G9NL 4F57L 1RZKL 4NM8H 3C8KB 5LG1A 2UWEA 4HWZB 2CGRH 4M43L 4MA3B 3CK0L 3GHEL 1MHCB 3TIDA 5C09E 1D7FA 2K4WA 1GZHC 4M3HA 4X4MA 4AQ1A 4GRLD 2CDEB 4MMYA 4QJ3B 1N3NB 1ZGLP 4A6YB 2GBTA 3SKNA 5JYMA 1XZ0B 3FSVA 4JFEE 4R2GB 5HDLA 3PIQB 5IP4A 3O3DB 3VRJA 2YZ8A 3I85A 2OMTA 3IJHA 3T6VA 5IIEB 4HKXB 5F88A 5AG9A 5DSCB 2J5LB 3T2NH 5EIIB 3QULB 5DHYA 4IBSA 1M1SA 3L5IA 5C0CE 4MRCA 3BEWB 3NVQA 4FKKA 4GS7B 4PJ8B 1E65A 4LCWA 4JPSA 1GHFL 1TSRA 5E2TL 1Z32X 1LGVA 5E9DA 3WTTA 4MAYB 4M6OL 2QZ5A 4J3TA 3DA0A 1EEQA 4G6FD 2QQNH 4PJ7F 1L0PA 3QQ3A 4QRRD 1KACB 5DMKB 1I53A 5E7BA 1CJYA 4DEUA 4PCKA 3JV5A 4PJCA 4RESB 4Y88A 3BW9A 3UTPE 2Y5QA 1TJXA 3HE7D 2YK1L 2NXYD 2K78A 3N55A 1SJEA 5J3HC 1M57B 1QUPA 2J8UE 1FE8L 1IGCH 5JLZA 1IC5L 2D9QB 1QNZL 2OCJA 4PWKA 5E1AA 5F6HJ 1JWSA 4LLYB 4C4BA 4ZD3H 1ZEAL 1KIQB 3Q1SL 4Z77A 4NO5A 3MBXL 2C3VB 2YS4A 5IB3A 3L4UA 5K9QG 3K2KA 2BNRD 1OD9A 4MWFB 1KTLA 3QH3B 1USQA 3IXTB 3WSQH 4NPKA 4WDIB 1XWVA 5IJBC 5EWIL 4G59C 4TNWK 4X98A 4Q6KA 3ZQWA 4NYLB 1FFQA 5T1MB 1UA3A 4X5QA 4U1MA 4EVNB 1KFGA 1PKQA 1QX1A 1VZGA 1MFAH 2X89A 3P77B 5T1DL 3UAJA 3VGHA 2BHYA 4KKCD 5SX5H 4Z8FL 1FORH 1M6OA 1S6NA 3ZKQD 5T3XL 4AM0A 3K6SA 3BGAA 1JPSL 2N01B 1IL1B 2DYSB 4I0CC 1NCIA 1NEZA 1TITA 2ZWYA 1N6QH 4W6YB 1ZIAA 2DYRB 2YMXL 1DVFC 5GQBA 3S3PA 2ATPA 3GXMA 1TTBA 3NJKA 1QI3A 1YQVL 2VN5A 2PABA 1J10A 3MO1A 3MV8D 5GRUH 4B9IA 3S5LA 4I2XE 3WFBH 5FB8B 4J2XA 3I6SA 2PXYA 3QYCA 3O8XA 5E1IA 3KLQA 3O2WH 1NDMB 5E2WL 3SB3A 3GMNB 2Y6SC 4AL8C 3WFCL 5GGQH 3BUBA 2DH2A 2VYRE 5ABDE 2UY7A 3N44B 3B2DC 4M7JH 1AZZC 2IH1B 2AVGA 2XQBH 3T1FB 2C5DC 3LKSB 4NQEA 3MYJA 3NCBB 2XXFA 1IRAY 1UACL 5GGRB 2GHZA 3CFCL 3N3EA 2IF7A 1DL7L 3ZYOA 4NFCA 4X4XB 2XG4B 4P4RB 2EDXA 2VLRD 5KVGH 4IIQA 1NIDA 2YJQA 3CNKA 3HG0A 4OLVH 4EPSA 3LZNA 4LLDB 3V0WL 1BWWA 3CVHB 1NBYA 3JV4B 1CF1A 2F8XC 1DQMH 1J1XH 3OB0H 4RRPG 5ACZB 4ONFH 3B9AA 4OCWH 3U46A 5C8JB 4NDMA 3ZOAA 4E41D 1KULA 2CGRL 4FNLL 1IQDA 4DGUA 3MNWB 3PPEA 2FATL 4IJTA 4YZFE 2A83A 1E3XA 1MQKH 4HIJB 3MBED 3JBG7 2B14A 4X7SH 4XP6H 1FBIH 3MLSH 4D0DB 3EYQC 5CGBA 3RWIB 1GMEA 1L9RA 1RUAH 3O11B 4FLHA 4GSXA 2H45A 1A5FH 3A4DA 2RD0A 4JZOB 2LR4A 1JTPA 5F0PB 5C92A 3CH1A 1RZ7H 2R2EB 3T4YA 4O2CB 4KXAA 1GSMA 4CNIA 3IDIA 3LNDA 3WUWG 2E6PA 2XA8H 4Y19A 3T2NL 1J8SA 2OI9C 4YPGA 5SWSD 4LSPH 1GY2A 3D25A 1XGRA 4Z7VE 1YEEH 4E5XB 1I82A 2Z92B 1KN4L 5DQJB 3PQYE 3H3PL 3TBCA 4EEEA 2X1QA 3CBRA 2YAFA 4W9HC 5MEOB 3OAZK 2DQUH 3WN5A 3KPTA 3O4LB 1OY3B 2VDNB 1JPST 2DWSA 1F6LL 3EJPA 1V7NL 4XI5D 4O02A 5DEZA 4W9LC 4GKNA 5HDBE 2QDWA 4QHLB 1JSYA 1GZPB 3HCVA 2X4QB 2YAHA 4HSAC 4U0QB 5CCKH 1IGCL 5ANMA 3QQ9C 1TF4A 3EBGA 3O3UN 4JHVA 5E8NB 3X14A 15C8H 3DARA 5BVPH 1P7KA 1CR9L 1HCVA 1B4TA 4N87A 2V7NA 1ONQA 3SBRA 3MYZA 1RZIA 2BZCA 2BSTB 2PW1B 1T1WB 1LNUB 4I3SL 2JIXB 3ML8A 4PJBF 3UP6A 3V5KA 3TX4A 2GTQA 5JW3H 3SDYH 1JRHI 1AD0B 1XTLA 1UWYA 1TQUA 3AXLB 5ICXA 3QZMA 1SOSA 3GJEB 1RZ8A 2AANA 3A24A 3KPSD 1G7IB 3S3DB 4DUXA 2BS8A 1RULL 3H7BB 3QDGA 4IGBD 1TIUA 1MH5B 2CXKA 4OZ4A 3SHSA 1MFDL 3VI4E 1AVAA 5B8CA 1T5XA 4HJ1A 1IEAB 1VESA 4PRHD 2HTKD 2ICWI 2XN9A 1N6QL 3V2AR 1F3JA 4UQ2B 1HWHB 3QEQD 5DVPA 3IDYC 3E3QE 2YA2A 2FDBP 1KEGL 1R3HA 4A2GA 1JV2B 1XO8A 5B38G 4AQ1C 3UTSE 3BWSA 3WFBL 4TL4A 1TVHA 2ED7A 2ZNWA 4O51B 2EH8L 1S78D 3VW3H 4U1GB 4H26A 4TUJB 3S34H 1I7RB 1OE3A 4B0MB 2H3NA 4K3EH 3UAFA 2XQYG 1LEGB 3M17B 1L7IH 4YXLH 2H8PB 1VFUA 3P30H 4TSAH 1AIFA 2CJTA 2KLTA 3OVUB 4EN3A 3EKCA 2VRAA 4HCFA 1A6VH 4HIHA 3LNGA 4P57A 2VXQH 4OLWH 4K71B 4PS3A 2XQBL 3IMWA 4HX1A 2HKAA 1NCTA 2P26A 3FUFA 5DHXB 2R2HB 4L4VA 4QRRA 4BSWA 2XFGB 5KVGL 3WTYA 3I50H 4HQQL 3S4SG 4MDRA 1G43A 3FFCB 1JL8A 4PW3A 2JCCB 2OLDA 1UENA 1MHHB 1DQML 1J1XL 1J88A 5C9JA 4LSUH 4OCWL 1THCA 4LL1A 1M71B 1ET8A 3T3MB 4HWEH 1MFCL 4PJFF 3FT3B 1OK0A 2D31A 5EO0B 1UD8A 5HGDB 2OZ4A 4FG0A 4ZFZB 1LM8V 5EZIL 3MLSL 4JFUA 4X6CB 5KVMC 5AAPA 3B5HA 2JSFA 3QWRD 4S10A 1I1AB 4UV7H 4HPHA 1A5FL 2VE6A 4JKPH 1QFWH 4ETQB 1WP6A 3M45A 4MQ7B 1F2QA 3ULSA 4N22A 3QEGL 1A3ZA 1DANU 2XA8L 2E7DA 4PJIE 4UOW0 3OGCA 1Z5YD 4LEXH 4LEOB 4N0RA 4LSPL 5C08D 5I5IA 5EEYA 1JD7A 2AQ2A 3W9DB 3BH4A 3NP4A 1N2RA 2XI9A 5E56A 1NAKL 1IAIM 1J0YA 1FCGA 3UAJC 5F8RC 3EGDB 3GLDA 5EBLB 4G82A 5IQMA 1WSST 1LWRA 3BGMB 5E94B 2VN7A 3QJRB 1TSHA 4S1QH 3UMTA 4OCMC 1KTRL 2JQAA 4ZFGL 4QOKB 2B7DT 3FU0A 1SPDA 4XNBA 5I1KL 4OGYL 1YMMB 4POYA 1GXEA 4MNQE 3DX8A 3BUPA 3TFKD 3RL2A 1A3QA 1SDAB 3FONA 5CCKL 4Q14A 1CI3M 1X7SA 2PCYA 4AYSA 1YNLL 2YPVA 4PJAB 5BVPL 1EUTA 2PXYC 1PS3A 1E4XH 2RFXA 2J4WL 2J20A 1KLFA 4KKQA 2PYEB 4DVBA 3NSFA 2I32A 5CINL 1KDIA 4ODVL 5JW3L 1NL0H 2GAZB 3FUIA 3SDYL 4PWFA 1Q0EA 3HS0B 5JIKA 2IGFH 2KH2B 1FYTE 4I5BB 3RVXC 1UZ6E 4DJMA 4QLWA 2AEOA 3KDMB 4WUKH 5FUOH 2C9AA 3IJYA 4W6XB 4WJ5B 4F93B 1T7XA 2VLRA 3F7PC 4IBLT 3WLWC 1NUFA 3APCA 4FN0A 3GM8A 4IIQC 2QADD 3DURB 4IEFA 3IU3A 5KBPA 4URKA 2BWDA 4TTDD 1QBML 5KJRH 3LY6A 1N0LA 3F3HA 3HR5A 4HUCA 3LQAC 3VWJD 4HFWA 2JV6A 1SOXA 4ADIA 1H6UA 3DV6B 2D3JA 2GUOA 3DK0A 2L7QA 4B3EA 1I1YA 2X4NA 4PJEA 3MBEA 1TZHB 3W5NA 1P1ZB 2CKBB 3ALXA 2D7MA 2WLLB 1UB5A 2VDQB 1RJYB 4F3FA 3HAEB 3QIUA 2Z7YA 4NXKA 4BKSC 5JW4M 2A74A 1XDTT 3ESPA 3OHXB 4JN1H 3S34L 3CFBA 2F74A 2K6WA 3QUML 1VHPA 1W0WB 1L7IL 5HHNB 4YXLL 5EU4B 3AMKA 4H20L 3DI3B 4P2QA 4TSAL 2VL4A 5DU7A 2XTLA 1HINL 2ZUWA 5SWSA 4CAGA 3ROOB 1C5BH 1A4KA 3CIQA 4HCGA 1OAUL 4IS6B 4R7VA 3QORB 2XBDA 1UWXK 1AJ7H 3CVIL 3S35H 3A6OA 3VXUD 3P3TA 4WNQB 4W9DC 1CDHA 4HEPA 3FUHA 5B3JF 2A0LC 5DEFB 3WN5C 5J7CC 4YHZL 2W9LA 4XBGA 2IFFH 4OQTL 4WEBH 2A9CA 3I50L 2MNUA 4S2SA 4ZYKB 5A2IH 5CEXB 3RWHA 3M6DA 3VXRA 5EN3A 4AK2A 5A43C 3L4CA 3DX7B 2ZUUA 3D39A 4HWEL 1HYSD 4LLWA 1T6VN 2EIZA 3SDDD 2CHNA 5HHOD 5TE4H 2F2HA 3QXDA 3WEMA 4KY1L 3EJRA 5A2FA 3R4RA 4S0SD 4W68A 5CR8A 1Y6NR 2DIBA 5KVDH 4MD4A 5BRPA 4HH9B 2ZICA 1U8HB 1KIUA 4JM0A 1R0AH 2WQRA 3HNSH 5AVVB 3ARGC 2YRPA 4C57C 3T0EA 4L8CB 1NC2B 3S36X 4BE6A 4U4IA 3ULVL 3LKPB 4HLZH 1NDGB 1GGIL 5IQ7L 1HL9A 5H8DA 5D2LB 1QLEH 3K3QA 4JDVB 1YJDL 5I23A 4HXAH 3W57A 3GIZH 5GS3A 3WLBA 1WZKA 2YUXA 3SO3B 3B8SA 4S1QL 2NY5H 1U91A 4PRHA 5I8OH 3IRZA 5B8CC 5EU5B 4AUUA 4KKLC 4HUVA 3B1TA 3EH1A 3K71B 5TE6L 5F7DA 3KLDA 2QEJA 4M1GH 1E0OB 1UJTA 1JXKA 5JMOC 4OJDH 2MJWA 4D0CB 1CGSH 3F7RA 4LSRH 4OZGB 2UX6A 5HYQB 1L7TL 3TBBA 4TS6A 2HT2D 4P2CG 3IKCB 5DDHA 2DICA 1T7VA 2YZ1A 2MEJB 3H9HA 1MF2L 2HJKA 2WNGA 4P5KA 1C9SA 4M1CD 4UTAA 4IRSA 5ABZA 1U92B 4B3VA 5DZAA 4EN3C 2NY1B 2BINA 1DQQA 1NL0L 3GJFB 3ZU8A 2EXWD 2BNQB 3U4KA 5GZNA 5M95B 1R3KA 1BX2A 2IGFL 5JMRA 2J25A 3MREB 3BJLA 1VEOA 4EIBA 4NN6B 2XKSA 4PJXA 2FECI 2PF6A 3ARZA 3MX0A 1DCEA 4HF5H 2BZDA 5K59E 3ALWA 4XN1A 3L9YA 3OKDB 5IW6A 4ZX5A 1H5BB 1BD2A 4GXVL 1J5OL 2CWRA 1PY9A 1IT9H 2A2QT 1XAKA 3Q5OA 3R0NA 1KZYA 3K6OA 1IAOB 4X7TB 1U0QA 4MGXA 2B0SH 2J72A 3QS2A 2CRYA 3WXWH 2B1OA 1HL8A 2NY0D 3CSYA 4FFZH 3OAUH 3D85B 4OLUH 5D7JB 4F2MA 1EO8H 1TCMA 2VR5A 2YEZA 3VXTA 2YBRB 4X5XB 3E0GA 1E8XA 2VAAB 4L4TB 5I1LA 1HHGA 4PS4L 5JNYB 3QUZD 4BJLA 3EJUA 4LAQL 3VG9B 4Z5RB 2XPGA 2G75A 3ENEA 2EZ0C 3QO0A 4OIAA 2GSIB 4XP9L 2BMKA 5C08A 3ZT5A 3ZRFC 3DTXB 2YGNA 4YEEA 5EU3A 5I71C 4I77H 4ELDA 3B9KA 2OMUA 1AJ7L 3E2HB 3S35L 2A77L 1I8MA 2CBPA 2ROXA 4DP7X 4FTVE 2X05A 2E9BA 4APQA 4KKCC 1JYXA 5HYJE 2WTRB 3OMAB 3VFWA 4ZAKA 1WBXB 4Y4KA 2F58L 3JT0A 4JFEB 2PW2A 3VFVA 1MLBA 4UQ9A 5SWZD 1DP0A 2OQJA 4PJ7A 5FKAB 4MKTA 3ESOA 1XIWD 3MODH 1OP5K 1JUFA 2ICWJ 3CQPA 1OT4A 5ESVB 5C07A 1T5WB 4X6DF 4LRIA 1SMOA 5D71L 5DR5L 4Y5VB 3HLAB 4GXFA 1H8NA 1LO4L 2NXZC 2DIJA 4ELMB 5B39G 3P4NB 5CHNB 4N1HB 5ALCL 1KGYE 5IREA 1UM5H 3A6BL 4WW1A 1EAOA 3FU6A 2OMVA 3H54A 4FXKB 4ABQA 5FK9A 4IRZL 1LMIA 1NC4D 3DIFA 1X5IA 3PRZA 3PWUA 5E9NA 1IX2A 3KLSA 1VERA 3QRLA 1R0AL 2ZKMX 3NJXA 3KE0A 4I13B 3A67H 5FO9A 2CU9A 3TT3H 3RX5A 2ZP9A 3U7WL 5MEQA 1U3YA 2QPSA 5D5ME 4XBMA 4N0UB 4OGAC 3UPRB 4C4KT 4U1KB 1A6ZA 1KB3A 2H2PC 3KR3L 4UINH 2N0KA 3F62A 3GXIA 4ORGA 1QLEL 4XPAL 1HNFA 4KFMA 5I76B 2H3XC 4HXAL 3U2JA 2PWHA 3HVNA 2ARJA 2F7QA 1UYWH 4B9JA 4XNYH 3KJ6L 3JWNE 4RMWA 1JHLL 4HUMB 3RKDC 3HMWH 4I9XA 3V5HA 3B6SA 4MMXB 1K2DA 2OCCB 1UH3A 5F9DC 4DKDC 3B2XA 4XB7A 4U1JA 3MCKB 2BFVL 4M1GL 3VFMA 1NSNH 2IJ0C 4N26A 3QFJE 4Y8DC 3OLIA 1IBDA 1CGSL 4LSRL 5IBTH 4M29A 3QIUC 4DERA 3T8VA 2LT9A 3PWJA 3VFRA 2A74C 1OB1A 1KIPA 2F7PA 1XR9A 4MCZB 3GGWB 3T2LA 4UT6H 1NOLA 1OAKH 3BAWA 4JHWH 3KLLA 4R4NC 4KXZI 2KMWA 2DQJH 5LVEA 2EADA 2NX5E 2Y36L 2ZOWA 4KO9A 1UXSA 4LSQL 3MR9A 4QYOA 2Z1PA 2EQDA 5FFGA 3TWCH 2DMGA 3V8CA 3H4FA 1ZPLA 4ZMWA 4DP6X 3CQFA 1U8JB 3RDTD 3RGVA 3U83A 4IKJA 3L5WA 3NAAH 4I2XB 1HEZB 3BD5A 3GLEA 1HN1A 3MRGB 1AKPA 2DQHH 4IIZA 3ZTDC 4NHUB 2E9GA 1QFUH 3ULUD 4NO0A 5C3LD 3O6ML 3QDJD 4ZTOH 4BCXA 1YUKB 4FQLL 3RA7H 3MOBL 3V0WH 3LIUA 3BRGC 1Z9PA 2W5PA 4YHPA 4D9RD 3SDDA 4TVPE 4L8BA 4XTRC 4TL5A 4FFZL 5K9OB 3OAUL 2UVFA 3GLZA 4PV9B 4ABUA 3UZQB 3IMRA 3APMA 3HVDA 4LEBA 5IB5A 4KQ3H 2XVLA 4C4UA 3CFMA 1EJFA 3MLYL 3KPPB 4J4PD 4UTBH 3QW9A 4Y8AA 5IMKA 3C8HA 4WK0B 2EEFA 3WEXA 5LLIC 2X70B 2PWGA 3WS3B 2A6DA 3T0EC 4GMTL 3INUH 2WWKT 1R47A 1K72A 2AGJH 5KSAA 3K72A 2OMBA 3LZOA 4JJ5A 2Z1KA 4YNYB 4I77L 2QPDB 3DX1A 1KTDA 1OW0A 2DQGL 5KUKA 5JW5B 1F6AB 3B9EA 2NLJB 3AQYA 5FYLD 1EZSA 3IJEB 3NPZB 3IMTA 4BQBA 1J0IA 3L13A 1P7QD 1MNNA 3GXNA 2DWEA 1P69B 2WBKA 3TFBA 3FT9A 1G7HB 3REVB 5DK2A 2VABB 4ZUVB 5FYKU 2OMZA 1BQ5A 2V5RA 4ODTL 4JM4L 4XNQB 3MODL 2M2DA 3BPCA 1U95A 1KCBA 4GIAA 3K0WA 5DMIH 1ZHNB 3NABH 3EYUH 1SEBA 1NINA 2X6MA 4PGEB 2GTZA 5GS1B 1NMBH 4AEIH 1PJ9A 4XPFL 1NGZB 3UTZB 1P2CA 4Q0XH 3WJMB 3PQYB 5FF6A 1T6WA 2X4TA 4M4RA 1RH8A 3J27A 5DJYB 4Q6IA 4FZ8H 3JZ7A 5EZOH 3L4WA 5FA3A 3I9IA 1QSEA 3UMNA 4IRSC 1PTZA 4LL4A 1UC6A 4ZS7H 3SPVB 3DPBA 4GKZA 1DBBH 3LRMA 5HDBB 3HPLB 4M5TA 4GW5B 1VACB 5GZNC 4EXKA 2WCGA 4FA8A 1BFTA 4N6RA 4JX0A 4K9EH 1RUMH 1ZVSB 2FWSA 4NQDB 4X7DC 4BGDA 5DJXB 4W9IC 3LRSB 2BX5A 3VA2C 1J5CA 3DOIA 3V6OE 1XEUA 1ZTXE 2IQAA 5GGVL 3RUGF 5DJ0A 3O3AB 2MCPL 2WQUA 4XNYL 2FJHB 3FPYA 3J8F7 3KW8A 5GRYA 2TRYA 1DSYA 1FG9C 3HMWL 5EA0L 2EE6A 1OE2A 3UG5A 4Q58C 3MLXL 1CG9A 1FO0H 2B59B 3BYYA 3HMXH 4AXWB 1NSNL 3CSBA 4EBQH 4YDLB 1A3LL 3HC3H 4G6KH 2EIJB 3GLAA 4ALAH 5BXFA 5IESL 2TRHA 2WB1A 5LO7A 5C0NC 3FTYA 4Q7DA 1OAKL 1WD9A 2NW3B 4NM4H 5FHBH 3VI4B 2I85A 1NCDL 2DQJL 4BKLB 2AJZB 5CWSB 5IM7A 4YXHH 1Q1PA 1BIIB 4G9DA 4H0HB 1XCWA 3TWCL 3DHUA 4IJ3C 3B9KC 2UY6A 3Q9PA 1NWOA 1F4HA 4B9KC 1FVCB 1YVLA 4APQC 4FYSA 4MXVE 5ENWA 4RGNC 5C0AD 3RRQA 4XOCA 4ZAKC 4A68A 4Y4KC 4BBWA 1LO2L 1XF4A 3HZKB 5SWZA 2VDOB 2AK4D 1M7UA 3P11H 3QQDA 5LDUA 4ZMTA 3RVVC 3T6QC 4XPGH 4A2EA 3T8MA 4MRBA 2LV4A 1T66D 4TF4A 1VGEL 4ZTOL 3UPCA 3I2CH 5A2CA 4LLQA 2CO4A 2ICEA 5IB2A 4J3WA 2H32B 3JSSA 4PJFA 1X5AA 1Y1DA 1JF1A 4X5WB 3T04D 3V4VH 2IPUK 5LCVL 2PTTA 4Z7UB 1E6OH 5IFAL 5BJTB 1I1FB 3D2TA 4WU7A 3DSNA 4HIEB 4UTBL 4WFHD 3SJVB 3C2AL 5D1QD 3ZUCA 1CTMA 1EUUA 5DJAB 3F7YA 4HU8A 2Z64C 3S37H 2DQFA 2ADJA 4GIPD 2AGJL 1QEWB 2R1YB 3CMGA 4CJ1A 1EEYA 1SDDB 1D5ZB 1MN4A 3CHRA 5E8PB 2GT9A 4FQQA 1INEH 2APFA 3PXLA 2IDUA 5EOQL 5FCUH 3U79A 3FF8A 1LK2B 3CBKB 5I1DB 1DFBL 1NM4A 1Y6KR 3J07A 5F8QC 4M7KL 4G9FB 4UM9A 2DQTH 4A2FA 1M56B 4WHTA 3WY3A 3ATEA 3PWPD 1KPUA 3QG7H 4XX5A 4X7EC 1ACYH 1SHWA 1PIGA 2LU4A 2QR0B 4HYTB 3ARFD 1G6VK 1AGDB 3JVGA 4O58L 4PJIB 1AFVH 4LB8A 3EYUL 3KWWA 2V5TA 1ADQH 1HHJA 4MYPA 1ZHLA 5HJ3A 3U6RA 4AEIL 3VFGH 3UROR 1RZKC 2NY3D 3IJSA 4X4ME 2YPLB 4ELKB 1BAWA 4CN1A 4KKNA 3PAZA 4XNAA 1A6WH 1FSKB 3GF8A 2EP6A 1M53A 4P3CH 4RAHA 3Q05A 1MZYA 4ODUB 4FZ8L 1J8HA 4HPOH 2EIBA 3LQZB 4BFEA 3WMQA 3GZKA 5HBBA 4ZS7L 4EI5C 2HLEB 4NRXA 3SKOB 2CNYA 1J0ZA 1GYUA 1A9BB 2EXSA 2H9GB 1NIEA 4L0ZA 2J6EH 3GS7A 2X6VA 2W38A 2N7SA 4MNQB 1DQKA 1PQZB 1UASA 3N0PB 4NZUH 1A7RH 1RUML 3CUPA 4LASH 2DQDH 3L9BA 5F1KC 3RGVC 1TMQA 1E3FA 4BD4A 1GGCH 4ODXA 1FVDA 1WFNA 2CAKA 5CO1A 3PHQA 1PIFA 4LCWE 4IU2A 5CSBA 3H2WA 3RWCA 4MQXD 1CL7I 5LBSA 1OPOA 3W9EA 4XN9A 4L8SB 1EXUA 3VB8A 4JY6B 3BN9D 4ISVB 5GGSY 3DTUB 4XNUH 4ES8A 4PJCE 1FL3B 5EU6A 1F42A 1TQCC 4H2AA 4N9GB 4HJUA 2NZ1A 2BDNL 4LCCA 3D2UA 1FO0L 3HMXL 4ZO7A 3FN9A 4EBQL 5LWYH 1RKRA 1JWUB 1DDTA 4AVIA 1A4JB 2XC8A 3DJRA 4MX7B 4OY9A 1H3TA 4ALAL 7PAZA 3ARBB 5FO8B 2ZOLA 4BIKA 4QRSA 3C2SA 3OKNA 5CP7A 2KBGA 5FHBL 5CD3B 3F5WA 4NM4L 4PWHA 5L0QB 2DWDA 3EH3B 1EHLL 4UMSA 1YECH 1S8DA 3DV4B 5KSAC 3CHPA 1ID5I 2HCZX 4YXHL 4CSTA 1HWGB 5GGSA 1UVQA 1OW0C 3QAQA 5BO1L 2YRLA 4BCZA 1FZOA 1UT2A 2BSRA 4R96B 3ROLB 3CZKA 4FG6D 5C0EA 5AKVA 2IALB 1UJ3B 5I73B 3VE0A 2Y7MA 1D7BA 2XTJB 3OWRA 1KTKE 1RLBA 2A4CA 1THAA 2HFFB 3BQUA 1U58B 3LEXB 3P11L 4XPGL 4ODHL 3OAYK 5D4QA 5AUMA 3G04A 1VFBB 4PGBB 4K3HA 4AKPA 3CTTA 2MH4A 4FA7B 4YEFA 5HVWA 2CDGA 4NUJB 4GG8B 4GRMB 1EPFA 3PGDA 3IGKA 3B2UC 1JTOA 3LSOB 4OUUB 1U93B 3ME0A 3NA9H 4XP5H 2PR4L 2HT2C 1UUSA 3SDCB 3QIBB 5LGJB 2VZ3A 5EOTB 3IWVA 2Z0UA 4Q6IC 1ZLVH 1AZCA 2Y72A 4WFFD 1H6TA 3L1GA 3D48R 4HK0B 9CGTA 1BPVA 1MVFA 2A9BA 2X1OA 2PO6D 3US0A 2CHWA 2EYTB 3E6FA 4M7ZC 3S37L 2AXWA 2Q7NA 4I89A 4UB0H 5EC1A 2WHVA 1Q90A 3A4FA 4L2YA 3OKKA 5KYXB 3GMMB 1Q9KB 3AMLA 2YAPA 3LRHA 3IN0A 3P4MA 3K8MA 2EXYC 4K8RD 3TH3T 5D1ZD 3NA4A 3TT1H 4B7LA 4RA0C 4ZOBA 3APNA 1ZSDB 5J6HA 4P07A 2Q86A 3FU9A 3OXRA 5F1IA 1BFSA 3TBVB 3RFZA 1C8PA 3TPUB 4UMGA 3I9PA 5LAXB 4QCIA 1F1AA 3C5ZB 5AVWB 4KJYB 5K39B 1L9QA 4EDWH 4X4YA 3L6FB 2XLLA 5MENB 3KVQA 5T1LB 4CVZA 4AC4A 4JRLA 4RNRA 4MZRA 1JMZA 2ENPA 4WO4D 1S3KH 5C7XH 1IGML 3NP3A 3ECBA 3PV7A 4NO3A 4FQ2H 4N2DA 1NZRA 1OTTC 1EEZA 1NLBL 4P3CL 4LLAA 4I1PA 2ERJC 4D94A 1URZA 4RH4A 4PMEA 4XCNB 4HPOL 3QUXB 4WV1B 4WF7A 7PCYA 1BCIA 4OI7A 1JD9A 2WUBL 3OLEA 4OM1H 3DPDA 1UXLA 2XQYA 3NZ8B 1E43A 3OTTA 4Y19E 3CD4A 4JM2F 1BREA 1E8ZA 4WSJA 1O9VA 5ACMA 3BH8A 2P44B 3U1SL 4KY2A 2F0CA 3EZ8A 1TZOA 1YEJL 1RZJL 1CXFA 2DBJA 2VXQA 1ESOA 4U1HB 1P53A 3TCLA 2FO8A 1AYRA 4Q97A 1K9TA 3DETC 3TNMB 2P80D 1IGIH 3LZRA 4YQXH 1T89A 2ICEC 3OZ9H 4DO4A 4EI6A 1CICA 3WIHL 1JGDA 3ZMNA 2VLKB 3QCUH 4PQXA 3NCXA 1E27A 3MRPA 4E9XA 2FUTA 4HCRL 2WAHA 5ANME 4LLVB 4OLXH 4Y4FB 4Q89A 1RPKA 3SQBA 4JQVC 1HH9A 3FT4A 3HG1A 4PIBA 4MDJA 4UQDA 4GRWH 2EKJA 3BKYH 1CXEA 4WGWB 2EDDA 1BJMA 3BP5A 3Q3GB 2B1AH 4A63A 1YECL 4D3CL 3DX6A 1E8WA 5I26A 3RJOA 2EUXA 4Q9CA 1CLZH 1SGKA 5C70A 3FCSB 5C3TA 4DKAA 1DFXA 1V8HA 1DSFH 1QAWA 3EJYC 2BVQB