4KVYA

Crystal structure of aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title Mechanistic insights from the binding of substrate and carbocation intermediate analogues to aristolochene synthase.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase/lyase inhibitor
total genus 130
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2013-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kvyA00
3QKCA 1V4EA 2EWGA 3EZ3A 3NF2A 3VJAA 2E90A 5IK0A 4DHDA 5I1UA 1VG7A 4KUXA 3ASXA 5H9DA 3WCEA 4DWGA 4XQRF 3EFQA 1UBXA 1VG6A 5A0IA 2F92F 5HNAA 3KRPA 1N24A 2QISA 3OABA 1V4KA 4KQUA 1WL3A 5ILHA 3LK5A 4OMHA 5DGNF 4E1EA 5ILKA 2F9KF 2OPNA 1YYRA 3UCAA 3PYAA 2FTZA 4RXCA 1V4IA 4KVIA 1ZW5A 3LLWA 3MAVA 4OGUA 3N1WF 2OPMA 2Z50A 5ILZA 4E9ZA 5KSXF 3Q1OA 3WEGA 2Q58A 3NPKA 4LUUA 2Q9YA 4LLSA 3LVSA 3N5JF 5DJVF 3M9UA 1YYUA 3W7FA 1YHKA 1YJ4A 3KRAB 4NFIF 5DJRF 4RXAA 3WEIA 4NUAA 1WMWA 2F7MF 3RMGA 5IVGA 4KVYA 3DYGA 3ADZA 3LGKA 3ICZA 4LFGA 3QQVA 3EGTA 1WKZA 4JXNA 5HN8A 5DZ2A 3PYBA 3AQ0A 2ZEUA 5IL8A 3G4FA 2ZCOA 3AQCB 3PDEA 4LZ3A 4PVYF 3WSAA 4KFAA 4P0WA 2PS6A 3NPRA 1WY0A 3N5HF 3M0GA 3WSBA 3S9VA 3N0FA 4JYXA 2PS7A 3ID0A 5B0IA 3WCFA 2ZY1A 2ZCQA 2P1CA 3WCBA 4PVXF 4RXDA 3PH7A 4NKEA 1YV5A 4KK2A 4H5DF 4KPDA 3VJCA 1VG3A 4EA1A 5IM1A 5HN9A 4NFKF 2E95A 2AZJA 3WJNA 3DYHA 3N0GA 2E93A 3WEKA 2Z4YA 3KB9A 1YYTA 5ER8A 2AZLA 4EA2A 1JFGA 1V4JA 3KBKA 1N23A 2ZCSA 3LDWA 3P41A 4XQSF 5ERNA 2OGDA 1WL0A 2J1PA 5CG5A 1YHLA 3VJBA 2F8CF 1RTRA 3RYEA 4LPGF 2Z4ZA 4H5EF 3AQBB 5IK6A 2PS5A 3WJOA 2F94F 3ZOUA 3RYWA 2F89F 2O1OA 3WCGA 3TFPA 2F8ZF 4GA3A 4LTZA 1HXGA 5E8KA 4LFVF 3S4JA 4F62A 4DXJA 5EROA 2DH4A 4XQTF 3BNXA 1RQJA 4EA0A 4LA6A 3M01A 4OMGA 5JA0F 2E8UA 4LZCA 1RQIA 4UMJA 2J1OA 5B01A 4DI5A 3TC1A 4F6VA 2PS8A 5JV1F 3N3DA 4LPHF 1VG2A 2OA6A 3G4DA 3LEEA 3MZVA 4KVWA 3LGZB 4FJQA 3NRIA 4ZQ8A 2J5CA 3WCDA 3ICMA 3LG5A 3IPIA 1YQ7A 3KRAA 3V1XA 4LA5A 3P5PA 1HM4A 1HM7A 3ZL6A 3SDQA 2Z7HA 3Q2ZA 3PKOA 4GP1A 4QXSF 2Z78A 1JFAA 3B7LA 3LOMA 3Q2QA 5B03A 2Z4WA 3ZMCA 5DHKA 3WCHA 4JXYA 4LOBA 3SDVA 5IK9A 1YHMA 3WEJA 4RYPA 2E91A 3DYFA 3KRFB 5A0JA 4DZWA 3SDRA 3ACYA 3IBAA 1DGPA 3WEFA 5ILYA 1EZFA 2E8VA 4Q23A 2PS4A 3Q30A 3CKEA 4FP4A 3BNYA 2E8TA 5AYPA 4NFJF 4E9UA 3OACB 3KRCB 2ONHA 3WJKA 5IMNA 3N6KF 4JZBA 4L2XF 3VJDA 4MC0A 4LZ0A 4DWBA 5DW7A 5ILJA 3P8RA 5ERMA 3ZCDA 1N1BA 2AZKA 3V1VA 4KPJA 4MC8A 2Z7IA 3LJIA 3KRCA 1HX9A 4NG6A 5EAUA 3KRPB 3LMDA 4KQ5A 2AELA 3VJEA 3OABB 5B0JA 5IKHA 2RAHA 2E8WA 3CP6A 3TFVA 4LLTA 4P0XA 2Z4VA 3N45F 5IMPA 2I19A 2Q9ZA 4RXEA 4GAXA 3TS7A 3N1VF 4LFEA 1N20A 1UBWA 5IMIA 3VJ9A 4HD1A 4KWDA 1N1ZA 3KROB 3ZMBA 4H5CF 3RBMA 2E8XA 5JV0F 3SAEA 5B00A 4RNQA 3ICKA 3WEHA 5AFXA 1UBVA 2ZCRA 2VF6A 3P5RA 1HXCA 4P0VA 4GP2A 5DGMF 1V4HA 5DJPF 3ACXA 3P8LA 4LTVA 5B0LA 3SDUA 2ZEVA 3KROA 2H8OA 3WCIA 1FPSA 1YYQA 3WCMA 4OKZA 4QPFA 5E8LA 4DEMF 3AE0A 5C05A 5DHIA 1N21A 3N46F 4MC3A 2AEKA 1UBYA 1WL1A 1KIYA 3WE9A 3LSNA 4F6XA 4KQSA 3VJ8A 4KVDA 2ONGA 3CC9A 5AHUB 4OKMA 4LXWA 1YYSA 2E92A 4NKFA 3WCLA 4JVJF 5IKAA 3SDTA 4JZXA 1KIZA 3OYRA 3ACWA 3M02A 3APZA 3M00A 4N9UA 5ILDA 5IN8A 2Z4XA 2E4OA 5AELA 4WK5A 1N22A 3WCCA 5B0MA 5E8HA 3TFNA 3N3LF 5HN7A 3KRFA 5ILIA 3LZ9A 4KKMA 5B02A 4K10A 4LIXA 1DI1A 1VG4A 2Q80A 2E94A 5DGSF 1WL2A 5B0KA 3V66A 4N1ZF 5CG6A 3WC9A 5A0KA 3OACA 5JUZF 2AETA 2Z52A 5EATA 3WCJA 3N49F 3ICNA 1PS1A 5EASA 3WCAA 5DIQF 2FORA 1HXAA 5JV2F 5IL3A
chains in the Genus database with same CATH superfamily
3QKCA 1V4EA 2EWGA 3EZ3A 3NF2A 3VJAA 2E90A 5IK0A 4DHDA 5I1UA 1VG7A 4KUXA 3ASXA 5H9DA 3WCEA 4DWGA 4XQRF 3EFQA 1UBXA 1VG6A 5A0IA 2F92F 5HNAA 3KRPA 1N24A 2QISA 3OABA 1V4KA 4KQUA 1WL3A 5ILHA 3LK5A 4OMHA 5DGNF 4E1EA 5ILKA 2F9KF 2OPNA 1YYRA 3UCAA 3PYAA 2FTZA 4RXCA 1V4IA 4KVIA 1ZW5A 3LLWA 3MAVA 4OGUA 3N1WF 2OPMA 2Z50A 5ILZA 4E9ZA 5KSXF 3Q1OA 3WEGA 2Q58A 3NPKA 4LUUA 2Q9YA 4LLSA 3LVSA 3N5JF 5DJVF 3M9UA 1YYUA 3W7FA 1YHKA 1YJ4A 3KRAB 4NFIF 5DJRF 4RXAA 3WEIA 4NUAA 1WMWA 2F7MF 3RMGA 5IVGA 4KVYA 3DYGA 3ADZA 3LGKA 3ICZA 4LFGA 3QQVA 3EGTA 1WKZA 4JXNA 5HN8A 5DZ2A 3PYBA 3AQ0A 2ZEUA 5IL8A 3G4FA 2ZCOA 3AQCB 3PDEA 4LZ3A 4PVYF 3WSAA 4KFAA 4P0WA 2PS6A 3NPRA 1WY0A 3N5HF 3M0GA 3WSBA 3S9VA 3N0FA 4JYXA 2PS7A 3ID0A 5B0IA 3WCFA 2ZY1A 2ZCQA 2P1CA 3WCBA 4PVXF 4RXDA 3PH7A 4NKEA 1YV5A 4KK2A 4H5DF 4KPDA 3VJCA 1VG3A 4EA1A 5IM1A 5HN9A 4NFKF 2E95A 2AZJA 3WJNA 3DYHA 3N0GA 2E93A 3WEKA 2Z4YA 3KB9A 1YYTA 5ER8A 2AZLA 4EA2A 1JFGA 1V4JA 3KBKA 1N23A 2ZCSA 3LDWA 3P41A 4XQSF 5ERNA 2OGDA 1WL0A 2J1PA 5CG5A 1YHLA 3VJBA 2F8CF 1RTRA 3RYEA 4LPGF 2Z4ZA 4H5EF 3AQBB 5IK6A 2PS5A 3WJOA 2F94F 3ZOUA 3RYWA 2F89F 2O1OA 3WCGA 3TFPA 2F8ZF 4GA3A 4LTZA 1HXGA 5E8KA 4LFVF 3S4JA 4F62A 4DXJA 5EROA 2DH4A 4XQTF 3BNXA 1RQJA 4EA0A 4LA6A 3M01A 4OMGA 5JA0F 2E8UA 4LZCA 1RQIA 4UMJA 2J1OA 5B01A 4DI5A 3TC1A 4F6VA 2PS8A 5JV1F 3N3DA 4LPHF 1VG2A 2OA6A 3G4DA 3LEEA 3MZVA 4KVWA 3LGZB 4FJQA 3NRIA 4ZQ8A 2J5CA 3WCDA 3ICMA 3LG5A 3IPIA 1YQ7A 3KRAA 3V1XA 4LA5A 3P5PA 1HM4A 1HM7A 3ZL6A 3SDQA 2Z7HA 3Q2ZA 3PKOA 4GP1A 4QXSF 2Z78A 1JFAA 3B7LA 3LOMA 3Q2QA 5B03A 2Z4WA 3ZMCA 5DHKA 3WCHA 4JXYA 4LOBA 3SDVA 5IK9A 1YHMA 3WEJA 4RYPA 2E91A 3DYFA 3KRFB 5A0JA 4DZWA 3SDRA 3ACYA 3IBAA 1DGPA 3WEFA 5ILYA 1EZFA 2E8VA 4Q23A 2PS4A 3Q30A 3CKEA 4FP4A 3BNYA 2E8TA 5AYPA 4NFJF 4E9UA 3OACB 3KRCB 2ONHA 3WJKA 5IMNA 3N6KF 4JZBA 4L2XF 3VJDA 4MC0A 4LZ0A 4DWBA 5DW7A 5ILJA 3P8RA 5ERMA 3ZCDA 1N1BA 2AZKA 3V1VA 4KPJA 4MC8A 2Z7IA 3LJIA 3KRCA 1HX9A 4NG6A 5EAUA 3KRPB 3LMDA 4KQ5A 2AELA 3VJEA 3OABB 5B0JA 5IKHA 2RAHA 2E8WA 3CP6A 3TFVA 4LLTA 4P0XA 2Z4VA 3N45F 5IMPA 2I19A 2Q9ZA 4RXEA 4GAXA 3TS7A 3N1VF 4LFEA 1N20A 1UBWA 5IMIA 3VJ9A 4HD1A 4KWDA 1N1ZA 3KROB 3ZMBA 4H5CF 3RBMA 2E8XA 5JV0F 3SAEA 5B00A 4RNQA 3ICKA 3WEHA 5AFXA 1UBVA 2ZCRA 2VF6A 3P5RA 1HXCA 4P0VA 4GP2A 5DGMF 1V4HA 5DJPF 3ACXA 3P8LA 4LTVA 5B0LA 3SDUA 2ZEVA 3KROA 2H8OA 3WCIA 1FPSA 1YYQA 3WCMA 4OKZA 4QPFA 5E8LA 4DEMF 3AE0A 5C05A 5DHIA 1N21A 3N46F 4MC3A 2AEKA 1UBYA 1WL1A 1KIYA 3WE9A 3LSNA 4F6XA 4KQSA 3VJ8A 4KVDA 2ONGA 3CC9A 5AHUB 4OKMA 4LXWA 1YYSA 2E92A 4NKFA 3WCLA 4JVJF 5IKAA 3SDTA 4JZXA 1KIZA 3OYRA 3ACWA 3M02A 3APZA 3M00A 4N9UA 5ILDA 5IN8A 2Z4XA 2E4OA 5AELA 4WK5A 1N22A 3WCCA 5B0MA 5E8HA 3TFNA 3N3LF 5HN7A 3KRFA 5ILIA 3LZ9A 4KKMA 5B02A 4K10A 4LIXA 1DI1A 1VG4A 2Q80A 2E94A 5DGSF 1WL2A 5B0KA 3V66A 4N1ZF 5CG6A 3WC9A 5A0KA 3OACA 5JUZF 2AETA 2Z52A 5EATA 3WCJA 3N49F 3ICNA 1PS1A 5EASA 3WCAA 5DIQF 2FORA 1HXAA 5JV2F 5IL3A
chains in the Genus database with same CATH topology
3QKCA 1V4EA 2EWGA 3EZ3A 3NF2A 3VJAA 2E90A 5IK0A 4DHDA 5I1UA 1VG7A 4KUXA 3ASXA 5H9DA 3WCEA 4DWGA 4XQRF 3EFQA 1UBXA 1VG6A 5A0IA 2F92F 5HNAA 3KRPA 1N24A 2QISA 3OABA 1V4KA 4KQUA 1WL3A 5ILHA 3LK5A 4OMHA 5DGNF 4E1EA 5ILKA 2F9KF 2OPNA 1YYRA 3UCAA 3PYAA 2FTZA 4RXCA 1V4IA 4KVIA 1ZW5A 3LLWA 3MAVA 4OGUA 3N1WF 2OPMA 2Z50A 5ILZA 4E9ZA 5KSXF 3Q1OA 3WEGA 2Q58A 3NPKA 4LUUA 2Q9YA 4LLSA 3LVSA 3N5JF 5DJVF 3M9UA 1YYUA 3W7FA 1YHKA 1YJ4A 3KRAB 4NFIF 5DJRF 4RXAA 3WEIA 4NUAA 1WMWA 2F7MF 3RMGA 5IVGA 4KVYA 3DYGA 3ADZA 3LGKA 3ICZA 4LFGA 3QQVA 3EGTA 1WKZA 4JXNA 5HN8A 5DZ2A 3PYBA 3AQ0A 2ZEUA 5IL8A 3G4FA 2ZCOA 3AQCB 3PDEA 4LZ3A 4PVYF 3WSAA 4KFAA 4P0WA 2PS6A 3NPRA 1WY0A 3N5HF 3M0GA 3WSBA 3S9VA 3N0FA 4JYXA 2PS7A 3ID0A 5B0IA 3WCFA 2ZY1A 2ZCQA 2P1CA 3WCBA 4PVXF 4RXDA 3PH7A 4NKEA 1YV5A 4KK2A 4H5DF 4KPDA 3VJCA 1VG3A 4EA1A 5IM1A 5HN9A 4NFKF 2E95A 2AZJA 3WJNA 3DYHA 3N0GA 2E93A 3WEKA 2Z4YA 3KB9A 1YYTA 5ER8A 2AZLA 4EA2A 1JFGA 1V4JA 3KBKA 1N23A 2ZCSA 3LDWA 3P41A 4XQSF 5ERNA 2OGDA 1WL0A 2J1PA 5CG5A 1YHLA 3VJBA 2F8CF 1RTRA 3RYEA 4LPGF 2Z4ZA 4H5EF 3AQBB 5IK6A 2PS5A 3WJOA 2F94F 3ZOUA 3RYWA 2F89F 2O1OA 3WCGA 3TFPA 2F8ZF 4GA3A 4LTZA 1HXGA 5E8KA 4LFVF 3S4JA 4F62A 4DXJA 5EROA 2DH4A 4XQTF 3BNXA 1RQJA 4EA0A 4LA6A 3M01A 4OMGA 5JA0F 2E8UA 4LZCA 1RQIA 4UMJA 2J1OA 5B01A 4DI5A 3TC1A 4F6VA 2PS8A 5JV1F 3N3DA 4LPHF 1VG2A 2OA6A 3G4DA 3LEEA 3MZVA 4KVWA 3LGZB 4FJQA 3NRIA 4ZQ8A 2J5CA 3WCDA 3ICMA 3LG5A 3IPIA 1YQ7A 3KRAA 3V1XA 4LA5A 3P5PA 1HM4A 1HM7A 3ZL6A 3SDQA 2Z7HA 3Q2ZA 3PKOA 4GP1A 4QXSF 2Z78A 1JFAA 3B7LA 3LOMA 3Q2QA 5B03A 2Z4WA 3ZMCA 5DHKA 3WCHA 4JXYA 4LOBA 3SDVA 5IK9A 1YHMA 3WEJA 4RYPA 2E91A 3DYFA 3KRFB 5A0JA 4DZWA 3SDRA 3ACYA 3IBAA 1DGPA 3WEFA 5ILYA 1EZFA 2E8VA 4Q23A 2PS4A 3Q30A 3CKEA 4FP4A 3BNYA 2E8TA 5AYPA 4NFJF 4E9UA 3OACB 3KRCB 2ONHA 3WJKA 5IMNA 3N6KF 4JZBA 4L2XF 3VJDA 4MC0A 4LZ0A 4DWBA 5DW7A 5ILJA 3P8RA 5ERMA 3ZCDA 1N1BA 2AZKA 3V1VA 4KPJA 4MC8A 2Z7IA 3LJIA 3KRCA 1HX9A 4NG6A 5EAUA 3KRPB 3LMDA 4KQ5A 2AELA 3VJEA 3OABB 5B0JA 5IKHA 2RAHA 2E8WA 3CP6A 3TFVA 4LLTA 4P0XA 2Z4VA 3N45F 5IMPA 2I19A 2Q9ZA 4RXEA 4GAXA 3TS7A 3N1VF 4LFEA 1N20A 1UBWA 5IMIA 3VJ9A 4HD1A 4KWDA 1N1ZA 3KROB 3ZMBA 4H5CF 3RBMA 2E8XA 5JV0F 3SAEA 5B00A 4RNQA 3ICKA 3WEHA 5AFXA 1UBVA 2ZCRA 2VF6A 3P5RA 1HXCA 4P0VA 4GP2A 5DGMF 1V4HA 5DJPF 3ACXA 3P8LA 4LTVA 5B0LA 3SDUA 2ZEVA 3KROA 2H8OA 3WCIA 1FPSA 1YYQA 3WCMA 4OKZA 4QPFA 5E8LA 4DEMF 3AE0A 5C05A 5DHIA 1N21A 3N46F 4MC3A 2AEKA 1UBYA 1WL1A 1KIYA 3WE9A 3LSNA 4F6XA 4KQSA 3VJ8A 4KVDA 2ONGA 3CC9A 5AHUB 4OKMA 4LXWA 1YYSA 2E92A 4NKFA 3WCLA 4JVJF 5IKAA 3SDTA 4JZXA 1KIZA 3OYRA 3ACWA 3M02A 3APZA 3M00A 4N9UA 5ILDA 5IN8A 2Z4XA 2E4OA 5AELA 4WK5A 1N22A 3WCCA 5B0MA 5E8HA 3TFNA 3N3LF 5HN7A 3KRFA 5ILIA 3LZ9A 4KKMA 5B02A 4K10A 4LIXA 1DI1A 1VG4A 2Q80A 2E94A 5DGSF 1WL2A 5B0KA 3V66A 4N1ZF 5CG6A 3WC9A 5A0KA 3OACA 5JUZF 2AETA 2Z52A 5EATA 3WCJA 3N49F 3ICNA 1PS1A 5EASA 3WCAA 5DIQF 2FORA 1HXAA 5JV2F 5IL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKC A;  1V4E A;  2EWG A;  3EZ3 A;  3NF2 A;  3VJA A;  2E90 A;  5IK0 A;  4DHD A;  5I1U A;  1VG7 A;  4KUX A;  3ASX A;  5H9D A;  3WCE A;  4DWG A;  4XQR F;  3EFQ A;  1UBX A;  1VG6 A;  5A0I A;  2F92 F;  5HNA A;  3KRP A;  1N24 A;  2QIS A;  3OAB A;  1V4K A;  4KQU A;  1WL3 A;  5ILH A;  3LK5 A;  4OMH A;  5DGN F;  4E1E A;  5ILK A;  2F9K F;  2OPN A;  1YYR A;  3UCA A;  3PYA A;  2FTZ A;  4RXC A;  1V4I A;  4KVI A;  1ZW5 A;  3LLW A;  3MAV A;  4OGU A;  3N1W F;  2OPM A;  2Z50 A;  5ILZ A;  4E9Z A;  5KSX F;  3Q1O A;  3WEG A;  2Q58 A;  3NPK A;  4LUU A;  2Q9Y A;  4LLS A;  3LVS A;  3N5J F;  5DJV F;  3M9U A;  1YYU A;  3W7F A;  1YHK A;  1YJ4 A;  3KRA B;  4NFI F;  5DJR F;  4RXA A;  3WEI A;  4NUA A;  1WMW A;  2F7M F;  3RMG A;  5IVG A;  4KVY A;  3DYG A;  3ADZ A;  3LGK A;  3ICZ A;  4LFG A;  3QQV A;  3EGT A;  1WKZ A;  4JXN A;  5HN8 A;  5DZ2 A;  3PYB A;  3AQ0 A;  2ZEU A;  5IL8 A;  3G4F A;  2ZCO A;  3AQC B;  3PDE A;  4LZ3 A;  4PVY F;  3WSA A;  4KFA A;  4P0W A;  2PS6 A;  3NPR A;  1WY0 A;  3N5H F;  3M0G A;  3WSB A;  3S9V A;  3N0F A;  4JYX A;  2PS7 A;  3ID0 A;  5B0I A;  3WCF A;  2ZY1 A;  2ZCQ A;  2P1C A;  3WCB A;  4PVX F;  4RXD A;  3PH7 A;  4NKE A;  1YV5 A;  4KK2 A;  4H5D F;  4KPD A;  3VJC A;  1VG3 A;  4EA1 A;  5IM1 A;  5HN9 A;  4NFK F;  2E95 A;  2AZJ A;  3WJN A;  3DYH A;  3N0G A;  2E93 A;  3WEK A;  2Z4Y A;  3KB9 A;  1YYT A;  5ER8 A;  2AZL A;  4EA2 A;  1JFG A;  1V4J A;  3KBK A;  1N23 A;  2ZCS A;  3LDW A;  3P41 A;  4XQS F;  5ERN A;  2OGD A;  1WL0 A;  2J1P A;  5CG5 A;  1YHL A;  3VJB A;  2F8C F;  1RTR A;  3RYE A;  4LPG F;  2Z4Z A;  4H5E F;  3AQB B;  5IK6 A;  2PS5 A;  3WJO A;  2F94 F;  3ZOU A;  3RYW A;  2F89 F;  2O1O A;  3WCG A;  3TFP A;  2F8Z F;  4GA3 A;  4LTZ A;  1HXG A;  5E8K A;  4LFV F;  3S4J A;  4F62 A;  4DXJ A;  5ERO A;  2DH4 A;  4XQT F;  3BNX A;  1RQJ A;  4EA0 A;  4LA6 A;  3M01 A;  4OMG A;  5JA0 F;  2E8U A;  4LZC A;  1RQI A;  4UMJ A;  2J1O A;  5B01 A;  4DI5 A;  3TC1 A;  4F6V A;  2PS8 A;  5JV1 F;  3N3D A;  4LPH F;  1VG2 A;  2OA6 A;  3G4D A;  3LEE A;  3MZV A;  4KVW A;  3LGZ B;  4FJQ A;  3NRI A;  4ZQ8 A;  2J5C A;  3WCD A;  3ICM A;  3LG5 A;  3IPI A;  1YQ7 A;  3KRA A;  3V1X A;  4LA5 A;  3P5P A;  1HM4 A;  1HM7 A;  3ZL6 A;  3SDQ A;  2Z7H A;  3Q2Z A;  3PKO A;  4GP1 A;  4QXS F;  2Z78 A;  1JFA A;  3B7L A;  3LOM A;  3Q2Q A;  5B03 A;  2Z4W A;  3ZMC A;  5DHK A;  3WCH A;  4JXY A;  4LOB A;  3SDV A;  5IK9 A;  1YHM A;  3WEJ A;  4RYP A;  2E91 A;  3DYF A;  3KRF B;  5A0J A;  4DZW A;  3SDR A;  3ACY A;  3IBA A;  1DGP A;  3WEF A;  5ILY A;  1EZF A;  2E8V A;  4Q23 A;  2PS4 A;  3Q30 A;  3CKE A;  4FP4 A;  3BNY A;  2E8T A;  5AYP A;  4NFJ F;  4E9U A;  3OAC B;  3KRC B;  2ONH A;  3WJK A;  5IMN A;  3N6K F;  4JZB A;  4L2X F;  3VJD A;  4MC0 A;  4LZ0 A;  4DWB A;  5DW7 A;  5ILJ A;  3P8R A;  5ERM A;  3ZCD A;  1N1B A;  2AZK A;  3V1V A;  4KPJ A;  4MC8 A;  2Z7I A;  3LJI A;  3KRC A;  1HX9 A;  4NG6 A;  5EAU A;  3KRP B;  3LMD A;  4KQ5 A;  2AEL A;  3VJE A;  3OAB B;  5B0J A;  5IKH A;  2RAH A;  2E8W A;  3CP6 A;  3TFV A;  4LLT A;  4P0X A;  2Z4V A;  3N45 F;  5IMP A;  2I19 A;  2Q9Z A;  4RXE A;  4GAX A;  3TS7 A;  3N1V F;  4LFE A;  1N20 A;  1UBW A;  5IMI A;  3VJ9 A;  4HD1 A;  4KWD A;  1N1Z A;  3KRO B;  3ZMB A;  4H5C F;  3RBM A;  2E8X A;  5JV0 F;  3SAE A;  5B00 A;  4RNQ A;  3ICK A;  3WEH A;  5AFX A;  1UBV A;  2ZCR A;  2VF6 A;  3P5R A;  1HXC A;  4P0V A;  4GP2 A;  5DGM F;  1V4H A;  5DJP F;  3ACX A;  3P8L A;  4LTV A;  5B0L A;  3SDU A;  2ZEV A;  3KRO A;  2H8O A;  3WCI A;  1FPS A;  1YYQ A;  3WCM A;  4OKZ A;  4QPF A;  5E8L A;  4DEM F;  3AE0 A;  5C05 A;  5DHI A;  1N21 A;  3N46 F;  4MC3 A;  2AEK A;  1UBY A;  1WL1 A;  1KIY A;  3WE9 A;  3LSN A;  4F6X A;  4KQS A;  3VJ8 A;  4KVD A;  2ONG A;  3CC9 A;  5AHU B;  4OKM A;  4LXW A;  1YYS A;  2E92 A;  4NKF A;  3WCL A;  4JVJ F;  5IKA A;  3SDT A;  4JZX A;  1KIZ A;  3OYR A;  3ACW A;  3M02 A;  3APZ A;  3M00 A;  4N9U A;  5ILD A;  5IN8 A;  2Z4X A;  2E4O A;  5AEL A;  4WK5 A;  1N22 A;  3WCC A;  5B0M A;  5E8H A;  3TFN A;  3N3L F;  5HN7 A;  3KRF A;  5ILI A;  3LZ9 A;  4KKM A;  5B02 A;  4K10 A;  4LIX A;  1DI1 A;  1VG4 A;  2Q80 A;  2E94 A;  5DGS F;  1WL2 A;  5B0K A;  3V66 A;  4N1Z F;  5CG6 A;  3WC9 A;  5A0K A;  3OAC A;  5JUZ F;  2AET A;  2Z52 A;  5EAT A;  3WCJ A;  3N49 F;  3ICN A;  1PS1 A;  5EAS A;  3WCA A;  5DIQ F;  2FOR A;  1HXA A;  5JV2 F;  5IL3 A; 
#chains in the Genus database with same CATH topology
 3QKC A;  1V4E A;  2EWG A;  3EZ3 A;  3NF2 A;  3VJA A;  2E90 A;  5IK0 A;  4DHD A;  5I1U A;  1VG7 A;  4KUX A;  3ASX A;  5H9D A;  3WCE A;  4DWG A;  4XQR F;  3EFQ A;  1UBX A;  1VG6 A;  5A0I A;  2F92 F;  5HNA A;  3KRP A;  1N24 A;  2QIS A;  3OAB A;  1V4K A;  4KQU A;  1WL3 A;  5ILH A;  3LK5 A;  4OMH A;  5DGN F;  4E1E A;  5ILK A;  2F9K F;  2OPN A;  1YYR A;  3UCA A;  3PYA A;  2FTZ A;  4RXC A;  1V4I A;  4KVI A;  1ZW5 A;  3LLW A;  3MAV A;  4OGU A;  3N1W F;  2OPM A;  2Z50 A;  5ILZ A;  4E9Z A;  5KSX F;  3Q1O A;  3WEG A;  2Q58 A;  3NPK A;  4LUU A;  2Q9Y A;  4LLS A;  3LVS A;  3N5J F;  5DJV F;  3M9U A;  1YYU A;  3W7F A;  1YHK A;  1YJ4 A;  3KRA B;  4NFI F;  5DJR F;  4RXA A;  3WEI A;  4NUA A;  1WMW A;  2F7M F;  3RMG A;  5IVG A;  4KVY A;  3DYG A;  3ADZ A;  3LGK A;  3ICZ A;  4LFG A;  3QQV A;  3EGT A;  1WKZ A;  4JXN A;  5HN8 A;  5DZ2 A;  3PYB A;  3AQ0 A;  2ZEU A;  5IL8 A;  3G4F A;  2ZCO A;  3AQC B;  3PDE A;  4LZ3 A;  4PVY F;  3WSA A;  4KFA A;  4P0W A;  2PS6 A;  3NPR A;  1WY0 A;  3N5H F;  3M0G A;  3WSB A;  3S9V A;  3N0F A;  4JYX A;  2PS7 A;  3ID0 A;  5B0I A;  3WCF A;  2ZY1 A;  2ZCQ A;  2P1C A;  3WCB A;  4PVX F;  4RXD A;  3PH7 A;  4NKE A;  1YV5 A;  4KK2 A;  4H5D F;  4KPD A;  3VJC A;  1VG3 A;  4EA1 A;  5IM1 A;  5HN9 A;  4NFK F;  2E95 A;  2AZJ A;  3WJN A;  3DYH A;  3N0G A;  2E93 A;  3WEK A;  2Z4Y A;  3KB9 A;  1YYT A;  5ER8 A;  2AZL A;  4EA2 A;  1JFG A;  1V4J A;  3KBK A;  1N23 A;  2ZCS A;  3LDW A;  3P41 A;  4XQS F;  5ERN A;  2OGD A;  1WL0 A;  2J1P A;  5CG5 A;  1YHL A;  3VJB A;  2F8C F;  1RTR A;  3RYE A;  4LPG F;  2Z4Z A;  4H5E F;  3AQB B;  5IK6 A;  2PS5 A;  3WJO A;  2F94 F;  3ZOU A;  3RYW A;  2F89 F;  2O1O A;  3WCG A;  3TFP A;  2F8Z F;  4GA3 A;  4LTZ A;  1HXG A;  5E8K A;  4LFV F;  3S4J A;  4F62 A;  4DXJ A;  5ERO A;  2DH4 A;  4XQT F;  3BNX A;  1RQJ A;  4EA0 A;  4LA6 A;  3M01 A;  4OMG A;  5JA0 F;  2E8U A;  4LZC A;  1RQI A;  4UMJ A;  2J1O A;  5B01 A;  4DI5 A;  3TC1 A;  4F6V A;  2PS8 A;  5JV1 F;  3N3D A;  4LPH F;  1VG2 A;  2OA6 A;  3G4D A;  3LEE A;  3MZV A;  4KVW A;  3LGZ B;  4FJQ A;  3NRI A;  4ZQ8 A;  2J5C A;  3WCD A;  3ICM A;  3LG5 A;  3IPI A;  1YQ7 A;  3KRA A;  3V1X A;  4LA5 A;  3P5P A;  1HM4 A;  1HM7 A;  3ZL6 A;  3SDQ A;  2Z7H A;  3Q2Z A;  3PKO A;  4GP1 A;  4QXS F;  2Z78 A;  1JFA A;  3B7L A;  3LOM A;  3Q2Q A;  5B03 A;  2Z4W A;  3ZMC A;  5DHK A;  3WCH A;  4JXY A;  4LOB A;  3SDV A;  5IK9 A;  1YHM A;  3WEJ A;  4RYP A;  2E91 A;  3DYF A;  3KRF B;  5A0J A;  4DZW A;  3SDR A;  3ACY A;  3IBA A;  1DGP A;  3WEF A;  5ILY A;  1EZF A;  2E8V A;  4Q23 A;  2PS4 A;  3Q30 A;  3CKE A;  4FP4 A;  3BNY A;  2E8T A;  5AYP A;  4NFJ F;  4E9U A;  3OAC B;  3KRC B;  2ONH A;  3WJK A;  5IMN A;  3N6K F;  4JZB A;  4L2X F;  3VJD A;  4MC0 A;  4LZ0 A;  4DWB A;  5DW7 A;  5ILJ A;  3P8R A;  5ERM A;  3ZCD A;  1N1B A;  2AZK A;  3V1V A;  4KPJ A;  4MC8 A;  2Z7I A;  3LJI A;  3KRC A;  1HX9 A;  4NG6 A;  5EAU A;  3KRP B;  3LMD A;  4KQ5 A;  2AEL A;  3VJE A;  3OAB B;  5B0J A;  5IKH A;  2RAH A;  2E8W A;  3CP6 A;  3TFV A;  4LLT A;  4P0X A;  2Z4V A;  3N45 F;  5IMP A;  2I19 A;  2Q9Z A;  4RXE A;  4GAX A;  3TS7 A;  3N1V F;  4LFE A;  1N20 A;  1UBW A;  5IMI A;  3VJ9 A;  4HD1 A;  4KWD A;  1N1Z A;  3KRO B;  3ZMB A;  4H5C F;  3RBM A;  2E8X A;  5JV0 F;  3SAE A;  5B00 A;  4RNQ A;  3ICK A;  3WEH A;  5AFX A;  1UBV A;  2ZCR A;  2VF6 A;  3P5R A;  1HXC A;  4P0V A;  4GP2 A;  5DGM F;  1V4H A;  5DJP F;  3ACX A;  3P8L A;  4LTV A;  5B0L A;  3SDU A;  2ZEV A;  3KRO A;  2H8O A;  3WCI A;  1FPS A;  1YYQ A;  3WCM A;  4OKZ A;  4QPF A;  5E8L A;  4DEM F;  3AE0 A;  5C05 A;  5DHI A;  1N21 A;  3N46 F;  4MC3 A;  2AEK A;  1UBY A;  1WL1 A;  1KIY A;  3WE9 A;  3LSN A;  4F6X A;  4KQS A;  3VJ8 A;  4KVD A;  2ONG A;  3CC9 A;  5AHU B;  4OKM A;  4LXW A;  1YYS A;  2E92 A;  4NKF A;  3WCL A;  4JVJ F;  5IKA A;  3SDT A;  4JZX A;  1KIZ A;  3OYR A;  3ACW A;  3M02 A;  3APZ A;  3M00 A;  4N9U A;  5ILD A;  5IN8 A;  2Z4X A;  2E4O A;  5AEL A;  4WK5 A;  1N22 A;  3WCC A;  5B0M A;  5E8H A;  3TFN A;  3N3L F;  5HN7 A;  3KRF A;  5ILI A;  3LZ9 A;  4KKM A;  5B02 A;  4K10 A;  4LIX A;  1DI1 A;  1VG4 A;  2Q80 A;  2E94 A;  5DGS F;  1WL2 A;  5B0K A;  3V66 A;  4N1Z F;  5CG6 A;  3WC9 A;  5A0K A;  3OAC A;  5JUZ F;  2AET A;  2Z52 A;  5EAT A;  3WCJ A;  3N49 F;  3ICN A;  1PS1 A;  5EAS A;  3WCA A;  5DIQ F;  2FOR A;  1HXA A;  5JV2 F;  5IL3 A; 
#chains in the Genus database with same CATH homology
 3QKC A;  1V4E A;  2EWG A;  3EZ3 A;  3NF2 A;  3VJA A;  2E90 A;  5IK0 A;  4DHD A;  5I1U A;  1VG7 A;  4KUX A;  3ASX A;  5H9D A;  3WCE A;  4DWG A;  4XQR F;  3EFQ A;  1UBX A;  1VG6 A;  5A0I A;  2F92 F;  5HNA A;  3KRP A;  1N24 A;  2QIS A;  3OAB A;  1V4K A;  4KQU A;  1WL3 A;  5ILH A;  3LK5 A;  4OMH A;  5DGN F;  4E1E A;  5ILK A;  2F9K F;  2OPN A;  1YYR A;  3UCA A;  3PYA A;  2FTZ A;  4RXC A;  1V4I A;  4KVI A;  1ZW5 A;  3LLW A;  3MAV A;  4OGU A;  3N1W F;  2OPM A;  2Z50 A;  5ILZ A;  4E9Z A;  5KSX F;  3Q1O A;  3WEG A;  2Q58 A;  3NPK A;  4LUU A;  2Q9Y A;  4LLS A;  3LVS A;  3N5J F;  5DJV F;  3M9U A;  1YYU A;  3W7F A;  1YHK A;  1YJ4 A;  3KRA B;  4NFI F;  5DJR F;  4RXA A;  3WEI A;  4NUA A;  1WMW A;  2F7M F;  3RMG A;  5IVG A;  4KVY A;  3DYG A;  3ADZ A;  3LGK A;  3ICZ A;  4LFG A;  3QQV A;  3EGT A;  1WKZ A;  4JXN A;  5HN8 A;  5DZ2 A;  3PYB A;  3AQ0 A;  2ZEU A;  5IL8 A;  3G4F A;  2ZCO A;  3AQC B;  3PDE A;  4LZ3 A;  4PVY F;  3WSA A;  4KFA A;  4P0W A;  2PS6 A;  3NPR A;  1WY0 A;  3N5H F;  3M0G A;  3WSB A;  3S9V A;  3N0F A;  4JYX A;  2PS7 A;  3ID0 A;  5B0I A;  3WCF A;  2ZY1 A;  2ZCQ A;  2P1C A;  3WCB A;  4PVX F;  4RXD A;  3PH7 A;  4NKE A;  1YV5 A;  4KK2 A;  4H5D F;  4KPD A;  3VJC A;  1VG3 A;  4EA1 A;  5IM1 A;  5HN9 A;  4NFK F;  2E95 A;  2AZJ A;  3WJN A;  3DYH A;  3N0G A;  2E93 A;  3WEK A;  2Z4Y A;  3KB9 A;  1YYT A;  5ER8 A;  2AZL A;  4EA2 A;  1JFG A;  1V4J A;  3KBK A;  1N23 A;  2ZCS A;  3LDW A;  3P41 A;  4XQS F;  5ERN A;  2OGD A;  1WL0 A;  2J1P A;  5CG5 A;  1YHL A;  3VJB A;  2F8C F;  1RTR A;  3RYE A;  4LPG F;  2Z4Z A;  4H5E F;  3AQB B;  5IK6 A;  2PS5 A;  3WJO A;  2F94 F;  3ZOU A;  3RYW A;  2F89 F;  2O1O A;  3WCG A;  3TFP A;  2F8Z F;  4GA3 A;  4LTZ A;  1HXG A;  5E8K A;  4LFV F;  3S4J A;  4F62 A;  4DXJ A;  5ERO A;  2DH4 A;  4XQT F;  3BNX A;  1RQJ A;  4EA0 A;  4LA6 A;  3M01 A;  4OMG A;  5JA0 F;  2E8U A;  4LZC A;  1RQI A;  4UMJ A;  2J1O A;  5B01 A;  4DI5 A;  3TC1 A;  4F6V A;  2PS8 A;  5JV1 F;  3N3D A;  4LPH F;  1VG2 A;  2OA6 A;  3G4D A;  3LEE A;  3MZV A;  4KVW A;  3LGZ B;  4FJQ A;  3NRI A;  4ZQ8 A;  2J5C A;  3WCD A;  3ICM A;  3LG5 A;  3IPI A;  1YQ7 A;  3KRA A;  3V1X A;  4LA5 A;  3P5P A;  1HM4 A;  1HM7 A;  3ZL6 A;  3SDQ A;  2Z7H A;  3Q2Z A;  3PKO A;  4GP1 A;  4QXS F;  2Z78 A;  1JFA A;  3B7L A;  3LOM A;  3Q2Q A;  5B03 A;  2Z4W A;  3ZMC A;  5DHK A;  3WCH A;  4JXY A;  4LOB A;  3SDV A;  5IK9 A;  1YHM A;  3WEJ A;  4RYP A;  2E91 A;  3DYF A;  3KRF B;  5A0J A;  4DZW A;  3SDR A;  3ACY A;  3IBA A;  1DGP A;  3WEF A;  5ILY A;  1EZF A;  2E8V A;  4Q23 A;  2PS4 A;  3Q30 A;  3CKE A;  4FP4 A;  3BNY A;  2E8T A;  5AYP A;  4NFJ F;  4E9U A;  3OAC B;  3KRC B;  2ONH A;  3WJK A;  5IMN A;  3N6K F;  4JZB A;  4L2X F;  3VJD A;  4MC0 A;  4LZ0 A;  4DWB A;  5DW7 A;  5ILJ A;  3P8R A;  5ERM A;  3ZCD A;  1N1B A;  2AZK A;  3V1V A;  4KPJ A;  4MC8 A;  2Z7I A;  3LJI A;  3KRC A;  1HX9 A;  4NG6 A;  5EAU A;  3KRP B;  3LMD A;  4KQ5 A;  2AEL A;  3VJE A;  3OAB B;  5B0J A;  5IKH A;  2RAH A;  2E8W A;  3CP6 A;  3TFV A;  4LLT A;  4P0X A;  2Z4V A;  3N45 F;  5IMP A;  2I19 A;  2Q9Z A;  4RXE A;  4GAX A;  3TS7 A;  3N1V F;  4LFE A;  1N20 A;  1UBW A;  5IMI A;  3VJ9 A;  4HD1 A;  4KWD A;  1N1Z A;  3KRO B;  3ZMB A;  4H5C F;  3RBM A;  2E8X A;  5JV0 F;  3SAE A;  5B00 A;  4RNQ A;  3ICK A;  3WEH A;  5AFX A;  1UBV A;  2ZCR A;  2VF6 A;  3P5R A;  1HXC A;  4P0V A;  4GP2 A;  5DGM F;  1V4H A;  5DJP F;  3ACX A;  3P8L A;  4LTV A;  5B0L A;  3SDU A;  2ZEV A;  3KRO A;  2H8O A;  3WCI A;  1FPS A;  1YYQ A;  3WCM A;  4OKZ A;  4QPF A;  5E8L A;  4DEM F;  3AE0 A;  5C05 A;  5DHI A;  1N21 A;  3N46 F;  4MC3 A;  2AEK A;  1UBY A;  1WL1 A;  1KIY A;  3WE9 A;  3LSN A;  4F6X A;  4KQS A;  3VJ8 A;  4KVD A;  2ONG A;  3CC9 A;  5AHU B;  4OKM A;  4LXW A;  1YYS A;  2E92 A;  4NKF A;  3WCL A;  4JVJ F;  5IKA A;  3SDT A;  4JZX A;  1KIZ A;  3OYR A;  3ACW A;  3M02 A;  3APZ A;  3M00 A;  4N9U A;  5ILD A;  5IN8 A;  2Z4X A;  2E4O A;  5AEL A;  4WK5 A;  1N22 A;  3WCC A;  5B0M A;  5E8H A;  3TFN A;  3N3L F;  5HN7 A;  3KRF A;  5ILI A;  3LZ9 A;  4KKM A;  5B02 A;  4K10 A;  4LIX A;  1DI1 A;  1VG4 A;  2Q80 A;  2E94 A;  5DGS F;  1WL2 A;  5B0K A;  3V66 A;  4N1Z F;  5CG6 A;  3WC9 A;  5A0K A;  3OAC A;  5JUZ F;  2AET A;  2Z52 A;  5EAT A;  3WCJ A;  3N49 F;  3ICN A;  1PS1 A;  5EAS A;  3WCA A;  5DIQ F;  2FOR A;  1HXA A;  5JV2 F;  5IL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...