4KVYA

Crystal structure of aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title Mechanistic insights from the binding of substrate and carbocation intermediate analogues to aristolochene synthase.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase/lyase inhibitor
total genus 130
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2013-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kvyA00
1UBVA 2E8WA 2Z7HA 3PDEA 1KIZA 2F89F 4OKZA 3WEGA 3NF2A 3G4DA 3LEEA 3PKOA 3EGTA 3KRAB 4RXAA 2AEKA 3WCGA 1YYSA 3N6KF 3LJIA 2I19A 2QISA 1YHLA 3LDWA 4MC8A 3Q1OA 2E4OA 4NFIF 3N1WF 3B7LA 3KBKA 2E8VA 3KRFA 4N1ZF 5DGMF 2PS5A 5JUZF 3ID0A 3ICZA 4NUAA 3WEJA 4LUUA 2P1CA 3OABA 3AQCB 4FJQA 2ZCRA 2E8XA 5IMIA 5ILKA 3ICMA 4OKMA 4JVJF 4K10A 1RQIA 5H9DA 3OACA 5DZ2A 5B03A 1N1ZA 3N1VF 5HN7A 3WCMA 3P41A 4NG6A 4XQSF 2Z4VA 3RYEA 4E9ZA 3TC1A 4QXSF 5DJVF 3KB9A 5IKHA 2E95A 1PS1A 3RBMA 1YHKA 1HXGA 4N9UA 3P8RA 3RYWA 3KRFB 4NKEA 3KRCB 3KROA 1V4KA 3BNYA 3KRPA 5AYPA 5JV0F 5KSXF 2AZLA 2RAHA 3ZMBA 3M0GA 5B0LA 5E8HA 3N5HF 3Q30A 4LLSA 5IK0A 4KKMA 3SDVA 3ACXA 1YV5A 4RNQA 2E94A 2Z50A 3OACB 5EROA 4FP4A 1YYTA 5ILDA 5EAUA 3KRAA 1EZFA 4KPDA 2ZCOA 3WEIA 3WE9A 3ACYA 3WEHA 1HM4A 3NPRA 3VJCA 3SDQA 4EA2A 5A0JA 1DI1A 2Z52A 2Q9YA 4LTVA 4LFGA 4LXWA 2AELA 2ONGA 3ADZA 3M00A 3AQBB 3PYBA 1RQJA 3PH7A 5DW7A 3IBAA 1YQ7A 3ASXA 4GAXA 4LA6A 4JXNA 2F8CF 3P5RA 5IMNA 3W7FA 2J1PA 3N46F 5ERMA 1V4IA 3MZVA 2FTZA 2OPMA 3QQVA 5IVGA 1VG2A 4LZ3A 3VJ8A 4LZ0A 2ZCSA 5HNAA 3TS7A 3ZOUA 3VJAA 3KRCA 3VJ9A 5ILYA 4RYPA 1VG3A 4HD1A 3LOMA 1VG4A 4UMJA 5JV1F 4OMHA 3UCAA 3N5JF 5DHIA 3WJNA 3APZA 2F7MF 5IM1A 4RXCA 2J1OA 3BNXA 4DWBA 1YYUA 5A0IA 4MC0A 4L2XF 3LG5A 4LOBA 5ILJA 1YHMA 4LLTA 5B01A 2ZCQA 4NFJF 1YYQA 3S9VA 4RXEA 5IKAA 5IN8A 4JZXA 4MC3A 5E8LA 3N49F 2E93A 3ICNA 1N1BA 3Q2ZA 1UBWA 5ERNA 4DWGA 1N23A 3P5PA 4LA5A 3EFQA 4F62A 1HX9A 4KPJA 4KWDA 3EZ3A 1HXCA 5HN8A 4NFKF 1WY0A 4KVDA 1HXAA 4LPGF 3DYGA 1WL1A 2ZY1A 4EA1A 3CKEA 4JZBA 2E91A 3LLWA 5C05A 2AZJA 3M02A 4KVWA 3IPIA 5IK6A 3TFPA 5B02A 3WCCA 3V1XA 5ILZA 3N3DA 2J5CA 4DXJA 1RTRA 5DJRF 3LVSA 3N3LF 3ICKA 3V1VA 5DGNF 5E8KA 3N0GA 2Q80A 5A0KA 4DI5A 3OYRA 2Z7IA 2Z4XA 3WCJA 5AFXA 2ONHA 3LGZB 3SDRA 1N24A 5CG5A 1ZW5A 4OMGA 4LFEA 2OPNA 3NPKA 2Q9ZA 3SDUA 2DH4A 4ZQ8A 1HM7A 4KQSA 4KVYA 3SDTA 5ILIA 3SAEA 3M9UA 4GP2A 4F6VA 1WL3A 5IL3A 3QKCA 5DHKA 5JA0F 5AHUB 5ILHA 3LMDA 5AELA 1UBXA 3WEKA 3DYHA 4DZWA 4KFAA 2Z4WA 3RMGA 5EATA 5I1UA 2Z4YA 5DJPF 5B0MA 1WL2A 5B0JA 1N21A 4LFVF 4PVYF 3WEFA 3ZL6A 1VG7A 2Z78A 4KQ5A 3WCFA 2E8TA 4JXYA 4NKFA 5JV2F 3NRIA 3WCBA 4LZCA 3WCHA 5IL8A 2ZEUA 1WL0A 2F9KF 2Z4ZA 3WJKA 3WCAA 5B00A 4P0XA 3TFVA 2PS8A 4H5EF 5ER8A 2E90A 4Q23A 3M01A 4P0VA 2E92A 4H5CF 3ZMCA 3TFNA 2AETA 3CP6A 1VG6A 4KVIA 3MAVA 3N0FA 2F8ZF 4DHDA 5IK9A 3P8LA 3G4FA 4KUXA 2OGDA 4XQRF 4LIXA 3AE0A 4JYXA 4GA3A 4EA0A 3WC9A 2PS7A 2OA6A 3AQ0A 4KQUA 1V4HA 4E1EA 2EWGA 5EASA 5B0KA 2F92F 3WJOA 1N20A 3CC9A 4RXDA 3DYFA 1KIYA 4LTZA 4QPFA 3WSAA 1WKZA 2FORA 2AZKA 1YJ4A 3Q2QA 5IMPA 3WCIA 1UBYA 4OGUA 3ACWA 3V66A 2ZEVA 3OABB 4WK5A 1FPSA 2O1OA 3VJBA 2E8UA 1YYRA 3WCEA 2Q58A 4PVXF 3VJDA 2F94F 4E9UA 3LK5A 1V4EA 2VF6A 3ZCDA 3LSNA 3S4JA 4H5DF 4P0WA 3N45F 4GP1A 2H8OA 3WCDA 3WSBA 3LZ9A 3WCLA 4DEMF 4F6XA 5CG6A 1JFGA 1DGPA 3KROB 3VJEA 2PS6A 3KRPB 2PS4A 4LPHF 1WMWA 5DIQF 5HN9A 3PYAA 3LGKA 4XQTF 1JFAA 1N22A 1V4JA 5B0IA 5DGSF 4KK2A
chains in the Genus database with same CATH superfamily
1UBVA 2E8WA 2Z7HA 3PDEA 1KIZA 2F89F 4OKZA 3WEGA 3NF2A 3G4DA 3LEEA 3PKOA 3EGTA 3KRAB 4RXAA 2AEKA 3WCGA 1YYSA 3N6KF 3LJIA 2I19A 2QISA 1YHLA 3LDWA 4MC8A 3Q1OA 2E4OA 4NFIF 3N1WF 3B7LA 3KBKA 2E8VA 3KRFA 4N1ZF 5DGMF 2PS5A 5JUZF 3ID0A 3ICZA 4NUAA 3WEJA 4LUUA 2P1CA 3OABA 3AQCB 4FJQA 2ZCRA 2E8XA 5IMIA 5ILKA 3ICMA 4OKMA 4JVJF 4K10A 1RQIA 5H9DA 3OACA 5DZ2A 5B03A 1N1ZA 3N1VF 5HN7A 3WCMA 3P41A 4NG6A 4XQSF 2Z4VA 3RYEA 4E9ZA 3TC1A 4QXSF 5DJVF 3KB9A 5IKHA 2E95A 1PS1A 3RBMA 1YHKA 1HXGA 4N9UA 3P8RA 3RYWA 3KRFB 4NKEA 3KRCB 3KROA 1V4KA 3BNYA 3KRPA 5AYPA 5JV0F 5KSXF 2AZLA 2RAHA 3ZMBA 3M0GA 5B0LA 5E8HA 3N5HF 3Q30A 4LLSA 5IK0A 4KKMA 3SDVA 3ACXA 1YV5A 4RNQA 2E94A 2Z50A 3OACB 5EROA 4FP4A 1YYTA 5ILDA 5EAUA 3KRAA 1EZFA 4KPDA 2ZCOA 3WEIA 3WE9A 3ACYA 3WEHA 1HM4A 3NPRA 3VJCA 3SDQA 4EA2A 5A0JA 1DI1A 2Z52A 2Q9YA 4LTVA 4LFGA 4LXWA 2AELA 2ONGA 3ADZA 3M00A 3AQBB 3PYBA 1RQJA 3PH7A 5DW7A 3IBAA 1YQ7A 3ASXA 4GAXA 4LA6A 4JXNA 2F8CF 3P5RA 5IMNA 3W7FA 2J1PA 3N46F 5ERMA 1V4IA 3MZVA 2FTZA 2OPMA 3QQVA 5IVGA 1VG2A 4LZ3A 3VJ8A 4LZ0A 2ZCSA 5HNAA 3TS7A 3ZOUA 3VJAA 3KRCA 3VJ9A 5ILYA 4RYPA 1VG3A 4HD1A 3LOMA 1VG4A 4UMJA 5JV1F 4OMHA 3UCAA 3N5JF 5DHIA 3WJNA 3APZA 2F7MF 5IM1A 4RXCA 2J1OA 3BNXA 4DWBA 1YYUA 5A0IA 4MC0A 4L2XF 3LG5A 4LOBA 5ILJA 1YHMA 4LLTA 5B01A 2ZCQA 4NFJF 1YYQA 3S9VA 4RXEA 5IKAA 5IN8A 4JZXA 4MC3A 5E8LA 3N49F 2E93A 3ICNA 1N1BA 3Q2ZA 1UBWA 5ERNA 4DWGA 1N23A 3P5PA 4LA5A 3EFQA 4F62A 1HX9A 4KPJA 4KWDA 3EZ3A 1HXCA 5HN8A 4NFKF 1WY0A 4KVDA 1HXAA 4LPGF 3DYGA 1WL1A 2ZY1A 4EA1A 3CKEA 4JZBA 2E91A 3LLWA 5C05A 2AZJA 3M02A 4KVWA 3IPIA 5IK6A 3TFPA 5B02A 3WCCA 3V1XA 5ILZA 3N3DA 2J5CA 4DXJA 1RTRA 5DJRF 3LVSA 3N3LF 3ICKA 3V1VA 5DGNF 5E8KA 3N0GA 2Q80A 5A0KA 4DI5A 3OYRA 2Z7IA 2Z4XA 3WCJA 5AFXA 2ONHA 3LGZB 3SDRA 1N24A 5CG5A 1ZW5A 4OMGA 4LFEA 2OPNA 3NPKA 2Q9ZA 3SDUA 2DH4A 4ZQ8A 1HM7A 4KQSA 4KVYA 3SDTA 5ILIA 3SAEA 3M9UA 4GP2A 4F6VA 1WL3A 5IL3A 3QKCA 5DHKA 5JA0F 5AHUB 5ILHA 3LMDA 5AELA 1UBXA 3WEKA 3DYHA 4DZWA 4KFAA 2Z4WA 3RMGA 5EATA 5I1UA 2Z4YA 5DJPF 5B0MA 1WL2A 5B0JA 1N21A 4LFVF 4PVYF 3WEFA 3ZL6A 1VG7A 2Z78A 4KQ5A 3WCFA 2E8TA 4JXYA 4NKFA 5JV2F 3NRIA 3WCBA 4LZCA 3WCHA 5IL8A 2ZEUA 1WL0A 2F9KF 2Z4ZA 3WJKA 3WCAA 5B00A 4P0XA 3TFVA 2PS8A 4H5EF 5ER8A 2E90A 4Q23A 3M01A 4P0VA 2E92A 4H5CF 3ZMCA 3TFNA 2AETA 3CP6A 1VG6A 4KVIA 3MAVA 3N0FA 2F8ZF 4DHDA 5IK9A 3P8LA 3G4FA 4KUXA 2OGDA 4XQRF 4LIXA 3AE0A 4JYXA 4GA3A 4EA0A 3WC9A 2PS7A 2OA6A 3AQ0A 4KQUA 1V4HA 4E1EA 2EWGA 5EASA 5B0KA 2F92F 3WJOA 1N20A 3CC9A 4RXDA 3DYFA 1KIYA 4LTZA 4QPFA 3WSAA 1WKZA 2FORA 2AZKA 1YJ4A 3Q2QA 5IMPA 3WCIA 1UBYA 4OGUA 3ACWA 3V66A 2ZEVA 3OABB 4WK5A 1FPSA 2O1OA 3VJBA 2E8UA 1YYRA 3WCEA 2Q58A 4PVXF 3VJDA 2F94F 4E9UA 3LK5A 1V4EA 2VF6A 3ZCDA 3LSNA 3S4JA 4H5DF 4P0WA 3N45F 4GP1A 2H8OA 3WCDA 3WSBA 3LZ9A 3WCLA 4DEMF 4F6XA 5CG6A 1JFGA 1DGPA 3KROB 3VJEA 2PS6A 3KRPB 2PS4A 4LPHF 1WMWA 5DIQF 5HN9A 3PYAA 3LGKA 4XQTF 1JFAA 1N22A 1V4JA 5B0IA 5DGSF 4KK2A
chains in the Genus database with same CATH topology
1UBVA 2E8WA 2Z7HA 3PDEA 1KIZA 2F89F 4OKZA 3WEGA 3NF2A 3G4DA 3LEEA 3PKOA 3EGTA 3KRAB 4RXAA 2AEKA 3WCGA 1YYSA 3N6KF 3LJIA 2I19A 2QISA 1YHLA 3LDWA 4MC8A 3Q1OA 2E4OA 4NFIF 3N1WF 3B7LA 3KBKA 2E8VA 3KRFA 4N1ZF 5DGMF 2PS5A 5JUZF 3ID0A 3ICZA 4NUAA 3WEJA 4LUUA 2P1CA 3OABA 3AQCB 4FJQA 2ZCRA 2E8XA 5IMIA 5ILKA 3ICMA 4OKMA 4JVJF 4K10A 1RQIA 5H9DA 3OACA 5DZ2A 5B03A 1N1ZA 3N1VF 5HN7A 3WCMA 3P41A 4NG6A 4XQSF 2Z4VA 3RYEA 4E9ZA 3TC1A 4QXSF 5DJVF 3KB9A 5IKHA 2E95A 1PS1A 3RBMA 1YHKA 1HXGA 4N9UA 3P8RA 3RYWA 3KRFB 4NKEA 3KRCB 3KROA 1V4KA 3BNYA 3KRPA 5AYPA 5JV0F 5KSXF 2AZLA 2RAHA 3ZMBA 3M0GA 5B0LA 5E8HA 3N5HF 3Q30A 4LLSA 5IK0A 4KKMA 3SDVA 3ACXA 1YV5A 4RNQA 2E94A 2Z50A 3OACB 5EROA 4FP4A 1YYTA 5ILDA 5EAUA 3KRAA 1EZFA 4KPDA 2ZCOA 3WEIA 3WE9A 3ACYA 3WEHA 1HM4A 3NPRA 3VJCA 3SDQA 4EA2A 5A0JA 1DI1A 2Z52A 2Q9YA 4LTVA 4LFGA 4LXWA 2AELA 2ONGA 3ADZA 3M00A 3AQBB 3PYBA 1RQJA 3PH7A 5DW7A 3IBAA 1YQ7A 3ASXA 4GAXA 4LA6A 4JXNA 2F8CF 3P5RA 5IMNA 3W7FA 2J1PA 3N46F 5ERMA 1V4IA 3MZVA 2FTZA 2OPMA 3QQVA 5IVGA 1VG2A 4LZ3A 3VJ8A 4LZ0A 2ZCSA 5HNAA 3TS7A 3ZOUA 3VJAA 3KRCA 3VJ9A 5ILYA 4RYPA 1VG3A 4HD1A 3LOMA 1VG4A 4UMJA 5JV1F 4OMHA 3UCAA 3N5JF 5DHIA 3WJNA 3APZA 2F7MF 5IM1A 4RXCA 2J1OA 3BNXA 4DWBA 1YYUA 5A0IA 4MC0A 4L2XF 3LG5A 4LOBA 5ILJA 1YHMA 4LLTA 5B01A 2ZCQA 4NFJF 1YYQA 3S9VA 4RXEA 5IKAA 5IN8A 4JZXA 4MC3A 5E8LA 3N49F 2E93A 3ICNA 1N1BA 3Q2ZA 1UBWA 5ERNA 4DWGA 1N23A 3P5PA 4LA5A 3EFQA 4F62A 1HX9A 4KPJA 4KWDA 3EZ3A 1HXCA 5HN8A 4NFKF 1WY0A 4KVDA 1HXAA 4LPGF 3DYGA 1WL1A 2ZY1A 4EA1A 3CKEA 4JZBA 2E91A 3LLWA 5C05A 2AZJA 3M02A 4KVWA 3IPIA 5IK6A 3TFPA 5B02A 3WCCA 3V1XA 5ILZA 3N3DA 2J5CA 4DXJA 1RTRA 5DJRF 3LVSA 3N3LF 3ICKA 3V1VA 5DGNF 5E8KA 3N0GA 2Q80A 5A0KA 4DI5A 3OYRA 2Z7IA 2Z4XA 3WCJA 5AFXA 2ONHA 3LGZB 3SDRA 1N24A 5CG5A 1ZW5A 4OMGA 4LFEA 2OPNA 3NPKA 2Q9ZA 3SDUA 2DH4A 4ZQ8A 1HM7A 4KQSA 4KVYA 3SDTA 5ILIA 3SAEA 3M9UA 4GP2A 4F6VA 1WL3A 5IL3A 3QKCA 5DHKA 5JA0F 5AHUB 5ILHA 3LMDA 5AELA 1UBXA 3WEKA 3DYHA 4DZWA 4KFAA 2Z4WA 3RMGA 5EATA 5I1UA 2Z4YA 5DJPF 5B0MA 1WL2A 5B0JA 1N21A 4LFVF 4PVYF 3WEFA 3ZL6A 1VG7A 2Z78A 4KQ5A 3WCFA 2E8TA 4JXYA 4NKFA 5JV2F 3NRIA 3WCBA 4LZCA 3WCHA 5IL8A 2ZEUA 1WL0A 2F9KF 2Z4ZA 3WJKA 3WCAA 5B00A 4P0XA 3TFVA 2PS8A 4H5EF 5ER8A 2E90A 4Q23A 3M01A 4P0VA 2E92A 4H5CF 3ZMCA 3TFNA 2AETA 3CP6A 1VG6A 4KVIA 3MAVA 3N0FA 2F8ZF 4DHDA 5IK9A 3P8LA 3G4FA 4KUXA 2OGDA 4XQRF 4LIXA 3AE0A 4JYXA 4GA3A 4EA0A 3WC9A 2PS7A 2OA6A 3AQ0A 4KQUA 1V4HA 4E1EA 2EWGA 5EASA 5B0KA 2F92F 3WJOA 1N20A 3CC9A 4RXDA 3DYFA 1KIYA 4LTZA 4QPFA 3WSAA 1WKZA 2FORA 2AZKA 1YJ4A 3Q2QA 5IMPA 3WCIA 1UBYA 4OGUA 3ACWA 3V66A 2ZEVA 3OABB 4WK5A 1FPSA 2O1OA 3VJBA 2E8UA 1YYRA 3WCEA 2Q58A 4PVXF 3VJDA 2F94F 4E9UA 3LK5A 1V4EA 2VF6A 3ZCDA 3LSNA 3S4JA 4H5DF 4P0WA 3N45F 4GP1A 2H8OA 3WCDA 3WSBA 3LZ9A 3WCLA 4DEMF 4F6XA 5CG6A 1JFGA 1DGPA 3KROB 3VJEA 2PS6A 3KRPB 2PS4A 4LPHF 1WMWA 5DIQF 5HN9A 3PYAA 3LGKA 4XQTF 1JFAA 1N22A 1V4JA 5B0IA 5DGSF 4KK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBV A;  2E8W A;  2Z7H A;  3PDE A;  1KIZ A;  2F89 F;  4OKZ A;  3WEG A;  3NF2 A;  3G4D A;  3LEE A;  3PKO A;  3EGT A;  3KRA B;  4RXA A;  2AEK A;  3WCG A;  1YYS A;  3N6K F;  3LJI A;  2I19 A;  2QIS A;  1YHL A;  3LDW A;  4MC8 A;  3Q1O A;  2E4O A;  4NFI F;  3N1W F;  3B7L A;  3KBK A;  2E8V A;  3KRF A;  4N1Z F;  5DGM F;  2PS5 A;  5JUZ F;  3ID0 A;  3ICZ A;  4NUA A;  3WEJ A;  4LUU A;  2P1C A;  3OAB A;  3AQC B;  4FJQ A;  2ZCR A;  2E8X A;  5IMI A;  5ILK A;  3ICM A;  4OKM A;  4JVJ F;  4K10 A;  1RQI A;  5H9D A;  3OAC A;  5DZ2 A;  5B03 A;  1N1Z A;  3N1V F;  5HN7 A;  3WCM A;  3P41 A;  4NG6 A;  4XQS F;  2Z4V A;  3RYE A;  4E9Z A;  3TC1 A;  4QXS F;  5DJV F;  3KB9 A;  5IKH A;  2E95 A;  1PS1 A;  3RBM A;  1YHK A;  1HXG A;  4N9U A;  3P8R A;  3RYW A;  3KRF B;  4NKE A;  3KRC B;  3KRO A;  1V4K A;  3BNY A;  3KRP A;  5AYP A;  5JV0 F;  5KSX F;  2AZL A;  2RAH A;  3ZMB A;  3M0G A;  5B0L A;  5E8H A;  3N5H F;  3Q30 A;  4LLS A;  5IK0 A;  4KKM A;  3SDV A;  3ACX A;  1YV5 A;  4RNQ A;  2E94 A;  2Z50 A;  3OAC B;  5ERO A;  4FP4 A;  1YYT A;  5ILD A;  5EAU A;  3KRA A;  1EZF A;  4KPD A;  2ZCO A;  3WEI A;  3WE9 A;  3ACY A;  3WEH A;  1HM4 A;  3NPR A;  3VJC A;  3SDQ A;  4EA2 A;  5A0J A;  1DI1 A;  2Z52 A;  2Q9Y A;  4LTV A;  4LFG A;  4LXW A;  2AEL A;  2ONG A;  3ADZ A;  3M00 A;  3AQB B;  3PYB A;  1RQJ A;  3PH7 A;  5DW7 A;  3IBA A;  1YQ7 A;  3ASX A;  4GAX A;  4LA6 A;  4JXN A;  2F8C F;  3P5R A;  5IMN A;  3W7F A;  2J1P A;  3N46 F;  5ERM A;  1V4I A;  3MZV A;  2FTZ A;  2OPM A;  3QQV A;  5IVG A;  1VG2 A;  4LZ3 A;  3VJ8 A;  4LZ0 A;  2ZCS A;  5HNA A;  3TS7 A;  3ZOU A;  3VJA A;  3KRC A;  3VJ9 A;  5ILY A;  4RYP A;  1VG3 A;  4HD1 A;  3LOM A;  1VG4 A;  4UMJ A;  5JV1 F;  4OMH A;  3UCA A;  3N5J F;  5DHI A;  3WJN A;  3APZ A;  2F7M F;  5IM1 A;  4RXC A;  2J1O A;  3BNX A;  4DWB A;  1YYU A;  5A0I A;  4MC0 A;  4L2X F;  3LG5 A;  4LOB A;  5ILJ A;  1YHM A;  4LLT A;  5B01 A;  2ZCQ A;  4NFJ F;  1YYQ A;  3S9V A;  4RXE A;  5IKA A;  5IN8 A;  4JZX A;  4MC3 A;  5E8L A;  3N49 F;  2E93 A;  3ICN A;  1N1B A;  3Q2Z A;  1UBW A;  5ERN A;  4DWG A;  1N23 A;  3P5P A;  4LA5 A;  3EFQ A;  4F62 A;  1HX9 A;  4KPJ A;  4KWD A;  3EZ3 A;  1HXC A;  5HN8 A;  4NFK F;  1WY0 A;  4KVD A;  1HXA A;  4LPG F;  3DYG A;  1WL1 A;  2ZY1 A;  4EA1 A;  3CKE A;  4JZB A;  2E91 A;  3LLW A;  5C05 A;  2AZJ A;  3M02 A;  4KVW A;  3IPI A;  5IK6 A;  3TFP A;  5B02 A;  3WCC A;  3V1X A;  5ILZ A;  3N3D A;  2J5C A;  4DXJ A;  1RTR A;  5DJR F;  3LVS A;  3N3L F;  3ICK A;  3V1V A;  5DGN F;  5E8K A;  3N0G A;  2Q80 A;  5A0K A;  4DI5 A;  3OYR A;  2Z7I A;  2Z4X A;  3WCJ A;  5AFX A;  2ONH A;  3LGZ B;  3SDR A;  1N24 A;  5CG5 A;  1ZW5 A;  4OMG A;  4LFE A;  2OPN A;  3NPK A;  2Q9Z A;  3SDU A;  2DH4 A;  4ZQ8 A;  1HM7 A;  4KQS A;  4KVY A;  3SDT A;  5ILI A;  3SAE A;  3M9U A;  4GP2 A;  4F6V A;  1WL3 A;  5IL3 A;  3QKC A;  5DHK A;  5JA0 F;  5AHU B;  5ILH A;  3LMD A;  5AEL A;  1UBX A;  3WEK A;  3DYH A;  4DZW A;  4KFA A;  2Z4W A;  3RMG A;  5EAT A;  5I1U A;  2Z4Y A;  5DJP F;  5B0M A;  1WL2 A;  5B0J A;  1N21 A;  4LFV F;  4PVY F;  3WEF A;  3ZL6 A;  1VG7 A;  2Z78 A;  4KQ5 A;  3WCF A;  2E8T A;  4JXY A;  4NKF A;  5JV2 F;  3NRI A;  3WCB A;  4LZC A;  3WCH A;  5IL8 A;  2ZEU A;  1WL0 A;  2F9K F;  2Z4Z A;  3WJK A;  3WCA A;  5B00 A;  4P0X A;  3TFV A;  2PS8 A;  4H5E F;  5ER8 A;  2E90 A;  4Q23 A;  3M01 A;  4P0V A;  2E92 A;  4H5C F;  3ZMC A;  3TFN A;  2AET A;  3CP6 A;  1VG6 A;  4KVI A;  3MAV A;  3N0F A;  2F8Z F;  4DHD A;  5IK9 A;  3P8L A;  3G4F A;  4KUX A;  2OGD A;  4XQR F;  4LIX A;  3AE0 A;  4JYX A;  4GA3 A;  4EA0 A;  3WC9 A;  2PS7 A;  2OA6 A;  3AQ0 A;  4KQU A;  1V4H A;  4E1E A;  2EWG A;  5EAS A;  5B0K A;  2F92 F;  3WJO A;  1N20 A;  3CC9 A;  4RXD A;  3DYF A;  1KIY A;  4LTZ A;  4QPF A;  3WSA A;  1WKZ A;  2FOR A;  2AZK A;  1YJ4 A;  3Q2Q A;  5IMP A;  3WCI A;  1UBY A;  4OGU A;  3ACW A;  3V66 A;  2ZEV A;  3OAB B;  4WK5 A;  1FPS A;  2O1O A;  3VJB A;  2E8U A;  1YYR A;  3WCE A;  2Q58 A;  4PVX F;  3VJD A;  2F94 F;  4E9U A;  3LK5 A;  1V4E A;  2VF6 A;  3ZCD A;  3LSN A;  3S4J A;  4H5D F;  4P0W A;  3N45 F;  4GP1 A;  2H8O A;  3WCD A;  3WSB A;  3LZ9 A;  3WCL A;  4DEM F;  4F6X A;  5CG6 A;  1JFG A;  1DGP A;  3KRO B;  3VJE A;  2PS6 A;  3KRP B;  2PS4 A;  4LPH F;  1WMW A;  5DIQ F;  5HN9 A;  3PYA A;  3LGK A;  4XQT F;  1JFA A;  1N22 A;  1V4J A;  5B0I A;  5DGS F;  4KK2 A; 
#chains in the Genus database with same CATH topology
 1UBV A;  2E8W A;  2Z7H A;  3PDE A;  1KIZ A;  2F89 F;  4OKZ A;  3WEG A;  3NF2 A;  3G4D A;  3LEE A;  3PKO A;  3EGT A;  3KRA B;  4RXA A;  2AEK A;  3WCG A;  1YYS A;  3N6K F;  3LJI A;  2I19 A;  2QIS A;  1YHL A;  3LDW A;  4MC8 A;  3Q1O A;  2E4O A;  4NFI F;  3N1W F;  3B7L A;  3KBK A;  2E8V A;  3KRF A;  4N1Z F;  5DGM F;  2PS5 A;  5JUZ F;  3ID0 A;  3ICZ A;  4NUA A;  3WEJ A;  4LUU A;  2P1C A;  3OAB A;  3AQC B;  4FJQ A;  2ZCR A;  2E8X A;  5IMI A;  5ILK A;  3ICM A;  4OKM A;  4JVJ F;  4K10 A;  1RQI A;  5H9D A;  3OAC A;  5DZ2 A;  5B03 A;  1N1Z A;  3N1V F;  5HN7 A;  3WCM A;  3P41 A;  4NG6 A;  4XQS F;  2Z4V A;  3RYE A;  4E9Z A;  3TC1 A;  4QXS F;  5DJV F;  3KB9 A;  5IKH A;  2E95 A;  1PS1 A;  3RBM A;  1YHK A;  1HXG A;  4N9U A;  3P8R A;  3RYW A;  3KRF B;  4NKE A;  3KRC B;  3KRO A;  1V4K A;  3BNY A;  3KRP A;  5AYP A;  5JV0 F;  5KSX F;  2AZL A;  2RAH A;  3ZMB A;  3M0G A;  5B0L A;  5E8H A;  3N5H F;  3Q30 A;  4LLS A;  5IK0 A;  4KKM A;  3SDV A;  3ACX A;  1YV5 A;  4RNQ A;  2E94 A;  2Z50 A;  3OAC B;  5ERO A;  4FP4 A;  1YYT A;  5ILD A;  5EAU A;  3KRA A;  1EZF A;  4KPD A;  2ZCO A;  3WEI A;  3WE9 A;  3ACY A;  3WEH A;  1HM4 A;  3NPR A;  3VJC A;  3SDQ A;  4EA2 A;  5A0J A;  1DI1 A;  2Z52 A;  2Q9Y A;  4LTV A;  4LFG A;  4LXW A;  2AEL A;  2ONG A;  3ADZ A;  3M00 A;  3AQB B;  3PYB A;  1RQJ A;  3PH7 A;  5DW7 A;  3IBA A;  1YQ7 A;  3ASX A;  4GAX A;  4LA6 A;  4JXN A;  2F8C F;  3P5R A;  5IMN A;  3W7F A;  2J1P A;  3N46 F;  5ERM A;  1V4I A;  3MZV A;  2FTZ A;  2OPM A;  3QQV A;  5IVG A;  1VG2 A;  4LZ3 A;  3VJ8 A;  4LZ0 A;  2ZCS A;  5HNA A;  3TS7 A;  3ZOU A;  3VJA A;  3KRC A;  3VJ9 A;  5ILY A;  4RYP A;  1VG3 A;  4HD1 A;  3LOM A;  1VG4 A;  4UMJ A;  5JV1 F;  4OMH A;  3UCA A;  3N5J F;  5DHI A;  3WJN A;  3APZ A;  2F7M F;  5IM1 A;  4RXC A;  2J1O A;  3BNX A;  4DWB A;  1YYU A;  5A0I A;  4MC0 A;  4L2X F;  3LG5 A;  4LOB A;  5ILJ A;  1YHM A;  4LLT A;  5B01 A;  2ZCQ A;  4NFJ F;  1YYQ A;  3S9V A;  4RXE A;  5IKA A;  5IN8 A;  4JZX A;  4MC3 A;  5E8L A;  3N49 F;  2E93 A;  3ICN A;  1N1B A;  3Q2Z A;  1UBW A;  5ERN A;  4DWG A;  1N23 A;  3P5P A;  4LA5 A;  3EFQ A;  4F62 A;  1HX9 A;  4KPJ A;  4KWD A;  3EZ3 A;  1HXC A;  5HN8 A;  4NFK F;  1WY0 A;  4KVD A;  1HXA A;  4LPG F;  3DYG A;  1WL1 A;  2ZY1 A;  4EA1 A;  3CKE A;  4JZB A;  2E91 A;  3LLW A;  5C05 A;  2AZJ A;  3M02 A;  4KVW A;  3IPI A;  5IK6 A;  3TFP A;  5B02 A;  3WCC A;  3V1X A;  5ILZ A;  3N3D A;  2J5C A;  4DXJ A;  1RTR A;  5DJR F;  3LVS A;  3N3L F;  3ICK A;  3V1V A;  5DGN F;  5E8K A;  3N0G A;  2Q80 A;  5A0K A;  4DI5 A;  3OYR A;  2Z7I A;  2Z4X A;  3WCJ A;  5AFX A;  2ONH A;  3LGZ B;  3SDR A;  1N24 A;  5CG5 A;  1ZW5 A;  4OMG A;  4LFE A;  2OPN A;  3NPK A;  2Q9Z A;  3SDU A;  2DH4 A;  4ZQ8 A;  1HM7 A;  4KQS A;  4KVY A;  3SDT A;  5ILI A;  3SAE A;  3M9U A;  4GP2 A;  4F6V A;  1WL3 A;  5IL3 A;  3QKC A;  5DHK A;  5JA0 F;  5AHU B;  5ILH A;  3LMD A;  5AEL A;  1UBX A;  3WEK A;  3DYH A;  4DZW A;  4KFA A;  2Z4W A;  3RMG A;  5EAT A;  5I1U A;  2Z4Y A;  5DJP F;  5B0M A;  1WL2 A;  5B0J A;  1N21 A;  4LFV F;  4PVY F;  3WEF A;  3ZL6 A;  1VG7 A;  2Z78 A;  4KQ5 A;  3WCF A;  2E8T A;  4JXY A;  4NKF A;  5JV2 F;  3NRI A;  3WCB A;  4LZC A;  3WCH A;  5IL8 A;  2ZEU A;  1WL0 A;  2F9K F;  2Z4Z A;  3WJK A;  3WCA A;  5B00 A;  4P0X A;  3TFV A;  2PS8 A;  4H5E F;  5ER8 A;  2E90 A;  4Q23 A;  3M01 A;  4P0V A;  2E92 A;  4H5C F;  3ZMC A;  3TFN A;  2AET A;  3CP6 A;  1VG6 A;  4KVI A;  3MAV A;  3N0F A;  2F8Z F;  4DHD A;  5IK9 A;  3P8L A;  3G4F A;  4KUX A;  2OGD A;  4XQR F;  4LIX A;  3AE0 A;  4JYX A;  4GA3 A;  4EA0 A;  3WC9 A;  2PS7 A;  2OA6 A;  3AQ0 A;  4KQU A;  1V4H A;  4E1E A;  2EWG A;  5EAS A;  5B0K A;  2F92 F;  3WJO A;  1N20 A;  3CC9 A;  4RXD A;  3DYF A;  1KIY A;  4LTZ A;  4QPF A;  3WSA A;  1WKZ A;  2FOR A;  2AZK A;  1YJ4 A;  3Q2Q A;  5IMP A;  3WCI A;  1UBY A;  4OGU A;  3ACW A;  3V66 A;  2ZEV A;  3OAB B;  4WK5 A;  1FPS A;  2O1O A;  3VJB A;  2E8U A;  1YYR A;  3WCE A;  2Q58 A;  4PVX F;  3VJD A;  2F94 F;  4E9U A;  3LK5 A;  1V4E A;  2VF6 A;  3ZCD A;  3LSN A;  3S4J A;  4H5D F;  4P0W A;  3N45 F;  4GP1 A;  2H8O A;  3WCD A;  3WSB A;  3LZ9 A;  3WCL A;  4DEM F;  4F6X A;  5CG6 A;  1JFG A;  1DGP A;  3KRO B;  3VJE A;  2PS6 A;  3KRP B;  2PS4 A;  4LPH F;  1WMW A;  5DIQ F;  5HN9 A;  3PYA A;  3LGK A;  4XQT F;  1JFA A;  1N22 A;  1V4J A;  5B0I A;  5DGS F;  4KK2 A; 
#chains in the Genus database with same CATH homology
 1UBV A;  2E8W A;  2Z7H A;  3PDE A;  1KIZ A;  2F89 F;  4OKZ A;  3WEG A;  3NF2 A;  3G4D A;  3LEE A;  3PKO A;  3EGT A;  3KRA B;  4RXA A;  2AEK A;  3WCG A;  1YYS A;  3N6K F;  3LJI A;  2I19 A;  2QIS A;  1YHL A;  3LDW A;  4MC8 A;  3Q1O A;  2E4O A;  4NFI F;  3N1W F;  3B7L A;  3KBK A;  2E8V A;  3KRF A;  4N1Z F;  5DGM F;  2PS5 A;  5JUZ F;  3ID0 A;  3ICZ A;  4NUA A;  3WEJ A;  4LUU A;  2P1C A;  3OAB A;  3AQC B;  4FJQ A;  2ZCR A;  2E8X A;  5IMI A;  5ILK A;  3ICM A;  4OKM A;  4JVJ F;  4K10 A;  1RQI A;  5H9D A;  3OAC A;  5DZ2 A;  5B03 A;  1N1Z A;  3N1V F;  5HN7 A;  3WCM A;  3P41 A;  4NG6 A;  4XQS F;  2Z4V A;  3RYE A;  4E9Z A;  3TC1 A;  4QXS F;  5DJV F;  3KB9 A;  5IKH A;  2E95 A;  1PS1 A;  3RBM A;  1YHK A;  1HXG A;  4N9U A;  3P8R A;  3RYW A;  3KRF B;  4NKE A;  3KRC B;  3KRO A;  1V4K A;  3BNY A;  3KRP A;  5AYP A;  5JV0 F;  5KSX F;  2AZL A;  2RAH A;  3ZMB A;  3M0G A;  5B0L A;  5E8H A;  3N5H F;  3Q30 A;  4LLS A;  5IK0 A;  4KKM A;  3SDV A;  3ACX A;  1YV5 A;  4RNQ A;  2E94 A;  2Z50 A;  3OAC B;  5ERO A;  4FP4 A;  1YYT A;  5ILD A;  5EAU A;  3KRA A;  1EZF A;  4KPD A;  2ZCO A;  3WEI A;  3WE9 A;  3ACY A;  3WEH A;  1HM4 A;  3NPR A;  3VJC A;  3SDQ A;  4EA2 A;  5A0J A;  1DI1 A;  2Z52 A;  2Q9Y A;  4LTV A;  4LFG A;  4LXW A;  2AEL A;  2ONG A;  3ADZ A;  3M00 A;  3AQB B;  3PYB A;  1RQJ A;  3PH7 A;  5DW7 A;  3IBA A;  1YQ7 A;  3ASX A;  4GAX A;  4LA6 A;  4JXN A;  2F8C F;  3P5R A;  5IMN A;  3W7F A;  2J1P A;  3N46 F;  5ERM A;  1V4I A;  3MZV A;  2FTZ A;  2OPM A;  3QQV A;  5IVG A;  1VG2 A;  4LZ3 A;  3VJ8 A;  4LZ0 A;  2ZCS A;  5HNA A;  3TS7 A;  3ZOU A;  3VJA A;  3KRC A;  3VJ9 A;  5ILY A;  4RYP A;  1VG3 A;  4HD1 A;  3LOM A;  1VG4 A;  4UMJ A;  5JV1 F;  4OMH A;  3UCA A;  3N5J F;  5DHI A;  3WJN A;  3APZ A;  2F7M F;  5IM1 A;  4RXC A;  2J1O A;  3BNX A;  4DWB A;  1YYU A;  5A0I A;  4MC0 A;  4L2X F;  3LG5 A;  4LOB A;  5ILJ A;  1YHM A;  4LLT A;  5B01 A;  2ZCQ A;  4NFJ F;  1YYQ A;  3S9V A;  4RXE A;  5IKA A;  5IN8 A;  4JZX A;  4MC3 A;  5E8L A;  3N49 F;  2E93 A;  3ICN A;  1N1B A;  3Q2Z A;  1UBW A;  5ERN A;  4DWG A;  1N23 A;  3P5P A;  4LA5 A;  3EFQ A;  4F62 A;  1HX9 A;  4KPJ A;  4KWD A;  3EZ3 A;  1HXC A;  5HN8 A;  4NFK F;  1WY0 A;  4KVD A;  1HXA A;  4LPG F;  3DYG A;  1WL1 A;  2ZY1 A;  4EA1 A;  3CKE A;  4JZB A;  2E91 A;  3LLW A;  5C05 A;  2AZJ A;  3M02 A;  4KVW A;  3IPI A;  5IK6 A;  3TFP A;  5B02 A;  3WCC A;  3V1X A;  5ILZ A;  3N3D A;  2J5C A;  4DXJ A;  1RTR A;  5DJR F;  3LVS A;  3N3L F;  3ICK A;  3V1V A;  5DGN F;  5E8K A;  3N0G A;  2Q80 A;  5A0K A;  4DI5 A;  3OYR A;  2Z7I A;  2Z4X A;  3WCJ A;  5AFX A;  2ONH A;  3LGZ B;  3SDR A;  1N24 A;  5CG5 A;  1ZW5 A;  4OMG A;  4LFE A;  2OPN A;  3NPK A;  2Q9Z A;  3SDU A;  2DH4 A;  4ZQ8 A;  1HM7 A;  4KQS A;  4KVY A;  3SDT A;  5ILI A;  3SAE A;  3M9U A;  4GP2 A;  4F6V A;  1WL3 A;  5IL3 A;  3QKC A;  5DHK A;  5JA0 F;  5AHU B;  5ILH A;  3LMD A;  5AEL A;  1UBX A;  3WEK A;  3DYH A;  4DZW A;  4KFA A;  2Z4W A;  3RMG A;  5EAT A;  5I1U A;  2Z4Y A;  5DJP F;  5B0M A;  1WL2 A;  5B0J A;  1N21 A;  4LFV F;  4PVY F;  3WEF A;  3ZL6 A;  1VG7 A;  2Z78 A;  4KQ5 A;  3WCF A;  2E8T A;  4JXY A;  4NKF A;  5JV2 F;  3NRI A;  3WCB A;  4LZC A;  3WCH A;  5IL8 A;  2ZEU A;  1WL0 A;  2F9K F;  2Z4Z A;  3WJK A;  3WCA A;  5B00 A;  4P0X A;  3TFV A;  2PS8 A;  4H5E F;  5ER8 A;  2E90 A;  4Q23 A;  3M01 A;  4P0V A;  2E92 A;  4H5C F;  3ZMC A;  3TFN A;  2AET A;  3CP6 A;  1VG6 A;  4KVI A;  3MAV A;  3N0F A;  2F8Z F;  4DHD A;  5IK9 A;  3P8L A;  3G4F A;  4KUX A;  2OGD A;  4XQR F;  4LIX A;  3AE0 A;  4JYX A;  4GA3 A;  4EA0 A;  3WC9 A;  2PS7 A;  2OA6 A;  3AQ0 A;  4KQU A;  1V4H A;  4E1E A;  2EWG A;  5EAS A;  5B0K A;  2F92 F;  3WJO A;  1N20 A;  3CC9 A;  4RXD A;  3DYF A;  1KIY A;  4LTZ A;  4QPF A;  3WSA A;  1WKZ A;  2FOR A;  2AZK A;  1YJ4 A;  3Q2Q A;  5IMP A;  3WCI A;  1UBY A;  4OGU A;  3ACW A;  3V66 A;  2ZEV A;  3OAB B;  4WK5 A;  1FPS A;  2O1O A;  3VJB A;  2E8U A;  1YYR A;  3WCE A;  2Q58 A;  4PVX F;  3VJD A;  2F94 F;  4E9U A;  3LK5 A;  1V4E A;  2VF6 A;  3ZCD A;  3LSN A;  3S4J A;  4H5D F;  4P0W A;  3N45 F;  4GP1 A;  2H8O A;  3WCD A;  3WSB A;  3LZ9 A;  3WCL A;  4DEM F;  4F6X A;  5CG6 A;  1JFG A;  1DGP A;  3KRO B;  3VJE A;  2PS6 A;  3KRP B;  2PS4 A;  4LPH F;  1WMW A;  5DIQ F;  5HN9 A;  3PYA A;  3LGK A;  4XQT F;  1JFA A;  1N22 A;  1V4J A;  5B0I A;  5DGS F;  4KK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...