4KWBA

Structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
237
Chain Sequence
PSSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKKLEEIKKETKKPIYVSMGSMAASGGYYISTAADKIFATPETLTGSLGVIMESVNYSKLADKLGISFETIKSGAHADIMSPSREMTKEEKNIMQSMVDNSYEGFVDVISKGRGMPKAEVKKIADGRVYDGRQAKKLNLVDELGFYDDTITAMKKDHKDLKNASVISYESPRMMYLYAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of signal peptide peptidase A with C-termini bound in the active sites: insights into specificity, self-processing, and regulation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Signal peptide peptidase SppA
total genus 79
structure length 237
sequence length 268
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01343 Peptidase_S49 Peptidase family S49
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1750.20 Alpha Beta 3-Layer(aba) Sandwich peptide peptidase (sppa) fold peptide peptidase (sppa) fold 4kwbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4kwbA01
1W2XA 4ZU2A 3WG5A 2WTBA 3K8XA 2J5GD 4YLHA 2HW5A 2ZQRA 1EF9A 3NJBA 3TT6A 4QIIA 4MOUA 4FNDA 1UYTA 1DCIA 4KD6A 3QREA 3LKEA 5CTBA 4EMPA 3V5IA 1OD2A 4QIJA 2FW2A 4G2RA 3PGQA 1N6FA 5DUCA 2F9IA 1NZYA 3PEAA 3Q0GA 1PIXA 1FCFA 3V5EA 5DU6A 4I52A 1XNVA 1DUBA 4NNQA 2IEXA 5C90A 4JSBA 4U0GA 1RJNA 2J5IB 3G64A 4OMRA 1NZYB 3T89A 3U9RB 4Q0GA 3TV5A 3QMJA 4HC8A 3OC7A 2VSUE 2DEOA 3QXZA 4KPKA 3Q1TA 1XO6A 2FZSA 4Q1IA 3FDUA 1FC7A 3I47A 3ZW8A 2NP9A 3STAA 5DUFA 5KJPA 3T3WA 5E0NX 3T8BA 3SWXA 5IKLB 3U9SB 4OLQA 1Y7OA 4B3HA 1N6EA 1EF8A 5DL1A 4LK5A 4WYOB 3ZW9A 5DTWA 3T8AA 4NEKA 1N6DA 2VSUC 2VREA 3H02A 3ST9A 3N6RB 3BPPA 3R9SA 2ZL0A 4JVTA 2VSSE 2PG8A 3T88A 2F6QA 3LAOA 2J5SA 4QFEA 4ZDFA 3Q7HA 5MGBA 5INGA 4FZWC 4U1AA 4OG1A 4MI2A 2VSUA 3GLMA 1HNOA 5FIFA 1UYSA 4GM2A 4JFCA 3R0OA 3MOYA 4KNPA 2ZQQA 3R9TA 1WDMA 5DKPA 4IZDA 5INFA 4U19A 4JCSA 1XNWA 3QWDA 1K32A 3SLLA 2ZL3A 2DUBA 2C8TA 3HINA 4FN8A 3DORA 3ISAA 2CBYA 2ZL2A 3BEZA 2VSSF 2FBMA 1TG6A 3TVUA 1WDKA 2F9YA 3HLN1 2BZRA 4U18A 1ON9A 3PE8A 3QKAA 1TYFA 3Q0JA 4U0GH 4WCZA 5KDRA 1SZOA 3KTKA 4IZCA 1O8UA 2F6IA 4ZDCA 4JWVA 3KTJA 3GMAA 3TZ3A 3KQFA 3P5MA 2F9IB 2A81A 1JXZA 2W3PA 3GF3A 3GF7A 5KDRB 4I4ZA 3RSTA 1UYVA 3KTIA 3H81A 1WZ8A 3ZWCA 5JBWA 1SG4A 1PJHA 4DI1A 4EMMA 2J5IA 3KTHA 5JBXA 1EY3A 1K39A 4JJTA 3K50A 3H0UA 3BF0A 3H0QA 3P2LA 3RRVA 1ON3A 1Q51A 3OMEA 1UYRA 4JOTA 2GTRA 3ZWAA 4L8KA 3IB9A 3P85A 2Q34A 1X0UA 3NJDA 3HRXA 2A7KA 4ZDBA 3PZKA 4B3JA 2QQ3A 4K3WA 5C9GA 2PPYA 5DU4A 4WZ8B 1OD4A 2A7SA 4ASIA 4Z0MA 3QK8A 2EJ5A 2Q2XA 3GKBA 3MFMA 2VSUF 4K2NA 3JU1A 4JCTA 4RYFH 1FC9A 4IZBA 3IAVA 2CE3A 1UIYA 5DZKH 2D3TA 5G1RA 4K29A 4JCRA 3KTGA 4RCNA 4FB8A 4KWBA 2X24A 4JYJA 2PBPA 3HE2A 4L6WA 1MJ3A 2J5GA 5INIA 5FUSA 5E0SH 4ELXA 3TRRA 1J7XA 1RJMA 4FNBA 1XNYA 3ZWBA 4RYFA 3M6NA 3R9QA 2J5II 1XX4A 4FN7A 3QXIA 3QYRA 2VSSA 4MXIA 5DTPA 1YG6A 3TDCA 2F9YB 4HNKA 2X58A 3L3SA 2Q35A 4ELWA 4F47A 3MYBA 1HZDA 3IBBA 4B3IA 3U9TB 4EMLA 4ZDDA 1Q52A 5E0SA 4U0HA 4ZDEA 4JYLA 1HNUA 3TT7A 3HP0A 3M6MA 3FF6A 4GHNA 5G1QA 1VRGA 3MT6A 1YG8A 3OT6A 1WDLA 1FC6A 4FZWA 3TVWA 4ELSA 5DZKA 4FJWD 3VIVA 4JCQA 3DJAA 5G1SA 3H0SA 5CTCA 3RSIA 2ZL4A 3TLFA 2VX2A 5DU8A 2UZFA 4I42A 3R6HA 3H0JA
chains in the Genus database with same CATH superfamily
1W2XA 4ZU2A 3WG5A 2WTBA 3K8XA 2J5GD 4YLHA 2HW5A 2ZQRA 1EF9A 3NJBA 3TT6A 4QIIA 4MOUA 4FNDA 1UYTA 1DCIA 4KD6A 3QREA 3LKEA 5CTBA 4EMPA 3V5IA 1OD2A 4QIJA 2FW2A 4G2RA 3PGQA 1N6FA 5HUQA 5DUCA 2F9IA 1NZYA 3PEAA 3Q0GA 1PIXA 1FCFA 3V5EA 5DU6A 4I52A 1XNVA 1DUBA 4NNQA 2IEXA 5C90A 4JSBA 4U0GA 1RJNA 2J5IB 3G64A 4OMRA 1NZYB 3T89A 3U9RB 4Q0GA 3TV5A 3QMJA 4HC8A 3OC7A 2VSUE 2DEOA 3QXZA 4KPKA 3Q1TA 1XO6A 2FZSA 4Q1IA 3FDUA 1FC7A 3I47A 3ZW8A 2NP9A 3STAA 5DUFA 5KJPA 3T3WA 5E0NX 3T8BA 3SWXA 5IKLB 3U9SB 4OLQA 1Y7OA 4B3HA 1N6EA 1EF8A 5DL1A 4LK5A 4WYOB 3ZW9A 5DTWA 3T8AA 4NEKA 1N6DA 2VSUC 2VREA 3H02A 3ST9A 3N6RB 3BPPA 3R9SA 2ZL0A 4JVTA 2VSSE 2PG8A 3T88A 2F6QA 3LAOA 2J5SA 4QFEA 4ZDFA 3Q7HA 5MGBA 5INGA 4FZWC 4U1AA 4OG1A 4MI2A 2VSUA 3GLMA 1HNOA 5FIFA 1UYSA 4GM2A 4JFCA 3R0OA 3MOYA 4KNPA 2ZQQA 3R9TA 1WDMA 5DKPA 4IZDA 5INFA 4U19A 2YJGA 4JCSA 1XNWA 3QWDA 1K32A 3SLLA 2ZL3A 2DUBA 2C8TA 3HINA 4FN8A 3DORA 3ISAA 2CBYA 3BEZA 2ZL2A 2VSSF 2FBMA 1TG6A 3TVUA 1WDKA 2F9YA 3HLN1 2BZRA 4U18A 1ON9A 3PE8A 3QKAA 1TYFA 3Q0JA 4U0GH 4WCZA 5KDRA 1SZOA 3KTKA 4IZCA 1O8UA 2F6IA 4ZDCA 4JWVA 3KTJA 3GMAA 3TZ3A 3KQFA 3P5MA 2F9IB 2A81A 1JXZA 2W3PA 3GF3A 3GF7A 5KDRB 4I4ZA 3RSTA 1UYVA 3KTIA 3H81A 1WZ8A 3ZWCA 5JBWA 1SG4A 1PJHA 4DI1A 4EMMA 2J5IA 3KTHA 5JBXA 1EY3A 1K39A 4JJTA 3K50A 3H0UA 4J2UA 3BF0A 3H0QA 3P2LA 3RRVA 1ON3A 1Q51A 3OMEA 1UYRA 4JOTA 2GTRA 3ZWAA 4L8KA 3IB9A 3P85A 2Q34A 1X0UA 3NJDA 3HRXA 2A7KA 4ZDBA 3PZKA 4B3JA 2QQ3A 4K3WA 5C9GA 2PPYA 5DU4A 4WZ8B 1OD4A 2A7SA 4ASIA 4Z0MA 3QK8A 2EJ5A 2Q2XA 3GKBA 3MFMA 2VSUF 4K2NA 3JU1A 4JCTA 4RYFH 1FC9A 4IZBA 3IAVA 2CE3A 1UIYA 5DZKH 2D3TA 5G1RA 4K29A 4JCRA 3KTGA 4RCNA 4FB8A 4KWBA 2X24A 4JYJA 2PBPA 3HE2A 4L6WA 1MJ3A 2J5GA 5INIA 5FUSA 5E0SH 4ELXA 3TRRA 1J7XA 1RJMA 4FNBA 1XNYA 3ZWBA 4RYFA 3M6NA 3R9QA 2J5II 1XX4A 4FN7A 3QXIA 3QYRA 2VSSA 4MXIA 5DTPA 1YG6A 3TDCA 2F9YB 4HNKA 2X58A 3L3SA 2Q35A 4ELWA 4F47A 3MYBA 1HZDA 3IBBA 4B3IA 3U9TB 4EMLA 4ZDDA 1Q52A 5E0SA 4U0HA 4ZDEA 4HDTA 4NARA 4JYLA 1HNUA 3TT7A 3HP0A 3M6MA 3FF6A 4GHNA 5G1QA 1VRGA 3MT6A 1YG8A 3OT6A 1WDLA 1FC6A 4FZWA 3TVWA 4ELSA 5DZKA 4FJWD 3VIVA 4JCQA 3DJAA 3BPTA 5G1SA 3H0SA 5CTCA 3RSIA 2ZL4A 3TLFA 2VX2A 5DU8A 2UZFA 4I42A 3R6HA 3H0JA
chains in the Genus database with same CATH topology
1W2XA 4ZU2A 3WG5A 2WTBA 3K8XA 2J5GD 4YLHA 2HW5A 2ZQRA 1EF9A 3NJBA 3TT6A 4QIIA 4MOUA 4FNDA 1UYTA 1DCIA 4KD6A 3QREA 3LKEA 5CTBA 4EMPA 3V5IA 1OD2A 4QIJA 2FW2A 4G2RA 3PGQA 1N6FA 5HUQA 5DUCA 2F9IA 1NZYA 3PEAA 3Q0GA 1PIXA 1FCFA 3V5EA 5DU6A 4I52A 1XNVA 1DUBA 4NNQA 2IEXA 5C90A 4JSBA 4U0GA 1RJNA 2J5IB 3G64A 4OMRA 1NZYB 3T89A 3U9RB 4Q0GA 3TV5A 3QMJA 4HC8A 3OC7A 2VSUE 2DEOA 3QXZA 4KPKA 3Q1TA 1XO6A 2FZSA 4Q1IA 3FDUA 1FC7A 3I47A 3ZW8A 2NP9A 3STAA 5DUFA 5KJPA 3T3WA 5E0NX 3T8BA 3SWXA 5IKLB 3U9SB 4OLQA 1Y7OA 4B3HA 1N6EA 1EF8A 5DL1A 4LK5A 4WYOB 3ZW9A 5DTWA 3T8AA 4NEKA 1N6DA 2VSUC 2VREA 3H02A 3ST9A 3N6RB 3BPPA 3R9SA 2ZL0A 4JVTA 2VSSE 2PG8A 3T88A 2F6QA 3LAOA 2J5SA 4QFEA 4ZDFA 3Q7HA 5MGBA 5INGA 4FZWC 4U1AA 4OG1A 4MI2A 2VSUA 3GLMA 1HNOA 5FIFA 1UYSA 4GM2A 4JFCA 3R0OA 3MOYA 4KNPA 2ZQQA 3R9TA 1WDMA 5DKPA 4IZDA 5INFA 4U19A 2YJGA 4JCSA 1XNWA 3QWDA 1K32A 3SLLA 2ZL3A 2DUBA 2C8TA 3HINA 4FN8A 3DORA 3ISAA 2CBYA 2ZL2A 3BEZA 2VSSF 2FBMA 1TG6A 3TVUA 1WDKA 2F9YA 3HLN1 2BZRA 4U18A 1ON9A 3PE8A 3QKAA 1TYFA 3Q0JA 4U0GH 4WCZA 5KDRA 1SZOA 3KTKA 4IZCA 1O8UA 2F6IA 4ZDCA 4JWVA 3KTJA 3GMAA 3TZ3A 3KQFA 3P5MA 2F9IB 2A81A 1JXZA 2W3PA 3GF3A 3GF7A 5KDRB 4I4ZA 3RSTA 1UYVA 3KTIA 3H81A 1WZ8A 3ZWCA 5JBWA 1SG4A 1PJHA 4DI1A 4EMMA 2J5IA 3KTHA 5JBXA 1EY3A 1K39A 4JJTA 3K50A 3H0UA 4J2UA 3BF0A 3H0QA 3P2LA 3RRVA 1ON3A 1Q51A 3OMEA 1UYRA 4JOTA 2GTRA 3ZWAA 4L8KA 3IB9A 3P85A 2Q34A 1X0UA 3NJDA 3HRXA 2A7KA 4ZDBA 3PZKA 4B3JA 2QQ3A 4K3WA 5C9GA 2PPYA 5DU4A 4WZ8B 1OD4A 2A7SA 4ASIA 4Z0MA 3QK8A 2EJ5A 2Q2XA 3GKBA 3MFMA 2VSUF 4K2NA 3JU1A 4JCTA 4RYFH 1FC9A 4IZBA 3IAVA 2CE3A 1UIYA 5DZKH 2D3TA 5G1RA 4K29A 4JCRA 3KTGA 4RCNA 4FB8A 4KWBA 2X24A 4JYJA 2PBPA 3HE2A 4L6WA 1MJ3A 2J5GA 5INIA 5FUSA 5E0SH 4ELXA 3TRRA 1J7XA 1RJMA 4FNBA 1XNYA 3ZWBA 4RYFA 3M6NA 3R9QA 2J5II 1XX4A 4FN7A 3QXIA 3QYRA 2VSSA 4MXIA 5DTPA 1YG6A 3TDCA 2F9YB 4HNKA 2X58A 3L3SA 2Q35A 4ELWA 4F47A 3MYBA 1HZDA 3IBBA 4B3IA 3U9TB 4EMLA 4ZDDA 1Q52A 5E0SA 4U0HA 4ZDEA 4HDTA 4NARA 4JYLA 1HNUA 3TT7A 3HP0A 3M6MA 3FF6A 4GHNA 5G1QA 1VRGA 3MT6A 1YG8A 3OT6A 1WDLA 1FC6A 4FZWA 3TVWA 4ELSA 5DZKA 4FJWD 3VIVA 4JCQA 3DJAA 3BPTA 5G1SA 3H0SA 5CTCA 3RSIA 2ZL4A 3TLFA 2VX2A 5DU8A 2UZFA 4I42A 3R6HA 3H0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2X A;  4ZU2 A;  3WG5 A;  2WTB A;  3K8X A;  2J5G D;  4YLH A;  2HW5 A;  2ZQR A;  1EF9 A;  3NJB A;  3TT6 A;  4QII A;  4MOU A;  4FND A;  1UYT A;  1DCI A;  4KD6 A;  3QRE A;  3LKE A;  5CTB A;  4EMP A;  3V5I A;  1OD2 A;  4QIJ A;  2FW2 A;  4G2R A;  3PGQ A;  1N6F A;  5DUC A;  2F9I A;  1NZY A;  3PEA A;  3Q0G A;  1PIX A;  1FCF A;  3V5E A;  5DU6 A;  4I52 A;  1XNV A;  1DUB A;  4NNQ A;  2IEX A;  5C90 A;  4JSB A;  4U0G A;  1RJN A;  2J5I B;  3G64 A;  4OMR A;  1NZY B;  3T89 A;  3U9R B;  4Q0G A;  3TV5 A;  3QMJ A;  4HC8 A;  3OC7 A;  2VSU E;  2DEO A;  3QXZ A;  4KPK A;  3Q1T A;  1XO6 A;  2FZS A;  4Q1I A;  3FDU A;  1FC7 A;  3I47 A;  3ZW8 A;  2NP9 A;  3STA A;  5DUF A;  5KJP A;  3T3W A;  5E0N X;  3T8B A;  3SWX A;  5IKL B;  3U9S B;  4OLQ A;  1Y7O A;  4B3H A;  1N6E A;  1EF8 A;  5DL1 A;  4LK5 A;  4WYO B;  3ZW9 A;  5DTW A;  3T8A A;  4NEK A;  1N6D A;  2VSU C;  2VRE A;  3H02 A;  3ST9 A;  3N6R B;  3BPP A;  3R9S A;  2ZL0 A;  4JVT A;  2VSS E;  2PG8 A;  3T88 A;  2F6Q A;  3LAO A;  2J5S A;  4QFE A;  4ZDF A;  3Q7H A;  5MGB A;  5ING A;  4FZW C;  4U1A A;  4OG1 A;  4MI2 A;  2VSU A;  3GLM A;  1HNO A;  5FIF A;  1UYS A;  4GM2 A;  4JFC A;  3R0O A;  3MOY A;  4KNP A;  2ZQQ A;  3R9T A;  1WDM A;  5DKP A;  4IZD A;  5INF A;  4U19 A;  4JCS A;  1XNW A;  3QWD A;  1K32 A;  3SLL A;  2ZL3 A;  2DUB A;  2C8T A;  3HIN A;  4FN8 A;  3DOR A;  3ISA A;  2CBY A;  2ZL2 A;  3BEZ A;  2VSS F;  2FBM A;  1TG6 A;  3TVU A;  1WDK A;  2F9Y A;  3HLN 1;  2BZR A;  4U18 A;  1ON9 A;  3PE8 A;  3QKA A;  1TYF A;  3Q0J A;  4U0G H;  4WCZ A;  5KDR A;  1SZO A;  3KTK A;  4IZC A;  1O8U A;  2F6I A;  4ZDC A;  4JWV A;  3KTJ A;  3GMA A;  3TZ3 A;  3KQF A;  3P5M A;  2F9I B;  2A81 A;  1JXZ A;  2W3P A;  3GF3 A;  3GF7 A;  5KDR B;  4I4Z A;  3RST A;  1UYV A;  3KTI A;  3H81 A;  1WZ8 A;  3ZWC A;  5JBW A;  1SG4 A;  1PJH A;  4DI1 A;  4EMM A;  2J5I A;  3KTH A;  5JBX A;  1EY3 A;  1K39 A;  4JJT A;  3K50 A;  3H0U A;  3BF0 A;  3H0Q A;  3P2L A;  3RRV A;  1ON3 A;  1Q51 A;  3OME A;  1UYR A;  4JOT A;  2GTR A;  3ZWA A;  4L8K A;  3IB9 A;  3P85 A;  2Q34 A;  1X0U A;  3NJD A;  3HRX A;  2A7K A;  4ZDB A;  3PZK A;  4B3J A;  2QQ3 A;  4K3W A;  5C9G A;  2PPY A;  5DU4 A;  4WZ8 B;  1OD4 A;  2A7S A;  4ASI A;  4Z0M A;  3QK8 A;  2EJ5 A;  2Q2X A;  3GKB A;  3MFM A;  2VSU F;  4K2N A;  3JU1 A;  4JCT A;  4RYF H;  1FC9 A;  4IZB A;  3IAV A;  2CE3 A;  1UIY A;  5DZK H;  2D3T A;  5G1R A;  4K29 A;  4JCR A;  3KTG A;  4RCN A;  4FB8 A;  4KWB A;  2X24 A;  4JYJ A;  2PBP A;  3HE2 A;  4L6W A;  1MJ3 A;  2J5G A;  5INI A;  5FUS A;  5E0S H;  4ELX A;  3TRR A;  1J7X A;  1RJM A;  4FNB A;  1XNY A;  3ZWB A;  4RYF A;  3M6N A;  3R9Q A;  2J5I I;  1XX4 A;  4FN7 A;  3QXI A;  3QYR A;  2VSS A;  4MXI A;  5DTP A;  1YG6 A;  3TDC A;  2F9Y B;  4HNK A;  2X58 A;  3L3S A;  2Q35 A;  4ELW A;  4F47 A;  3MYB A;  1HZD A;  3IBB A;  4B3I A;  3U9T B;  4EML A;  4ZDD A;  1Q52 A;  5E0S A;  4U0H A;  4ZDE A;  4JYL A;  1HNU A;  3TT7 A;  3HP0 A;  3M6M A;  3FF6 A;  4GHN A;  5G1Q A;  1VRG A;  3MT6 A;  1YG8 A;  3OT6 A;  1WDL A;  1FC6 A;  4FZW A;  3TVW A;  4ELS A;  5DZK A;  4FJW D;  3VIV A;  4JCQ A;  3DJA A;  5G1S A;  3H0S A;  5CTC A;  3RSI A;  2ZL4 A;  3TLF A;  2VX2 A;  5DU8 A;  2UZF A;  4I42 A;  3R6H A;  3H0J A; 
#chains in the Genus database with same CATH topology
 1W2X A;  4ZU2 A;  3WG5 A;  2WTB A;  3K8X A;  2J5G D;  4YLH A;  2HW5 A;  2ZQR A;  1EF9 A;  3NJB A;  3TT6 A;  4QII A;  4MOU A;  4FND A;  1UYT A;  1DCI A;  4KD6 A;  3QRE A;  3LKE A;  5CTB A;  4EMP A;  3V5I A;  1OD2 A;  4QIJ A;  2FW2 A;  4G2R A;  3PGQ A;  1N6F A;  5HUQ A;  5DUC A;  2F9I A;  1NZY A;  3PEA A;  3Q0G A;  1PIX A;  1FCF A;  3V5E A;  5DU6 A;  4I52 A;  1XNV A;  1DUB A;  4NNQ A;  2IEX A;  5C90 A;  4JSB A;  4U0G A;  1RJN A;  2J5I B;  3G64 A;  4OMR A;  1NZY B;  3T89 A;  3U9R B;  4Q0G A;  3TV5 A;  3QMJ A;  4HC8 A;  3OC7 A;  2VSU E;  2DEO A;  3QXZ A;  4KPK A;  3Q1T A;  1XO6 A;  2FZS A;  4Q1I A;  3FDU A;  1FC7 A;  3I47 A;  3ZW8 A;  2NP9 A;  3STA A;  5DUF A;  5KJP A;  3T3W A;  5E0N X;  3T8B A;  3SWX A;  5IKL B;  3U9S B;  4OLQ A;  1Y7O A;  4B3H A;  1N6E A;  1EF8 A;  5DL1 A;  4LK5 A;  4WYO B;  3ZW9 A;  5DTW A;  3T8A A;  4NEK A;  1N6D A;  2VSU C;  2VRE A;  3H02 A;  3ST9 A;  3N6R B;  3BPP A;  3R9S A;  2ZL0 A;  4JVT A;  2VSS E;  2PG8 A;  3T88 A;  2F6Q A;  3LAO A;  2J5S A;  4QFE A;  4ZDF A;  3Q7H A;  5MGB A;  5ING A;  4FZW C;  4U1A A;  4OG1 A;  4MI2 A;  2VSU A;  3GLM A;  1HNO A;  5FIF A;  1UYS A;  4GM2 A;  4JFC A;  3R0O A;  3MOY A;  4KNP A;  2ZQQ A;  3R9T A;  1WDM A;  5DKP A;  4IZD A;  5INF A;  4U19 A;  2YJG A;  4JCS A;  1XNW A;  3QWD A;  1K32 A;  3SLL A;  2ZL3 A;  2DUB A;  2C8T A;  3HIN A;  4FN8 A;  3DOR A;  3ISA A;  2CBY A;  3BEZ A;  2ZL2 A;  2VSS F;  2FBM A;  1TG6 A;  3TVU A;  1WDK A;  2F9Y A;  3HLN 1;  2BZR A;  4U18 A;  1ON9 A;  3PE8 A;  3QKA A;  1TYF A;  3Q0J A;  4U0G H;  4WCZ A;  5KDR A;  1SZO A;  3KTK A;  4IZC A;  1O8U A;  2F6I A;  4ZDC A;  4JWV A;  3KTJ A;  3GMA A;  3TZ3 A;  3KQF A;  3P5M A;  2F9I B;  2A81 A;  1JXZ A;  2W3P A;  3GF3 A;  3GF7 A;  5KDR B;  4I4Z A;  3RST A;  1UYV A;  3KTI A;  3H81 A;  1WZ8 A;  3ZWC A;  5JBW A;  1SG4 A;  1PJH A;  4DI1 A;  4EMM A;  2J5I A;  3KTH A;  5JBX A;  1EY3 A;  1K39 A;  4JJT A;  3K50 A;  3H0U A;  4J2U A;  3BF0 A;  3H0Q A;  3P2L A;  3RRV A;  1ON3 A;  1Q51 A;  3OME A;  1UYR A;  4JOT A;  2GTR A;  3ZWA A;  4L8K A;  3IB9 A;  3P85 A;  2Q34 A;  1X0U A;  3NJD A;  3HRX A;  2A7K A;  4ZDB A;  3PZK A;  4B3J A;  2QQ3 A;  4K3W A;  5C9G A;  2PPY A;  5DU4 A;  4WZ8 B;  1OD4 A;  2A7S A;  4ASI A;  4Z0M A;  3QK8 A;  2EJ5 A;  2Q2X A;  3GKB A;  3MFM A;  2VSU F;  4K2N A;  3JU1 A;  4JCT A;  4RYF H;  1FC9 A;  4IZB A;  3IAV A;  2CE3 A;  1UIY A;  5DZK H;  2D3T A;  5G1R A;  4K29 A;  4JCR A;  3KTG A;  4RCN A;  4FB8 A;  4KWB A;  2X24 A;  4JYJ A;  2PBP A;  3HE2 A;  4L6W A;  1MJ3 A;  2J5G A;  5INI A;  5FUS A;  5E0S H;  4ELX A;  3TRR A;  1J7X A;  1RJM A;  4FNB A;  1XNY A;  3ZWB A;  4RYF A;  3M6N A;  3R9Q A;  2J5I I;  1XX4 A;  4FN7 A;  3QXI A;  3QYR A;  2VSS A;  4MXI A;  5DTP A;  1YG6 A;  3TDC A;  2F9Y B;  4HNK A;  2X58 A;  3L3S A;  2Q35 A;  4ELW A;  4F47 A;  3MYB A;  1HZD A;  3IBB A;  4B3I A;  3U9T B;  4EML A;  4ZDD A;  1Q52 A;  5E0S A;  4U0H A;  4ZDE A;  4HDT A;  4NAR A;  4JYL A;  1HNU A;  3TT7 A;  3HP0 A;  3M6M A;  3FF6 A;  4GHN A;  5G1Q A;  1VRG A;  3MT6 A;  1YG8 A;  3OT6 A;  1WDL A;  1FC6 A;  4FZW A;  3TVW A;  4ELS A;  5DZK A;  4FJW D;  3VIV A;  4JCQ A;  3DJA A;  3BPT A;  5G1S A;  3H0S A;  5CTC A;  3RSI A;  2ZL4 A;  3TLF A;  2VX2 A;  5DU8 A;  2UZF A;  4I42 A;  3R6H A;  3H0J A; 
#chains in the Genus database with same CATH homology
 1W2X A;  4ZU2 A;  3WG5 A;  2WTB A;  3K8X A;  2J5G D;  4YLH A;  2HW5 A;  2ZQR A;  1EF9 A;  3NJB A;  3TT6 A;  4QII A;  4MOU A;  4FND A;  1UYT A;  1DCI A;  4KD6 A;  3QRE A;  3LKE A;  5CTB A;  4EMP A;  3V5I A;  1OD2 A;  4QIJ A;  2FW2 A;  4G2R A;  3PGQ A;  1N6F A;  5HUQ A;  5DUC A;  2F9I A;  1NZY A;  3PEA A;  3Q0G A;  1PIX A;  1FCF A;  3V5E A;  5DU6 A;  4I52 A;  1XNV A;  1DUB A;  4NNQ A;  2IEX A;  5C90 A;  4JSB A;  4U0G A;  1RJN A;  2J5I B;  3G64 A;  4OMR A;  1NZY B;  3T89 A;  3U9R B;  4Q0G A;  3TV5 A;  3QMJ A;  4HC8 A;  3OC7 A;  2VSU E;  2DEO A;  3QXZ A;  4KPK A;  3Q1T A;  1XO6 A;  2FZS A;  4Q1I A;  3FDU A;  1FC7 A;  3I47 A;  3ZW8 A;  2NP9 A;  3STA A;  5DUF A;  5KJP A;  3T3W A;  5E0N X;  3T8B A;  3SWX A;  5IKL B;  3U9S B;  4OLQ A;  1Y7O A;  4B3H A;  1N6E A;  1EF8 A;  5DL1 A;  4LK5 A;  4WYO B;  3ZW9 A;  5DTW A;  3T8A A;  4NEK A;  1N6D A;  2VSU C;  2VRE A;  3H02 A;  3ST9 A;  3N6R B;  3BPP A;  3R9S A;  2ZL0 A;  4JVT A;  2VSS E;  2PG8 A;  3T88 A;  2F6Q A;  3LAO A;  2J5S A;  4QFE A;  4ZDF A;  3Q7H A;  5MGB A;  5ING A;  4FZW C;  4U1A A;  4OG1 A;  4MI2 A;  2VSU A;  3GLM A;  1HNO A;  5FIF A;  1UYS A;  4GM2 A;  4JFC A;  3R0O A;  3MOY A;  4KNP A;  2ZQQ A;  3R9T A;  1WDM A;  5DKP A;  4IZD A;  5INF A;  4U19 A;  2YJG A;  4JCS A;  1XNW A;  3QWD A;  1K32 A;  3SLL A;  2ZL3 A;  2DUB A;  2C8T A;  3HIN A;  4FN8 A;  3DOR A;  3ISA A;  2CBY A;  2ZL2 A;  3BEZ A;  2VSS F;  2FBM A;  1TG6 A;  3TVU A;  1WDK A;  2F9Y A;  3HLN 1;  2BZR A;  4U18 A;  1ON9 A;  3PE8 A;  3QKA A;  1TYF A;  3Q0J A;  4U0G H;  4WCZ A;  5KDR A;  1SZO A;  3KTK A;  4IZC A;  1O8U A;  2F6I A;  4ZDC A;  4JWV A;  3KTJ A;  3GMA A;  3TZ3 A;  3KQF A;  3P5M A;  2F9I B;  2A81 A;  1JXZ A;  2W3P A;  3GF3 A;  3GF7 A;  5KDR B;  4I4Z A;  3RST A;  1UYV A;  3KTI A;  3H81 A;  1WZ8 A;  3ZWC A;  5JBW A;  1SG4 A;  1PJH A;  4DI1 A;  4EMM A;  2J5I A;  3KTH A;  5JBX A;  1EY3 A;  1K39 A;  4JJT A;  3K50 A;  3H0U A;  4J2U A;  3BF0 A;  3H0Q A;  3P2L A;  3RRV A;  1ON3 A;  1Q51 A;  3OME A;  1UYR A;  4JOT A;  2GTR A;  3ZWA A;  4L8K A;  3IB9 A;  3P85 A;  2Q34 A;  1X0U A;  3NJD A;  3HRX A;  2A7K A;  4ZDB A;  3PZK A;  4B3J A;  2QQ3 A;  4K3W A;  5C9G A;  2PPY A;  5DU4 A;  4WZ8 B;  1OD4 A;  2A7S A;  4ASI A;  4Z0M A;  3QK8 A;  2EJ5 A;  2Q2X A;  3GKB A;  3MFM A;  2VSU F;  4K2N A;  3JU1 A;  4JCT A;  4RYF H;  1FC9 A;  4IZB A;  3IAV A;  2CE3 A;  1UIY A;  5DZK H;  2D3T A;  5G1R A;  4K29 A;  4JCR A;  3KTG A;  4RCN A;  4FB8 A;  4KWB A;  2X24 A;  4JYJ A;  2PBP A;  3HE2 A;  4L6W A;  1MJ3 A;  2J5G A;  5INI A;  5FUS A;  5E0S H;  4ELX A;  3TRR A;  1J7X A;  1RJM A;  4FNB A;  1XNY A;  3ZWB A;  4RYF A;  3M6N A;  3R9Q A;  2J5I I;  1XX4 A;  4FN7 A;  3QXI A;  3QYR A;  2VSS A;  4MXI A;  5DTP A;  1YG6 A;  3TDC A;  2F9Y B;  4HNK A;  2X58 A;  3L3S A;  2Q35 A;  4ELW A;  4F47 A;  3MYB A;  1HZD A;  3IBB A;  4B3I A;  3U9T B;  4EML A;  4ZDD A;  1Q52 A;  5E0S A;  4U0H A;  4ZDE A;  4HDT A;  4NAR A;  4JYL A;  1HNU A;  3TT7 A;  3HP0 A;  3M6M A;  3FF6 A;  4GHN A;  5G1Q A;  1VRG A;  3MT6 A;  1YG8 A;  3OT6 A;  1WDL A;  1FC6 A;  4FZW A;  3TVW A;  4ELS A;  5DZK A;  4FJW D;  3VIV A;  4JCQ A;  3DJA A;  3BPT A;  5G1S A;  3H0S A;  5CTC A;  3RSI A;  2ZL4 A;  3TLF A;  2VX2 A;  5DU8 A;  2UZF A;  4I42 A;  3R6H A;  3H0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...