4KWBA

Structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
237
Chain Sequence
b'PSSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKKLEEIKKETKKPIYVSMGSMAASGGYYISTAADKIFATPETLTGSLGVIMESVNYSKLADKLGISFETIKSGAHADIMSPSREMTKEEKNIMQSMVDNSYEGFVDVISKGRGMPKAEVKKIADGRVYDGRQAKKLNLVDELGFYDDTITAMKKDHKDLKNASVISYESPRMMYLYAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal peptide peptidase SppA
publication title Structure of signal peptide peptidase A with C-termini bound in the active sites: insights into specificity, self-processing, and regulation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 79
structure length 237
sequence length 268
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01343 Peptidase_S49 Peptidase family S49
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1750.20 Alpha Beta 3-Layer(aba) Sandwich peptide peptidase (sppa) fold peptide peptidase (sppa) fold 4kwbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4kwbA01
5INIA 2VSSA 3TZ3A 3K8XA 3NJBA 1HNOA 4QIIA 4ZDDA 4I4ZA 3M6MA 2PPYA 1RJMA 1OD2A 2NP9A 2J5II 3TT6A 4B3HA 5DU8A 4U0HA 3MYBA 3P2LA 1X0UA 1NZYA 2VSSF 1WDMA 3OT6A 2ZL4A 1MJ3A 2A81A 3RSIA 1FC6A 3STAA 3QYRA 1Q52A 3KQFA 4U18A 4YLHA 5DU4A 1VRGA 4GHNA 5C90A 4FZWA 2HW5A 1FCFA 3T3WA 4FNBA 4GM2A 3HLN1 3QWDA 3VIVA 2FW2A 1PIXA 4LK5A 2VSUE 5CTBA 1N6FA 5CTCA 5FIFA 3KTKA 2X24A 1ON9A 1RJNA 2VSUA 2EJ5A 3R9QA 1YG8A 2QQ3A 5E0SH 4FJWD 1WZ8A 3T88A 4JFCA 4JSBA 3HP0A 3RSTA 5JBWA 4JCSA 3H0UA 3HE2A 4JCRA 3LKEA 3GMAA 2ZL2A 4DI1A 3QREA 4K2NA 2VSUF 1FC9A 3PE8A 4JOTA 3L3SA 1SG4A 3V5IA 3V5EA 5DTWA 3LAOA 3GLMA 1K39A 3HRXA 2F9IB 5KDRA 5MGBA 4B3IA 3DORA 1N6EA 5DTPA 4HNKA 5DKPA 3R9TA 4Q1IA 3BPPA 5G1QA 3ZWBA 3FF6A 3ZW8A 1XNWA 2Q35A 4FNDA 1ON3A 2GTRA 5E0NX 3P5MA 3QKAA 4ELXA 4KPKA 2C8TA 1Y7OA 3P85A 1HZDA 5JBXA 2D3TA 3H0SA 3NJDA 4ZDEA 1XNYA 3QK8A 1SZOA 1HNUA 5FUSA 4JCTA 4OMRA 5INGA 5INFA 1UYSA 2A7SA 1EY3A 4L8KA 2DUBA 3H02A 5E0SA 5DZKH 3Q0JA 3G64A 1OD4A 4MI2A 4ZDFA 2ZL0A 1TG6A 4JWVA 4ELSA 3BEZA 2J5SA 1WDLA 3R0OA 3IB9A 4G2RA 4FN8A 1EF8A 1FC7A 1DCIA 2J5GD 4U0GH 3TVWA 2J5IB 2F6IA 1YG6A 2A7KA 4KNPA 3QXZA 5IKLB 4Z0MA 1PJHA 3I47A 3TT7A 4Q0GA 4HC8A 1UYTA 3ZWCA 3TDCA 1O8UA 3TV5A 3GF3A 3TRRA 3ZW9A 3H0QA 2F9IA 3U9RB 4JJTA 4EMPA 4FB8A 1WDKA 2J5GA 4K29A 2VREA 4JYJA 1Q51A 4KD6A 3SLLA 4EMLA 3TLFA 3R6HA 3IAVA 4L6WA 4RYFH 4QIJA 4IZCA 4KWBA 2PBPA 5G1RA 2DEOA 4ZU2A 4QFEA 4B3JA 1N6DA 3Q0GA 5DL1A 3GKBA 1K32A 3T8AA 3WG5A 2BZRA 4WCZA 3H0JA 3OMEA 5DZKA 4JVTA 2CE3A 5KJPA 1UYRA 1TYFA 1XNVA 2FBMA 3BF0A 3OC7A 3PEAA 4MXIA 2ZQRA 4OG1A 2CBYA 3PGQA 3PZKA 4U0GA 4RCNA 4FZWC 2W3PA 2VX2A 4ZDCA 4ZDBA 2J5IA 4FN7A 3MFMA 3RRVA 3Q7HA 2X58A 3JU1A 3SWXA 2Q34A 4F47A 2VSUC 3K50A 4I42A 1NZYB 4EMMA 3ISAA 3GF7A 4NNQA 4I52A 3T8BA 2Q2XA 4U1AA 5G1SA 4U19A 4IZDA 4MOUA 4OLQA 3QMJA 3H81A 1W2XA 1UYVA 3U9SB 4RYFA 5DUCA 3KTJA 4ELWA 3FDUA 3KTIA 2ZQQA 1JXZA 2F6QA 1J7XA 3U9TB 4WYOB 4ASIA 4IZBA 5C9GA 2F9YA 5DU6A 2FZSA 5DUFA 3R9SA 3TVUA 2UZFA 3MOYA 4JYLA 4WZ8B 2IEXA 3ST9A 3N6RB 4JCQA 3T89A 5KDRB 2ZL3A 4K3WA 1EF9A 2F9YB 4NEKA 3MT6A 3DJAA 3Q1TA 3ZWAA 1XO6A 3IBBA 1UIYA 3HINA 3M6NA 3QXIA 2PG8A 2VSSE 1DUBA 1XX4A 3KTHA 2WTBA 3KTGA
chains in the Genus database with same CATH superfamily
5INIA 2VSSA 3TZ3A 3K8XA 3NJBA 1HNOA 4QIIA 4ZDDA 4I4ZA 3M6MA 2PPYA 1RJMA 1OD2A 2NP9A 2J5II 3TT6A 4B3HA 5DU8A 4U0HA 3MYBA 3P2LA 3BPTA 1X0UA 1NZYA 2VSSF 1WDMA 3OT6A 2ZL4A 1MJ3A 2A81A 3RSIA 1FC6A 3STAA 3QYRA 1Q52A 3KQFA 4U18A 4YLHA 5DU4A 1VRGA 4GHNA 5C90A 4FZWA 2HW5A 1FCFA 3T3WA 4FNBA 4GM2A 3HLN1 3QWDA 3VIVA 2FW2A 1PIXA 4LK5A 2VSUE 5CTBA 1N6FA 5CTCA 5FIFA 3KTKA 2X24A 1ON9A 4HDTA 1RJNA 2VSUA 2EJ5A 3R9QA 1YG8A 2QQ3A 4NARA 5E0SH 4FJWD 1WZ8A 3T88A 4JFCA 4JSBA 3HP0A 3RSTA 5JBWA 4JCSA 3H0UA 3HE2A 4JCRA 3LKEA 3GMAA 2ZL2A 4DI1A 3QREA 4K2NA 2VSUF 1FC9A 3PE8A 4JOTA 3L3SA 1SG4A 3V5IA 3V5EA 5DTWA 3LAOA 3GLMA 1K39A 3HRXA 2F9IB 5KDRA 5MGBA 4B3IA 3DORA 1N6EA 5DTPA 4HNKA 5DKPA 3R9TA 4Q1IA 3BPPA 5G1QA 3ZWBA 3FF6A 3ZW8A 2YJGA 1XNWA 2Q35A 4FNDA 1ON3A 2GTRA 5E0NX 3P5MA 3QKAA 4ELXA 4KPKA 2C8TA 1Y7OA 3P85A 1HZDA 5JBXA 2D3TA 3H0SA 3NJDA 4ZDEA 1XNYA 3QK8A 1SZOA 1HNUA 5FUSA 4JCTA 4OMRA 5INGA 5INFA 1UYSA 2A7SA 1EY3A 4L8KA 2DUBA 3H02A 5E0SA 5DZKH 3Q0JA 3G64A 1OD4A 4MI2A 4ZDFA 2ZL0A 1TG6A 4JWVA 4ELSA 3BEZA 2J5SA 1WDLA 3R0OA 3IB9A 4G2RA 4FN8A 1EF8A 1FC7A 1DCIA 2J5GD 4U0GH 3TVWA 2J5IB 2F6IA 1YG6A 2A7KA 4KNPA 3QXZA 4J2UA 5IKLB 4Z0MA 1PJHA 3I47A 3TT7A 4Q0GA 4HC8A 1UYTA 3ZWCA 3TDCA 1O8UA 3TV5A 3GF3A 3TRRA 3ZW9A 3H0QA 2F9IA 3U9RB 4JJTA 4EMPA 4FB8A 1WDKA 2J5GA 4K29A 2VREA 4JYJA 1Q51A 4KD6A 3SLLA 4EMLA 3TLFA 3R6HA 3IAVA 4L6WA 4RYFH 4QIJA 4IZCA 4KWBA 2PBPA 5G1RA 2DEOA 4ZU2A 4QFEA 4B3JA 1N6DA 3Q0GA 5DL1A 3GKBA 1K32A 3T8AA 3WG5A 2BZRA 4WCZA 3H0JA 3OMEA 5DZKA 4JVTA 2CE3A 5KJPA 1UYRA 1TYFA 1XNVA 2FBMA 3BF0A 3OC7A 3PEAA 4MXIA 2ZQRA 4OG1A 2CBYA 3PGQA 3PZKA 4U0GA 4RCNA 4FZWC 2W3PA 2VX2A 5HUQA 4ZDCA 4ZDBA 2J5IA 4FN7A 3MFMA 3RRVA 3Q7HA 2X58A 3JU1A 3SWXA 2Q34A 4F47A 2VSUC 3K50A 4I42A 1NZYB 4EMMA 3ISAA 3GF7A 4NNQA 4I52A 3T8BA 2Q2XA 4U1AA 5G1SA 4U19A 4IZDA 4MOUA 4OLQA 3QMJA 3H81A 1W2XA 1UYVA 3U9SB 4RYFA 5DUCA 3KTJA 4ELWA 3FDUA 3KTIA 2ZQQA 1JXZA 2F6QA 1J7XA 3U9TB 4WYOB 4ASIA 4IZBA 5C9GA 2F9YA 5DU6A 2FZSA 5DUFA 3R9SA 3TVUA 2UZFA 3MOYA 4JYLA 4WZ8B 2IEXA 3ST9A 3N6RB 4JCQA 3T89A 5KDRB 2ZL3A 4K3WA 1EF9A 2F9YB 4NEKA 3MT6A 3DJAA 3Q1TA 3ZWAA 1XO6A 3IBBA 1UIYA 3HINA 3M6NA 3QXIA 2PG8A 2VSSE 1DUBA 1XX4A 3KTHA 2WTBA 3KTGA
chains in the Genus database with same CATH topology
5INIA 2VSSA 3TZ3A 3K8XA 3NJBA 1HNOA 4QIIA 4ZDDA 4I4ZA 3M6MA 2PPYA 1RJMA 1OD2A 2NP9A 2J5II 3TT6A 4B3HA 5DU8A 4U0HA 3MYBA 3P2LA 3BPTA 1X0UA 1NZYA 2VSSF 1WDMA 3OT6A 2ZL4A 1MJ3A 2A81A 3RSIA 1FC6A 3STAA 3QYRA 1Q52A 3KQFA 4U18A 4YLHA 5DU4A 1VRGA 4GHNA 5C90A 4FZWA 2HW5A 1FCFA 3T3WA 4FNBA 4GM2A 3HLN1 3QWDA 3VIVA 2FW2A 1PIXA 4LK5A 2VSUE 5CTBA 1N6FA 5CTCA 5FIFA 3KTKA 2X24A 1ON9A 4HDTA 1RJNA 2VSUA 2EJ5A 3R9QA 1YG8A 2QQ3A 4NARA 5E0SH 4FJWD 1WZ8A 3T88A 4JFCA 4JSBA 3HP0A 3RSTA 5JBWA 4JCSA 3H0UA 3HE2A 4JCRA 3LKEA 3GMAA 2ZL2A 4DI1A 3QREA 4K2NA 2VSUF 1FC9A 3PE8A 4JOTA 3L3SA 1SG4A 3V5IA 3V5EA 5DTWA 3LAOA 3GLMA 1K39A 3HRXA 2F9IB 5KDRA 5MGBA 4B3IA 3DORA 1N6EA 5DTPA 4HNKA 5DKPA 3R9TA 4Q1IA 3BPPA 5G1QA 3ZWBA 3FF6A 3ZW8A 2YJGA 1XNWA 2Q35A 4FNDA 1ON3A 2GTRA 5E0NX 3P5MA 3QKAA 4ELXA 4KPKA 2C8TA 1Y7OA 3P85A 1HZDA 5JBXA 2D3TA 3H0SA 3NJDA 4ZDEA 1XNYA 3QK8A 1SZOA 1HNUA 5FUSA 4JCTA 4OMRA 5INGA 5INFA 1UYSA 2A7SA 1EY3A 4L8KA 2DUBA 3H02A 5E0SA 5DZKH 3Q0JA 3G64A 1OD4A 4MI2A 4ZDFA 2ZL0A 1TG6A 4JWVA 4ELSA 3BEZA 2J5SA 1WDLA 3R0OA 3IB9A 4G2RA 4FN8A 1EF8A 1FC7A 1DCIA 2J5GD 4U0GH 3TVWA 2J5IB 2F6IA 1YG6A 2A7KA 4KNPA 3QXZA 4J2UA 5IKLB 4Z0MA 1PJHA 3I47A 3TT7A 4Q0GA 4HC8A 1UYTA 3ZWCA 3TDCA 1O8UA 3TV5A 3GF3A 3TRRA 3ZW9A 3H0QA 2F9IA 3U9RB 4JJTA 4EMPA 4FB8A 1WDKA 2J5GA 4K29A 2VREA 4JYJA 1Q51A 4KD6A 3SLLA 4EMLA 3TLFA 3R6HA 3IAVA 4L6WA 4RYFH 4QIJA 4IZCA 4KWBA 2PBPA 5G1RA 2DEOA 4ZU2A 4QFEA 4B3JA 1N6DA 3Q0GA 5DL1A 3GKBA 1K32A 3T8AA 3WG5A 2BZRA 4WCZA 3H0JA 3OMEA 5DZKA 4JVTA 2CE3A 5KJPA 1UYRA 1TYFA 1XNVA 2FBMA 3BF0A 3OC7A 3PEAA 4MXIA 2ZQRA 4OG1A 2CBYA 3PGQA 3PZKA 4U0GA 4RCNA 4FZWC 2W3PA 2VX2A 5HUQA 4ZDCA 4ZDBA 2J5IA 4FN7A 3MFMA 3RRVA 3Q7HA 2X58A 3JU1A 3SWXA 2Q34A 4F47A 2VSUC 3K50A 4I42A 1NZYB 4EMMA 3ISAA 3GF7A 4NNQA 4I52A 3T8BA 2Q2XA 4U1AA 5G1SA 4U19A 4IZDA 4MOUA 4OLQA 3QMJA 3H81A 1W2XA 1UYVA 3U9SB 4RYFA 5DUCA 3KTJA 4ELWA 3FDUA 3KTIA 2ZQQA 1JXZA 2F6QA 1J7XA 3U9TB 4WYOB 4ASIA 4IZBA 5C9GA 2F9YA 5DU6A 2FZSA 5DUFA 3R9SA 3TVUA 2UZFA 3MOYA 4JYLA 4WZ8B 2IEXA 3ST9A 3N6RB 4JCQA 3T89A 5KDRB 2ZL3A 4K3WA 1EF9A 2F9YB 4NEKA 3MT6A 3DJAA 3Q1TA 3ZWAA 1XO6A 3IBBA 1UIYA 3HINA 3M6NA 3QXIA 2PG8A 2VSSE 1DUBA 1XX4A 3KTHA 2WTBA 3KTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INI A;  2VSS A;  3TZ3 A;  3K8X A;  3NJB A;  1HNO A;  4QII A;  4ZDD A;  4I4Z A;  3M6M A;  2PPY A;  1RJM A;  1OD2 A;  2NP9 A;  2J5I I;  3TT6 A;  4B3H A;  5DU8 A;  4U0H A;  3MYB A;  3P2L A;  1X0U A;  1NZY A;  2VSS F;  1WDM A;  3OT6 A;  2ZL4 A;  1MJ3 A;  2A81 A;  3RSI A;  1FC6 A;  3STA A;  3QYR A;  1Q52 A;  3KQF A;  4U18 A;  4YLH A;  5DU4 A;  1VRG A;  4GHN A;  5C90 A;  4FZW A;  2HW5 A;  1FCF A;  3T3W A;  4FNB A;  4GM2 A;  3HLN 1;  3QWD A;  3VIV A;  2FW2 A;  1PIX A;  4LK5 A;  2VSU E;  5CTB A;  1N6F A;  5CTC A;  5FIF A;  3KTK A;  2X24 A;  1ON9 A;  1RJN A;  2VSU A;  2EJ5 A;  3R9Q A;  1YG8 A;  2QQ3 A;  5E0S H;  4FJW D;  1WZ8 A;  3T88 A;  4JFC A;  4JSB A;  3HP0 A;  3RST A;  5JBW A;  4JCS A;  3H0U A;  3HE2 A;  4JCR A;  3LKE A;  3GMA A;  2ZL2 A;  4DI1 A;  3QRE A;  4K2N A;  2VSU F;  1FC9 A;  3PE8 A;  4JOT A;  3L3S A;  1SG4 A;  3V5I A;  3V5E A;  5DTW A;  3LAO A;  3GLM A;  1K39 A;  3HRX A;  2F9I B;  5KDR A;  5MGB A;  4B3I A;  3DOR A;  1N6E A;  5DTP A;  4HNK A;  5DKP A;  3R9T A;  4Q1I A;  3BPP A;  5G1Q A;  3ZWB A;  3FF6 A;  3ZW8 A;  1XNW A;  2Q35 A;  4FND A;  1ON3 A;  2GTR A;  5E0N X;  3P5M A;  3QKA A;  4ELX A;  4KPK A;  2C8T A;  1Y7O A;  3P85 A;  1HZD A;  5JBX A;  2D3T A;  3H0S A;  3NJD A;  4ZDE A;  1XNY A;  3QK8 A;  1SZO A;  1HNU A;  5FUS A;  4JCT A;  4OMR A;  5ING A;  5INF A;  1UYS A;  2A7S A;  1EY3 A;  4L8K A;  2DUB A;  3H02 A;  5E0S A;  5DZK H;  3Q0J A;  3G64 A;  1OD4 A;  4MI2 A;  4ZDF A;  2ZL0 A;  1TG6 A;  4JWV A;  4ELS A;  3BEZ A;  2J5S A;  1WDL A;  3R0O A;  3IB9 A;  4G2R A;  4FN8 A;  1EF8 A;  1FC7 A;  1DCI A;  2J5G D;  4U0G H;  3TVW A;  2J5I B;  2F6I A;  1YG6 A;  2A7K A;  4KNP A;  3QXZ A;  5IKL B;  4Z0M A;  1PJH A;  3I47 A;  3TT7 A;  4Q0G A;  4HC8 A;  1UYT A;  3ZWC A;  3TDC A;  1O8U A;  3TV5 A;  3GF3 A;  3TRR A;  3ZW9 A;  3H0Q A;  2F9I A;  3U9R B;  4JJT A;  4EMP A;  4FB8 A;  1WDK A;  2J5G A;  4K29 A;  2VRE A;  4JYJ A;  1Q51 A;  4KD6 A;  3SLL A;  4EML A;  3TLF A;  3R6H A;  3IAV A;  4L6W A;  4RYF H;  4QIJ A;  4IZC A;  4KWB A;  2PBP A;  5G1R A;  2DEO A;  4ZU2 A;  4QFE A;  4B3J A;  1N6D A;  3Q0G A;  5DL1 A;  3GKB A;  1K32 A;  3T8A A;  3WG5 A;  2BZR A;  4WCZ A;  3H0J A;  3OME A;  5DZK A;  4JVT A;  2CE3 A;  5KJP A;  1UYR A;  1TYF A;  1XNV A;  2FBM A;  3BF0 A;  3OC7 A;  3PEA A;  4MXI A;  2ZQR A;  4OG1 A;  2CBY A;  3PGQ A;  3PZK A;  4U0G A;  4RCN A;  4FZW C;  2W3P A;  2VX2 A;  4ZDC A;  4ZDB A;  2J5I A;  4FN7 A;  3MFM A;  3RRV A;  3Q7H A;  2X58 A;  3JU1 A;  3SWX A;  2Q34 A;  4F47 A;  2VSU C;  3K50 A;  4I42 A;  1NZY B;  4EMM A;  3ISA A;  3GF7 A;  4NNQ A;  4I52 A;  3T8B A;  2Q2X A;  4U1A A;  5G1S A;  4U19 A;  4IZD A;  4MOU A;  4OLQ A;  3QMJ A;  3H81 A;  1W2X A;  1UYV A;  3U9S B;  4RYF A;  5DUC A;  3KTJ A;  4ELW A;  3FDU A;  3KTI A;  2ZQQ A;  1JXZ A;  2F6Q A;  1J7X A;  3U9T B;  4WYO B;  4ASI A;  4IZB A;  5C9G A;  2F9Y A;  5DU6 A;  2FZS A;  5DUF A;  3R9S A;  3TVU A;  2UZF A;  3MOY A;  4JYL A;  4WZ8 B;  2IEX A;  3ST9 A;  3N6R B;  4JCQ A;  3T89 A;  5KDR B;  2ZL3 A;  4K3W A;  1EF9 A;  2F9Y B;  4NEK A;  3MT6 A;  3DJA A;  3Q1T A;  3ZWA A;  1XO6 A;  3IBB A;  1UIY A;  3HIN A;  3M6N A;  3QXI A;  2PG8 A;  2VSS E;  1DUB A;  1XX4 A;  3KTH A;  2WTB A;  3KTG A; 
#chains in the Genus database with same CATH topology
 5INI A;  2VSS A;  3TZ3 A;  3K8X A;  3NJB A;  1HNO A;  4QII A;  4ZDD A;  4I4Z A;  3M6M A;  2PPY A;  1RJM A;  1OD2 A;  2NP9 A;  2J5I I;  3TT6 A;  4B3H A;  5DU8 A;  4U0H A;  3MYB A;  3P2L A;  3BPT A;  1X0U A;  1NZY A;  2VSS F;  1WDM A;  3OT6 A;  2ZL4 A;  1MJ3 A;  2A81 A;  3RSI A;  1FC6 A;  3STA A;  3QYR A;  1Q52 A;  3KQF A;  4U18 A;  4YLH A;  5DU4 A;  1VRG A;  4GHN A;  5C90 A;  4FZW A;  2HW5 A;  1FCF A;  3T3W A;  4FNB A;  4GM2 A;  3HLN 1;  3QWD A;  3VIV A;  2FW2 A;  1PIX A;  4LK5 A;  2VSU E;  5CTB A;  1N6F A;  5CTC A;  5FIF A;  3KTK A;  2X24 A;  1ON9 A;  4HDT A;  1RJN A;  2VSU A;  2EJ5 A;  3R9Q A;  1YG8 A;  2QQ3 A;  4NAR A;  5E0S H;  4FJW D;  1WZ8 A;  3T88 A;  4JFC A;  4JSB A;  3HP0 A;  3RST A;  5JBW A;  4JCS A;  3H0U A;  3HE2 A;  4JCR A;  3LKE A;  3GMA A;  2ZL2 A;  4DI1 A;  3QRE A;  4K2N A;  2VSU F;  1FC9 A;  3PE8 A;  4JOT A;  3L3S A;  1SG4 A;  3V5I A;  3V5E A;  5DTW A;  3LAO A;  3GLM A;  1K39 A;  3HRX A;  2F9I B;  5KDR A;  5MGB A;  4B3I A;  3DOR A;  1N6E A;  5DTP A;  4HNK A;  5DKP A;  3R9T A;  4Q1I A;  3BPP A;  5G1Q A;  3ZWB A;  3FF6 A;  3ZW8 A;  2YJG A;  1XNW A;  2Q35 A;  4FND A;  1ON3 A;  2GTR A;  5E0N X;  3P5M A;  3QKA A;  4ELX A;  4KPK A;  2C8T A;  1Y7O A;  3P85 A;  1HZD A;  5JBX A;  2D3T A;  3H0S A;  3NJD A;  4ZDE A;  1XNY A;  3QK8 A;  1SZO A;  1HNU A;  5FUS A;  4JCT A;  4OMR A;  5ING A;  5INF A;  1UYS A;  2A7S A;  1EY3 A;  4L8K A;  2DUB A;  3H02 A;  5E0S A;  5DZK H;  3Q0J A;  3G64 A;  1OD4 A;  4MI2 A;  4ZDF A;  2ZL0 A;  1TG6 A;  4JWV A;  4ELS A;  3BEZ A;  2J5S A;  1WDL A;  3R0O A;  3IB9 A;  4G2R A;  4FN8 A;  1EF8 A;  1FC7 A;  1DCI A;  2J5G D;  4U0G H;  3TVW A;  2J5I B;  2F6I A;  1YG6 A;  2A7K A;  4KNP A;  3QXZ A;  4J2U A;  5IKL B;  4Z0M A;  1PJH A;  3I47 A;  3TT7 A;  4Q0G A;  4HC8 A;  1UYT A;  3ZWC A;  3TDC A;  1O8U A;  3TV5 A;  3GF3 A;  3TRR A;  3ZW9 A;  3H0Q A;  2F9I A;  3U9R B;  4JJT A;  4EMP A;  4FB8 A;  1WDK A;  2J5G A;  4K29 A;  2VRE A;  4JYJ A;  1Q51 A;  4KD6 A;  3SLL A;  4EML A;  3TLF A;  3R6H A;  3IAV A;  4L6W A;  4RYF H;  4QIJ A;  4IZC A;  4KWB A;  2PBP A;  5G1R A;  2DEO A;  4ZU2 A;  4QFE A;  4B3J A;  1N6D A;  3Q0G A;  5DL1 A;  3GKB A;  1K32 A;  3T8A A;  3WG5 A;  2BZR A;  4WCZ A;  3H0J A;  3OME A;  5DZK A;  4JVT A;  2CE3 A;  5KJP A;  1UYR A;  1TYF A;  1XNV A;  2FBM A;  3BF0 A;  3OC7 A;  3PEA A;  4MXI A;  2ZQR A;  4OG1 A;  2CBY A;  3PGQ A;  3PZK A;  4U0G A;  4RCN A;  4FZW C;  2W3P A;  2VX2 A;  5HUQ A;  4ZDC A;  4ZDB A;  2J5I A;  4FN7 A;  3MFM A;  3RRV A;  3Q7H A;  2X58 A;  3JU1 A;  3SWX A;  2Q34 A;  4F47 A;  2VSU C;  3K50 A;  4I42 A;  1NZY B;  4EMM A;  3ISA A;  3GF7 A;  4NNQ A;  4I52 A;  3T8B A;  2Q2X A;  4U1A A;  5G1S A;  4U19 A;  4IZD A;  4MOU A;  4OLQ A;  3QMJ A;  3H81 A;  1W2X A;  1UYV A;  3U9S B;  4RYF A;  5DUC A;  3KTJ A;  4ELW A;  3FDU A;  3KTI A;  2ZQQ A;  1JXZ A;  2F6Q A;  1J7X A;  3U9T B;  4WYO B;  4ASI A;  4IZB A;  5C9G A;  2F9Y A;  5DU6 A;  2FZS A;  5DUF A;  3R9S A;  3TVU A;  2UZF A;  3MOY A;  4JYL A;  4WZ8 B;  2IEX A;  3ST9 A;  3N6R B;  4JCQ A;  3T89 A;  5KDR B;  2ZL3 A;  4K3W A;  1EF9 A;  2F9Y B;  4NEK A;  3MT6 A;  3DJA A;  3Q1T A;  3ZWA A;  1XO6 A;  3IBB A;  1UIY A;  3HIN A;  3M6N A;  3QXI A;  2PG8 A;  2VSS E;  1DUB A;  1XX4 A;  3KTH A;  2WTB A;  3KTG A; 
#chains in the Genus database with same CATH homology
 5INI A;  2VSS A;  3TZ3 A;  3K8X A;  3NJB A;  1HNO A;  4QII A;  4ZDD A;  4I4Z A;  3M6M A;  2PPY A;  1RJM A;  1OD2 A;  2NP9 A;  2J5I I;  3TT6 A;  4B3H A;  5DU8 A;  4U0H A;  3MYB A;  3P2L A;  3BPT A;  1X0U A;  1NZY A;  2VSS F;  1WDM A;  3OT6 A;  2ZL4 A;  1MJ3 A;  2A81 A;  3RSI A;  1FC6 A;  3STA A;  3QYR A;  1Q52 A;  3KQF A;  4U18 A;  4YLH A;  5DU4 A;  1VRG A;  4GHN A;  5C90 A;  4FZW A;  2HW5 A;  1FCF A;  3T3W A;  4FNB A;  4GM2 A;  3HLN 1;  3QWD A;  3VIV A;  2FW2 A;  1PIX A;  4LK5 A;  2VSU E;  5CTB A;  1N6F A;  5CTC A;  5FIF A;  3KTK A;  2X24 A;  1ON9 A;  4HDT A;  1RJN A;  2VSU A;  2EJ5 A;  3R9Q A;  1YG8 A;  2QQ3 A;  4NAR A;  5E0S H;  4FJW D;  1WZ8 A;  3T88 A;  4JFC A;  4JSB A;  3HP0 A;  3RST A;  5JBW A;  4JCS A;  3H0U A;  3HE2 A;  4JCR A;  3LKE A;  3GMA A;  2ZL2 A;  4DI1 A;  3QRE A;  4K2N A;  2VSU F;  1FC9 A;  3PE8 A;  4JOT A;  3L3S A;  1SG4 A;  3V5I A;  3V5E A;  5DTW A;  3LAO A;  3GLM A;  1K39 A;  3HRX A;  2F9I B;  5KDR A;  5MGB A;  4B3I A;  3DOR A;  1N6E A;  5DTP A;  4HNK A;  5DKP A;  3R9T A;  4Q1I A;  3BPP A;  5G1Q A;  3ZWB A;  3FF6 A;  3ZW8 A;  2YJG A;  1XNW A;  2Q35 A;  4FND A;  1ON3 A;  2GTR A;  5E0N X;  3P5M A;  3QKA A;  4ELX A;  4KPK A;  2C8T A;  1Y7O A;  3P85 A;  1HZD A;  5JBX A;  2D3T A;  3H0S A;  3NJD A;  4ZDE A;  1XNY A;  3QK8 A;  1SZO A;  1HNU A;  5FUS A;  4JCT A;  4OMR A;  5ING A;  5INF A;  1UYS A;  2A7S A;  1EY3 A;  4L8K A;  2DUB A;  3H02 A;  5E0S A;  5DZK H;  3Q0J A;  3G64 A;  1OD4 A;  4MI2 A;  4ZDF A;  2ZL0 A;  1TG6 A;  4JWV A;  4ELS A;  3BEZ A;  2J5S A;  1WDL A;  3R0O A;  3IB9 A;  4G2R A;  4FN8 A;  1EF8 A;  1FC7 A;  1DCI A;  2J5G D;  4U0G H;  3TVW A;  2J5I B;  2F6I A;  1YG6 A;  2A7K A;  4KNP A;  3QXZ A;  4J2U A;  5IKL B;  4Z0M A;  1PJH A;  3I47 A;  3TT7 A;  4Q0G A;  4HC8 A;  1UYT A;  3ZWC A;  3TDC A;  1O8U A;  3TV5 A;  3GF3 A;  3TRR A;  3ZW9 A;  3H0Q A;  2F9I A;  3U9R B;  4JJT A;  4EMP A;  4FB8 A;  1WDK A;  2J5G A;  4K29 A;  2VRE A;  4JYJ A;  1Q51 A;  4KD6 A;  3SLL A;  4EML A;  3TLF A;  3R6H A;  3IAV A;  4L6W A;  4RYF H;  4QIJ A;  4IZC A;  4KWB A;  2PBP A;  5G1R A;  2DEO A;  4ZU2 A;  4QFE A;  4B3J A;  1N6D A;  3Q0G A;  5DL1 A;  3GKB A;  1K32 A;  3T8A A;  3WG5 A;  2BZR A;  4WCZ A;  3H0J A;  3OME A;  5DZK A;  4JVT A;  2CE3 A;  5KJP A;  1UYR A;  1TYF A;  1XNV A;  2FBM A;  3BF0 A;  3OC7 A;  3PEA A;  4MXI A;  2ZQR A;  4OG1 A;  2CBY A;  3PGQ A;  3PZK A;  4U0G A;  4RCN A;  4FZW C;  2W3P A;  2VX2 A;  5HUQ A;  4ZDC A;  4ZDB A;  2J5I A;  4FN7 A;  3MFM A;  3RRV A;  3Q7H A;  2X58 A;  3JU1 A;  3SWX A;  2Q34 A;  4F47 A;  2VSU C;  3K50 A;  4I42 A;  1NZY B;  4EMM A;  3ISA A;  3GF7 A;  4NNQ A;  4I52 A;  3T8B A;  2Q2X A;  4U1A A;  5G1S A;  4U19 A;  4IZD A;  4MOU A;  4OLQ A;  3QMJ A;  3H81 A;  1W2X A;  1UYV A;  3U9S B;  4RYF A;  5DUC A;  3KTJ A;  4ELW A;  3FDU A;  3KTI A;  2ZQQ A;  1JXZ A;  2F6Q A;  1J7X A;  3U9T B;  4WYO B;  4ASI A;  4IZB A;  5C9G A;  2F9Y A;  5DU6 A;  2FZS A;  5DUF A;  3R9S A;  3TVU A;  2UZF A;  3MOY A;  4JYL A;  4WZ8 B;  2IEX A;  3ST9 A;  3N6R B;  4JCQ A;  3T89 A;  5KDR B;  2ZL3 A;  4K3W A;  1EF9 A;  2F9Y B;  4NEK A;  3MT6 A;  3DJA A;  3Q1T A;  3ZWA A;  1XO6 A;  3IBB A;  1UIY A;  3HIN A;  3M6N A;  3QXI A;  2PG8 A;  2VSS E;  1DUB A;  1XX4 A;  3KTH A;  2WTB A;  3KTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...