4KWTA

Crystal structure of unliganded anabolic ornithine carbamoyltransferase from vibrio vulnificus at 1.86 a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
335
structure length
323
Chain Sequence
AMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWRVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
total genus 126
structure length 323
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4kwtA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4kwtA02
1RAFA 5ILQA 6AT1A 4FYXA 4A8TA 4NF2A 5G1OA 1ML4A 2P2GA 1RACA 1VLVA 4A8PA 1PVVA 3KZMA 3KZNA 1ZA2A 9ATCA 4JQOA 4JFRA 2QGFA 1DXHA 1F1BA 3AT1A 3TXXA 2QG9A 1RABA 4E2FA 1EZZA 1C9YA 4WTOA 4AM8A 4KWTA 5G1PA 4FYVA 3SDSA 3M4JA 4BJHB 1R0CA 5G1NA 1FVOA 3R7LA 3D6NB 3MPUA 8AT1A 4H31A 4KH0A 1I5OA 1D09A 3L06A 1TUGA 1AT1A 1R0BA 4FYYA 2FZCA 4A8HA 1TTHA 4KGXA 2EF0A 1RAHA 2BE9A 1A1SA 8ATCA 2W37A 3L05A 4IV5A 3KZCA 3R7DA 3KZKA 4ANFA 1RADA 4KGVA 4FYWA 1XJWA 1Q95A 4KGZA 1DUVG 4OH7A 4JHXA 2FZKA 4AT1A 2AIRA 1RAAA 3M5CA 1PG5A 4KH1A 2BE7A 2RGWA 2A0FA 3R7FA 4AMUA 1ORTA 1FB5A 2AT1A 4F2GA 1NBEA 3KZOA 3D7SA 2FZGA 3E2PA 2G7MC 1EP9A 1JS1X 2H3EA 3M5DA 1AKMA 2YFKA 4F04A 3LXMA 3M4NA 2I6UA 3GD5A 3L02A 1RAIA 4EP1A 3TPFA 1SKUA 7AT1A 3UPDA 1RAEA 1ACMA 2ATCA 3Q98A 2FG6C 5AT1A 2IPOA 2HSEA 2FG7C 3CSUA 1TU0A 1RAGA 2OTCA 3L04A 3NPMA 4EKNB 1EKXA 3GRFA 1ZA1A 1OTHA
chains in the Genus database with same CATH superfamily
3SE0A 4WZAA 1E9RA 2Q4EA 3RV3A 1T9AA 1SHJA 3PFGA 5ALKA 1YZFA 5JYCA 1U8YA 1IZ7A 3NZEA 2G71A 3HGQA 5DMXA 1PTKA 3LX5A 4XTCS 5H68A 4A8PA 4F91B 2NSHA 2GWHA 5KTNA 4FR0A 4M99A 2CCJA 1G8KA 1Z6GA 4P7KA 3TGLA 4BY9E 4HMPA 1Z7YA 2PIAA 1LB1B 3LBNA 4WW0A 2PLWA 4FR5A 3EPHA 4C0HA 1KZGB 3IBYA 1IY9A 3L6RA 1QF9A 1W44A 2ALJA 2R25B 5CA1F 1CUXA 1CY6A 1H66A 2CCGA 1XVAA 3MLAA 1T1EA 4BJ1A 2YNMC 4XRGA 4WKGA 4YRQA 3R3JA 4CE6A 3HU5A 3EPKA 1TJ4A 1CB0A 3UC9A 5FWXB 1U0EA 3EAGA 2C77A 2QN8A 3OP4A 1NW4A 3QU2A 4A1OA 2X1MA 4BNKA 3GMTA 3CUKA 4LMPA 3G9QA 1JBEA 2PVCA 3NASA 3R9IA 4CM3A 4GGPA 5IASA 2PMKA 2W6IA 4AY2A 4V2UA 1MLDA 1SEPA 2J6IA 1BHQ1 3LOPA 3W8FA 3KOZA 4Q00A 2QSYA 5CNMA 1K6XA 2X7JA 1RC1A 4M37A 1YV9A 4YMIA 2X13A 3MPUA 4L51A 4TMFA 1P39A 4WZBE 5KYUA 4MO9A 2XMSA 2R5FA 1CEXA 1LRJA 1QVZA 4KO1S 3ZCTA 5JMOA 5KAMA 3LBIA 3OCZA 4BFTA 2J5BA 2XCUA 4R1MA 5JSHA 1Z07A 4KV9A 2X9LA 4JLWA 4F9FA 3BWXA 1T1JA 1E1QA 4WXYB 5CFPA 2QAJA 1CERA 2QTBA 5F2NA 3Q8WA 1CYEA 3I6IA 3L7CA 2I6SA 1JQLB 2GAJA 1K27A 4PAWA 4FHCA 2AX4A 2VVTA 4BLRA 5DBOA 1QORA 3LYUA 1EX9A 1SZDA 3K4QA 4QNMA 1JFLA 4PE5B 5A9TA 1H2RS 4C6SA 2YXNA 4MQ5A 5T4FA 2CMDA 2R8EA 1S8AA 2X19A 3QOXA 1A9XB 4RACA 1EGQA 4KVFA 4QGAA 3T9EA 3IODA 2HDOA 4CHTA 1LV7A 1MX3A 3CEHA 3EH1A 4NMWA 1R4ZA 3GRRA 3EDYA 3ZDAA 1FFSA 1OBVA 1XKLA 2IOQA 2RI1A 2XA9A 3AFNA 3NVKI 1OSNA 1MB9A 5HUQA 4FHGA 3SLRA 4BASA 4Y2RA 1ADGA 2WYIA 4RY0A 1D6SA 1NI5A 1W48A 2DQSA 2PX6A 3ANXA 3DEZA 1X1AA 2P1DA 1S2IA 2Q6OA 3EGDB 4X54A 1AKMA 3CRNA 5INTA 1QP0A 3TTTA 5JG7A 3HP4A 3MQ4A 4KXXA 1DBRA 3O8BA 1WQ3A 4JEIA 4QECA 4ZC1A 3SZLA 5TPZD 3KVNA 1UZNA 3WGOA 2A9KA 1VIMA 5FTWA 4O59O 1OLSA 1D2EA 4ZCTA 3REGA 1P44A 2O8CA 2VDRB 5JCJD 2I1VB 3D2LA 5JSKA 2DFDA 2V1XA 3DTYA 3V8VA 3U81A 4L0DA 3EIQA 3WIVA 3B5IA 4REMA 3BB3A 4B17A 1CY7A 1U0NA 3GF4A 1SVMA 2NUPB 1E7SA 2V7UA 4PQRA 4Z4GA 4Q9AA 3G8AA 4O08A 3A31A 3QVTA 4F1KA 3ZBQA 1N3LA 3F7OA 5YASA 1GNVA 1DC3A 1ZVQA 4EYGA 2H7YA 4LGMA 5A1JA 1X1SA 3IOMA 2J9RA 1QAOA 4UCXA 3GP3A 4G89A 4J7AA 2IVFA 4UPVA 2C9BA 5AQ1A 2I0FA 1JHYA 4LMRA 2GRUA 2X23A 3ZY5A 1UT8A 5J5AA 2PIDA 3C7KA 1YB5A 2LCFA 2Q5LA 3LNCA 4IGIA 4IJQA 2B3DA 4OI2A 3WDLA 1SA0B 2JA2A 1NKSA 3G2JA 3W2TA 1QQAA 4ODIA 2QT1A 1M0WA 4WH0A 3ZBTA 3L5OA 2WUFA 5B6PA 4UQLA 1JI0A 3RF7A 2B34A 1FFCA 3CKYA 3GN1A 3QEJA 2RGCA 3BX1A 3A1UA 4FOLA 2Z56A 2C7PA 5LMUB 1QO0A 2X8JA 1EU1A 5ICGA 4CCAA 3WMFA 1P3Y1 3KG2A 1SOUA 4G0XA 4KR3A 3L7IA 3RT7A 1V41E 2ZREA 2WJ4A 2NNLD 3H9CA 2I9KA 2CLHB 5KQGA 3DGEC 5DM0A 2RARA 2VKQA 4DLAA 4YYEA 1Q1NA 2QQ0A 3O2NA 2NU9B 4HWKA 1QHHA 3LT4A 1H5NA 1G21E 2IUTA 3DWFA 4JLDA 5AK5A 3CVYA 4P3YA 1XX6A 3GA5A 1DFHA 2VYVD 3WFJA 1BXRB 1LI5A 4U8GA 2Q2OA 1YE3A 2QPAA 3QF4B 4OF4A 1NV8A 1UF9A 4K3VA 4WKNA 3JALA 3OE5A 3QMWA 2CUTA 2OZKA 2EJWA 1XSEA 3WO0A 2JIZD 4R2JA 4FDLA 1PTJA 5KJEA 5EJ6A 4B7ZA 1FP6A 1HE3A 1M7GA 1Z8DA 1HFKA 2HBYA 2YZMA 5LA6A 2VJQA 3AKZA 2PFGA 2HJRA 5BVHB 2CNOA 3NTLA 4E4YA 1NUAA 1W2GA 3G5TA 2CUZA 4LDQA 4NVRA 2C3OA 4MMYB 1XD2A 1MHTA 5LCXA 2OC9A 3I8SA 3L0CA 5KKCA 4MV1A 3BTVA 1ZI8A 3JWPA 3LXMA 1KI2A 1E9VA 4RK1A 2I8AA 3S7TA 4KYTA 1V95A 1N7IA 2EQBA 1G0NA 1XYYA 5CFNA 4U9UA 4TSKA 4BMSA 2JJ1A 1T6BY 3OIGA 3T54A 1JB9A 3LHSA 4L22A 4QDTA 5EG5A 3H5OA 1WVMA 5BW4A 1I14A 2W98A 3H8SA 5LQMA 4KVZA 5DM4A 3USZA 3TNLA 2VDPB 4B7XA 3ISTA 5BV7A 1VSBA 1M1YB 1DCFA 3CWCA 5DTRA 2OOKA 3GDOA 1SWVA 3PVCA 1CUBA 2BMFA 2QAGB 5E0OA 5ECWA 4E88A 3HM2A 4ER7A 1YOBA 2DH5A 4NLLA 2DULA 3IE2A 3W5UA 4DYDA 4ND4A 2QZSA 3UWOA 1DKUA 5JR3A 1O9BA 1ZA2A 3E0XA 4MQEB 2Q21A 3KWMA 4X7MA 3ZHUA 4D9JA 1CUYA 2YXBA 4EKEA 2ZZNA 1EVJA 1T1IA 1KZ4A 3O4HA 3FDZA 5EIEA 4CDRA 4TS4A 1KVQA 2NVOA 3MCVA 3MNFA 4X6YA 5E9JA 5AW2A 4OYYA 3PNYA 2Q9CA 3M81A 3HB0A 2A92A 2QGFA 2ZU0C 1F5SA 1ORIA 4E33A 5A4MS 1WHTB 2O6HA 2QGNA 3ED1A 5B7NA 2Z4RA 2W2PA 3S99A 4F5DA 1W59A 2WFMA 1Y8QA 1S1CA 1P2VA 4K03A 5EERA 2YQ5A 3ZD7A 2EKPA 3A6LA 4KRFA 2FWRA 2ZBGA 2D4AA 4L5JA 3SFZA 3IELA 1GL7A 4B3RB 4AKGA 1UZUA 4BNNA 4MWOA 3VAYA 3S2EA 4MA4A 1Y1SA 2REXB 2E1PA 1K92A 3PGXA 4RDXA 4PO8A 1UXHA 1OASA 4OQXA 2DPMA 4COOA 3CMCO 2ONKA 1AGNA 4ZYZA 4G0UA 4HG2A 1RFGE 1FDVA 3HCRA 4TXHA 3RBVA 3L6OO 3OJOA 4Z7OB 3I2JA 1WNTA 5JDCA 2O06A 4KH0A 1CS0B 1X74A 2ZULA 4V39A 5KMGA 5I7EA 1V5WA 3FETA 4OD0A 5L4SA 3NALA 2YZ7A 5AD1A 2W22A 2Q46A 3CW8X 3A28A 3DUFB 1AKYA 1SQ0A 1GITA 3ETDA 3GRVA 4WZBA 3V3TA 4S04A 3LO8A 3V2GA 4RFLA 3RNLA 3QE9Y 1KYVA 3G2OA 4J1TC 5JQGB 1CQXA 2Z8YA 4IILA 3NBMA 4Z9BA 4DNPA 4IDAA 2E5LB 2CBXA 1KTVA 1IHDA 2JFPA 3N3AC 3PUWA 5JHHB 1XDBA 5B58C 1GSHA 2RCNA 2RHOA 4ZAWA 2JLYA 4MV6A 2HWUA 3WR5A 3DEKA 2NYUA 1N8NA 2J87A 2O1XA 1Y89A 3KJFA 4DMHA 1R88A 2PS0A 2V7GA 3WGIA 1TYDE 4HFNA 3PQFA 1FZTA 5T64A 4QULA 3H8JA 3R7SA 2GD0A 2PT7A 4EY6A 4Y1RA 1B6SA 3QKRA 4NENA 4TTRA 3ZE7A 1A5SB 1BIFA 5CVJA 3M1YA 4DC1A 3TXAA 2FF7A 1VRCA 4QKQA 3TRJA 2FPOA 3IDOA 1Q0LA 4NATA 3M9XA 1E63A 1RHQA 1D7AA 3GEHA 5BN3B 2ZWAA 3G59A 1Q7CA 3BREA 2VHTA 4IIJA 2W2LA 1TX4B 3NC4A 3VTZA 4CIDA 4QE3A 3H3FA 4KPUB 3V2UA 3WB9A 3AR7A 4Q19A 2E21A 1HDRA 2REBA 1MRSA 3SZUA 1B74A 3RKUA 1KO1A 2NG1A 4BQIA 1QTRA 3PIIA 2XMGA 3FWZA 4G4GA 5AVVA 2PWYA 1ZD9A 1KBOA 2V6FA 4I46A 5AVWA 1RT9A 3ZY2A 1JAYA 4B74A 1G291 1UC8A 3IRUA 1NF2A 4K7JA 3D1LA 1QTQA 2GYYA 5C51B 1V35A 3PGMA 2XMPA 2V7TA 3G7SA 3JQRA 2CL5A 3ZNNA 3KT8A 4RJ2A 2B1RA 1HDCA 3PYXA 4Y2GA 3MS7A 2B1JA 1NLMA 3HA5A 3TQSA 2N1MA 1RM5A 3PCRB 4XPIA 4MQUA 4E07A 3CNNA 1V96A 1ZEJA 1Y4ZA 4QOSA 4TXLA 1QC5B 5CLFA 3WL8A 5CCDA 3TOXA 3F4BA 4HX9A 2QTTA 4M6WA 4TV8B 3KPYA 5ITSA 3TS1A 1CULC 3NHJA 1GKUB 2RKBA 3EZXA 1U81A 1QKIA 3ELUA 3JARB 3UK6A 1TZ2A 1NY5A 1PF7E 4H77A 4K2AA 4OA8A 5DGIA 3T1OA 1L4NA 1YE5A 4TTSA 2V59A 5LP6C 1NYQA 2I4NA 4FCTA 1DFGA 1AO0A 3PTAA 3B6JA 1JB1A 1TRHA 16PKA 2PUEA 2HCFA 3GZNB 1JQ3A 2PZGA 5EP4A 2C8VA 2XVYA 4B34A 4ZYYA 1Q0SA 1AXGA 5TR9A 2EARA 2N47A 1P2DA 1TVKB 2W11A 5LQSA 2ZRKA 2C03A 5J40A 2WSBA 2KLBA 5HQJA 4EY5A 2CZQA 2VF2A 5FUBA 4W82A 1JHVA 3B1JA 1S2GA 3EWIA 4Q6WA 4YT2A 1SNYA 1PP4A 1XWFA 4L4YA 2W8BA 1UOQA 3R0JA 4RA9B 2QNIA 2WT4A 3WK8A 4DEYA 5FPKA 5BR8B 5H0IA 5C4GB 2O8NA 3KKLA 3U9LA 1ML3A 2NU7B 4XWYA 4WJLA 1FNDA 1U4SA 3MYRA 3R8FA 1VG9B 1LS6A 2I2CA 3GGOA 4N8EA 3MTGA 1Q0RA 1Y8QB 3TLAA 3LVBA 3GG9A 5CYOA 3E9RA 4CKZA 2V0GA 5KYYA 1RBQA 2O2YA 4KQ6A 5EQDA 3RRJA 4D3XA 1UUFA 3OUZA 4ZZIA 1G7TA 2ZJ0A 4QJ4A 4UUBA 5FTJA 3U60B 4WN3A 2XUHA 1Y6QA 2NO4A 2VIIA 3EQ6A 4QO7A 1SY7A 5AXAA 3DNPA 2QRLA 4ZK2A 4QTUB 3QVGB 4BIIA 5EKDA 4GL2A 5JNWA 4CZ2A 2FMXA 1LNQA 5EYPA 4CDMA 1K66A 4D43A 1M2EA 3V4VB 5ALSA 3L43A 4TWAA 1N2CB 3O8QB 1X2EA 1E1NA 4HX5A 4RVCA 1VLZA 4YCDA 4OJNA 3DUFA 3KT6A 3CZMA 4II3A 3TDMA 2OBMA 3ZGOA 3SIPA 2R8PA 3Q2OA 2XQGA 4YT8A 3TZKA 4DCTA 2Y67A 1PFGA 1XU7A 1SOVA 1T2FA 2ORWA 4YJFA 2X8WA 5EJGA 2QVZX 1GG9A 3G8DA 4QHTA 1J2UA 1RIFA 3ZZUA 2YW9A 3Q9UA 3ZDZB 1ONOA 3AB7A 2H7XA 3UJ9A 2VWQA 5DX8A 3FD8A 4FYIA 1Z33A 2XX3A 2QR2A 5KVQA 1GPNA 2LXNA 3FA2A 3OLZA 2H06A 3A36A 4MWCA 1E61A 1XU4A 1YVRA 5AUOB 1PQUA 2HYIC 4OHXA 3ACBA 3FPKA 4P2BA 4DLRA 4DLBA 2WE8A 3KQHA 3NO4A 1HF3A 5TT1A 3W7BA 4HWPA 1I6LA 5B4VA 2D2FA 1OTHA 2AC2A 4MWBA 4B76A 5FV4A 4C4OA 2EU8A 3L8GA 3AU8A 4FS8A 1ULUA 4R41A 5BW5A 5HHTA 1Y3IA 1YVEI 3HVHA 2C61A 1A27A 1W75A 2YIMA 3GX1A 5JJBA 2OGSA 1W0JA 3F46A 2V9PA 3KDPA 4Q3AA 3S2YA 9ATCA 3ADDA 4MO2A 2PH5A 4FGZA 5C46F 2DTEA 4U2KA 3SYMA 3TJZA 2PX4A 4PHFA 4CCYB 2HJVA 5EJ7A 2P27A 4WASA 5CDUA 1CS4C 2R5WA 4D9GA 4KMOA 4MQFB 3ZCQA 5JSZB 2ZBUA 3ASZA 3K8OE 3SLGA 3U7RA 5KNCH 3EZYA 3EDQA 4ER0A 5KWIA 1ADYA 2RHWA 4ZV4A 3RNOA 1UL1X 2IS6A 1M0TA 3RRYA 1GUDA 2ZE8A 3H5IA 2CDNA 1UZMA 3KHUA 3PTZA 3HMKA 5KAPA 3S2SA 3ZGYA 3MCUA 5CLGA 1ZRHA 5G53C 4L8LA 4CLRA 3AETB 1YZQA 5JXIA 3UAYA 1WHTA 5JSZA 1GP2A 1QS0B 1ZS9A 5AM5A 1IHPA 5A7GA 1VE5A 1Z47A 2DHRA 4G37A 3UUEA 4WJKB 4MVJF 2CNNA 3FH0A 3BMNA 3GLKA 3K05A 3PHIA 3I01A 1PUXA 3OEHA 3E1SA 3Q0TA 3M6VA 2XOKA 1TIPA 1V8ZA 4O29A 4BZWA 1FDRA 2J67A 5K4HA 4JVOA 3H7AA 1NJSA 2FETA 3D6NB 4I7EA 4Z2AA 2D0IA 3I83A 4G5XA 2G83A 4V3BA 2W2NA 4L6IA 5DH9A 3ELYA 4H27A 4C0KA 1YBMA 3B78A 2JFQA 3ORFA 3RTBA 2QXTA 3L01A 1HNNA 5CD9A 2H51A 1H0SA 1TT5B 5EHZA 4J9UE 5LSAA 3PHLA 1V25A 4BHTA 2IPLA 4MKZA 5C4IA 2J9ZB 5SZKB 2FSVA 2JI7A 2SCUB 3RV4A 2GDZA 2O52A 1A8UA 1KFBB 1M83A 1L5VA 3FKJA 5IYZF 3E9EA 4KLCA 5EVJA 3EVZA 4TL6A 4BQQA 1L5QA 4MS1B 2OCLA 2F3QA 2CHGA 3HYTA 4UVGA 4U63A 1LS1A 1VCOA 5A2GA 2AOTA 5LXTB 1VG0B 3HFJA 3QX9A 1QF6A 2M98A 4G0PA 1QK5A 1RTKA 2CLSA 3G0GA 4I50A 5C3UA 3VHXA 4XM2A 5FPTA 2WSYB 4KMSA 1GV1A 1P2FA 3P2IA 3M6FA 4MVJA 4UBJA 5J5VA 3ROTA 4M2LA 4I1VA 3ZXIA 1KBZA 3S8YA 2CJFA 2UVDA 1AMNA 3OIUA 2PBFA 4MLPA 1JQKA 2YHAA 2BDTA 3KOWA 3SC4A 4ZVMA 4AK9A 3KD3A 4WUTA 3OHMA 1AUPA 1G21A 1EIZA 1S3GA 4PNZA 1LSOA 3HXKA 3PNMA 4I1RA 4OHCA 4A26A 5KWEA 4ZEWA 5AUNB 3FOAA 1BGVA 1RWWA 4BZZA 1EBFA 2YDXA 2WM3A 3IIIA 3I72A 4P7GA 5C7IO 2JIPA 2XYPA 4R2LA 4EP1A 4JJ6A 3UFXB 3W5VA 4O3MA 3GL9A 3PWKA 3ZD8A 2IXFA 2OVBA 2QQGA 3LX6A 1HL7A 4YO7A 4YLGA 3VR0A 4KIWA 2XMBA 5DHUA 2AA3A 3IUMA 2QIPA 1R5BA 2IDZA 1W6RA 4GGMX 4ZI5A 2PA3A 2FG6C 1DZIA 2P3LA 2B8EA 2ZSIA 4ND3A 3CY6A 3UH1A 4AVYA 3NORA 2WFLB 4HWGA 2FZ4A 2PSEA 1CF2O 2UZIR 3GT7A 3KDSE 1W9HA 1CY2A 2VJYA 3PPXA 3V1TC 9LDTA 5LDHA 2ZJ8A 2PR2A 4LVUA 1EUDB 1UAYA 4MUFA 1W36D 4G1FA 4JVMA 4B7CA 4WEOA 4NCNA 4H7PA 4GDFA 2VLIA 3CO0S 1ZRMA 4N9WA 4XWGA 3VNRA 1FZQA 1H2FA 1WVGA 2GBFA 2Q0HA 4PTYA 5SZJA 3SIXA 1II0A 2G88A 5EFOA 5WRFA 5JAMA 3EVGA 1VYVA 2IPXA 3DVRX 3PL5A 3VM6A 4IKPA 4PYRA 5AM4A 1WSAA 4JI1B 1SFRA 4NK4A 1ZAKA 2OY0A 1L5ZA 4KXYA 4TVBA 2EAUA 1TZKA 3UB3A 2C58A 4QUAA 2JGIA 3G6KA 4R0VA 3IIKA 2IU0A 1E1QD 1UBTS 3PNKA 2I1LA 2V0NA 2I2FA 4MEBA 3KKQA 1OLUA 2IUSA 4DNQA 2VZ9A 3ETNA 3PEYA 4BP8A 4B35A 4CIWA 1K7EB 3VR6D 3T38A 2H2GA 3PQ4A 1C0EA 3D02A 4MJLA 4HVCA 1EWTA 3ANTA 3I2GA 4FGLA 4XEUA 1NPYA 5K4GA 4B6PA 2VNJA 4IHAA 3KP1A 2PL5A 1HFWA 1ANKA 4E09A 2JLUA 4HZUA 3IOEA 1OIWA 1YTLA 2NZ8A 4FZJA 5CX1A 3TW4A 5GIPE 1NM5A 3VGJA 3DEAA 1B8VA 1HQYE 2IF2A 3A1TA 4M7WA 3IAHA 5HQTA 2GBLC 2ZTMA 4MP8A 4V0ME 1OX6A 4RTJA 1DBWA 2QVGA 4V24A 1J25A 3A1NA 4DCNA 5J47A 4QQNA 1V37A 4F3NA 4BNIA 5C9ZA 1MGPA 4Q3EA 2QX6A 4F2DA 3PJRA 4UBKA 2NZ2A 1A1SA 1SXGA 3BWBA 1CZKA 8ATCA 2WFZA 4ZDJA 4MVJD 3PENA 1AGPA 1Q83A 5I9TA 2Y0PA 3RTAA 1JA1A 1C81A 1T8RA 3QENA 2B5VA 1L5RA 3P45A 1E4EB 3A37A 1SPXA 4NBLA 4RH3A 2BDUA 5IAKA 4CKBB 4D4LA 2BGRA 4GGOA 4HGOA 3KX2A 4KDRA 1L7MA 1HYHA 2P1ZA 4PLHA 2JFWA 2WB4A 5BW6B 4BRSA 4DPMA 3T5AA 3QOFA 4J7CA 1I94B 4HRXA 1WDKA 2V98A 3TD9A 1DL5A 3WVNA 3N87A 2HHLA 3VU3A 4R81A 2IOFA 1GGJA 4UE3S 5FB3A 1SELA 4J9VA 1ZHOA 4JBYA 1WG8A 4UHFA 4X62B 4R1NA 1L1RA 1NVVQ 3PEVA 1KQPA 4WZZA 5T57A 2V4UA 3ITDA 5DGXA 3Q88A 4FUTA 4OGKA 3STVA 2LV8A 4F97A 5KYNA 2BCEA 3DCJA 1X1RA 4KYUA 4KXWA 1PWEA 2G7MC 5LQKA 1WB5A 3KPVA 4QO8A 4FMDB 2XUGA 1JDNA 1UP6A 1WZNA 3DAGA 2X0RA 3I73A 2IV2X 4F86A 1H8HD 3IQIX 2NP7A 3JQCA 1CHDA 3B9PA 3HQ4O 1FMLA 2G67A 3BZWA 1FYVA 2HT1A 1TVKA 3EZ7A 1G5TA 2RG7A 1OHHD 5TVGA 2JKZA 5B57C 4MRNA 3NIFB 1AQNA 2XODA 2QAIA 2RGNA 4WV3A 2G3YA 1LVGA 5EJFA 3ZNQA 1AOXA 2FJPA 2IZOA 3DBVO 4YRIA 4MEAA 4H3KB 4JJIA 4UQOA 2J3LA 3VKFA 3KLBA 4I4CA 2J3DA 3BORA 1LK7A 4KN9S 5CDFA 4EW6A 3BXXA 1ENPA 4FWTA 4G01B 3T3IA 1K86A 4Q7MB 3DE2X 5I48A 3QXJA 1QE0A 2DYKA 3UMJA 3NS7A 4YI5A 3SC2B 5CVEA 1VI2A 5AVKA 3VR2A 2REQB 4RZSA 3KU1A 3U4QB 3UMCA 4EFLA 3KQWA 1F0YA 4KLAA 1LVUA 2G40A 3KQTA 4PYQA 3FZQA 7MHTA 4MI9A 4OQYA 2IYVA 2QD1A 1ZD2P 1SIWA 4BKPA 4HDRA 4IDDA 3OVMA 2JDID 2CXOA 4QM6A 4K9DA 2V7QA 1KMQA 4WBSA 2PN1A 5HBGA 4H4EA 4ZOQI 5CDFE 4HT3B 3FCUB 4ENSA 4RJKA 1RE0A 1SHKA 2R11A 4ZIRB 2H18A 4CQLA 1DDIA 1ZIYA 4CM4A 2XDAA 4OGWA 3RFCA 2C88A 4LZNA 4BGDA 1QH8A 2D7JA 3A6ZA 3LAWA 5C8DA 3E23A 5JHGB 5CLLA 2ROQA 3HL0A 3CEPB 3LCRA 4YREA 1YD7A 5M34A 1L5MA 2QM3A 4IYJA 1DX4A 1NRJB 1PW5A 2NXWA 1B26A 4WESA 3D4OA 3U1BA 3UCEA 3GJYA 1TNDA 3LPAA 2YS6A 1VB3A 4Q1DA 3CUTA 1S01A 3EMDA 1SC6A 1B93A 3AB8A 3DEFA 4FQ7A 4Y6LA 3MMPA 1ZSYA 2FPMA 1FP4A 4FYKA 2J7PA 3LA8A 2X1LA 2P6RA 1SULA 1FRQA 1ZOSA 4O4HA 1VJ1A 1T3SA 2XYGA 3CR7A 1ODFA 4N3BA 1B2RA 2BGMA 2BJVA 2AS0A 1PJ4A 3C3AA 3FNGA 3PUJA 2O14A 4GUDA 2EIHA 3QE0A 4KQCA 4RAQA 5JQWA 1AB6A 5IJAA 1DTWB 4CG0A 1SKMA 1RXEA 3FPFA 1XVTA 2A5JA 3MJRA 1IPFA 1OWMA 2AEEA 3EVNA 1YS2X 3I9V1 3KQLA 2R1TA 1U0HC 3AEKB 3HACA 1YVPA 3N2KB 3DBHA 4MUAA 2DERA 2Y1OA 2W58A 2FUEA 1Y6JA 2HNBA 3SWWA 1XALA 3ROQA 2WIAA 2YJ3A 1GGVA 4TM8A 4FDAA 2GM5A 1ESCA 4HAVA 5BUZA 3RUDA 3M82A 5BT9A 4BFWA 1X14A 1Q57A 1CCWA 2PGJA 4XEHA 4CM9A 3U7FB 3T3NA 2BFOA 2ODQA 3C3MA 4P3PA 1P62B 3GARA 3JS5A 1JEJA 1LBIA 3VPHA 4ETWA 3N2GA 5I5EA 5TQ2A 3SBEA 5DHAA 1OBHA 1PVDA 3DVQX 4A6EA 1W30A 3MBOA 4PG7A 5TQ0B 1QUEA 2WM9B 3HN6A 1GN9A 1PHRA 3RRFA 4ROTA 3VH1A 2VA8A 1P4JA 2O0JA 3FYCA 5LA6B 4CKEA 4E5SA 3BGIA 4KQXA 1OXXK 1EP9A 2G76A 3NHMA 4L75A 4TTTS 4DOMA 4D8VA 2FW8A 3KB6A 3GA7A 1QGUB 3N39C 4X66B 1LLDA 2JGJA 3ZD9A 3ZX5A 4RDHA 3ZWWA 2Q3CA 1ZPDA 1T15A 2RAUA 1ZK1A 1U0BB 3P26A 4RZ2A 4WPGA 4FP9A 5CAEA 1GPDG 4WLUA 1VBKA 3ZDDA 4TN1A 2IUUA 3A2NA 1BXZA 2ZR8A 1S8OA 3C5HA 3PHBE 4X45A 1RHJA 5LYYA 2HWKA 1EWQA 1QM5A 5KOYA 4TTPA 5LD2C 2DPYA 2X1HA 4MR7A 3CEAA 3D64A 3WMXA 4MYCA 3HJGA 1FUYB 4W1QA 2PNJA 2E1RA 3JPYA 2CZGA 2O8DA 2G28A 3PUVA 3HZRA 4A8TA 2O8CB 2C3MA 4GFDA 3CG4A 1NOIA 4FDTA 2JCGA 2R47A 3AJDA 1ZGHA 1C5KA 1HURA 1XZPA 3L4BC 1WMDA 4AJ2A 4AZ3A 4YLEA 1PT7A 2P4QA 2DUNA 3TLCA 2BKXA 4XWWA 1UBNA 3H5RA 4GAEA 5LLDA 3KSMA 1Q0UA 2OG1A 5KPDA 3A32A 1GAJA 1G2IA 1WLYA 3BJRA 2YTZA 1ULSA 1I6KA 3V9PA 1M8FA 2G9UA 1A88A 2O3QA 4K6CA 2O8BA 3L6CA 2ZCJA 2W2MA 3ET4A 2QZJA 3R9KA 4EENA 2HRRA 1NF9A 4JSTA 3OICA 3PFKA 4J0JA 4P8RA 4RA6A 4ZHQA 2IE0A 3BCUA 3OTGA 4XLLA 5LA6F 4GZLA 1RZRA 5IXSA 1KHTA 2ZI7A 4F4IA 4FFDA 4B7AA 4C76A 3HJUA 1ESMA 1RHMA 1CQIB 2B1QA 3LT0A 1NJ6A 3N05A 3AHFA 4JP2A 4MUHA 3L3BA 3UHOA 8OHMA 3SFVA 5CT6A 5D3MA 2Z2KA 4DRZA 2RC5A 3EJ6A 3PFFA 4AUKA 5G41A 2YN2A 5H83A 3D43A 3RSZA 4Q3DA 1WD7A 4C9BA 1PFWA 1H0RA 1E1DA 3CH4B 2A3RA 1SU7A 2L17A 2V03A 4GOND 4AKTA 2OHJA 4KP7A 2GGSA 4RVSA 2WWRA 4PHCA 3VJRA 1S02A 2GCGA 2YV3A 2AD5A 3CJQA 3FNBA 5IAAA 4RJIA 4IMRA 2QLTA 2GPYA 1MX9A 3HCNA 2VHWA 1T8WA 1PJ2A 2GTIA 2TSYB 3BRWD 3H6GA 3ZYCA 5ESDA 1J20A 3HYLA 1G5PA 2VF8A 3DOCA 4GI3A 1Z2OX 1Z16A 3MMXA 4FHZA 4YAJA 3PXDA 4EB3A 1K6MA 1GAEO 1X1EA 5BPHA 1GZ6A 1KR5A 2Q2QA 2RK6A 3G0OA 4C4SA 1R6TA 1LBHA 3I52A 1J2TA 4GPIB 1KARA 3UMFA 2VTEA 3V2HA 2VRNA 3K5HA 4QYIB 1L7DA 2HHAA 2W4IA 3H1BA 5JISA 3FVTA 3GAMA 3RRXA 1JKJA 4CTKA 4JJ8A 3QPUA 4F2PA 1ZOIA 1QH0A 3BVPA 1NR1A 3U7JA 5ITWA 1FU4A 4YUYA 1OU4A 1QIKA 4HN2A 4KO4S 1GQRA 3B6MA 4F8JA 5L3QA 2I54A 4U7WA 3PPYA 4WBXC 1K4MA 2QNRA 4D6YA 4Z7JA 1T6ZA 3PNLA 5K8TA 2ZAOA 1I0ZA 5JAUA 1NI4B 4DW8A 4F85A 5FAKA 1KGSA 1MZVA 1TKCA 3MWJA 4TSFA 2VYNA 3G0CA 4V2IA 1FVHA 2G0TA 1Y4DE 1Q1EA 1CT9A 3HN2A 4WDQA 5GWXA 3KAKA 1EVYA 3EF1A 4QFDA 2C5EA 4E30A 1CJTC 2HSDA 4R68A 2UDPA 3F3MA 2EQ5A 3G2IA 1DPFA 3ABRB 4K1XA 2WD7A 2BHNA 4P4SB 4BZPA 3IQXA 4RO0A 2H9IA 1P0IA 3K72B 4ZRNA 1XQXA 1EA7A 4B6RA 1G8PA 3X1DA 1GCUA 5IMSA 3UXMA 4PBRA 3BE4A 2AR0A 3FHLA 4I08A 3PYMA 1QK3A 3WL3A 3IB6A 4RM3A 4FNAA 2ZCUA 5JY6A 2JIRA 3B7PA 4DR5B 1MTZA 1ZQ9A 4KOAA 2BH9A 3NDPA 3IBFA 3GDHA 2J48A 1QYDA 3LX4A 4EIWA 3I5XA 1OIXA 1LSSA 3M8KA 4LWPA 5JH7A 3ZDFA 3V1UA 2B9VA 2EFCB 1LK0A 1PNQA 4ARUA 2OM6A 1MT0A 5LVAA 5DX0A 4NOMA 1B0PA 1RRVA 1CF4A 1E7MA 2DUMA 3GRCA 3L6EA 3OCYA 3OI7A 1LW7A 3HBFA 2ZAGA 4IX9A 2BFFA 4HUQA 1O54A 2WSSA 3DOFA 1FSFA 3R8CA 4O5AA 1XEXA 1YVDA 4UASA 5AVQA 3W90A 3ON5A 4N12A 3VC7A 2IKQA 2FMTA 2R00A 1Y7PA 2BJWA 1EM8B 4GLOA 4O4HF 1DRWA 4PC3A 3UCXA 3UMSA 4MK4A 1SEVA 3ZLVA 5DI3B 5IAOA 3IP8A 1RXUA 2PQ2A 2XBUA 4HB2A 4MUMA 3WLKX 3ZXYA 4BFYA 1J2JA 5FL7A 1S8FA 3C16C 2ZITA 3NHUA 4B81A 1CUCA 2C78A 4W5JA 3U16A 3IVMA 2HU2A 2FGJA 4I19A 3U26A 1D2GA 4ZTUB 2UZ3A 5DVZA 4H6VA 3W7AA 4ZRDA 3N8HA 1FS4A 1LQTA 4LISA 2ZR7A 3GCDA 3L4SO 2WT8A 2LZ0A 4RLFA 3VVMA 4DIOA 4YRZA 2PUGA 5JZMA 3Q85A 2DT5A 2NU9A 1JFFB 3PDJA 1VCHA 1VPEA 2VWPA 3DFZA 2QXUA 1Y9DA 2A0YA 3Q3JB 4FFMA 2XE8A 4MDFA 5BV2P 1JDUA 1O7JA 2GN0A 5JWRA 5IKXA 3UOWA 2DFKB 5DYYA 1GGKA 1Y5RA 5H4HA 1I2BA 1B8NA 5K3DA 1CEYA 2WJWA 3BJEA 1O77A 1IHOA 3LOQA 3W8DA 2YN0A 3MWFA 2HDHA 1VLJA 3JYHA 4D8XA 5D01A 1WNFA 1P4HA 1N6PA 1QFYA 4BLQA 5K45A 5AI5A 4QZVA 2B4KA 3SVLA 4J4BA 2GZMA 2Z1MA 3K70B 5IEBA 1G8AA 3Q7QA 3CUWA 1S5PA 5BSVA 3K09C 1UMDB 2ZUBA 4WK4B 4RTSA 2R6FA 3M33A 3NNSA 1QP7A 4BNGA 3G1WA 3L6DA 5ILGA 3B1FA 1T5DX 3L79A 3QVWA 2ZRIA 1VB5A 4FOSA 3JQ7B 4JKIA 1EVZA 1YUMA 4PIPA 2OT3B 3P9CA 3SS9X 4X00A 3QA3E 5LKRA 1P1HA 3KZOA 1UODA 1YR1A 1HY3A 4UUAA 2PHZA 3H0KA 2FOLA 4FIDA 3YASA 3TECE 1PR3A 2B25A 1NVBA 2UVPA 4PG6A 1BEUB 1J0DA 2WIBA 3EW7A 1PL6A 2CXPA 4F04A 3D7MA 4CQNA 3GFQA 3PNOA 3GRKA 1MV8A 2R62A 2WM2A 2PH3A 2WWXA 2C7VA 4CQJA 1XCLA 5K6AC 1NX6A 3Q7IA 4HUTA 4CN9A 2I9PA 3PFIA 2QRZA 3CT4A 1E60A 4KIFA 4TMWA 5JAZA 5AM3A 3M89A 1RQ7A 4FCCA 4ZVUA 3C39A 2QE7D 3GCXA 4NI5A 1ARZA 5C18A 2FWIA 2WKSA 2XT0A 3GFPA 3KKKA 4Q4DA 1Y6FA 1P1IA 3BMCA 3AK4A 4QYIA 2VAMA 4PV7A 5EIXA 3LK6A 1SOMA 3V1KA 1DFIA 3EOBI 2JLXA 4HX2A 4IHQA 3VUFA 4KQJA 4KO3S 3QNMA 4PF1A 4J8PA 4LJ9A 2JBAB 1KWKA 3OM0A 5TC4A 1E9SA 3SS8A 4BBAA 4M8NE 5MN6A 4G5RA 3N2KA 4UAJA 1OC2A 4E15A 4QELA 3EA0A 3BDAA 2GN6A 1ZIPA 3M5WA 1R74A 3NRBA 1FNBA 2H08A 3OT5A 3D6VA 4DB4A 4LFAB 4JFRA 4YASA 4PS1A 3K2IA 4XYLA 3M6AA 4E5NA 1EVQA 3CEJA 3WYDA 3BHMA 3GIWA 2DPLA 4FMPA 2D1QA 3CN7A 1B1AA 1DAEA 3LKVA 3H8WA 3TIFA 3T3MB 1WZ2A 1PYOA 4K9QA 2OGZA 3BSSA 3B82A 1JPVA 1P19A 1RBMA 2J7PD 3KSZO 4I50F 4Q9HA 5ABPA 1WMFA 2GZSA 1GVHA 1KEWA 3NG1A 2HRDA 4MITA 5SY9A 2JAWA 2IEGA 5GM2A 3H5TA 1N2OA 1E3SA 2UAGA 2VQ3A 1JRLA 1MN6A 3LW7A 4XLTA 3AI1A 3E1KA 2BY4A 4FFRA 5HS6A 1A50B 1L4BA 3EISA 1YZVA 5C53B 1SXJB 4G65A 2QPOA 1TW2A 2QSJA 4FC7A 4JP1A 3CQ9A 4MTCA 2NU6B 3RYTC 4GNRA 3GBPA 2AD1A 4OQFA 2ZTVA 1G8YA 3I9MA 1Q6YA 3AEQA 1WWKA 3ZBUA 3OZ7A 1MC1A 2XZLA 3ZXUB 1X8JA 3ZK9A 5K0GA 2I7CA 3ZS9A 3W78A 2WTXA 4BO6A 2X1VA 1P5HA 2XUJA 3BERA 2WAXA 2QTNA 3H11A 2FF5A 1ETUA 1Y6RA 3B13B 3I30X 4MQLA 1AD2A 1YQDA 1J09A 4ZQEA 2P6MA 4KDCA 3IEKA 3UFXA 1E2UA 3VYWA 4LY0A 1QQ5A 2ZRPA 3FKQA 4FNGA 2B4TO 3L07A 4H7JA 4YPFA 1GXSB 4OHWA 4C89A 5HP4A 3WZMA 2IH2A 1EI9A 5CGZA 3EWAA 3DHNA 1V9CA 3WGJA 3WK7A 2RGBA 3FTPA 3I76A 5CA1A 3H2JA 3U44A 1NULA 1WUHS 3L1VA 3W6UA 4ZYWA 3KPWA 2DE0X 5NULA 5TMDA 3I62A 3U61B 4GBGA 2BFAA 2QT9A 3INYA 4QU8A 5COBA 4L7VA 1Q11A 1KMHB 4X1YA 4JWTA 3HY3A 1ZRSA 6CHYA 1KO7A 4IXMA 5KNCD 1KHHA 1AN9A 1GPBA 3IAXA 1KQNA 3IE0A 2P69A 1ECGA 5CA0B 4K3UA 1VSUA 3EXFB 3IQEA 4ZARA 3BE5A 2QW1A 5FNZA 1WJGA 2ZUSA 5EZYA 4ZAYA 4ZOLB 1OHHA 3G9TA 2IQ5A 2P62A 3GD5A 2VBIA 1AQJA 4WCFA 2XH8A 3DMTC 4RS3A 2H1OA 1I4OA 2O3RA 2O2DA 1UC4B 3DCNA 3VOTA 3G9UA 4HDKB 3BMXA 3RHSA 4NS1A 1EK5A 1PR6A 3KM0A 2MSCB 1I30A 1VIDA 5G3YA 4CG3A 2Z6VA 1OXKB 5BSWA 3F97A 2Q3EA 2Q62A 3KSBC 1XMSA 2COKA 4F4UA 3BJMA 1R64A 2VHJA 5ILQA 2AYYA 1TYCA 1QG0A 5GONF 1Z0IA 1EB9A 1Q50A 5U4XA 4H9GA 3G2HA 4IH4A 4GQIA 4ZREA 3T9AA 4X6XA 3VTKA 2ZM6B 2O8EA 3MIIA 1KDTA 1IFXA 1ZCFA 2C20A 3N2EA 1XGKA 1MAWA 1PYDA 4B82A 3GJXC 1CRQA 4EHKA 5LUBA 3ACDA 4KBFA 3O82A 1C9NA 2IEZA 5BWCA 5LOVF 2FV8A 3AERA 4P2GA 4C04A 1C3JA 4IJ6A 3IKLA 1V2GA 3BWDD 1KPIA 3DXYA 3LUFA 5AO9A 4MVJI 5A3SA 3VZQA 4CM4B 1Z0SA 1KYTA 2BI7A 3ESDA 1UJ2A 1H1DA 1JQBA 2VJMA 1QNLA 4J3FA 4QPPA 4Z0HO 3Q7EA 1DUSA 2H1IA 1BMFA 2WHQA 3FFXA 4BGEA 3IBSA 4J7XA 5TMBA 5B1YA 3H65A 2ODBA 3QPBA 1O6GA 3QUBA 7REQB 5IKMA 3MT0A 2QY9A 4ED9A 5EMMA 3MJDA 4NDZA 3U7EB 5CA0F 2GBIA 3E2IA 3M3PA 4P4GA 5HSGA 1EFRD 2HRQA 2ZRGA 2XCOA 4TS3A 2XADA 4NG5A 2JKYA 1YQUA 4Z86A 2Z4SA 2BM0A 4EW2A 2K7FA 4Z53A 2ZSBA 1VYHA 3LQRA 3HU2A 1S4QA 2BFDA 1A9QA 3H4IA 5HIIA 3QELB 1DC4A 3CLRD 4QSHA 5AH0A 2W6ID 1DLIA 2XHZA 1K68A 1ZIOA 3NCHA 2HQBA 5BOVA 2O5RA 1EK6A 2VAVA 3C87A 3EZ6A 1F6DA 1ICIA 2J4CA 3OOSA 3UN1A 1KEUA 2VBFA 3KXLA 1B3RA 4A0GA 3PKIA 1L3IA 1O94A 2HLHA 3ZUGA 2B99A 3K0EA 3JARA 3WK5A 5D3ZA 1SIUA 2CJYA 4GKVA 2K2WA 3TEMA 4E94A 5CBPB 2ZPUA 4EKGA 3DE7X 4HDQB 4JZYA 2G06A 5FBKA 1V16B 1A82A 3P32A 3QMMA 4JQCA 4YK7A 5T8KC 2O3UA 2OXIA 5KSYA 1QGYA 2CB9A 5JDIA 1UQRA 4E32A 1F6WA 2NXCA 2W2KB 1QR6A 3M1AA 4PRLA 4EHJA 3HXMA 3TBHA 2ZRCA 4ZI7B 5IJ0A 2HAEA 3ZVNA 4L28A 2AWNA 4DA6A 3K96A 3LCVB 2QMUA 3JYNA 4JX8A 4OUDB 4CR6A 5JEDA 4AMUA 1JTEA 5CA1B 5HF6A 3WAKA 3QTBA 3MSXA 3WXBA 3CPJB 2VDKB 1T2NA 4KQKA 2PT9A 2VWGA 4RADA 1OGJA 4JLJA 4MX8A 4Y7DA 1ZVVA 3R09A 3QBEA 1SXJE 5IJ0B 8ABPA 2RB4A 5LNK1 2MINA 2X14A 4GPEA 5DOVA 3ZV3A 4JUCA 3SD7A 3T4EA 3KWJA 1OQAA 3ITNA 4CEIB 1E7QA 4JHLA 4LYEA 4C3ZA 4ESHA 2NUTA 1I24A 3R3YA 4PR0A 5KHLB 1KO5A 4H4DA 4KBGA 1QZZA 5DLDA 1N0UA 3N1UA 2FPIA 3R7WA 4GX2A 3KUKA 4UBOA 4FC6A 3GRPA 4XASA 1UFRA 2QVLA 1AKVA 2XVXA 3W6PA 4J75A 1FDUA 2O8DB 3V7NA 3ROKA 1IXRC 2JFOA 1GGEA 4GUAA 1PJRA 1N78A 2P2SA 3V48A 1T0HB 1CUIA 1XRSB 1TPYA 1SUIA 2YASA 2N42A 1N6RA 1C3OB 1SCDA 3D7NA 1BFUA 3GV0A 4EGQA 1WY7A 2R1VB 4ZZ1A 3L0BA 4PAMA 5E6SA 2HGZA 3KSRA 4QUDA 1BO6A 3BQ9A 4MYUA 4QDUA 3UUWA 3GFBA 3S5JA 4ND8B 3W7VA 1N57A 4RTLA 5BPFA 1H22A 1F8FA 4CQMD 3EEQA 3STXA 3UICA 4B4VA 1YFJA 1J2YA 4LHSA 2CXNA 1ZJWA 4S1OA 4N7MA 1EJBA 4HYTA 3CNEA 5BMVF 3WADA 1IL0A 4PANA 4FE3A 1KE2A 3KVRA 4ZDWA 1I4LD 3MYYA 4QDOA 4DQUA 1CJCA 3KUCA 4GZ3A 2C7QA 2EZUA 1DT5A 3JZAA 1DAIA 1OFGA 2I3AA 2HGSA 4GNKA 2AH5A 4RANA 1W9MA 4INAA 3EZFA 3PC4A 4PLGA 2BF4A 3E05A 1U1EA 4IIFA 4DADA 4W5TA 1NNUA 5EWLA 4EFDA 4V1CB 2V4MA 4HL6A 5DU2A 3UPUA 2GZAA 1D2CA 1DADA 1NOKA 4JP8A 3AHHA 2IY8A 4ENQA 4HDOB 2C00A 3LKDA 2R8RA 3H6HA 3ZLTA 1OX4B 4KI0A 5TRTA 4U0JA 3KEOA 1PCXA 3DYIA 2GM9A 3DLAA 4LVCA 3GCZA 2FN3A 3C6MA 3TQHA 4I5GA 1NNLA 3R6TA 2CFOA 1BJTA 1YWGO 4YTEA 3E3OA 4B6EA 4QFBA 1BXGA 1EFPA 1JQJC 2PD4A 4X7RA 3HEBA 3KR9A 3PPVA 4MGIR 4AY6A 4BC1A 1KAMA 3F7MA 3TRIA 3D6TB 3OIDA 3MGCA 1NMQA 4P0TA 5HE9A 3SJCA 3E82A 2DHQA 2XZTA 3C1UA 1IB6A 5CDYA 1PBTA 5A3QA 3CH7A 2IIQA 4GKAA 4X91A 2GJ8A 1ZVKA 4REQB 3REQB 5KYKA 3W9BA 4BNDA 2JBAA 1KP2A 5B3AA 3TUZC 2Z6UA 1EHYA 1TQ2A 2C04A 2OV2A 3OKFA 2GQ0A 1U31A 2V58A 4MW5A 1OA0A 4BO5A 3PC8A 3LBHA 1W47A 2JA1A 3I9FA 4HVAA 1G42A 4IDCA 2IYXA 3P9YA 4W7IA 4AU1A 3HCEA 2ONJA 2CMFA 4B79A 4LN1A 3ZJUA 4AC9A 1U2PA 4ZU1X 2JEOA 1RQLA 3C41J 3QSGA 2C7OA 1EFUA 3NVMB 4IDEA 2HWWA 3QLUA 5K0TA 2B69A 1HXHA 3R5KA 4D9HA 3H1TA 2D00A 1TAGA 2GXQA 1TE2A 2HK7A 3NXSA 4WQMA 3D3WA 4AZSA 4F3KA 5GV7A 4QG3A 4TV9B 4TL7A 1P9RA 1XWWA 3OZUA 4WERA 4NZNA 5IVDA 4GWKA 1GLNA 4HS9A 5LYJB 2ERCA 1IN8A 4KE8A 1LLQA 1T2CA 3WLNA 1XNQB 3OTIA 3AHEA 1DKNA 5E0KB 3R5XA 2EATA 1XKTA 2JCYA 2H4JA 3C6YA 4OQEA 4X1OA 5THXA 3SIWA 3UPDA 4L4ZA 4BVEA 5J4YA 3OMLA 4PHGA 3ZDRA 1AMOA 1GGMA 2GFHA 3SEZA 1OH5A 4ZZ2A 1LW6E 2R6CA 2V8OA 2XLCA 3WKAA 4CT5A 4WBNA 1XEXB 1R5NA 3WRVA 5EQFA 1ADFA 4DG9A 3WHKA 4NONA 4P5DA 3AL0C 1WOYA 2H54A 1EKXA 3MGAA 1SVSA 4G67A 1QWOA 1HR0B 2V3CC 4OFBA 4F93B 4UDXX 4CKWA 1ZJ6A 1Z68A 1X1CA 3AP1A 3CKKA 4HRAA 4N0PA 2D62A 2DP4E 2IV7A 2FSUA 1QCZA 4QGHA 1Y33E 5LJLA 1QQ7A 4BQFA 3EEOA 1VJCA 1ZWLA 1RXIA 1LLCA 1NT4A 3DVAB 4DZRA 5HM6A 1VG1A 4QHSA 3GEEA 4GM1A 4PONA 3SXJA 4LDAA 5H9WA 2QYOA 5JNTA 3DZHA 1QOQB 3BRQA 4M1ZA 4I66A 4B40A 1RRMA 1XA0A 2BZ0A 2YWFA 3C3BA 5AM0A 4S24A 4YMTA 3CZAA 2OQVA 2DHDA 3GJ4A 1KY2A 3ADCA 5JMTA 1JLRA 3Q1KA 3QFHA 1EK2A 2HYDA 3VPXA 3WGVA 5SY4A 3W5CA 5JJIA 4HLQB 4R1PA 1GA6A 2Z30A 1L6IA 3A6JA 1BMQA 1T0PA 5KI6A 4DGSA 4G0MA 1SKYB 3MTEA 1NJ2A 3JQAA 3MLBA 4O25A 3QU7A 3RSGA 4DV4B 4R16A 2CNDA 2WWFA 3BXOA 1U0GA 4M8SA 3T41A 4IHJB 2XI4A 1UXIA 3QMVA 1VTKA 2P2CA 2PV7A 3REOA 2EWWA 4HLDA 1WZIA 2ZB2A 3PJDA 4I36A 3OKPA 2CLFB 4D3YA 5KYWA 4X95A 4TYYA 1P6QA 3TJRA 3N58A 3A05A 4MHTA 1OXMA 4QU9A 4BO9A 2EF0A 3KVVA 5KYXB 1RDFA 2NZUG 3L18A 3IE1A 2WK1A 3KXDA 4MUIA 2OZEA 2ZBFA 3K71B 2HUNA 2Y4NA 3EOZA 4DUGA 2ZS7A 3NHSA 4DA7A 3DBLB 3T61A 2BGUA 1C8BA 4TKUA 3WDKA 4DIKA 5DRTA 3T4UA 1VIVA 1I1QB 4IFTA 1U4OA 2G9QA 4YQEA 1W88A 2XNJA 5KVAA 1KI9A 4BB5A 3BF8A 2HK8A 1APBA 3AM1A 5AW3A 5JSQA 4ZU6X 4BLOA 2E3JA 3AUAA 1A9TA 1UPBA 4W5NA 3PZRA 1JR2A 4A0FA 3VVCA 3B36A 4RXTA 3NQ41 1B7GO 1SVNA 2RGWA 2WKRA 2VJNA 4KUEA 3ZR4B 3HTXA 4TZ0A 1J5EB 4TYWA 5T4HA 1EUZA 5B30A 1U6IA 3AEQB 1IXSB 5T3YA 1TKBA 4PXYA 1R16A 5BR4A 4WKBA 4R01A 5AW8A 2IH5A 1GIAA 1RLIA 2BGGA 1KZHA 1OYOA 4MS4B 1FJHA 1L4LA 5BVHA 2C42A 3EXIB 4JBIA 1U3UA 3GAFA 1I2DA 1M1YE 5HGJA 4C0XA 3RYCB 3MS2A 2C2YA 4YWJA 1BJRE 3MIZA 1XCGB 1E5LA 1YB4A 2P5UA 3FB1A 1EZ1A 4PEVA 5A1TA 3WTBA 5JH7B 2PPVA 5FLYA 1B1CA 2FGKA 3FCOA 3EXEA 4IO0A 4OB8A 4XGRA 2X0EA 3RGWS 1AXEA 3DVSX 4I5IA 4UM9D 2Y1DA 1E6KA 1NY6A 1VJ0A 4YH1A 4DV5B 5GJBA 7GPBA 1BCRB 3AX6A 4JLPA 2Y99A 3WGNA 4YRBA 1BEEA 3CMMA 1Z4PX 3QV2A 4CUJA 1I9GA 1H3NA 5A9RA 3A9VA 2Q1XA 1KOGA 3S3TA 5A62A 4U1RA 2PXHA 3BBPA 1D2MA 1AK2A 4GC9A 4W6QA 1W34A 1KI1A 3QJGA 3BILA 4XX0A 3MHTA 2OQIA 5G1OA 1QFMA 3QITA 3I12A 5AI0A 5DXJA 4EW1A 3RUAA 2IEYA 1AH2A 3STWA 1KVSA 4TVOA 2ZJOA 1XPJA 3F5SA 3QRWA 1RC0A 1KYZA 2ACEA 3F78A 1WZUA 2JATA 1SQ6A 3D0KA 4A82A 2HY7A 4UZSA 5DYIA 2WTBA 3AYZB 1QLJA 1JX6A 2Q3HA 2WG2A 1Q7EA 5DLEA 1QH1A 2HXSA 2I33A 1W52X 1P74A 2WWWA 3I05A 4DA9A 4G0WA 5ITZB 3FPCA 5L53A 1BS2A 1FRVA 3R41A 1WXIA 2DQYA 1VLHA 5J2TB 1ABEA 2VK4A 5EPOA 4UU7A 4Q7LA 4YP1A 1EFLA 4CHGA 5DNUA 1NVGA 2ECPA 2RGDA 3NYWA 4GYJA 4J7UA 3KALA 4MPJA 4TTJA 2AQIA 2PS9A 3H6KA 4BX9A 1YUBA 4WLOA 2L69A 2DUWA 1A9RA 1TM2A 1VMKA 4RE5A 3F1LA 3H99A 4N0EA 1EUQA 1T35A 2N0SA 2YYYA 1A8IA 3B2NA 3D8HA 1EZ4A 3WYNA 3A3PA 4W4TA 2GT1A 2WDZA 2PO5A 1PHPA 4XDZA 5DI3A 2XBMA 1IAQA 5TIIA 3LBAA 1Y8ZA 1XFAA 3TE7A 1PV2A 4IP0A 3PQ8A 1N0IA 1MVLA 1ZCBA 4XQEA 4HNUA 2QB5A 4D7AA 1FS6A 2G63A 3CTMA 3RWMB 3WP0A 2WJZB 5IWCA 1G5FA 1YB6A 5GOZA 1FXSA 1Y1QA 3V4SA 4MVJG 2YV1A 4C06A 4R8LA 4ZDKA 4NNPA 3ZWOA 4GYWA 1RJEA 3NIBA 3RSSA 3AZQA 3UOAB 3OLWA 3IAEA 3O1JC 3V4FA 1KY4A 1MABA 1UKCA 4BBPA 3JVIA 4IV0A 1XEAA 3BDIA 3LE8A 5DBEX 1JQDA 1YR3A 3Q87B 4EBBA 3EGCA 5FUVA 1ITZA 3PA8A 2ZSHA 1EDEA 1OLXA 4ZOLF 2Z2IA 4UULA 1ULZA 2W9XA 3K9CA 4ZAVA 4JLMA 3LK7A 3HH8A 2OENG 4AZWA 1RQRA 3KTOA 4U2CA 4PW0A 1Y3FE 4A27A 4BKMA 2HIGA 1YJXA 1UKAA 4UBIA 1JMVA 4FW8A 4WFJA 1JPJA 3FB4A 2W2OA 2GEUA 3JU3A 3RFFA 3QUCA 4IJWA 3IXQA 2Q9BA 4LOKA 3BL6A 3V55A 3F49S 3K0KA 2OLEA 4AYTA 3U9TA 2NUBA 3IKMB 4BMVA 1QLWA 3PV0A 3E35A 4KHZA 4Q1FA 3DOEA 2OXTA 3S27A 1T0IA 3UO8B 2BFEA 4MR9B 1KRHA 2I4OA 3HVRA 4I8DA 2X8JB 2PNFA 1NBIA 1QONA 4BCBA 2RKWA 4FD3A 5L3QB 3UWDA 5E6RA 2XIQA 3COVA 4INJA 3S81A 4RTNA 1DCMA 3PICA 3IESA 5AVZA 4NX2A 4E6PA 4YXWA 4Z4EA 3IQGX 2NO7A 3R0IA 2VZ8A 4Q66C 3N2GB 4K9NA 1LPPA 4LS3A 5SZHB 3O8CA 2B92A 1AC5A 1K08A 2QMYA 4N40A 1NVAA 3K92A 4C05A 4XWAA 3OY7A 3UF0A 4ARIA 2BEJA 1SXHA 3CRZA 2PGIA 4J0CA 3SXPA 3WAJA 1CVLA 1GA1A 5ALTA 4Z6KA 1XTKA 1IBMB 1Z4JA 3IAS1 3ORHA 2Q4RA 5F64A 4F4CA 1Q7GA 1ADCA 3ND6A 4DDWA 3QLUC 1NXTA 5HJEA 2IEBA 3WK6A 4E4RA 1X7DA 1ZMBA 2CJXA 2CDCA 4RABA 1JR6A 3ZEAA 2DHCA 4MTLA 4V0RA 3BGSA 2ZRJA 4F96A 1HZZC 3NATA 5IT9A 1OXTA 2Q45A 3DFKA 1XDUA 5E7JA 2HPVA 2CDRA 3K09A 3T9FA 4M9SA 4KAFA 4AP5A 1FYFA 4BN0A 3ICWA 1T24A 1ONSA 2JGDA 2X42A 2VSQA 3GA0A 3OKAA 1FVFA 3EGIA 3I09A 3ZU5A 1QBGA 2DB3A 1PZFA 4B31A 4DNOA 4RJTA 1GRRA 2QW8A 1CS0A 4F5WA 3LLCA 2GJ9A 4Y0AA 2BI8A 3QPWA 2GHQA 1GXSA 2FUNB 4QUHA 1UMCB 1JA0A 5FOWA 4RL6A 1E3IA 2VJBA 1QHEA 1GSAA 2VL7A 3OCCA 3ZWVA 2YNMD 4UHCA 5JROA 1PV4A 2SBTA 1GEGA 2EW2A 3HWSA 4G81A 1RCUA 4HGRA 5ALYA 1PR5A 1YZTA 4E5MA 4EW3A 2A14A 3ZH2A 1MJHA 2VP5A 3A27A 4LNUB 2OYRA 1NMZA 4WLFA 2ZT6A 1PQYA 1OAOC 1G38A 3I34X 4RKRA 2QUBA 1XZIA 3NIDB 1NNEA 1YJ8A 3SQXA 3EA5A 4B0PA 4J3NA 1NVXQ 5LN1A 4CQMA 2V7VA 1XQWA 3QPAA 3OO1A 2XITA 3P71T 1DLJA 2B30A 1U0OC 3ER6A 1SCNE 5AMXA 3S2GA 4MLCA 3KHSA 4ZP1A 5KYVA 3QG5A 2QWXA 1SCQA 3SE7A 2FZKA 2V5UA 2RGUA 2FDCA 1H8ED 3RW9A 4ZN6A 1XK7A 5B2ZA 1Q12A 5IEJA 2CUKA 4B3XA 1AZLA 5SYMA 1A76A 2QYHA 3UUGA 3C8MA 3DMHA 3OCXA 3T7TA 3VI3B 3DULA 2D59A 5H02A 4EKDA 3ZVKA 3PKJA 5LBUA 3SYKA 1DIGA 1L1FA 3FDJA 1GCOA 1XJ0A 4GF5A 5BR7A 4J91A 2FFBA 1YS6A 3TTYA 5AVTA 2O2XA 1FMCA 4JB0A 4YP5A 4IZOA 2X6RA 1PJTA 3D5TA 4LQ4A 1P0QA 1EA5A 1BH6A 4ND8A 5H81A 4R6XA 4R8KA 3MRTA 1JE1A 4AWAA 2V1UA 4UVIA 5SYAA 1UPAA 4HWRA 2APJA 4ZPJA 1CNFA 2O3SA 3JRNA 1R9GA 3RIXA 4FB5A 2NVUA 1NUTA 5REQA 2PYZA 1UWKA 1W5EA 2D8MA 3ZWDA 3UB4A 3AEUB 2R66A 2XUKA 2DVMA 1OT5A 1TU3A 5JXJA 1KQFA 3DHEA 4BVKA 2WABA 3V8BA 2UV8A 1MC4A 1Y1LA 2O20A 4JL8A 4TKLA 1R00A 4UVHA 5TARA 3TD2A 3ID6C 4ER6A 4W5RA 2JBHA 5IAGA 3UNXA 3O3CA 2PWZA 3O8NA 1NBMD 5AKGA 4DABA 1M5RA 4JI2B 4HTFB 2ARKA 3P2OA 4QRHA 1LBEA 3PNSA 2AZDA 1D1QA 3LCMA 4O4JF 3FWPA 3HUFA 1N8SA 4FFOA 2WKPA 3CVWA 5E2BA 3HB1A 4DQXA 1IZYA 2A9RA 3ADOA 4ZVVA 1Z4IA 3X2EA 3AHGA 4ZI7F 3Q5GA 5BUSA 1NVKA 3MAJA 3PIRA 3FTQA 1EP3B 1AQLA 2IOYA 5K7SA 5LR6A 2I4RA 1WXHA 2NYRA 3HR4A 4LCBA 3WRXA 4HDSA 1BMDA 2XLBA 3CJTA 2ZVJA 1U0FA 2B94A 2VP3A 4ALKA 4BU1A 4IPTA 2QJTA 3BGOS 3CGWA 5LZ9A 3UAGA 5B58T 3BGWA 1MC8A 4D5GA 4KMRA 1VZ3A 1VECA 5HKKA 4EPYA 4J0GA 1WCIA 2HTEA 3OC0A 4KO2S 4M38A 4OIMA 5EI5A 4CV0A 1G3MA 4D46A 2C4MA 4UM8B 2Q9UA 4CM7A 4IJ5A 4DLZA 3WHLA 4EECA 3H0CA 1CDDA 1EX6A 2ZIGA 1KA9H 2EIXA 3AR5A 3CLKA 5DM2A 4ENRA 4ALIA 3G82C 1TCVA 2C2GA 1AB5A 1KIMA 1P18A 1K9SA 1V16A 2P2NA 2Z08A 3WRXC 2D7DA 4RXMA 1LKZA 1JZQA 1RI5A 3KSAC 4BBZA 1EBUA 1E58A 1UBLS 3FZEA 3JATB 2F8LA 4M1QA 1ZX1A 1NATA 3D5EA 1ZMXA 2CCKA 1PQWA 1OFVA 1Z6AA 4IG4A 3B1YA 3LP8A 1YJCA 1VPLA 4CIAA 1YC2A 1U28C 2JAXA 1X70A 4ZYXA 3QE3A 1XL0A 1TEZA 1RWOA 1X8XA 3ZV4A 4EI9A 4MR7B 1KKLA 5DTEA 1ZW1A 4QBFA 2IYEA 1R5JA 4JELA 5EP3A 4DM4A 3HJRA 2W6NA 1MR3F 4J29A 5CM8B 1ZI6A 1NYLA 2C5GA 1H85A 4NXNB 3KQKA 1W581 2RG1A 5CRIA 1U3VA 3P0HA 1VGRA 4OLJA 1GUBA 5C31A 2EL7A 3BRCA 4FFLA 1KI4A 2ZTUA 4ASUA 4MV7A 3U5ZB 4R8SA 3CF4A 5K0NA 4J07A 1AQIA 1KRWA 4HJRA 1KOLA 1IN1A 4OB7A 4K0KB 3VU0A 1I3KA 3ORRA 4JL6A 4E21A 3HU1A 4L0CA 5KYXA 5M04A 3OZXA 4RK0A 4PGHA 4EI8A 3I5UA 3F3YA 5E3HA 3IVRA 4R1TA 2VOEA 3R3ZA 3RBAA 1N2ZA 4EFNA 4EQ6A 3UPTA 1R8YA 4GRIA 2WVAA 1JNYA 1U8CB 4L76A 1DAMA 2CVPA 4F4FA 1YRLA 1P1BA 2O5VA 3RAJA 2C29D 2IX9A 3LHDA 1EK1A 2OUIA 5JSFA 3AP3A 2BD0A 2VO1A 3RABA 1NE7A 1E9AA 2GETA 5CDHA 1E99A 1JN0A 3WFIA 2XEXA 2DQZA 4RVGA 4JY7A 5K1ZA 3HJCA 4DFDA 3MLEA 1PSWA 2HWXA 2WMYA 3MTDA 1NZJA 3OCWA 4IS2A 3JQFA 2VF7A 3W06A 2PMFA 1IVNA 4NE7A 1Q0QA 5COQA 4YUVA 3WL6A 2X0JA 5F1YA 1PD1A 4TUYF 4QDJA 4GOMD 4X71A 5KCMA 3OT1B 3VRHA 4IKEA 4FCVA 4DVJA 1NC1A 1YDGA 1BKDR 1DIAA 3C3DA 4OXRA 1F2UA 4QIHA 1Z6QA 2IU6A 3FF4A 4H4CA 5IG2A 2PS1A 2QI9C 3KQNA 2DKNA 4JBHA 4CEHB 3B6IA 5HKBA 1G41A 5F98A 3GI1A 4AKEA 3K1AB 4L02A 1L5NA 5FORA 4CF6A 4Y7CA 4AS1A 4P7BA 3KPJA 4HQRA 1U2DC 1J8FA 3FUUA 4BO4A 1HFJA 4LYGA 5FHRA 1LJ8A 1CQWA 3E58A 3TIXB 3IFSA 2BPOA 3Q9NA 3QVXA 4NCXA 3SJBA 3NTUA 1NTRA 1SPBS 4MQ4A 4DJTA 1ZUIA 4CODB 3B6KA 4G23A 4UAGA 3T7DA 3KQPA 3EIOA 4B09A 2CLCX 1IWOA 1MDFA 2FPGA 3PXUA 3QTTA 3F7TA 4XCQA 4RD0A 3HKCB 4RMIA 2W6OA 5ALPA 1NR7A 4BLUA 1YZ3A 4QOGA 2CJWB 5DP2A 5FOTA 4CKCB 2PJRA 1C9DB 4WKOA 1YJAA 2VH2A 3K6RA 3BE8A 3N0TA 1BYUA 2EJUA 3MJVA 3IMCA 1SU4A 1H9CA 2JRCA 2ZJZA 3X0DA 1T8PA 2AXEA 2OV3A 4KJZA 2IYZA 4DR4B 5AI6A 1OUMA 2O48X 4O8CA 5BNWA 2J3IA 5FUMA 4WOPA 2BEWA 2EX0A 4HV4A 4DJDC 1QNFA 1W4LA 1OA1A 2EBHX 2OECA 1ZESA 3K31A 5DZSA 2HQ1A 3OT4A 3Q40A 1EJ6A 4U39A 4RK7A 3RE1A 4MVXA 4DSUA 5HJ5A 4QEDA 1GAXA 3ZEIA 1FX0A 4OP3A 3KV3O 2M9MA 1GZ3A 2P4EA 3GOHA 3H42B 5FBLB 3Q11A 3E18A 1H4QA 4Z4FA 3QSYA 1HE5A 2QMZA 1U0JA 3LZDA 1T5HX 2NOAA 2VDLB 4FYWA 3DMGA 4ARZA 2WQ6A 1CC1S 2YOFA 1HO3A 1K6JA 1JVSA 4LDPA 3GVHA 3FZNA 4WK0B 5BQPA 3RS7A 1CUGA 1P7VA 1Y4UA 4E11A 4EB8A 5KWVA 3OE7D 1C29B 3H17A 5KOJB 2H16A 2HEIA 2AIRA 1DAKA 3GK3A 4K6KA 4OIFA 8GPBA 2PWAA 1BSVA 1G21B 4MS4A 4G1CA 5P8WA 4C0WA 2XB4A 2QTVA 3AOEC 5HFAA 4KSYA 3UATA 3B8EA 3VSAA 4RPJA 4HGZA 4ZCSA 2AOWA 3EFOB 3L7MA 3FYHA 1IQ0A 3DBIA 2OYCA 1F38A 4JOBA 3D31A 421PA 1YHNA 2XXAB 2FR8C 2J5KA 4C7JA 2YMPA 3U4DA 5HRCA 2QLLA 1KMMA 3RVQA 2O7RA 2Y93A 3UJAA 1Z5ZA 4EATA 1R15A 3TR5A 4C1NA 1R37A 2GA8A 5MN4A 4ZQFA 5IUJC 5ICFA 3EBOA 1NA5A 1GSIA 2H4ZA 2IUEA 3PXXA 1DDOA 4JAVC 4IVQA 4F6LA 5MF6A 4RENA 2QX7A 3JQ9A 1D07A 4JDUA 3BQMB 3JR3A 1R0RE 1DX9A 4D74A 3UT0A 4NJEB 1GA4A 3PU6A 3WIOA 3PFBA 4Q47A 3EK2A 2BT4A 2QMOA 2QLNA 2XQJA 3ROMA 1JDPA 1U2SA 3E2MA 3CO5A 3TBKA 5B2EA 2UYGA 4RF4A 4B3FX 3SS7X 4QD3A 3EFHA 3W5HA 2PZEA 1BAPA 1L7XA 3E61A 3O26A 3FDFA 1BVYF 1ACLA 2G1JA 4MP6A 2ZYIA 1GRVA 2R1ZA 5L3VA 3HDGA 1EG7A 2A94A 5EKUA 3RC7A 3TFQA 4MJXA 2WG0A 2XZDA 4MGHA 3VBCA 5F7OA 3M49A 1EJ2A 2OP0A 4CMKA 1XG5A 1IQRA 1Q7TA 3ICPA 3LKZA 4JXXA 1HA3A 1SO8A 1URPA 3UEOA 3VOAA 3NEYA 3PPWA 3ORSA 4JQOA 3QNWA 4H59A 1VL1A 4OXXA 2AL7A 2C7BA 4QYWA 3TLGB 3GAAA 4F0JA 3NCTA 4YPOA 4Z7NB 2Y6VA 3FX2A 1OZFA 3NUGA 2BIFA 3PDUA 2HMWA 3K2BA 1XXHE 1WXEA 1S1MA 1FLDA 3AFOA 4F92B 3QVOA 3V4PB 3NW9A 2A5LA 1V5IA 4D9BA 5ESXA 3OJLA 5CXSA 2ZUFA 3PHJA 1J07A 1JF8A 1EZZA 2HPAA 2I78A 2G0NA 4WN9A 2P6PA 3RYFA 4NZMA 1IBLB 3WWOA 1MOQA 1PDWA 3UUFA 1PAUA 3AVOA 1OZ0A 2W6PA 3KDAA 3P5BA 4JJKA 1FTYA 1Y5LA 2CW5A 2RC6A 4NG4A 1UKZA 3DH0A 4CCWA 4LRTB 4KR7A 2X2EA 5B1SA 3NFYA 3TQQA 4MGEA 4FZ3A 5LQJA 1D8TA 3CFYA 3CW9A 3ETHA 3FMVA 1SXJD 1UBMS 3PGLA 1CHNA 5IU6A 3ASUA 3TAHA 4LOAA 2E37A 4MIKA 1FX0B 1NPTO 2BGIA 2Z09A 4LRXA 4NPCA 4Q39A 5F51A 1FQJA 3T3PB 1E9CA 4P33A 5JS2A 1OTXA 3GHHA 1QHXA 1ADJA 1E0DA 4MARA 2ERXA 3D4LA 1LY1A 4LWQA 3N8NA 3K0SA 1PT8A 1Z4QA 3OQNA 3ZJ5A 3ABSB 3B1VA 3OFJA 1JJAA 1NM5C 3FI9A 4DYHA 4MP3A 4XXHA 2XWQA 2VHZA 1JP7A 2XTNA 4RZQA 3QVLA 2XMRA 3IP6A 3SHFA 4CF7A 2CNWA 4QUBA 1JTFA 3PLAE 2BM9A 3C6XA 3IL2A 1ZGCA 4JBNA 4TL8A 5D5HA 2VQSA 5A4AA 1VMEA 1GFWA 1IN5A 3EAFA 2W4QA 4LXXA 3K6SB 1H2XA 1Y81A 2IXDA 3I28A 1H65A 3EVBA 3L8DA 1FRFS 3H2SA 1RJ9A 2W42A 4YHBA 1QU3A 1GGFA 1EGHA 2PGAA 2JJ1D 2XTAA 4XUCA 1GCGA 3WKDA 1U2GA 2XGMA 1L6RA 4N65A 4TTAA 2OCYC 3SMVA 2IGTA 4NMXB 1BZYA 1T4CB 5ALGA 1UINA 2A30A 4R0MA 1RJ9B 1XMPA 4WWHA 3M5DA 2IYNA 2X76A 3A1WA 1O58A 3PB3A 2VJOA 4IEEA 1DMSA 1BWPA 2CE7A 3JWGA 4HMQA 4RJLA 3A3KA 4UHDA 1KFCB 1H2YA 5F12A 3WAGA 4QLAA 1ISFA 1GNPA 3VR5H 2HQRA 4X3PA 3CCCA 6REQA 3HUEA 1A9ZA 4H6WA 2MWMA 2WJ3A 4OHVA 3TZEA 3OQOA 3OU7A 3H1AA 4LOLA 3HCAA 5I01A 4G36A 4F5ZA 3L8CA 4Y1RB 1LNZA 1R4MB 1HOTA 1F2TB 2IPOA 2WIJA 2XGSA 3GJTA 3GN2A 3MRXA 2RH9B 4UTVA 5H4GA 4MZXA 1FSGA 1T26A 2WYWA 5FUXA 5KKNB 1M7HA 4P0PB 2E18A 5KMGB 4M0KA 1NF8A 4UDOA 4X1KA 1DRJA 4EITA 2X0IA 3G2QA 2BTQB 3KZNA 3EW9A 1Q6ZA 1MIOA 2PZAA 4UTOA 2OO5A 4A6XA 2E7ZA 2J45A 3ETCA 1KJ9A 3BA6A 4G5OA 3FZYA 4E5PA 3VDQA 4ENUA 2XCSB 2XZOA 1Z7EA 3I61A 3CRMA 3CVVA 1IEXA 5FUWA 2ZR9A 5DW3A 1Q20A 3D54D 2NSYA 2X58A 3DQPA 5E4JA 1ZI9A 1Z74A 2FSHA 3RFUA 3V3KA 3KKMA 4DWOA 3TW6A 1I2AA 3C3CA 4IG9A 2QG9A 2OCBA 5E9AA 4ZODA 5FFFA 3PDCA 4P38A 3TEFA 4KR0A 4ITRC 4GI5A 4LXQA 3TOZA 2JF0A 1HE4A 4MRVA 2Z1NA 3PLNA 2YOHA 3PXEA 4BV2A 4PBSA 2YX1A 1JEAA 2XOKD 2YR0A 1RCFA 2XQVA 2VSXA 4GC5A 1L5KA 4A92A 4JYMA 3NP9A 1E1MA 3SICE 2DTXA 1UK7A 5LBIA 3S5UA 3TOSA 1H2BA 2QS9A 2W70A 4CWAA 2G72A 4KB5A 4O1MA 5HX7A 1N3IA 3Q9SA 4XR4A 4IV8A 1Y5MA 3N0WA 1I9CA 3DBOB 4D4JA 4D5EA 4NZYA 2C9OA 1AT1A 3OOYA 5FI1B 1V11A 3DWGA 5K8IA 1IBRA 1Y8CA 1QGED 1KDOA 1N2IA 2GZHA 3OSZA 5EA2A 4M54A 2WLTA 4FPXA 4TXMA 1ORDA 3V4RA 4QT0A 4TLAA 2X5JO 3NBFA 1WQ1R 4DLLA 3GPDG 4ZGWA 4WBNB 1RD4A 5ADVA 4XWKA 4PLPA 1D2HA 1GCIA 4GLJA 3P97A 3D8RA 3DFUA 4UUPA 3ZWBA 3OESA 3B3AA 4KR9A 4IJUA 1RPNA 1PD0A 3G9XA 4MICA 4CM5A 3O47A 3AI7A 1GUYA 2GPSA 4J0HA 1WW2A 2OV8A 5C8YA 1QZ3A 2ZGVA 4EKIA 3WKBA 4JUBA 5ALMA 3SC2A 2PLAA 2PE5A 4IUDS 1FYDA 1NP3A 4LI3X 2RHMA 4L7QA 3T9DA 2BMEA 4W5OA 4RTOA 2YN4A 2FEXA 4EGSA 4RKWA 2Q5HA 1N2SA 5EIAA 3ELWA 1WDLA 3BIXA 4PNPA 1U4NA 4UHJA 4OFXA 3I2FA 1BJKA 1BGWA 5I47A 2AX3A 2ZI4A 2VJMB 3E9CA 5CHEA 1IPEA 1MJ5A 5F78A 3RIMA 1U5CA 2ZE5A 1PK9A 2I62A 2QTVB 2X8BA 1OX4A 3IS3A 3NBAA 2R0QC 1WBBA 4X6LA 2H1LA 5IJ9B 1E3JA 4BAGA 2GBPA 3LWBA 4MPRA 3ABQB 1H3EA 3PC8C 3QNUA 3DHVA 3JRXA 4MSUA 5FHQA 1NVUQ 1V5EA 5ARBA 2FSSA 3BQNB 3EXIA 4NEHB 3RYCA 4KQFA 2VHXA 3IEVA 4KFSA 1OFUX 1OE0A 2AFRA 2IC5A 3A6FA 2YV2A 4UCQA 3G2MA 3RROA 3X1XA 3CZ9A 2CXHA 4JJGA 4HGNA 2HQSA 3THYB 2WV9A 2Z2XA 3MWGA 1Q2UA 4JLKA 4R9VA 2IHUA 4LYYA 4KWIA 5TQJA 4DNXA 1VHWA 3PXGA 2UYCA 2YXEA 2BEWB 1BE0A 3NOXA 4LCJA 4EPRA 2EFHB 2HCJB 1I7NA 3COWA 2OFWA 3EE6A 3ESCA 1H69A 6AT1A 3RK4A 1YBHA 3CRQA 3SXUA 4PQYA 3TAXA 1D9ZA 3ZQUA 3M1IA 4OM8A 4GWGA 2JGLA 3BC1A 4FMBB 1PZGA 2DJ5A 1QYCA 1VHTA 3RJZA 1VI5A 1EPUA 1CRWG 2OBYA 3UFBA 3JSAA 4M1KA 5I7VA 3CEMA 1YGYA 1SU6A 3F8SA 1SVKA 4NC9A 4QYTA 4C4ZA 4OOEA 3O2SB 3WK4A 2JJQA 4BUCA 3QWAA 5KC8A 4WFQA 3VX4A 1VMAA 5H59A 4EG4A 3D8SA 4ER3A 4INZA 2EKZA 3QE2A 4YCJA 1JHXA 3N8IA 1K3FA 4YO8A 3RYIB 4O2RA 2RI6A 3C6ZA 4ML3A 4MXDA 1DCTA 3QG1A 4UZFA 1VC2A 2E89A 4IIDA 4FMDF 5EGSA 4B32A 4YR7A 2BZGA 2XTZA 3OQHA 5AJHA 4M0MA 5L7TA 1XAHA 1L5FA 4RS4A 2HIAA 1PZMA 5F21A 5BYBA 1BGXT 2PXXA 2CB0A 2D1SA 2J31A 3LOUA 3IAAA 3BXFA 1RHRA 3AFGA 4R98A 2E55A 1FVOA 4BV8A 4LXUA 4DDHA 1IM2A 4PLYA 1KNXA 4MV8A 2VP2A 2PG3A 1IMOA 2DSNA 3A4TA 3A4IA 3HI4A 3ZK7A 2UUBB 1LSUA 4Z5XA 2VF4X 3MJSA 5K8CA 3VPAA 3THRA 1HYBA 2ZI6A 2WVGA 1BE1A 4RF2A 5TMEA 1HYQA 1QAMA 2QRKA 1YK1A 3I39X 4JSYA 3AILA 3L0YA 4UMFA 1F48A 3SR0A 3WZLA 1GQYA 5GQSA 5MGBA 2F64A 2K5UA 1T0JB 2OCGA 4ENTA 3L4KA 3QM1A 2YZKA 5FFMA 3U4GA 3EC2A 1DJQA 4YJ3A 1SUDA 3DO8A 2A9JA 1YQEA 1RBZA 4XOIA 4HH1A 3HSKA 2RIRA 4COKA 5AJYA 4NXMB 1HUQA 1SOAA 4M9UA 1G1MA 3DC7A 4R8VA 2IZ6A 5THKA 1KMIY 3D6FA 3ZJVA 3BH0A 1U7XA 4FDUA 2JLQA 1G7SA 1HKHA 1P91A 1U02A 1ZK2A 2E48A 4G4JA 1FFHA 4NU5A 3ZWCA 2ZTLA 3FRJA 3P4XA 2WNSA 4X90A 1KP3A 3MJEA 3NH6A 1D0VA 1GZHB 2D13A 4EGJA 4JQZA 5JCZA 3BAZA 2JCVA 1GADO 2J7KA 4I2NA 5ERGB 5LFAA 3KWFA 1UBOS 1IDOA 3L0PA 3DCIA 3WL7A 2IXAA 2VTVA 2YVQA 3T3EA 3F5DA 2R8XA 4X41A 4FCWA 4BWYA 1LDEA 3H4TA 1JZSA 2MSKA 4FILA 4MLDA 3WBFA 1CBUA 1QVRA 2WPNA 3F8TA 5BQ5A 3U3MA 4BV3A 1LPNA 1HEUA 2H2WA 2REQA 3PDHA 5I7RA 2VJPA 3DVAA 3WNQA 1RRGA 1YFKA 1D3AA 4HZUB 3V33A 2Z5VA 4TZTA 2EERA 1DG9A 3L0OA 5ALIA 4LF5B 4L3WA 4DMGA 1IDN1 3LWDA 3T3OA 3G5AA 2DH6A 1A5ZA 1JIJA 3LX8A 5J2UB 3UW1A 4BE9A 3B60A 1R1DA 1YB2A 1P1RA 2CBZA 4XIYA 3GNSA 2RSLA 4LC1A 3WLSA 2QROA 1R3DA 1TO6A 1K8YB 2H92A 2WZBA 3STTA 1MO3A 2C92A 3JZDA 4JCCA 4BN4A 1YAHA 3MJ4A 4KSBA 5B3JC 3V7YA 3MJTA 4DIBA 3E7PA 5FI3A 1T8SA 4NV0A 3ZVMA 2Z6AA 1OV6A 1NL3A 3BXGA 3TDNA 5BQFA 5DHSA 1ZU5A 4I1SA 5IH3A 2AG6A 1C7RA 3GJQA 4HQ6A 3JALB 2WIDA 3E3NA 2BGJA 3A25A 5IJ9A 3I8OA 3JAWA 2RONA 4JXJA 4YJFB 4CLRB 4LEIA 1XMIA 4YHHB 2ZKLA 1XRLA 3STYA 3KTFA 4M9RA 4CDNA 1NW5A 1OPRA 2DR2A 3VR5A 4KTTE 1V3UA 3IUSA 4HAXA 5BW8A 3FR8A 3OJWA 3EUWA 1N0VC 1WULS 1QG6A 2PEYA 4U5QA 1MPXA 5JOQA 2F7SA 3HNRA 2NTYC 4FFBA 4YIKA 3DS8A 4L8FA 1X2BA 1QVWA 4OM7A 5ICMA 2EGGA 2V7PA 4Y67A 1CUEA 4XIIA 2HF8A 2PUTA 4KJXA 2XSZA 3L41A 1GQFA 1Q91A 3KXIA 2VQFB 2HA5A 2JGEA 2JIQA 2PKQP 4BMPB 4KZKA 4PCAA 3L4BA 1ATIA 2Q0XA 1U3DA 2DEUA 2F59A 3A4NA 1SQSA 1DXOA 2EZ8A 2D2XA 4PZPA 4MI1A 4BX8A 4JLVA 1EGAA 1ODSA 5AHKA 2Z83A 1SD2A 2BGKA 3FGPA 4HNRA 4UC0A 4ZZ3A 2QENA 1TGVA 5HF5A 4E2ZA 4L9AA 2ZT5A 1CRLA 2BMAA 4RSGA 5LJIA 2G1UA 3ZG6A 3M5PA 3W2IA 3Q4GA 4BP9A 4FFWA 1T9KA 1IK6A 4JJFA 3K20A 3WLQA 1XFDA 4XSGA 1KL7A 2VBGA 3HRKA 5LYJA 4EY4A 3OD5A 2BCGY 1CUFA 3FYUB 4NYIR 1PQ4A 3GPIA 1UZLA 3X44A 4RMJA 1JA9A 4L16A 2E4WA 4ZD6A 1IXZA 3WMEA 3MTBA 4FU0A 4GOLD 2YHBA 4S2UA 3R44A 2XDQA 2PKQO 3H1PA 5CK5A 3WIDA 5BYKA 1ZD1A 3DXXA 1OXUA 5PNTA 1IWPB 3BRSA 1FUIA 4LYAA 4FK8A 2J3QA 3T0FA 2D5BA 3N59A 1NBEA 2ATEA 3PX2A 4HYYA 5H82A 5A0FA 4DCVA 3FPHA 2PUCA 1T2VA 4OATA 4YP0A 3U39A 5TGTA 1Z83A 3IB3A 4ZVSA 4C03A 3AVYA 3X1KA 3KNZA 2EKBA 1HYGA 1CNEA 2JGRA 4UW9A 2ZI3A 1RYYA 2O7SA 4FSXA 3SR3A 3SAJA 1MIOB 1SUCA 2WF9A 3TB6A 3JWHA 5F77A 4IM7A 4S1VA 5JU6A 3DLIA 1G8SA 4TS9A 1POWA 7AT1A 1JU3A 1U8FO 3B52X 4LQDA 4Z0TA 2JFZA 2PUFA 1JLSA 1F3OA 1NLZA 2DBZA 2MR5A 3RRBA 3TSAA 1XCMA 3EMVA 4A2CA 4URYR 1QIMA 1WAMA 4B45A 2BEUB 4FZVA 1TCUA 4OHKA 4ZTZB 3IT1A 4TWRA 5FEMA 3CNBA 3VKUA