4KWYA

Crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
137
structure length
137
Chain Sequence
AGVESGLSSIETVAAEGRGGYLLREQLDDALAHRQGSPAAYKLYLSVNEQRFARGVRLDNVANRFELRMSVDWRLLDAKNGAEVHKGRTDVSVTYDSADQPYAAIAAQQDGQERAAAEAARKIQLDLATWLAGKKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a hypothetical protein (CC_3750) from Caulobacter crescentus CB15 at 2.40 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Caulobacter crescentus
molecule tags Transport protein
total genus 45
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4kwyA00
4RH8A 4N4RB 2R76A 4KWYA 5TSEA 5IV8B 4Q35B 2JXPA 4NHRA 4RHBB 2N8XA 3BF2A 5IXMB
chains in the Genus database with same CATH superfamily
1X6FA 4BMJA 4B3SE 2M9AA 4LU9A 2EMIA 1P47A 2EN6A 1PJTA 4LF9E 3C4TA 2J7JA 3HTXA 2CT1A 2A25A 4F9CB 4J8ZA 1YUIA 2HGHA 2EPXA 1A1HA 5A6AA 1MEYC 2EN1A 2YT4A 2RS7A 4K0KE 2IHR1 2EP3A 4JI4E 2WZOA 2NABA 2EM9A 2EMZA 2EOYA 4R2AA 2LJUA 4DR1E 4JI2E 4LF6E 2VF1A 1IMUA 3MSWA 1A1KA 2L3JA 2EOEA 5IT9C 4IS1C 2EPAA 4R2CA 2ODRC 4RHBB 3C4BA 1ZBQA 2VE7C 3ADJA 3K6QA 3LLHA 1EH6A 2VQFE 2F8BA 2EMCA 1QNTA 2E5LE 4M2ZA 2GPIA 3KZYA 2RSIA 4X65E 2EOOA 5AASA 4DV7E 2JOBA 2ELYA 2RTXA 4DUYE 2UUAE 1TF6A 1KJKA 1YYKA 2EOHA 2L6MA 2L2KB 2EPNA 1RMDA 1X48A 3AUZA 2JP9A 2L92A 2EWLA 2KOUA 3T1HE 2EPZA 2V87A 3HQ1A 2DIXA 3J7AG 1AH5A 2EMKA 4DKKA 2MC5A 1WHQA 5LL6R 2LJHA 2YRHA 2DRPA 2DLQA 4P78A 2MKNA 4BCAA 3LMLA 3J7Yp 2YTDA 1N34E 3ECRA 2YTEA 5A6JA 2B3TB 1IBME 4DR4E 2CPNA 5LMUE 3VYXA 2CTDA 2NA2A 2BBGA 2YTOA 2EM3A 5LMNE 4WXDA 4X62E 2WBUA 2EPKX 2YU8A 2EN2A 1WHNA 1T4NA 2EM6A 2V88A 3KZZA 1HR0E 3JTZA 3ADLA 2FGGA 1PDAA 1GTKA 1JK1A 1EKZA 5BR8E 1ZAAC 4NXME 4F6MA 2EZ6A 2EMWA 1NCSA 2RSMA 1HNZE 1ZU1A 3KWRA 1EH7A 2LTSA 1N32E 4JI5E 4R2PA 4GKKE 3OMLA 2DSYA 3HPSA 2B7TA 1JK2A 1GZ6A 3MHHC 2L2NA 1AAYA 5A6BD 4BC7A 4ZYHA 1G2FC 4DR7E 2Q8UA 5KL5A 4R2RA 4LF5E 4KZSA 3P1XA 2LMZA 4DV4E 2NUFA 2DMYA 1A1JA 4X9JA 3EPKA 1FJGE 2V83A 2EPPA 1N33E 4DV1E 2E72A 2JR1A 3C6MA 3AV0A 1L4SA 2B7VA 2WBTA 1PJSA 2EN8A 4R2DA 3RMPA 2EN7A 2FTXB 2EL5A 4WXCA 1RC7A 2ADRA 2G7HA 2LUQA 2YTIA 2M4IA 2V89A 2LCEA 2LE2A 2HHHE 1QU6A 2EM5A 4B3RE 2UXCE 5A2QC 4DV0E 3JU0A 4DR6E 4LFBE 5DNYA 1YUJA 5FLXC 3THNA 2YTFA 1ZR9A 2EL4A 2R76A 5KL2A 2ELZA 1X5WA 5KL6A 1A1IA 2EOJA 3H09A 2YRMA 2LUPB 1IBKE 3TQMA 2EOQA 3J81C 4HEIA 2YPNA 2YTJA 2JOXA 1UN6B 4DV2E 2JPAA 2EMBA 3ADGA 3IWDA 4YY3E 3EPJA 1XNQE 4ZYEA 1BB8A 1RQ0A 4LTYA 2YU5A 4N4RB 5F3WA 2LTRA 2VQEE 1J5EE 2GLIA 2UXBE 2FV4B 2EPRA 2JWOA 1XMQE 4BS9A 5KL4A 4OX9E 4JI1E 2MC6A 2EN3A 4TUGA 2MKDA 4O24A 3BGHA 2M7QA 5IXMB 2EORA 2EMLA 2M1SA 5CFFE 1T4OA 1N3GA 4YHHE 2DLKA 4DMIA 1DI2A 1SFEA 3OTOE 4TUIA 2VRDA 5LLQA 2WBSA 4R2EA 4JI6E 2YRKA 1T4LB 4NXNE 1YYWA 3M99B 4JI7E 4WFTA 1A1FA 3VK6A 3F6GA 3ADIA 3J80C 2NUGA 3F6HA 5ADZA 5IV8B 2D9HA 1TN9A 4BHBA 2EM0A 2KHXA 4M30A 2EPCA 4L5NC 1YPNA 2LT7A 2MDRA 1KYQA 2CSHA 2EL6A 2EOZA 2L3CA 3DJWA 1GQEA 4KWYA 1A1LA 2EM4A 4JI3E 1LLMC 4BBYA 2EM7A 4B3ME 5AC4A 1XMOE 2DGCA 2B9DA 1FKAE 2EQ3A 2EOFA 2I13A 4NHRA 4F6NA 3MHSC 2EMYA 2RS6A 5KL7A 1UILA 4OOGC 2EQ1A 1TF3A 4ZYGA 4JYAE 3T1YE 2YZTA 2EOSA 4IJDA 4RH8A 1X6EA 4JI8E 3VHTB 1WXRA 3BF2A 3EPHA 2YTPA 1F2IG 2EJ4A 2H36X 3JAMC 4DR5E 1EH8A 2L8TA 5AC5A 5A69A 4JI0E 2N3HA 1N36E 1Z1BA 2EPOA 2JY9A 2I9IA 1UBDC 4LFAE 5AE1A 1WRJA 4WYQB 3EQ1A 1YYOA 2JYAA 4O5GA 3C6KA 2EMXA 4AQYE 2UXDE 1PJQA 1XNRE 2HC5A 1IQOA 5T6JA 4DUZE 2EMHA 2EM8A 1NEIA 1B69A 2R1FA 3FIGA 2JVAA 2LRSA 2LBSB 4NZVA 1HNXE 2UUBE 2N8XA 1X47A 3THOB 1SR9A 4X64E 5AE2A 4Q28A 5AE3A 1A1GA 3VYYA 1YSAC 4X8WA 1O0WA 2EOXA 1MGTA 1YZ9A 4R2QA 2NUEA 2WCC3 4BHCA 2V86A 4ZYDA 2K7IA 4KHPE 1STUA 4BC9A 1PKPA 3BIDA 4GZNC 1BBOA 2ODRD 4HTGA 2F4VE 3L00A 1IQSA 3IWBA 4F9AB 2YSPA 3EPLA 4GKJE 4JV5E 3HXLA 4B3TE 2ENHA 1DGCA 2V8QB 4P7DA 1J26A 2RPCA 4DV5E 3HPZA 4M0VA 5KL3A 2K4VA 2EN4A 1UHZA 5A6BA 4DV3E 1IBLE 4DR2E 1I94E 4Q35B 2EPLX 4F9BB 2RQLA 4R8OA 2EMAA 2BB8A 2PRTA 2YTQA 2HJJA 4WX9A 1WJPA 4FK5C 4WSGA 4LF8E 2ZM6E 4X66E 5A6KA 2E1MA 4R03A 4O43A 2DB2A 2EMGA 1X49A 2GHFA 4F54A 4L8NA 3UK3C 2KONA 1T38A 4LFCE 4F2JC 5IWAE 2LV2A 1X6HA 1DQ3A 1X3CA 3BBGA 2JXPA 2EOIA 2N3GA 1G2DC 2EQ0A 2LVHA 3DF6A 2LO3A 5TSEA 2EPUA 4WSPA 4I8OA 4M9VC 2YWQA 4WPYA 2EMFA 2UU9E 1HNWE 2L2MA 2MDGA 4LF4E 4DR3E 2EE8A 2YTGA 4O4KA 2UUCE 4LF7E 4DV6E 1T39A 4R2SA 2V85A 3IWCA 4GEQB 2DMIA 1BBGA 2L33A 3ZOQB 2EPMX 2EM2A 2YSOA 2YTNA 1YFHA 2EOMA 3QG5C 2ENAA 1ZBTA 4MLQA 4MLVA 2ENCA
chains in the Genus database with same CATH topology
4RH8A 4N4RB 2R76A 4KWYA 5TSEA 5IV8B 4Q35B 2JXPA 4NHRA 4RHBB 2N8XA 3BF2A 5IXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RH8 A;  4N4R B;  2R76 A;  4KWY A;  5TSE A;  5IV8 B;  4Q35 B;  2JXP A;  4NHR A;  4RHB B;  2N8X A;  3BF2 A;  5IXM B; 
#chains in the Genus database with same CATH topology
 1X6F A;  4BMJ A;  4B3S E;  2M9A A;  4LU9 A;  2EMI A;  1P47 A;  2EN6 A;  1PJT A;  4LF9 E;  3C4T A;  2J7J A;  3HTX A;  2CT1 A;  2A25 A;  4F9C B;  4J8Z A;  1YUI A;  2HGH A;  2EPX A;  1A1H A;  5A6A A;  1MEY C;  2EN1 A;  2YT4 A;  2RS7 A;  4K0K E;  2IHR 1;  2EP3 A;  4JI4 E;  2WZO A;  2NAB A;  2EM9 A;  2EMZ A;  2EOY A;  4R2A A;  2LJU A;  4DR1 E;  4JI2 E;  4LF6 E;  2VF1 A;  1IMU A;  3MSW A;  1A1K A;  2L3J A;  2EOE A;  5IT9 C;  4IS1 C;  2EPA A;  4R2C A;  2ODR C;  4RHB B;  3C4B A;  1ZBQ A;  2VE7 C;  3ADJ A;  3K6Q A;  3LLH A;  1EH6 A;  2VQF E;  2F8B A;  2EMC A;  1QNT A;  2E5L E;  4M2Z A;  2GPI A;  3KZY A;  2RSI A;  4X65 E;  2EOO A;  5AAS A;  4DV7 E;  2JOB A;  2ELY A;  2RTX A;  4DUY E;  2UUA E;  1TF6 A;  1KJK A;  1YYK A;  2EOH A;  2L6M A;  2L2K B;  2EPN A;  1RMD A;  1X48 A;  3AUZ A;  2JP9 A;  2L92 A;  2EWL A;  2KOU A;  3T1H E;  2EPZ A;  2V87 A;  3HQ1 A;  2DIX A;  3J7A G;  1AH5 A;  2EMK A;  4DKK A;  2MC5 A;  1WHQ A;  5LL6 R;  2LJH A;  2YRH A;  2DRP A;  2DLQ A;  4P78 A;  2MKN A;  4BCA A;  3LML A;  3J7Y p;  2YTD A;  1N34 E;  3ECR A;  2YTE A;  5A6J A;  2B3T B;  1IBM E;  4DR4 E;  2CPN A;  5LMU E;  3VYX A;  2CTD A;  2NA2 A;  2BBG A;  2YTO A;  2EM3 A;  5LMN E;  4WXD A;  4X62 E;  2WBU A;  2EPK X;  2YU8 A;  2EN2 A;  1WHN A;  1T4N A;  2EM6 A;  2V88 A;  3KZZ A;  1HR0 E;  3JTZ A;  3ADL A;  2FGG A;  1PDA A;  1GTK A;  1JK1 A;  1EKZ A;  5BR8 E;  1ZAA C;  4NXM E;  4F6M A;  2EZ6 A;  2EMW A;  1NCS A;  2RSM A;  1HNZ E;  1ZU1 A;  3KWR A;  1EH7 A;  2LTS A;  1N32 E;  4JI5 E;  4R2P A;  4GKK E;  3OML A;  2DSY A;  3HPS A;  2B7T A;  1JK2 A;  1GZ6 A;  3MHH C;  2L2N A;  1AAY A;  5A6B D;  4BC7 A;  4ZYH A;  1G2F C;  4DR7 E;  2Q8U A;  5KL5 A;  4R2R A;  4LF5 E;  4KZS A;  3P1X A;  2LMZ A;  4DV4 E;  2NUF A;  2DMY A;  1A1J A;  4X9J A;  3EPK A;  1FJG E;  2V83 A;  2EPP A;  1N33 E;  4DV1 E;  2E72 A;  2JR1 A;  3C6M A;  3AV0 A;  1L4S A;  2B7V A;  2WBT A;  1PJS A;  2EN8 A;  4R2D A;  3RMP A;  2EN7 A;  2FTX B;  2EL5 A;  4WXC A;  1RC7 A;  2ADR A;  2G7H A;  2LUQ A;  2YTI A;  2M4I A;  2V89 A;  2LCE A;  2LE2 A;  2HHH E;  1QU6 A;  2EM5 A;  4B3R E;  2UXC E;  5A2Q C;  4DV0 E;  3JU0 A;  4DR6 E;  4LFB E;  5DNY A;  1YUJ A;  5FLX C;  3THN A;  2YTF A;  1ZR9 A;  2EL4 A;  2R76 A;  5KL2 A;  2ELZ A;  1X5W A;  5KL6 A;  1A1I A;  2EOJ A;  3H09 A;  2YRM A;  2LUP B;  1IBK E;  3TQM A;  2EOQ A;  3J81 C;  4HEI A;  2YPN A;  2YTJ A;  2JOX A;  1UN6 B;  4DV2 E;  2JPA A;  2EMB A;  3ADG A;  3IWD A;  4YY3 E;  3EPJ A;  1XNQ E;  4ZYE A;  1BB8 A;  1RQ0 A;  4LTY A;  2YU5 A;  4N4R B;  5F3W A;  2LTR A;  2VQE E;  1J5E E;  2GLI A;  2UXB E;  2FV4 B;  2EPR A;  2JWO A;  1XMQ E;  4BS9 A;  5KL4 A;  4OX9 E;  4JI1 E;  2MC6 A;  2EN3 A;  4TUG A;  2MKD A;  4O24 A;  3BGH A;  2M7Q A;  5IXM B;  2EOR A;  2EML A;  2M1S A;  5CFF E;  1T4O A;  1N3G A;  4YHH E;  2DLK A;  4DMI A;  1DI2 A;  1SFE A;  3OTO E;  4TUI A;  2VRD A;  5LLQ A;  2WBS A;  4R2E A;  4JI6 E;  2YRK A;  1T4L B;  4NXN E;  1YYW A;  3M99 B;  4JI7 E;  4WFT A;  1A1F A;  3VK6 A;  3F6G A;  3ADI A;  3J80 C;  2NUG A;  3F6H A;  5ADZ A;  5IV8 B;  2D9H A;  1TN9 A;  4BHB A;  2EM0 A;  2KHX A;  4M30 A;  2EPC A;  4L5N C;  1YPN A;  2LT7 A;  2MDR A;  1KYQ A;  2CSH A;  2EL6 A;  2EOZ A;  2L3C A;  3DJW A;  1GQE A;  4KWY A;  1A1L A;  2EM4 A;  4JI3 E;  1LLM C;  4BBY A;  2EM7 A;  4B3M E;  5AC4 A;  1XMO E;  2DGC A;  2B9D A;  1FKA E;  2EQ3 A;  2EOF A;  2I13 A;  4NHR A;  4F6N A;  3MHS C;  2EMY A;  2RS6 A;  5KL7 A;  1UIL A;  4OOG C;  2EQ1 A;  1TF3 A;  4ZYG A;  4JYA E;  3T1Y E;  2YZT A;  2EOS A;  4IJD A;  4RH8 A;  1X6E A;  4JI8 E;  3VHT B;  1WXR A;  3BF2 A;  3EPH A;  2YTP A;  1F2I G;  2EJ4 A;  2H36 X;  3JAM C;  4DR5 E;  1EH8 A;  2L8T A;  5AC5 A;  5A69 A;  4JI0 E;  2N3H A;  1N36 E;  1Z1B A;  2EPO A;  2JY9 A;  2I9I A;  1UBD C;  4LFA E;  5AE1 A;  1WRJ A;  4WYQ B;  3EQ1 A;  1YYO A;  2JYA A;  4O5G A;  3C6K A;  2EMX A;  4AQY E;  2UXD E;  1PJQ A;  1XNR E;  2HC5 A;  1IQO A;  5T6J A;  4DUZ E;  2EMH A;  2EM8 A;  1NEI A;  1B69 A;  2R1F A;  3FIG A;  2JVA A;  2LRS A;  2LBS B;  4NZV A;  1HNX E;  2UUB E;  2N8X A;  1X47 A;  3THO B;  1SR9 A;  4X64 E;  5AE2 A;  4Q28 A;  5AE3 A;  1A1G A;  3VYY A;  1YSA C;  4X8W A;  1O0W A;  2EOX A;  1MGT A;  1YZ9 A;  4R2Q A;  2NUE A;  2WCC 3;  4BHC A;  2V86 A;  4ZYD A;  2K7I A;  4KHP E;  1STU A;  4BC9 A;  1PKP A;  3BID A;  4GZN C;  1BBO A;  2ODR D;  4HTG A;  2F4V E;  3L00 A;  1IQS A;  3IWB A;  4F9A B;  2YSP A;  3EPL A;  4GKJ E;  4JV5 E;  3HXL A;  4B3T E;  2ENH A;  1DGC A;  2V8Q B;  4P7D A;  1J26 A;  2RPC A;  4DV5 E;  3HPZ A;  4M0V A;  5KL3 A;  2K4V A;  2EN4 A;  1UHZ A;  5A6B A;  4DV3 E;  1IBL E;  4DR2 E;  1I94 E;  4Q35 B;  2EPL X;  4F9B B;  2RQL A;  4R8O A;  2EMA A;  2BB8 A;  2PRT A;  2YTQ A;  2HJJ A;  4WX9 A;  1WJP A;  4FK5 C;  4WSG A;  4LF8 E;  2ZM6 E;  4X66 E;  5A6K A;  2E1M A;  4R03 A;  4O43 A;  2DB2 A;  2EMG A;  1X49 A;  2GHF A;  4F54 A;  4L8N A;  3UK3 C;  2KON A;  1T38 A;  4LFC E;  4F2J C;  5IWA E;  2LV2 A;  1X6H A;  1DQ3 A;  1X3C A;  3BBG A;  2JXP A;  2EOI A;  2N3G A;  1G2D C;  2EQ0 A;  2LVH A;  3DF6 A;  2LO3 A;  5TSE A;  2EPU A;  4WSP A;  4I8O A;  4M9V C;  2YWQ A;  4WPY A;  2EMF A;  2UU9 E;  1HNW E;  2L2M A;  2MDG A;  4LF4 E;  4DR3 E;  2EE8 A;  2YTG A;  4O4K A;  2UUC E;  4LF7 E;  4DV6 E;  1T39 A;  4R2S A;  2V85 A;  3IWC A;  4GEQ B;  2DMI A;  1BBG A;  2L33 A;  3ZOQ B;  2EPM X;  2EM2 A;  2YSO A;  2YTN A;  1YFH A;  2EOM A;  3QG5 C;  2ENA A;  1ZBT A;  4MLQ A;  4MLV A;  2ENC A; 
#chains in the Genus database with same CATH homology
 4RH8 A;  4N4R B;  2R76 A;  4KWY A;  5TSE A;  5IV8 B;  4Q35 B;  2JXP A;  4NHR A;  4RHB B;  2N8X A;  3BF2 A;  5IXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...