4KWYA

Crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
137
structure length
137
Chain Sequence
AGVESGLSSIETVAAEGRGGYLLREQLDDALAHRQGSPAAYKLYLSVNEQRFARGVRLDNVANRFELRMSVDWRLLDAKNGAEVHKGRTDVSVTYDSADQPYAAIAAQQDGQERAAAEAARKIQLDLATWLAGKKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (CC_3750) from Caulobacter crescentus CB15 at 2.40 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Caulobacter crescentus
molecule tags Transport protein
molecule keywords Putative uncharacterized protein
total genus 45
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4kwyA00
4N4RB 4RH8A 4KWYA 2N8XA 4Q35B 3BF2A 5TSEA 5IV8B 2R76A 4NHRA 4RHBB 5IXMB 2JXPA
chains in the Genus database with same CATH superfamily
2V87A 1UBDC 2YTNA 2LMZA 2EPZA 1A1JA 2EMLA 1XNQE 4WX9A 4LF4E 2L2NA 2EPOA 3J7AG 2EPMX 1T4NA 1X6HA 1P47A 4DR3E 3C4BA 2UXCE 1WXRA 2LCEA 2N8XA 2V8QB 3AV0A 4DV6E 3THNA 5IV8B 2MKDA 4DUYE 1A1FA 3VHTB 1I94E 2JWOA 2LO3A 2WZOA 4X9JA 2YTFA 4NXME 2WBUA 2LTSA 2B9DA 4R2DA 4B3TE 2YSOA 2YPNA 2JXPA 2H36X 2EMHA 2PRTA 4DR2E 4GKKE 4X66E 1AAYA 1FKAE 3JAMC 2B7TA 4N4RB 4LF8E 2EOOA 2I9IA 3OMLA 4BMJA 2WBTA 3J7Yp 1A1LA 2EMBA 2EMFA 2EQ0A 3T1HE 2K4VA 1WHNA 2E5LE 1XNRE 2EPPA 4LF9E 4GKJE 4DV7E 2BB8A 2G7HA 1BB8A 2RTXA 2EOHA 3KZYA 2EMKA 1G2FC 4YY3E 5A6JA 4MLQA 4WXDA 2DB2A 3JU0A 4DV5E 2LE2A 5A6BA 3MHSC 2LVHA 1MGTA 4B3SE 4P7DA 2EOJA 4BC7A 1TF3A 1WRJA 2EOMA 2IHR1 2EL5A 2EN4A 2EWLA 2EN7A 2CSHA 2VE7C 1G2DC 4ZYHA 5KL4A 2YRHA 3J81C 2FGGA 1N34E 2YRKA 4DR7E 3DJWA 3VYXA 2I13A 3HPSA 4WXCA 3ZOQB 2V85A 2DMYA 2EM9A 2EPXA 3IWBA 1EH6A 2E1MA 2V89A 4OOGC 5BR8E 1ZR9A 1UHZA 1IBME 4WFTA 1AH5A 1RQ0A 4M9VC 4F9CB 5A6KA 5KL5A 4Q35B 2UXBE 2UU9E 2RQLA 4JI0E 1X47A 2M1SA 2DRPA 1RMDA 2MKNA 4WYQB 2EPRA 1F2IG 1PJTA 4ZYEA 2EMGA 1IMUA 5A6BD 1BBGA 1YYKA 3BF2A 2ZM6E 2YU5A 2DLQA 2D9HA 5CFFE 5LMNE 4JI3E 1YFHA 2JYAA 1QU6A 4R2EA 4R2PA 4B3RE 3M99B 3EPJA 1NCSA 2UUCE 2KONA 2RS7A 4LTYA 3EPLA 4DR6E 2L3CA 4F2JC 4ZYDA 2L2MA 1B69A 1EH7A 2LTRA 2DIXA 3C6MA 1EKZA 2F4VE 4R03A 2ELZA 1HR0E 1HNXE 1TF6A 2DGCA 4I8OA 4RHBB 1N33E 1PJSA 1A1GA 3QG5C 3K6QA 2YU8A 1Z1BA 4LF6E 2YTJA 4L8NA 2LRSA 1KYQA 2LBSB 1SR9A 2EORA 4GZNC 1X3CA 4ZYGA 2FTXB 4O5GA 1MEYC 2YTEA 4LFCE 4M2ZA 2FV4B 3P1XA 4X64E 2DMIA 3F6GA 4FK5C 2UUAE 3F6HA 2YZTA 1ZU1A 2BBGA 2ENHA 2EOYA 3MHHC 1NEIA 1DGCA 4AQYE 2JOBA 2NUGA 1WJPA 1YPNA 4NHRA 1QNTA 1WHQA 2RSMA 1PKPA 1JK2A 4DV1E 2UXDE 4TUGA 2M9AA 4F9BB 3EPKA 1YUJA 5KL3A 4R2RA 2B7VA 2B3TB 2EMXA 1IBLE 4BBYA 1IQOA 3THOB 2WCC3 1RC7A 2EMWA 1X48A 2EMIA 1UILA 2EM0A 5KL2A 2ENAA 2EM2A 4F9AB 2YRMA 2CTDA 3VK6A 4YHHE 2EOQA 2CT1A 2LJHA 3C4TA 1GTKA 4JYAE 4K0KE 2EMYA 2EL6A 1IBKE 2EN6A 2VQFE 2F8BA 2EQ1A 2V86A 2RS6A 4DKKA 2N3HA 1PJQA 2DLKA 5T6JA 2J7JA 1J26A 4B3ME 2JVAA 2EPCA 4BHCA 1SFEA 2HC5A 4NZVA 2EOSA 3L00A 2JY9A 2HJJA 1X49A 2N3GA 4DV4E 1ZBQA 1HNWE 1KJKA 1X6FA 3TQMA 2EZ6A 4F6NA 2EM5A 2EN1A 1LLMC 1FJGE 2HHHE 2EPAA 3VYYA 2GPIA 2EOIA 1GQEA 5A6AA 2YT4A 2M4IA 2YWQA 5KL7A 5IWAE 4LF7E 3HTXA 5A69A 1ZBTA 2JP9A 5AASA 4R8OA 2JOXA 1HNZE 4JI5E 3FIGA 4BC9A 4Q28A 2EQ3A 5A2QC 5AE2A 3BGHA 2YSPA 2E72A 4KHPE 4X65E 2JR1A 2YTPA 1BBOA 1N32E 4KWYA 3J80C 3DF6A 4WSPA 2NUEA 3AUZA 1GZ6A 4JI7E 4DR5E 4IS1C 4DMIA 1YZ9A 4DUZE 4J8ZA 3BIDA 1TN9A 1YYOA 1DI2A 5LLQA 1YSAC 3IWDA 1X5WA 1XMQE 2L33A 2JPAA 4JI6E 4DV3E 3IWCA 2V83A 4IJDA 4O24A 5DNYA 3HQ1A 1N36E 4L5NC 2EM8A 2L6MA 2NUFA 2EOXA 2VQEE 3ADIA 1IQSA 4WSGA 1YYWA 4DR4E 3HPZA 5AE3A 5LMUE 1YUIA 2EOFA 4WPYA 2EP3A 4OX9E 3RMPA 1N3GA 4X62E 1EH8A 4GEQB 4P78A 3OTOE 5LL6R 1STUA 2LT7A 2R1FA 3KWRA 2EOEA 2LV2A 2HGHA 3BBGA 2EMCA 2ODRC 3JTZA 2Q8UA 2MC6A 1ZAAC 1A1HA 3HXLA 2MDGA 1L4SA 2EN2A 2K7IA 2EN8A 5AE1A 3UK3C 4R2QA 2ODRD 2NABA 4R2AA 2M7QA 4JI4E 4LF5E 2DSYA 4JI1E 2L92A 4DR1E 2EOZA 2L8TA 3C6KA 4JV5E 4JI8E 2EPUA 5IXMB 1XMOE 4M0VA 4X8WA 2WBSA 2ADRA 2EMAA 4LU9A 2KOUA 5TSEA 2YTIA 2YTOA 2ELYA 3LLHA 4R2SA 2MC5A 2GLIA 1PDAA 2YTGA 3ADLA 2VF1A 4BCAA 4DV2E 4F6MA 4TUIA 4NXNE 2EM6A 2EM3A 3KZZA 2UUBE 2A25A 5F3WA 4MLVA 2EL4A 2V88A 5ADZA 2L3JA 4KZSA 1J5EE 2YTQA 2LJUA 3ECRA 4JI2E 2R76A 3ADJA 2CPNA 2ENCA 4F54A 4DV0E 1T4OA 5FLXC 2RPCA 3H09A 2LUQA 2EM7A 2EPNA 1JK1A 4O43A 4LFBE 5KL6A 2EJ4A 2EPLX 2EPKX 3EQ1A 1O0WA 5AC4A 4HTGA 1T4LB 1A1IA 2MDRA 4HEIA 1T38A 3EPHA 1X6EA 1A1KA 4R2CA 2VRDA 2EMZA 5AC5A 2NA2A 3LMLA 2RSIA 5IT9C 4BHBA 3MSWA 2KHXA 2EM4A 4LFAE 3ADGA 4O4KA 4RH8A 2GHFA 4BS9A 1DQ3A 1T39A 2L2KB 2EE8A 2YTDA 1UN6B 3T1YE 4M30A 2EN3A 2LUPB
chains in the Genus database with same CATH topology
4N4RB 4RH8A 4KWYA 2N8XA 4Q35B 3BF2A 5TSEA 5IV8B 2R76A 4NHRA 4RHBB 5IXMB 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4R B;  4RH8 A;  4KWY A;  2N8X A;  4Q35 B;  3BF2 A;  5TSE A;  5IV8 B;  2R76 A;  4NHR A;  4RHB B;  5IXM B;  2JXP A; 
#chains in the Genus database with same CATH topology
 2V87 A;  1UBD C;  2YTN A;  2LMZ A;  2EPZ A;  1A1J A;  2EML A;  1XNQ E;  4WX9 A;  4LF4 E;  2L2N A;  2EPO A;  3J7A G;  2EPM X;  1T4N A;  1X6H A;  1P47 A;  4DR3 E;  3C4B A;  2UXC E;  1WXR A;  2LCE A;  2N8X A;  2V8Q B;  3AV0 A;  4DV6 E;  3THN A;  5IV8 B;  2MKD A;  4DUY E;  1A1F A;  3VHT B;  1I94 E;  2JWO A;  2LO3 A;  2WZO A;  4X9J A;  2YTF A;  4NXM E;  2WBU A;  2LTS A;  2B9D A;  4R2D A;  4B3T E;  2YSO A;  2YPN A;  2JXP A;  2H36 X;  2EMH A;  2PRT A;  4DR2 E;  4GKK E;  4X66 E;  1AAY A;  1FKA E;  3JAM C;  2B7T A;  4N4R B;  4LF8 E;  2EOO A;  2I9I A;  3OML A;  4BMJ A;  2WBT A;  3J7Y p;  1A1L A;  2EMB A;  2EMF A;  2EQ0 A;  3T1H E;  2K4V A;  1WHN A;  2E5L E;  1XNR E;  2EPP A;  4LF9 E;  4GKJ E;  4DV7 E;  2BB8 A;  2G7H A;  1BB8 A;  2RTX A;  2EOH A;  3KZY A;  2EMK A;  1G2F C;  4YY3 E;  5A6J A;  4MLQ A;  4WXD A;  2DB2 A;  3JU0 A;  4DV5 E;  2LE2 A;  5A6B A;  3MHS C;  2LVH A;  1MGT A;  4B3S E;  4P7D A;  2EOJ A;  4BC7 A;  1TF3 A;  1WRJ A;  2EOM A;  2IHR 1;  2EL5 A;  2EN4 A;  2EWL A;  2EN7 A;  2CSH A;  2VE7 C;  1G2D C;  4ZYH A;  5KL4 A;  2YRH A;  3J81 C;  2FGG A;  1N34 E;  2YRK A;  4DR7 E;  3DJW A;  3VYX A;  2I13 A;  3HPS A;  4WXC A;  3ZOQ B;  2V85 A;  2DMY A;  2EM9 A;  2EPX A;  3IWB A;  1EH6 A;  2E1M A;  2V89 A;  4OOG C;  5BR8 E;  1ZR9 A;  1UHZ A;  1IBM E;  4WFT A;  1AH5 A;  1RQ0 A;  4M9V C;  4F9C B;  5A6K A;  5KL5 A;  4Q35 B;  2UXB E;  2UU9 E;  2RQL A;  4JI0 E;  1X47 A;  2M1S A;  2DRP A;  1RMD A;  2MKN A;  4WYQ B;  2EPR A;  1F2I G;  1PJT A;  4ZYE A;  2EMG A;  1IMU A;  5A6B D;  1BBG A;  1YYK A;  3BF2 A;  2ZM6 E;  2YU5 A;  2DLQ A;  2D9H A;  5CFF E;  5LMN E;  4JI3 E;  1YFH A;  2JYA A;  1QU6 A;  4R2E A;  4R2P A;  4B3R E;  3M99 B;  3EPJ A;  1NCS A;  2UUC E;  2KON A;  2RS7 A;  4LTY A;  3EPL A;  4DR6 E;  2L3C A;  4F2J C;  4ZYD A;  2L2M A;  1B69 A;  1EH7 A;  2LTR A;  2DIX A;  3C6M A;  1EKZ A;  2F4V E;  4R03 A;  2ELZ A;  1HR0 E;  1HNX E;  1TF6 A;  2DGC A;  4I8O A;  4RHB B;  1N33 E;  1PJS A;  1A1G A;  3QG5 C;  3K6Q A;  2YU8 A;  1Z1B A;  4LF6 E;  2YTJ A;  4L8N A;  2LRS A;  1KYQ A;  2LBS B;  1SR9 A;  2EOR A;  4GZN C;  1X3C A;  4ZYG A;  2FTX B;  4O5G A;  1MEY C;  2YTE A;  4LFC E;  4M2Z A;  2FV4 B;  3P1X A;  4X64 E;  2DMI A;  3F6G A;  4FK5 C;  2UUA E;  3F6H A;  2YZT A;  1ZU1 A;  2BBG A;  2ENH A;  2EOY A;  3MHH C;  1NEI A;  1DGC A;  4AQY E;  2JOB A;  2NUG A;  1WJP A;  1YPN A;  4NHR A;  1QNT A;  1WHQ A;  2RSM A;  1PKP A;  1JK2 A;  4DV1 E;  2UXD E;  4TUG A;  2M9A A;  4F9B B;  3EPK A;  1YUJ A;  5KL3 A;  4R2R A;  2B7V A;  2B3T B;  2EMX A;  1IBL E;  4BBY A;  1IQO A;  3THO B;  2WCC 3;  1RC7 A;  2EMW A;  1X48 A;  2EMI A;  1UIL A;  2EM0 A;  5KL2 A;  2ENA A;  2EM2 A;  4F9A B;  2YRM A;  2CTD A;  3VK6 A;  4YHH E;  2EOQ A;  2CT1 A;  2LJH A;  3C4T A;  1GTK A;  4JYA E;  4K0K E;  2EMY A;  2EL6 A;  1IBK E;  2EN6 A;  2VQF E;  2F8B A;  2EQ1 A;  2V86 A;  2RS6 A;  4DKK A;  2N3H A;  1PJQ A;  2DLK A;  5T6J A;  2J7J A;  1J26 A;  4B3M E;  2JVA A;  2EPC A;  4BHC A;  1SFE A;  2HC5 A;  4NZV A;  2EOS A;  3L00 A;  2JY9 A;  2HJJ A;  1X49 A;  2N3G A;  4DV4 E;  1ZBQ A;  1HNW E;  1KJK A;  1X6F A;  3TQM A;  2EZ6 A;  4F6N A;  2EM5 A;  2EN1 A;  1LLM C;  1FJG E;  2HHH E;  2EPA A;  3VYY A;  2GPI A;  2EOI A;  1GQE A;  5A6A A;  2YT4 A;  2M4I A;  2YWQ A;  5KL7 A;  5IWA E;  4LF7 E;  3HTX A;  5A69 A;  1ZBT A;  2JP9 A;  5AAS A;  4R8O A;  2JOX A;  1HNZ E;  4JI5 E;  3FIG A;  4BC9 A;  4Q28 A;  2EQ3 A;  5A2Q C;  5AE2 A;  3BGH A;  2YSP A;  2E72 A;  4KHP E;  4X65 E;  2JR1 A;  2YTP A;  1BBO A;  1N32 E;  4KWY A;  3J80 C;  3DF6 A;  4WSP A;  2NUE A;  3AUZ A;  1GZ6 A;  4JI7 E;  4DR5 E;  4IS1 C;  4DMI A;  1YZ9 A;  4DUZ E;  4J8Z A;  3BID A;  1TN9 A;  1YYO A;  1DI2 A;  5LLQ A;  1YSA C;  3IWD A;  1X5W A;  1XMQ E;  2L33 A;  2JPA A;  4JI6 E;  4DV3 E;  3IWC A;  2V83 A;  4IJD A;  4O24 A;  5DNY A;  3HQ1 A;  1N36 E;  4L5N C;  2EM8 A;  2L6M A;  2NUF A;  2EOX A;  2VQE E;  3ADI A;  1IQS A;  4WSG A;  1YYW A;  4DR4 E;  3HPZ A;  5AE3 A;  5LMU E;  1YUI A;  2EOF A;  4WPY A;  2EP3 A;  4OX9 E;  3RMP A;  1N3G A;  4X62 E;  1EH8 A;  4GEQ B;  4P78 A;  3OTO E;  5LL6 R;  1STU A;  2LT7 A;  2R1F A;  3KWR A;  2EOE A;  2LV2 A;  2HGH A;  3BBG A;  2EMC A;  2ODR C;  3JTZ A;  2Q8U A;  2MC6 A;  1ZAA C;  1A1H A;  3HXL A;  2MDG A;  1L4S A;  2EN2 A;  2K7I A;  2EN8 A;  5AE1 A;  3UK3 C;  4R2Q A;  2ODR D;  2NAB A;  4R2A A;  2M7Q A;  4JI4 E;  4LF5 E;  2DSY A;  4JI1 E;  2L92 A;  4DR1 E;  2EOZ A;  2L8T A;  3C6K A;  4JV5 E;  4JI8 E;  2EPU A;  5IXM B;  1XMO E;  4M0V A;  4X8W A;  2WBS A;  2ADR A;  2EMA A;  4LU9 A;  2KOU A;  5TSE A;  2YTI A;  2YTO A;  2ELY A;  3LLH A;  4R2S A;  2MC5 A;  2GLI A;  1PDA A;  2YTG A;  3ADL A;  2VF1 A;  4BCA A;  4DV2 E;  4F6M A;  4TUI A;  4NXN E;  2EM6 A;  2EM3 A;  3KZZ A;  2UUB E;  2A25 A;  5F3W A;  4MLV A;  2EL4 A;  2V88 A;  5ADZ A;  2L3J A;  4KZS A;  1J5E E;  2YTQ A;  2LJU A;  3ECR A;  4JI2 E;  2R76 A;  3ADJ A;  2CPN A;  2ENC A;  4F54 A;  4DV0 E;  1T4O A;  5FLX C;  2RPC A;  3H09 A;  2LUQ A;  2EM7 A;  2EPN A;  1JK1 A;  4O43 A;  4LFB E;  5KL6 A;  2EJ4 A;  2EPL X;  2EPK X;  3EQ1 A;  1O0W A;  5AC4 A;  4HTG A;  1T4L B;  1A1I A;  2MDR A;  4HEI A;  1T38 A;  3EPH A;  1X6E A;  1A1K A;  4R2C A;  2VRD A;  2EMZ A;  5AC5 A;  2NA2 A;  3LML A;  2RSI A;  5IT9 C;  4BHB A;  3MSW A;  2KHX A;  2EM4 A;  4LFA E;  3ADG A;  4O4K A;  4RH8 A;  2GHF A;  4BS9 A;  1DQ3 A;  1T39 A;  2L2K B;  2EE8 A;  2YTD A;  1UN6 B;  3T1Y E;  4M30 A;  2EN3 A;  2LUP B; 
#chains in the Genus database with same CATH homology
 4N4R B;  4RH8 A;  4KWY A;  2N8X A;  4Q35 B;  3BF2 A;  5TSE A;  5IV8 B;  2R76 A;  4NHR A;  4RHB B;  5IXM B;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...