4KWYA

Crystal structure of a putative lipoprotein (cc_3750) from caulobacter crescentus cb15 at 2.40 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
137
structure length
137
Chain Sequence
b'AGVESGLSSIETVAAEGRGGYLLREQLDDALAHRQGSPAAYKLYLSVNEQRFARGVRLDNVANRFELRMSVDWRLLDAKNGAEVHKGRTDVSVTYDSADQPYAAIAAQQDGQERAAAEAARKIQLDLATWLAGKKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a hypothetical protein (CC_3750) from Caulobacter crescentus CB15 at 2.40 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Caulobacter crescentus
molecule tags Transport protein
total genus 45
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4kwyA00
2N8XA 2JXPA 4RH8A 4N4RB 5IXMB 5IV8B 3BF2A 4NHRA 5TSEA 4RHBB 2R76A 4KWYA 4Q35B
chains in the Genus database with same CATH superfamily
1L4SA 4BBYA 1BBOA 1X6FA 3F6GA 1G2FC 3MHSC 2DB2A 2EN4A 2EN8A 4M2ZA 2NUEA 4BC7A 2YSPA 5KL7A 1J5EE 2F8BA 4LFAE 2EPPA 1XNQE 2N3HA 4P78A 4RH8A 4X62E 2EOXA 2UXBE 3J7AG 4ZYHA 2EOJA 3KZZA 2EOSA 2V87A 4R2EA 2DSYA 4M9VC 4Q28A 4LFBE 4M30A 2VQEE 1T4NA 1T4OA 2EPZA 4DV6E 3T1YE 3J7Yp 2G7HA 3HXLA 1XNRE 4JI8E 2WCC3 4LU9A 2MKDA 2EORA 5F3WA 2B9DA 2EN2A 2EL6A 4LTYA 2DMYA 2EM3A 2JWOA 4F54A 2VF1A 4IS1C 1NCSA 2L3CA 2WBUA 2JPAA 4B3ME 1EH6A 2UXCE 4F9BB 3KWRA 4BMJA 1RMDA 1HR0E 2YWQA 4JI1E 1EH8A 3HPZA 2UXDE 3VHTB 2EMAA 3IWCA 2WZOA 3ADGA 4X9JA 1JK2A 2PRTA 4NHRA 1X6HA 2D9HA 1SR9A 3K6QA 2L92A 4DV0E 1TF6A 4R2DA 4JYAE 2VE7C 2DMIA 3IWBA 2L2NA 4LF4E 2EMCA 4R2QA 2EOQA 2UUBE 2EMIA 4WPYA 5LLQA 3ZOQB 2YZTA 2ELYA 5ADZA 4JV5E 2EMZA 1J26A 2EOYA 4WFTA 2DLKA 4LFCE 2EE8A 2BBGA 2Q8UA 2RSIA 1X5WA 3HQ1A 2ENAA 3AUZA 4WXDA 2EPMX 2YT4A 4JI4E 2EWLA 2CSHA 4BS9A 4DR7E 2DIXA 2H36X 3J81C 2EM5A 4LF5E 4I8OA 4JI2E 4DR6E 3C6MA 4BC9A 2M4IA 2YTEA 2EL4A 2LUQA 3EPJA 4B3SE 3QG5C 3JAMC 4N4RB 5AE2A 5A69A 1NEIA 4WSGA 1GZ6A 2VQFE 1T39A 2K4VA 4ZYDA 2LO3A 2LVHA 5AC5A 2DLQA 4GKJE 2EOMA 2B7VA 1YUJA 3J80C 4DR5E 4OX9E 3LMLA 4DR2E 4R2PA 2YPNA 4HEIA 4R8OA 2NUGA 2EM7A 2EOZA 3HTXA 2M1SA 1DGCA 5KL4A 2L8TA 1KJKA 2V86A 1YPNA 4DR4E 1MGTA 2JP9A 1YFHA 2CPNA 5KL3A 1EKZA 1SFEA 4R03A 4LF6E 2FGGA 1WHQA 1UN6B 4O24A 1FKAE 2EJ4A 4GZNC 4O4KA 2EOFA 2FTXB 1A1FA 4DV4E 1ZU1A 2E5LE 5IT9C 2WBSA 4J8ZA 2V83A 2JOBA 1A1JA 5AE1A 2LE2A 2EMFA 2RQLA 4L8NA 3RMPA 1O0WA 2ELZA 4DMIA 1FJGE 1UHZA 4LF7E 3F6HA 2JOXA 4LF8E 1DQ3A 3BIDA 3ADLA 4YHHE 1HNXE 4B3RE 4ZYGA 4ZYEA 4FK5C 2MDRA 5AC4A 2JYAA 1YUIA 5A2QC 2EM0A 5BR8E 2EQ0A 2ENHA 1MEYC 1STUA 4WX9A 3UK3C 2KHXA 2LJUA 4AQYE 3ECRA 1N3GA 2EMGA 2ENCA 2YRKA 2F4VE 3DF6A 2FV4B 4DUYE 4F2JC 2V88A 4OOGC 3C4TA 3P1XA 2EOEA 2EPCA 1T38A 3MSWA 3T1HE 1ZAAC 3BF2A 4X66E 2KOUA 2M7QA 1YSAC 2EMYA 2JY9A 2EMHA 4X65E 1B69A 2UUCE 2EZ6A 3C6KA 5FLXC 2NABA 1IQOA 1BB8A 1GTKA 1X47A 2EM4A 3BGHA 1A1HA 4GKKE 1T4LB 4JI3E 3L00A 4BHBA 1AAYA 1BBGA 2V85A 4KWYA 5T6JA 4R2RA 2EOOA 1PJSA 1F2IG 2YTGA 1G2DC 2R76A 3VK6A 5AASA 2ADRA 2LBSB 1N32E 2L6MA 3THOB 2WBTA 1EH7A 1XMOE 4LF9E 2EN3A 1X6EA 1ZBQA 4WYQB 2N3GA 4DV1E 2A25A 2EQ3A 2HJJA 2JR1A 2L3JA 2MDGA 5A6BD 1HNWE 4NXNE 1XMQE 4Q35B 1IMUA 4JI6E 4R2AA 2EM2A 4X64E 2EMBA 4M0VA 2UUAE 3LLHA 4F6NA 5TSEA 1YYOA 4P7DA 2ZM6E 5LMNE 1PDAA 2K7IA 1TF3A 4TUIA 1YYWA 2M9AA 5KL5A 3M99B 4DV3E 2L2KB 2UU9E 1DI2A 1PJQA 3EPKA 2YU8A 1IBKE 1IBME 4X8WA 2N8XA 4BCAA 1P47A 1RC7A 1X49A 1HNZE 3KZYA 3IWDA 4NZVA 2GLIA 1LLMC 2ODRD 2MC5A 2EOHA 5IWAE 1WRJA 2VRDA 2RPCA 4KZSA 2EN7A 2J7JA 3EQ1A 1A1LA 1N33E 1N34E 2V89A 1AH5A 2JXPA 3HPSA 1UILA 2E1MA 4O43A 2EM6A 1JK1A 3VYXA 4GEQB 2KONA 4DR1E 1KYQA 2EMKA 1A1IA 2EL5A 5KL6A 4F9AB 4K0KE 1RQ0A 1PKPA 4MLVA 2EPOA 5KL2A 2YRHA 2EN6A 3EPLA 1YYKA 1Z1BA 1IQSA 2YTJA 2DRPA 2RSMA 3VYYA 2MKNA 2LJHA 2LTSA 4O5GA 4YY3E 1YZ9A 5AE3A 2YTPA 2EN1A 4F9CB 2EP3A 2L33A 4R2CA 1TN9A 2NUFA 2YTIA 2CT1A 2YTNA 4DUZE 4WSPA 2EPNA 3JU0A 5LMUE 1I94E 4NXME 2L2MA 5A6KA 2YU5A 4BHCA 2RTXA 5IV8B 5CFFE 1WXRA 1WHNA 2IHR1 2LV2A 2MC6A 2RS7A 3OMLA 3EPHA 5A6JA 1WJPA 1PJTA 3AV0A 1IBLE 4JI5E 2EPKX 4TUGA 2EPUA 3ADIA 4DR3E 2HHHE 3DJWA 2LMZA 4B3TE 3C4BA 2EPRA 2EMWA 2V8QB 1A1GA 2I13A 4DV5E 2ODRC 4HTGA 1QNTA 4R2SA 4L5NC 2NA2A 2EQ1A 3TQMA 3OTOE 2EM9A 2CTDA 3THNA 2EMXA 2HGHA 4IJDA 2YTOA 4KHPE 1QU6A 5DNYA 4WXCA 2EM8A 2YTDA 2RS6A 2E72A 3MHHC 1N36E 2LRSA 5LL6R 2GHFA 5A6AA 2LT7A 1ZR9A 2R1FA 2YTFA 5A6BA 2HC5A 2LTRA 2EOIA 2EPAA 2I9IA 4MLQA 2LUPB 4JI0E 3FIGA 4RHBB 3JTZA 2EPLX 1X3CA 3ADJA 4JI7E 4DV7E 2YSOA 1GQEA 1A1KA 2EMLA 4DKKA 2JVAA 2B3TB 4F6MA 2LCEA 2EPXA 4DV2E 3H09A 1X48A 2BB8A 1ZBTA 5IXMB 2B7TA 2GPIA 1UBDC 2YRMA 2DGCA 3BBGA 2YTQA
chains in the Genus database with same CATH topology
2N8XA 2JXPA 4RH8A 4N4RB 5IXMB 5IV8B 3BF2A 4NHRA 5TSEA 4RHBB 2R76A 4KWYA 4Q35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8X A;  2JXP A;  4RH8 A;  4N4R B;  5IXM B;  5IV8 B;  3BF2 A;  4NHR A;  5TSE A;  4RHB B;  2R76 A;  4KWY A;  4Q35 B; 
#chains in the Genus database with same CATH topology
 1L4S A;  4BBY A;  1BBO A;  1X6F A;  3F6G A;  1G2F C;  3MHS C;  2DB2 A;  2EN4 A;  2EN8 A;  4M2Z A;  2NUE A;  4BC7 A;  2YSP A;  5KL7 A;  1J5E E;  2F8B A;  4LFA E;  2EPP A;  1XNQ E;  2N3H A;  4P78 A;  4RH8 A;  4X62 E;  2EOX A;  2UXB E;  3J7A G;  4ZYH A;  2EOJ A;  3KZZ A;  2EOS A;  2V87 A;  4R2E A;  2DSY A;  4M9V C;  4Q28 A;  4LFB E;  4M30 A;  2VQE E;  1T4N A;  1T4O A;  2EPZ A;  4DV6 E;  3T1Y E;  3J7Y p;  2G7H A;  3HXL A;  1XNR E;  4JI8 E;  2WCC 3;  4LU9 A;  2MKD A;  2EOR A;  5F3W A;  2B9D A;  2EN2 A;  2EL6 A;  4LTY A;  2DMY A;  2EM3 A;  2JWO A;  4F54 A;  2VF1 A;  4IS1 C;  1NCS A;  2L3C A;  2WBU A;  2JPA A;  4B3M E;  1EH6 A;  2UXC E;  4F9B B;  3KWR A;  4BMJ A;  1RMD A;  1HR0 E;  2YWQ A;  4JI1 E;  1EH8 A;  3HPZ A;  2UXD E;  3VHT B;  2EMA A;  3IWC A;  2WZO A;  3ADG A;  4X9J A;  1JK2 A;  2PRT A;  4NHR A;  1X6H A;  2D9H A;  1SR9 A;  3K6Q A;  2L92 A;  4DV0 E;  1TF6 A;  4R2D A;  4JYA E;  2VE7 C;  2DMI A;  3IWB A;  2L2N A;  4LF4 E;  2EMC A;  4R2Q A;  2EOQ A;  2UUB E;  2EMI A;  4WPY A;  5LLQ A;  3ZOQ B;  2YZT A;  2ELY A;  5ADZ A;  4JV5 E;  2EMZ A;  1J26 A;  2EOY A;  4WFT A;  2DLK A;  4LFC E;  2EE8 A;  2BBG A;  2Q8U A;  2RSI A;  1X5W A;  3HQ1 A;  2ENA A;  3AUZ A;  4WXD A;  2EPM X;  2YT4 A;  4JI4 E;  2EWL A;  2CSH A;  4BS9 A;  4DR7 E;  2DIX A;  2H36 X;  3J81 C;  2EM5 A;  4LF5 E;  4I8O A;  4JI2 E;  4DR6 E;  3C6M A;  4BC9 A;  2M4I A;  2YTE A;  2EL4 A;  2LUQ A;  3EPJ A;  4B3S E;  3QG5 C;  3JAM C;  4N4R B;  5AE2 A;  5A69 A;  1NEI A;  4WSG A;  1GZ6 A;  2VQF E;  1T39 A;  2K4V A;  4ZYD A;  2LO3 A;  2LVH A;  5AC5 A;  2DLQ A;  4GKJ E;  2EOM A;  2B7V A;  1YUJ A;  3J80 C;  4DR5 E;  4OX9 E;  3LML A;  4DR2 E;  4R2P A;  2YPN A;  4HEI A;  4R8O A;  2NUG A;  2EM7 A;  2EOZ A;  3HTX A;  2M1S A;  1DGC A;  5KL4 A;  2L8T A;  1KJK A;  2V86 A;  1YPN A;  4DR4 E;  1MGT A;  2JP9 A;  1YFH A;  2CPN A;  5KL3 A;  1EKZ A;  1SFE A;  4R03 A;  4LF6 E;  2FGG A;  1WHQ A;  1UN6 B;  4O24 A;  1FKA E;  2EJ4 A;  4GZN C;  4O4K A;  2EOF A;  2FTX B;  1A1F A;  4DV4 E;  1ZU1 A;  2E5L E;  5IT9 C;  2WBS A;  4J8Z A;  2V83 A;  2JOB A;  1A1J A;  5AE1 A;  2LE2 A;  2EMF A;  2RQL A;  4L8N A;  3RMP A;  1O0W A;  2ELZ A;  4DMI A;  1FJG E;  1UHZ A;  4LF7 E;  3F6H A;  2JOX A;  4LF8 E;  1DQ3 A;  3BID A;  3ADL A;  4YHH E;  1HNX E;  4B3R E;  4ZYG A;  4ZYE A;  4FK5 C;  2MDR A;  5AC4 A;  2JYA A;  1YUI A;  5A2Q C;  2EM0 A;  5BR8 E;  2EQ0 A;  2ENH A;  1MEY C;  1STU A;  4WX9 A;  3UK3 C;  2KHX A;  2LJU A;  4AQY E;  3ECR A;  1N3G A;  2EMG A;  2ENC A;  2YRK A;  2F4V E;  3DF6 A;  2FV4 B;  4DUY E;  4F2J C;  2V88 A;  4OOG C;  3C4T A;  3P1X A;  2EOE A;  2EPC A;  1T38 A;  3MSW A;  3T1H E;  1ZAA C;  3BF2 A;  4X66 E;  2KOU A;  2M7Q A;  1YSA C;  2EMY A;  2JY9 A;  2EMH A;  4X65 E;  1B69 A;  2UUC E;  2EZ6 A;  3C6K A;  5FLX C;  2NAB A;  1IQO A;  1BB8 A;  1GTK A;  1X47 A;  2EM4 A;  3BGH A;  1A1H A;  4GKK E;  1T4L B;  4JI3 E;  3L00 A;  4BHB A;  1AAY A;  1BBG A;  2V85 A;  4KWY A;  5T6J A;  4R2R A;  2EOO A;  1PJS A;  1F2I G;  2YTG A;  1G2D C;  2R76 A;  3VK6 A;  5AAS A;  2ADR A;  2LBS B;  1N32 E;  2L6M A;  3THO B;  2WBT A;  1EH7 A;  1XMO E;  4LF9 E;  2EN3 A;  1X6E A;  1ZBQ A;  4WYQ B;  2N3G A;  4DV1 E;  2A25 A;  2EQ3 A;  2HJJ A;  2JR1 A;  2L3J A;  2MDG A;  5A6B D;  1HNW E;  4NXN E;  1XMQ E;  4Q35 B;  1IMU A;  4JI6 E;  4R2A A;  2EM2 A;  4X64 E;  2EMB A;  4M0V A;  2UUA E;  3LLH A;  4F6N A;  5TSE A;  1YYO A;  4P7D A;  2ZM6 E;  5LMN E;  1PDA A;  2K7I A;  1TF3 A;  4TUI A;  1YYW A;  2M9A A;  5KL5 A;  3M99 B;  4DV3 E;  2L2K B;  2UU9 E;  1DI2 A;  1PJQ A;  3EPK A;  2YU8 A;  1IBK E;  1IBM E;  4X8W A;  2N8X A;  4BCA A;  1P47 A;  1RC7 A;  1X49 A;  1HNZ E;  3KZY A;  3IWD A;  4NZV A;  2GLI A;  1LLM C;  2ODR D;  2MC5 A;  2EOH A;  5IWA E;  1WRJ A;  2VRD A;  2RPC A;  4KZS A;  2EN7 A;  2J7J A;  3EQ1 A;  1A1L A;  1N33 E;  1N34 E;  2V89 A;  1AH5 A;  2JXP A;  3HPS A;  1UIL A;  2E1M A;  4O43 A;  2EM6 A;  1JK1 A;  3VYX A;  4GEQ B;  2KON A;  4DR1 E;  1KYQ A;  2EMK A;  1A1I A;  2EL5 A;  5KL6 A;  4F9A B;  4K0K E;  1RQ0 A;  1PKP A;  4MLV A;  2EPO A;  5KL2 A;  2YRH A;  2EN6 A;  3EPL A;  1YYK A;  1Z1B A;  1IQS A;  2YTJ A;  2DRP A;  2RSM A;  3VYY A;  2MKN A;  2LJH A;  2LTS A;  4O5G A;  4YY3 E;  1YZ9 A;  5AE3 A;  2YTP A;  2EN1 A;  4F9C B;  2EP3 A;  2L33 A;  4R2C A;  1TN9 A;  2NUF A;  2YTI A;  2CT1 A;  2YTN A;  4DUZ E;  4WSP A;  2EPN A;  3JU0 A;  5LMU E;  1I94 E;  4NXM E;  2L2M A;  5A6K A;  2YU5 A;  4BHC A;  2RTX A;  5IV8 B;  5CFF E;  1WXR A;  1WHN A;  2IHR 1;  2LV2 A;  2MC6 A;  2RS7 A;  3OML A;  3EPH A;  5A6J A;  1WJP A;  1PJT A;  3AV0 A;  1IBL E;  4JI5 E;  2EPK X;  4TUG A;  2EPU A;  3ADI A;  4DR3 E;  2HHH E;  3DJW A;  2LMZ A;  4B3T E;  3C4B A;  2EPR A;  2EMW A;  2V8Q B;  1A1G A;  2I13 A;  4DV5 E;  2ODR C;  4HTG A;  1QNT A;  4R2S A;  4L5N C;  2NA2 A;  2EQ1 A;  3TQM A;  3OTO E;  2EM9 A;  2CTD A;  3THN A;  2EMX A;  2HGH A;  4IJD A;  2YTO A;  4KHP E;  1QU6 A;  5DNY A;  4WXC A;  2EM8 A;  2YTD A;  2RS6 A;  2E72 A;  3MHH C;  1N36 E;  2LRS A;  5LL6 R;  2GHF A;  5A6A A;  2LT7 A;  1ZR9 A;  2R1F A;  2YTF A;  5A6B A;  2HC5 A;  2LTR A;  2EOI A;  2EPA A;  2I9I A;  4MLQ A;  2LUP B;  4JI0 E;  3FIG A;  4RHB B;  3JTZ A;  2EPL X;  1X3C A;  3ADJ A;  4JI7 E;  4DV7 E;  2YSO A;  1GQE A;  1A1K A;  2EML A;  4DKK A;  2JVA A;  2B3T B;  4F6M A;  2LCE A;  2EPX A;  4DV2 E;  3H09 A;  1X48 A;  2BB8 A;  1ZBT A;  5IXM B;  2B7T A;  2GPI A;  1UBD C;  2YRM A;  2DGC A;  3BBG A;  2YTQ A; 
#chains in the Genus database with same CATH homology
 2N8X A;  2JXP A;  4RH8 A;  4N4R B;  5IXM B;  5IV8 B;  3BF2 A;  4NHR A;  5TSE A;  4RHB B;  2R76 A;  4KWY A;  4Q35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...