4KX5A

Cytosolic 5'-nucleotidase iii complexed with cytidine 5'-monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Cytosolic 5'-nucleotidase III complexed with cytidine 5'-monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx5A01
5AVYA 3R9KA 3AR8A 2BDEA 2AGVA 4Y2JA 1L7NA 3NIWA 5AKEA 2JGAA 5AKKA 3TLMA 1AQ6A 2ZBEA 4NABA 5ALIA 2OBBA 2Q4TA 4JB3A 3FVVA 2HOQA 3UMCA 2ZBGA 3U7EB 1NF2A 3ESQA 4YGYA 4UU1A 4AS3A 4KX3A 3I6BA 2WF7A 2WF6A 1U7OA 4UM5A 1RLMA 5AK4A 4UATA 3HYCA 1YMQA 3AR4A 5AVUA 2HI0A 1RRCA 5ALKA 3WK4A 3AR2A 5AVRA 5AI5A 3QUQA 4B6JA 3KOOA 3DNPA 4UARA 4HGRA 2CFRA 2R8XA 1TJ4A 1YNSA 2B82A 2D2VA 2FUEA 3B8EA 2O9JA 1IWOA 1XVIA 1F5SA 3FM9A 3WKDA 3WK5A 2WF8A 3AR9A 3QUCA 4GIBA 4UAUA 5AM5A 1ZJJA 2NYVA 2HEGA 4YCMA 2WHEA 3NRJA 4Y2PA 3DV9A 4YIKA 3RF6A 5A3SA 4J2TA 2ODAA 4G63A 2RB5A 3ZI4A 4HGQA 2ZXEA 2CFTA 5ALQA 2G80A 3ZTYA 1K1EA 4UAVA 2EAUA 5AK3A 2GMWA 1QQ7A 2P69A 4Y2YA 4EX6A 2I6XA 4UASA 3S6JA 3QUTA 3QX7A 4FFDA 3SHQA 1XPJA 2GO7A 5AK5A 3BA6A 3ZWDA 1JUDA 2P11A 3M1YA 3SD7A 2W11A 2C8LA 5AVTA 2ZBFA 3NANA 1RKQA 1N8NA 1SWWA 3ET5A 4NWIA 4Y3UA 3QYPA 4XOUA 3OCXA 3OCWA 5ALXA 4J03A 3AR5A 5AVWA 3SMVA 1N9KA 4O8CA 3QLEA 4IG4A 1YJ5A 5AVZA 3R4CA 2C9MA 3J7TA 3W5AA 3L0BA 2W4MA 4IFTA 4NV0A 4CF4A 1ZD5A 2GHQA 4ZEVA 3EWIA 2YMLA 2HO4A 3IJ5A 4DW8A 3GYGA 4HAIA 4Y2SA 4DCCA 5AKYA 5E0OA 1X42A 1XP5A 4UW9A 2B8JA 3KBBA 3U19A 2FPSA 2I34A 5AKIA 5AVQA 5ALHA 1ZD3A 5AM4A 2W43A 5AKLA 3L8HA 3OCVA 4F71A 4OD0A 3ET4A 3NALA 3ED5A 1ZS9A 3KD3A 1LVHA 5ALLA 2X4DA 3RFUA 2MSNA 4MWOA 3DAOA 1WR8A 2ZBDA 3OTQA 1Z4KA 3MMZA 3P96A 2AMYA 4BX2A 1J97A 3NASA 3QUBA 3FZQA 3QXGA 2QLTA 1T9ZA 1Z4IA 3UMBA 1L7OA 1MH9A 1RQLA 5AI0A 4DWOA 2ZG6A 5T41A 2FEAA 2JAOA 4Y2QA 4BX3A 2C8KA 3QGMA 1Z4QA 3MPOA 2R8ZA 2I54A 3ZX4A 4YCLA 3NUQA 4KYTA 4I9GA 3L7YA 3WKEA 1ZRMA 5ALNA 2CFSA 2IA5A 3I76A 1FEZA 4MUMA 3SF0A 2YY6A 1WZCA 2IYEA 4FYPA 4C4RA 4L57A 1VJ5A 5AKHA 3D6JA 3MN1A 5ALVA 3ESRA 5JJBA 4UMEA 5IT4A 4EZEA 1QH9A 1U2SA 2WM8A 3OCUA 5ALEA 5ALYA 1VJRA 4BNDB 3ZUPA 4G9BA 3BWVA 5A3RA 1TA0A 3ZWKA 2YMQA 4HGOA 1VFPA 3U7HB 5ALJA 3KZXA 3QU9A 3KDPA 2PQ0A 4XPZA 2FUCA 3QU2A 5A3QA 3QNMA 2RAVA 3CZ4A 2I7DA 2HSZA 3L5KA 4EENA 1L8LA 2JAUA 4Y2UA 4HYTA 5ALDA 4BBJA 1ZRNA 4UMVA 5ALMA 3OCYA 2CN1A 5AW6A 1U7PA 4Y2XA 2AUTA 2NO5A 3PCTA 3I1YA 3SKYA 2FPWA 3FPSA 5AW5A 1YS9A 4Y2TA 2P27A 3E81A 4BX0A 4BNDA 5AVSA 5IS2A 5ALRA 2HF7A 5AM0A 2EARA 5AKGA 3QU5A 3N5KA 4EX7A 1RMYA 4YIHA 5AI8A 3WGVA 4BKMA 1Z4LA 1SU4A 1RLTA 4XQ0A 3IB6A 3A1EA 4CF5A 2ZOSA 4GXTA 2Q5EA 3UMGA 1Z4OA 3ZW7A 4F72A 5ALSA 3PGLA 4OCZA 3AR3A 3ZVLA 4L6AA 3ZVNA 2HCFA 3L8FA 4RESA 3WK8A 4NFLA 3WK9A 4UMFA 4OHFA 3L1VA 5AVXA 3AR7A 3DDHA 3N1UA 3OCZA 5AM2A 2WF5A 5AW8A 5AW0A 3I28A 1U2TA 3B9RA 1RMTA 5AKJA 5AW1A 5ALPA 1KYTA 2C88A 2DQSA 1QQ6A 1ZD4A 3W5DA 4C4SA 5ALUA 4QJBA 4EEKA 2RARA 1ZD2P 4DFDA 4HGNA 3FPBA 4KN8A 3L8EA 4KNVA 5AI6A 4CNQA 5AVVA 2FDRA 3N28A 1RDFA 2HX1A 2PKEA 2YJ3A 3FGOA 1YV9A 3HLTA 4UMDA 2BY4A 3W5CA 2WFAA 3EF0A 5ALOA 1SWVA 3ZU6A 1TE2A 2B1RA 3UM9A 3SLRA 3WKAA 1RKVA 1Z5GA 4ZEWA 2G09A 1QQ5A 1T5SA 4XE5A 2G08A 3ZX5A 1WVIA 3VAYA 5ALTA 2B1QA 5AKXA 1Y8AA 5ALWA 2JAWA 2BDUA 2OA0A 4QQFA 1YDFA 4PNHA 3ZVMA 5ALGA 3PDWA 3W5BA 2PR7A 2FPXA 1EK2A 5AM1A 4NAVA 1L8OA 2R8YA 2FI1A 4FE3A 3L1UA 3EPRA 3N07A 1WPGA 5AK6A 2QYHA 3CNHA 5AIAA 3ONNA 3WKCA 1T5TA 3F9RA 1Q91A 3PGVA 4RETA 4OFZA 2YMPA 2JARA 4ZEXA 3A3YA 5AKZA 3U13A 3K1ZA 1CR6A 4YH1A 2OYCA 4BEWA 2YJ6A 2G0AA 2WF9A 4UM7A 5AW3A 1S8OA 5AICA 5FP0A 3N8GA 1LTQA 3EF1A 2B30A 4Y2RA 3MC1A 4H1WA 5AM3A 5AI4A 5IT0A 2HF2A 2O2XA 3B9BA 3A1CA 3A1DA 3WK7A 5AW2A 1U02A 3M9LA 2IOHA 3WKBA 4CE6A 5AESA 3NAMA 4C4TA 1RLOA 1PW5A 1QYIA 1Z4PX 2IOFA 2Q4RA 1RMQA 1J8DA 3E84A 4CF3A 3U26A 2GHTA 1RKUA 1RQNA 2G06A 2VKQA 1Z88A 2I55A 3QU7A 1EK1A 3L8GA 2YN4A 2EATA 4UU0A 4AS2A 3OPXA 5AHXA 5ALFA 3WGUA 3E58A 2FPRA 1TJ5A 4YCNA 2C4NA 2R8EA 4E88A 5AW9A 4KX5A 2MU1A 2YFYA 5AW7A 1RPZA 2G1AA 2RBKA 4AP9A 3U7GA 2HHLA 3E8MA 5ALZA 4HGPA 3U7FB 2GFHA 2YJ5A 1O08A 3L0CA 2YMMA 1Z5UA 3L0YA 1NRWA 1RC8A 4JDPA 1ZOLA 1L7PA 1O03A 3KC2A 4L6CA 2IOFK 5AIBA 3IRUA 1Z4NA 3SKXA 4Y2VA 4KNWA 5AI9A 2OM6A 3QU4A 2YJ4A 3R09A 2FPUA 2B8EA 3WK6A 4BYGA 2NO4A 2YBDA 5AW4A 3ZTWA 2G07A 1L7MA 1NNLA 2P9JA 3AR6A 4I9FA 1CQZA 1Q92A 4EELA 2I33A 2B0CA 1S2OA 1Z4JA 2AH5A 1Z4MA 4BEVA 1TJ3A 1L6RA 2HDOA
chains in the Genus database with same CATH superfamily
4HNRA 1UDXA 3NDIA 1I4LD 1N2XA 1WZIA 1HL7A 5CB6A 1NK8A 4WGGA 4YUZA 3R5HA 3ZU5A 4JT8A 2UUOA 2DHQA 4ECEA 1R37A 3G0BA 2BJHA 1WA5A 3VUFA 5BR8B 1WOYA 1JXMA 3H0KA 3FHJA 2W6QA 4YRKA 4JT4A 3DMRA 1K8QA 1K3UB 4TUPA 4D3XA 1XKQA 1J2UA 2ODPA 4EKDA 4LEIA 5F1KA 3QG5A 4WKOA 2I9PA 1S97A 2H1FA 3T5HA 1CUUA 1CE8B 4MYTA 5FI1B 2OSBA 4A10A 2ZR7A 3U09A 2J5QA 5DBGA 1W19A 1C0IA 3NDJA 3GMTA 1WU8A 4OIMA 4M87A 3KTDA 2PFOA 2QMOA 4X97A 4TTJA 1AS0A 1C1XA 2QB0A 4U2FA 1PR1A 1C1DB 2VOJA 1QYVA 2ZB3A 3SOZA 1WIWA 3U0VA 3UEOA 3VVBA 4BN0A 1JHXA 2O2CA 2AEFA 1KJYA 3OSPA 3D3NA 5DNDA 1VKNA 1FDSA 5T4HA 2CL5A 4WTOA 5KREA 3ENKA 5EIXA 1NVWQ 2GM9A 4KE8A 2CVZA 3TDKA 1UAYA 4MCJA 1XG5A 4ZMSA 1W1UA 1F8XA 3V9AA 3RIGA 2XTJA 4TSRA 2NG1A 3KVVA 1O5TA 1KGSA 4IGEA 4RT2A 2YY6A 2FAXA 4GX5A 4HDOB 4ID9A 5I7EA 5HTKA 2FSGA 3OO0A 1SXJA 3TZQA 3A05A 4DLXA 4PVDA 7REQA 3TQQA 3ZY5A 2ZIWA 2ETVA 4CTMA 1YCGA 3E9DA 5KKAA 2EQBA 1FFYA 4BFTA 1JDBB 3JYLA 4MMXB 1W2GA 2JAUA 1AKYA 1Z00A 4KO3S 1UK7A 3T3OA 2AFHE 4KBYA 3E7XA 1YA4A 3OJSA 3L7MA 2CJWA 1UMCA 3EVZA 4EDHA 4F2SA 2FLVA 3VR1A 5GZ3A 2GS9A 5IS2A 4G36A 1PJSA 1OREA 1KETA 1BZYA 2O05A 3DM5A 4RGVA 2VT2A 5ICGA 3DW1X 3U4HA 4YRAA 4CUKA 1ZQ9A 1OPXA 2R8IA 2J31A 3EGWA 2WYVA 1F3LA 4EA9A 3OCZA 3RIEA 1NG9A 4C5CA 4C5AA 4YD2A 3S99A 1N9ZA 5IDQA 3PUKA 4LHVA 1SH7A 1YRHA 2ZEJA 4RZ3A 3IEKA 3B5IA 5DGXA 2HXYA 1ILEA 2N3ZA 1ZQQA 1DUSA 2IOQA 1UBSB 2H54A 4RD2A 3U44A 4PYOA 4UMDA 1UCVA 1ZZEA 5ALOA 1ABBA 3GGGA 5M2QA 2JLSA 1CYEA 5EEGA 4L5CA 1V38A 3S8YA 2XPCA 3EY4A 1QGUB 4IL6U 4PLTA 5DM2A 4OJOA 1E3SA 4RZIA 2AR9A 4MMYB 2ZWMA 1PWYE 1ZNQO 3H4DA 3GLTA 3RAEC 2VP2A 3HB7A 3DCYA 5C32A 3Q6NA 9LDTA 1U8ZA 2O2ZA 2OH2A 1FDIA 4PYNA 1JSLA 1U9LA 1CUXA 1KOGA 2IP4A 2QUJA 3PUIA 4CM7A 1BCSB 4JUBA 3LUKA 1CQWA 4NENA 4J0GA 5JDIA 1C8KA 2B9EA 4MRAA 3Q85A 3OTIA 3M6AA 3GIJA 3FWHA 2QP4A 1JEDA 2HJ9A 1M2WA 1MJGA 4OLBA 4M0KA 2BMEA 1UT8A 3TW4A 1ZU5A 2M2IA 1H8HA 3M4YA 4KSCA 5CFPA 4N54A 4JI4B 5J1TB 4LFBB 4YDRA 1OI3A 1SL1A 3JQDA 2V9PA 1FFGA 4BJQA 3UXOA 5F4ZA 4A2QA 3WLMA 1K66A 2DGDA 3G0DA 1RXIA 3HH8A 2DHRA 4DJEC 3WNZA 3NNNA 3DBIA 3JASB 4E30A 2VUSA 4HBGA 4NZ9A 4ZAZA 5K9ZA 4OI1A 2O3TA 1RKBA 2YZKA 4RAOA 4KBGA 3NWJA 4R64A 3OIWA 3H17A 5CNKA 2XTNA 1VLJA 1HDIA 4A2PA 1WCWA 4BBAA 2O8VA 1DCFA 1TUEA 1JG7A 2FPIB 4URVR 1K2WA 4BV9A 3D2LA 3ZG6A 2C20A 3V46A 5IKOA 3HWRA 5FRDA 2VA2A 1MUUA 2DR3A 3H7AA 2Z8ZA 1A9ZA 1R4NB 4J4TA 3OE4A 1JW9B 3GBVA 3D1LA 4CUZA 2QMUA 1MV5A 3NVVA 4TKMA 3JZIA 3JQAA 1SC6A 3F74A 2SECE 1D04A 4P0TA 4DFKA 1P2VA 4LXHA 2VP9A 1Q0LA 3ZWPA 2QENA 2V0NA 3PEEA 2FUKA 1GA4A 5D5HA 4M98A 3T3HA 3NYIA 5A5FA 3RAFC 3N39C 1U5BB 1E9VA 2I80A 1O57A 4U3JA 4BLUA 3T3MB 4OGKA 4L22A 1O94C 1AHPA 2I5HA 2O8FA 1SQGA 3PW4A 5F2NA 1D0SA 3X1WA 1KMQA 1UPTA 4LUCA 3M4JA 4GUAA 4YJ2B 1OW3B 4KR9A 2A1JA 5IXYA 1GJRA 2HIMA 5BQXA 3Q9SA 2H1OA 3DP9A 5G4LA 3P2MA 1WW2A 2HQBA 2JFXA 3QW2A 1F6WA 4FE7A 5L53A 3MTAA 4QT4A 3NASA 1U1GA 1X1SA 1JFSA 1GNQA 3KFVA 3VR5A 1URJA 1DRUA 5GIPE 4Z53A 4F8EA 2C7GA 5JSYA 3D6VA 3N7TA 2VSXA 1BN7A 3ZX4A 2ZIUB 4JVMA 4JB0A 1YZ7A 4RMNA 1VBMA 5IT4A 3TCKA 2J7PD 4XWYA 5KG6A 1JAHA 1J2NA 1CTQA 3GLFA 1E6WA 1SRRA 2CJFA 2V7VA 4WCFB 2FW1A 3DVAA 3HQ4O 5BQ3A 2Q5CA 3V3TA 4LBZA 2MSWA 2NVUB 1X9MA 1ZITA 1U7ZA 5E3HA 1L8LA 2AJDA 2XDYA 4JELA 1I1HA 5TS2A 3HJGA 4DQVA 1Y4SA 4D0LB 3ENNA 4AU1A 5JVDA 2JAHA 3DMDA 5HNKA 1PV2A 3QE0A 1XROA 2Z5FA 3K4QA 2PMZF 3NBMA 1W85A 2X40A 3WL6A 1Z8DA 2WDZA 3MTIA 1V96A 4KMRA 2HLDD 4MP8A 2XGJA 4DV6B 4BGUA 4MEBA 4H4DA 1PDOA 2Q3FA 4HPJB 1HJPA 5GM2A 2WMNB 3NQ41 2ZE7A 2DY0A 2J6BA 1VSQA 3RJMA 3QJYA 1D8LA 4KDCA 1G5IA 4JB8A 5FWYB 2IBMA 3FG9A 2Y9UA 2J9ZB 4LE0A 3SSOA 5LIPA 1OFUX 3ZY3A 2QJTA 3GOHA 2JIMA 3ITKA 3MGHA 3EGDA 4JJIA 2XW6A 4I19A 2OA0A 5JU6A 3A6DA 2C42A 1SD5A 3LZCA 4YAOA 2YV1A 1KE2A 1EFLA 2W90A 1G3RA 3U62A 1O1YA 2IYUA 3RBAA 3KQYA 3LA6A 4J0QA 3C5WP 3EVDA 2V54A 4OBEA 2QTMA 3ESAA 2H1VA 1N5LA 3K9BA 3NCTA 2UZ3A 1B3BA 1V43A 2EBHX 1M1NA 2I1QA 3BZUA 1L4MA 4NLNA 3P9IA 5T57A 5HQTA 2R5WA 3E70C 1M1YB 5GJBA 5L95A 2QAJA 2EW1A 1KEVA 4H9GA 2L0XA 5ILQA 1BA2A 2ZPTX 3M6UA 5FR1A 4IDQA 1XHLA 1OY1A 1QDLB 4FE4A 3D7SA 1C0PA 3UC9A 2KNJA 1DC7A 4J90A 1ZM4A 3G89A 5HOEA 4CEIB 1NUHA 4BRWA 4EHDA 1HLDA 5FBZA 3W04A 4ES6A 2F90A 5CK5A 2PS0A 4B40A 1N33B 4MA4A 3PA8A 3AOEA 5IMBA 4Y6SA 4F8RA 1LTHR 4X61A 1T2NA 4ZU1X 5TMDA 3NVWA 4CDNA 3UMCA 4EUNA 1JI3A 2ZBVA 2ZRDA 1UH5A 4QDZA 5BN5B 5AJTA 2OCPA 2QN7A 2H0RA 4WPGA 1XEFA 1IONA 1RIIA 2H4HA 3KETA 1H4VB 4M8IA 3T5KA 3WK5A 1MB9A 1ZK4A 1X15A 2OCLA 3E9CA 2J1LA 1DI0A 2EEZA 1OWMA 1BH2A 4E5UA 1GR0A 2FSVA 1X0VA 2GN0A 3IUPA 3LPMA 1YZLA 1JHPA 1XR3A 1A27A 1M5RA 3ILHA 3STUA 3JAKB 2GD0A 1XRQA 3CH7A 3NANA 4D98A 4AY4A 3BWXA 1E94E 2YXLA 3HCFA 1Y3FE 3R2JA 4ZO8A 1AD2A 2X0KA 4JEUA 2WTUA 1E9CA 1GPDG 1LSSA 3MMNA 4YCDA 5I4KA 3ETLA 1QHSA 2EERA 4GSKA 4Q1EA 1IJBA 4Q9IA 4JODA 3R44A 4WINA 3B36A 1WMSA 2C4WA 4ZJZA 2JIPA 5CM8B 2IU4A 4WZAB 1GCIA 4FEEA 1IBKB 3OCVA 4ER7A 4UU7A 3IX7A 1AG9A 2Q5IA 2Z6VA 3VO8A 3CYMA 1JFFA 1K7SN 4IXTA 2QSJA 3UJPA 3H0MB 2G6BA 5EJMA 4B4OA 4L08A 2HBRA 3Q88A 3NAQA 4UUNA 4X84A 3RFTA 2PWAA 3CXRA 2QL5A 3H9QA 4I99A 2QG9A 3GV7B 3CU5A 3WICA 1AS2A 3IALA 3RYCA 3QVGB 3KQPA 4J9UE 4QZAA 4Q1VA 3QEKA 3LY8A 2CJXA 2IKQA 3I39X 1WXDA 4PGQA 1QGED 1MIHA 1KP2A 3SZLA 2IYTA 1H3EA 4HPXB 3IPRA 4HNVA 3PV8A 4W1RA 1TCAA 1EFKA 5TEVA 3QBVA 1UOEA 2VPYA 2PZ8A 2AUTA 4HT3B 1NAIA 1FNSA 3Q2OA 2FEMA 3CF2A 4FYJA 2AXTU 4G4GA 1CBUA 4AMYA 5BSVA 4DBLC 5FWNA 1L1FA 5IWCA 4LZPA 1KEJA 2HADA 4LXIA 4UTPA 1U7WA 1KYTA 2KYRA 1CEYA 4DLYA 4EGFA 2NPFA 3K94A 1DKLA 4RFSA 1T8PA 2R25B 4ZH4A 3U31A 1MU0A 2E8OA 2E0IA 2FEPA 3IPYA 3MDAA 4FMDF 2DTEA 2BEKA 3WKAA 2R5NA 4NE2A 1U6IA 5CTJA 2VPQA 3NRCA 3QUAA 5FORA 3KKMA 1NP7A 1YDFA 4IUBS 1XTIA 1KZ1A 2GJ4A 1ADJA 1XTTA 3WS7A 4E2XA 4JL5A 1CFJA 2JGLA 3U7JA 3ZV7A 5BQOA 1NVAA 2IDJA 4Q18A 4KN6A 4PW0A 4URHA 2D74A 3SYMA 4AIRA 2HHQA 4HBZA 3H9EO 3CC8A 3WK7A 2JFPA 1U02A 3OJ0A 1W4ZA 1X1BA 4JVNA 3DE3X 1H4QA 3B2EA 2F59A 5BSKA 3HRIA 4P54A 2ZFUA 1ZQGA 4UHFA 4IQUA 1KDVA 1PN3A 1WABA 3EA4A 4UB4A 3T7EA 1BQEA 3M6VA 4RIEA 1XDSA 2V7EA 5DOZA 2IYFA 2X77A 5D46A 4MW7A 2D5LA 3KOYA 4O1IA 5CIWA 1GZ7A 2H1RA 1KMCA 3GHYA 1NBEA 3HBMA 4TRJA 4AL4A 4OXIA 5LQMA 5TT0A 2IZZA 1NNEA 2DBYA 3ABIA 2I3GA 3HU3A 2QQFA 1M6VA 3ZWCA 3RS9A 1E64A 4LDZA 1GN8A 4YK7A 4AXXA 3IYLW 2DHCA 4KLOA 1U3FA 4MVJF 4L4SA 4ZO4A 1M83A 4HXGA 4W9RA 2A30A 4BBZA 1ZQKA 4C7VA 5JZMA 1J9EA 5JEDA 3QUQA 5C7IO 2O0LA 4YVFA 4TLCA 2INGX 2PLWA 4DEXA 3H1FA 4LHWA 3EIXA 1T36B 4RS4A 2HKIA 3DE5X 3HPRA 5MFZA 1I4WA 2P2DA 1U65A 2HWKA 5LU8A 4JLAA 4K4HA 3L4EA 2GKGA 2BFFA 3AM9A 1Z3EB 2GO7A 4HGYA 5C37A 4II3A 2IDKA 3PY8A 5GONF 1U8FO 2P8JA 3AI3A 2Y1LA 5DP2A 3EPHA 3BFPA 3U39A 3V1MA 3OU7A 3J81j 3OEWA 2J3IA 3FETA 2EEPA 1ZJWA 2OCXA 5EHQA 2PX6A 5LMCA 3A1VA 3ZZMA 3D4OA 1M7HA 2H59A 1V5GA 2FYTA 4JXKA 4ZYVA 4D4LA 3CLRC 4UQPA 3KD3A 4PQGA 1DEXA 2RHLA 2RRDA 3FAHA 4D46A 3HKCB 3BN3A 5JXGA 2I3DA 4GMKA 1DMRA 2RE8A 1RQLA 4CKCB 3MUFA 2W2LD 4XQGA 3L9XA 2GM3A 3R3XA 4Q1FA 3SLGA 4RQ6A 1RIFA 5A2QA 2R2AA 2DWQA 4Y6LA 3MAJA 5A4KA 3FUUA 5TT1A 4FILA 1O94D 4ED0A 5H9VA 1J0XO 3FPLA 2BWJA 3F3YA 3EGXB 3K09A 1QFZA 3SJCA 4J8PA 5A03A 3RV3A 5LZ9A 3PW5A 2LDBA 2PD3A 5TNXA 2A5DA 3JR3A 4DHWA 3GN2A 4XJXA 2W2QA 3U6BA 5JS6A 3HBFA 3EXHB 5KAMA 2I91A 4ED3A 4IS7A 4PHGA 3INGA 5HPYB 2Y1CA 3NWOA 3LP8A 3C4QA 4WNCA 5B58T 4LJ5A 2BSQA 4K3VA 2QD2A 4KQ2A 2DY1A 5TGTA 4QUJA 4TLBA 2OQVA 3CNQS 1ACLA 4TVKA 3LFUA 1T2UA 3VJRA 4OFWA 4X94A 2FWMX 4BLOA 1NVDA 3BILA 1C9DB 3ETCA 4K9OA 1LK5A 2XH8A 2SCUA 4U63A 4W1PA 4QPZA 1SUPA 5EC8A 4CM9D 4M9LA 1U2TA 1TTHA 5LUBA 4MFFA 3PS9A 5KFEA 4Q48A 3P9CA 1N61A 3AF5A 2KMLA 1ZD2P 4O2BA 3T3IA 4KN8A 2VXBA 4LI0A 5JWRA 5IW8A 1TMOA 1Z0ZA 2HMSA 4AO7A 1WVIA 3OPMA 3E9ZA 2HPZA 5EZYA 4BXOA 1SVNA 2OZVA 1QGZA 1KY5A 4GMXA 4EBFA 3RLFA 2VUTA 5I7AA 5EJEA 4Z99A 1O2DA 1E2IA 4G09A 4Q05A 1VA4A 3J81A 2EBFX 5K3AA 3NORA 2QRPA 4AN0A 1E6UA 5C1DA 1UZMA 1D1SA 1E60A 4XQ9A 4BVGA 3JRNA 2NU9B 1FPQA 2JGFA 3B12A 5KNDA 3BS5A 5K8JB 4Q3CA 1PO7A 1EBUA 3MHTA 1Z12A 3UA3A 4PX3A 2VF8A 3AL2A 3C1YA 3GVIA 2H6EA 3QU7A 2Q1XA 2YQ4A 4G1EB 1RC0A 2W7OA 1KEEA 1RZTA 4HSGA 4Y1FA 4KJXA 3BJEA 1HDCA 1QOQB 1JQBA 4MZXA 2FJPA 3OKPA 2PNJA 3B52X 4RSGA 3D3WB 3N59A 3WK6A 1MZVA 2EF1A 1UOOA 5JOQA 3LLVA 2ZYAA 2QLFA 3ZQ6A 5CJPA 3FYTA 1EXNA 1ZGZA 4AULA 3QOWA 4KHZA 2XYPA 3HKDA 1N0IA 3OWXA 2GBGA 3NPAA 3O73A 2K8AA 4X7PA 1WUKS 3KG2A 5JAQA 4QQRA 3GPDG 2B98A 3LUCA 2VHJA 2JIDA 4FR2A 1U3UA 3QZUA 2VNJA 5D01A 3VZDA 5KQMA 3KJFA 2EHJA 3CX4A 1BDJA 3O4VA 1M7BA 3NVYA 2CVQA 3I37X 1QSLA 3O6VA 1W59A 1NR7A 2REOA 3HC7A 2QR2A 3EG9A 2VDNB 2BPGA 5F33A 1ADYA 4RPGA 4B3JA 1A9XA 2X7XA 3U49A 1A4RA 1AUPA 1IZ0A 5KG5A 2JHCA 3HDYA 4IGKA 1CWUA 5DBAA 2CCJA 2IKSA 3FTDA 1J2MA 5KOJB 3DDSA 4K6KA 3JYNA 1Z45A 5LJIA 4M21A 5CRIA 3ASVA 2CBXA 3P2KA 3ZLTA 5AXCA 1G2OA 4Q6BA 5ARDA 1HUOA 2J33A 1P7WA 3ADDA 4ATNA 3AF0A 5J0WA 4XR4A 1JS1X 1UL1X 5C8XA 4EFLA 4H7FA 3N3AC 4F4DA 3MFQA 3UFBA 4MEXA 4C6HA 3ZDZB 1ELOA 5FADA 4YP0A 4KV9A 1RHRA 1M8FA 1GNTA 3NW9A 1XKXA 4EVQA 3ZDRA 5B3KA 3M6ZA 1E6LA 3TW6A 1N5XA 2Q0ZX 1CF2O 4CDRA 4IRXA 2LM4A 5F98A 3HR8A 4X85A 1U2GC 2CF5A 3GQVA 3CR3C 1EZ1A 4C7MA 1EEXB 2WMDA 4XASA 1W36B 4HUQB 3MWEA 5IVIA 3JQQA 4XKJA 3TLZA 2WJ6A 1CI4A 4L8VA 2GZAA 1XC9A 5ELMA 4YYZA 5HHTA 1V5IA 5DK4A 1CRWG 3R7WB 2PFSA 1VKRA 3MS4A 2FZ5A 4PONA 2UYOA 3RAQA 2CN1A 2BMWA 2NX2A 4DMKA 1ECPA 1E3EA 1LPOA 3H19A 4OIFA 1VPLA 2HQSA 4D9GA 2FG5A 3VHQA 1RJFA 4CODB 3T1TA 3R7AA 4HRXA 3WGVA 5CNIA 2Z58A 2WZCA 1EA5A 4KMSA 4DSJA 2NTYC 1UA0A 1DQRA 1HRDA 1BD4A 3CZQA 1MHPA 2JFYA 4ZYZA 3HXPA 2EGGA 1DSSG 3EQ6A 3W3ZB 3PLNA 2KE7A 1QIDA 2VPXA 5LP6C 4KP7A 3QFTA 4E51A 1G66A 4J49A 3H5RA 4R41A 3OT4A 3L4KA 2LCQA 2QRVB 3ASZA 1I9CA 1YQEA 3WL5A 1YMUA 2OK7A 1W25A 4ALNA 3K1AB 1DBVO 2EVWX 4OHYA 4P4LA 1MEEA 4X71A 2FEWB 1C1HA 1V3QE 1XF9A 2Q6IA 3EPRA 4RV9A 2B78A 1QO7A 1UOPA 2CUNA 5EIWA 3IHLA 4QNRA 3DAYA 2OCBA 1RQPA 4OFZA 4KLDA 4LXXA 2DR2A 4A03A 1UJ4A 4Q4HA 1JX6A 3D0KA 3OLCX 3TUIC 2P4UA 2ZDHA 3DT9A 4U7PB 1NYRA 2JLXA 3Q8MA 3UTCA 3A0HU 1KTIA 2REQB 4ARSA 1ZQWA 4PAOA 2KSQA 2HA5A 1JMSA 1Z6GA 2W48A 4WBNB 2AKYA 4L9WA 4GC6A 4ITVA 5DM1A 1UINA 1VGVA 1O03A 3T4PA 5CH3A 1SV0C 4C30A 3EXFA 4GZLA 3ZTWA 5JNWA 4BNNA 3DHWC 5CYGA 2A59A 2EP5A 1NF9A 4IIGA 3EQ8A 2IEZA 4OHOA 5J0TA 1SGGA 1E9AA 1S3SA 4UVIA 1M0EA 2RHCA 3PE4A 3BTSA 4AK9A 2RHJA 3BBLA 4QGFA 2O54A 3Q3CA 2J41A 3QKWA 1G21B 2WFLB 3PI7A 3V5NA 3ENWA 1OX5A 5M34A 4XB2A 3SJUA 2IHBA 4AP5A 1EFDN 4DS5A 1OFGA 5AFSA 3UWKA 5DSZA 1QK3A 4YJDA 5A3JA 4HRYA 3BL6A 3GZNB 1XU7A 5B3JC 5KJCA 3EW7A 1QV7A 4HQ0A 4JV1A 1C7IA 1D6JA 2NV2B 1QKJA 4GLXA 2ZYRA 5D86A 4LGVA 3ORSA 1Z2OX 1QMGA 2IU6A 2IL1A 1J6UA 1QV9A 2IQIA 1K2VN 2YV2A 2JPDA 3BX1A 4I8XA 5CVUA 2GKOA 5G3YA 3UUEA 4BNUA 4J29A 2EWWA 2Y0SF 1RP1A 1QCYA 2ZAYA 3QLEA 1NW4A 4IDBA 3R4CA 1T1IA 1O7JA 5EE5B 3G02A 4ZV7A 1O5OA 4OUDB 4U7CA 2AWNA 3OGUA 5EERA 3TR6A 5AVQA 1TQ6A 3L6UA 2PXHA 2ISPA 5REQA 4OD0A 3NALA 2O50A 3R5TA 3QEJA 1RJDA 2XZDA 3ND6A 1Z4KA 3IA7A 1PJ3A 2VJ5A 1YDEA 5JJLA 5F7ZA 2W71A 5J0QA 1L3TA 3U4GA 1UBLS 4M8LA 3EGEA 3JTEA 8ICJA 3DZCA 3ACCA 1NPYA 1COWD 3O8RA 2WZQA 3D8UA 5KT2A 4G6ZA 2OCGA 3M6LA 1VXOA 3V97A 2FX5A 1YJBA 1VE9A 3V1UA 2VSFA 3UHOA 1N57A 2PIDA 4XM2A 3CLRD 3ZVKA 3HRDD 3G7NA 1T5LA 4Y2UA 4MI3A 3ZE0B 3O21A 1ZRNA 5DNWA 1YFJA 3B53X 2C97A 1U7PA 3H1EA 1DIAA 3O7WA 4UU8A 2YZ2A 1SHLA 4CL2A 5HQ3A 1ZK0A 1UFOA 3PNPA 2JIRA 4BCDA 2EIXA 4TZKA 1XMIA 3ER6A 3DUFB 1WQ4A 1Y3DE 3UMGA 1OTYA 4A0FA 1OUMA 2W7TA 4WX2B 1GNLA 3CISA 4FWBA 1WP4A 2FHPA 2W6CX 3RT7A 1HFJA 1DTSA 4MF2A 2Y1DA 4M1SA 1EFVA 3AFMA 4LMBA 3DG9A 3LNCA 2OR3A 1XSNA 2Q0QA 3I3OA 4IIJA 3QUSA 6YASA 2FDRA 5FR2A 2EX4A 2HX1A 1Y8ZA 1S2MA 1FVFA 1EVKA 3N0RA 2Q7DA 1ODLA 3KJHA 1OE0A 2HIHA 4EGSA 1RJWA 5ALWA 5EJ2A 1PCXA 4FDMA 3ZDAA 3OHMA 1D8AA 1XMJA 2ORWA 3PHCA 3RABA 4EPTA 3BPSA 2LP4Y 5DRYA 1KU0A 4OXXA 2H65A 1PSWA 3M7IA 3G0GA 5F23A 3C6ZA 4ZD6A 5HRCA 2RH4A 4UM7A 5FP0A 3VJLA 2RH5A 1SVLA 1JU3A 1WKBA 4E32A 2YC4C 4IDOA 3KT0A 3LDAA 5J4YA 5HIKA 1GXSA 3DAFA 3F4KA 3G82C 4YFYA 3E84A 4L3OA 4CF3A 4JGBA 2AD1A 4PTYA 5DV9A 1RYZA 3QFCA 2AGOA 4I3HA 2E21A 2ZWPA 1ZMXA 3A70A 3GCZA 1H4SA 2OGWA 2YMMA 3Q0EA 2J0SA 4CKBB 5KFDA 1MSWD 4X1YA 4DRXB 4UNRA 2EFDB 5IF9A 1MOZA 3T1NA 4AX4A 2IQ5A 2HQOA 1QHEA 3L6BA 1Q15A 5H82A 4FJ2A 4JKOA 2YS7A 1Z5ZA 1JFRA 5H4HA 3L7LA 4X44A 4FEYA 4IWYA 4DLWA 5HKBA 3NIWA 4LWZA 4MWCA 1QRDA 4LOJA 4WJZA 3AUTA 1TYBE 2Q4OA 2XT9A 4O25A 2PZBA 2O8EB 1KO7A 5EG5A 1GP2A 2QVZX 1FFVA 3TZLA 1NJ8A 2AJQA 5AVUA 4F2PA 2HXSA 1QS0A 4X3CA 1LBQA 5LOVB 4YPOA 3GRPA 4MS3A 3HJRA 3SXPA 5I48A 3B3JA 1KH3A 4UAUA 3C7AA 3CNLA 5IC6A 1CVRA 3JZDA 4PN7A 1TAMA 3FKQA 4HYEA 1CUZA 4J2TA 1XTZA 3A36A 4FYHA 2QARB 4FMCF 1OT3A 1L1QA 4FS3A 3JPSA 4YAKA 4Q47A 3AEXA 2RJOA 3N2KA 4D9MA 1A1SA 4Z7NB 2PO7A 3IN5A 1GM5A 1TK9A 1XV5A 4BFVA 3HJFA 1AHNA 2JLYA 1FTNA 1JHAA 3BRWA 4EFDA 5JTIA 3RH5A 3UYLA 3SMVA 4I81A 4FS2A 3C1TA 4IFTA 3BIOA 1XSPA 1W4CA 1VKJA 1U48A 4DAOA 1YZYA 3B8HA 3ELUA 1H2FA 3K3PA 3HCNA 1I7SB 2ZUVA 4ZCSA 2OV6A 1Q8KA 1IY2A 1FFUA 2XMZA 1MORA 1EDOA 1J23A 1K9VF 1K6XA 3DYVA 4EO9A 2JZNA 3R5KA 1AKRA 5JRZA 2ZB7A 3L06A 5AI0A 3IHTA 4BX3A 4UDXX 2IZOA 2BFDA 1BC5A 3IQFA 3M5DA 3RR7A 2W4QA 2VSOA 3CSSA 2XWPA 1W5SA 2I03A 4ESOA 4ZMRA 5M7EA 2FR8C 3C3EA 5EINA 3BWVA 3EFOB 1KSJA 4WXMA 1NBMA 3QU9A 4PZLA 4AMGA 1JT2A 5LZ8A 1ZN8A 3KVRA 4KSBA 1JHZA 4K8OA 2RHDA 4ZCLA 4DR1B 4HVAA 4RHYA 4J94A 2I99A 3DKRA 1SK9A 3QXJA 1VFNA 2MWMA 3RRZA 3H86A 4D44A 1JEJA 4FI3C 4KGXA 3UATA 2EAOA 3PG5A 2JANA 2VPIA 1WBBA 4F4CA 1JZTA 3M3PA 1YC2A 4HXFB 1DO0A 4FFSA 3MG9A 1L5HB 4MMZB 5M04A 3I28A 4P92A 1IEXA 4RQ8A 4CMIB 5A2GA 5FQNA 1REQA 1ZD4A 3PNCA 3C8UA 4DWVA 1NNI1 4I5DA 4IGIA 1M34A 4WVLA 2M9NA 2OZLA 2PYZA 1U8YA 4EG3A 3E48A 2LPEA 3D59A 2E6UX 1SCIA 3KHUA 3UBMA 3ADBA 1BNPA 4ECXA 1NOKA 2BUBA 1GEGA 4OBBA 1V11A 7ICPA 1L9XA 4DV2B 4A2CA 2FFHA 4F1JA 5E1BA 5KYUB 4B33A 3O26A 4KKXB 4E6PA 1PZXA 2HJVA 1DV1A 3M9NB 1IM2A 3TVYA 3BYZA 5AJHA 4HZIA 3C98A 3TNLA 3BC1A 2P7IA 2H48A 1KEKA 2FZEA 3BD6A 3WDMA 3CKYA 1R6XA 5DGAA 4LV8B 2QX6A 4C06A 3OHSX 1GQQA 1FTYA 1N2BA 1ZIYA 2ZRLA 4CKWB 4INOA 3EIEA 3F3KA 2WD8A 5KG7A 4ZOBA 1WMFA 2FEOA 2J9GA 2JEFA 4FGSA 4H6PA 1QFXA 4X60A 4N0DA 2XUHA 4XWWA 2XVTA 4EI8A 3MUEA 4KIUA 4NHOA 2PKWA 3U56A 1QC5A 5EKTA 1B0PA 5CLHA 2P1DA 4Q19A 2BGJA 3E8MA 3ZNPA 1GGHA 2ZWOA 3WFZA 5DLQC 4DFJA 1ZXXA 4OB8A 3AW8A 1Z5UA 1YO6A 4NCAA 1AJEA 2IOFK 1WU7A 3C97A 5AIBA 4QTYA 3GVCA 1Z83A 1I3LA 5L3QA 5DYYA 3VA7A 1ZXLA 1VPEA 3ITDA 3ZHRA 2Y71A 2GBPA 1IHYA 4N3CA 2QQ0A 2HH9A 1KP3A 1SNYA 1JFLA 3FNQA 3W9UA 3PWZA 1RI3A 2IDZA 3GZFA 1BJRE 2BCRA 2Z30A 3HKBB 3MHPA 2PMWB 3JR7A 4ND8A 3LCUA 4TZ6A 5CX1A 2XVYA 1ZL2A 4KLTA 4IVNA 4W9NA 4LOLA 4KQFA 1RZRA 1GSIA 3L0SA 3TKLA 4P1ZA 4RVCA 5DXAA 5J4HA 3NUGA 1ZA1A 3B8EA 1ZGJA 1T3SA 4G5RA 2G5CA 3BZKA 2A9VA 1EM6A 4RM3A 4XA5A 4KR3A 2XQKA 2V65A 4UZEA 2B1IA 1YFLA 3F7NA 5I9IA 1S2NA 4UHDA 3B6KA 3L18A 3AWDA 3UB3A 2IUSA 2F9MA 1ZIXA 1KFCB 3ZNOA 4X9XA 3IOCA 3DOEA 1MAUA 1E69A 3EJWA 4ZU6X 3WRYC 5E6SB 3USCS 5HJEA 2GRAA 4OJPA 1Q1NA 1T2VA 3DMNA 4NY8A 3JVDA 3KVYA 3U37A 1VYTA 4DDKA 2D5AA 4U7WA 2J0QA 4W5RA 3NTQA 3AU2A 3LVRE 1ZJNA 1L4LA 1MC1A 4F1WA 2HC9A 3WGZA 3UMMA 4RFVA 4OL9A 5KFBA 1N1GA 2I71A 3GGSA 2A7QA 4JHXA 3JVEA 5TDHA 4U8HA 1WWVA 1G16A 5DI9A 1G7CA 2DKXA 2FKNA 2H1SA 3T9BA 4PFKA 1IVSA 3IKVA 1X8XA 3SF0A 3ZBPA 1M8KA 3FTQA 1TM3E 4L57A 1F3OA 1Q7TA 3SS8A 4EGQA 4CM4A 3NPMA 3MWKA 5HTOA 3B1KA 2ODNA 2WQZA 3QBEA 6GPBA 2B35A 4I0WB 4Q1DA 4C6TA 4K9LA 1ADBA 5CXXA 4PS1A 1T6BY 1T0BA 2IPOA 1PGPA 3KPYA 4RANA 3ZZNA 4I4TF 1W0JD 4FOPA 5KUTA 1ESNA 4IWXA 1E9EA 3LSYA 3HCBA 3SBXA 3KTFA 1UXHA 1SL2A 1DPGA 2IITA 2VNHA 3WGLA 3KR2A 1SUSA 5COAA 4FNOA 2E55A 3QVWA 4FC6A 3WV4A 1H9BA 2MT9A 4Y6OA 1NVKA 3FJOA 2ZI3A 3ZCPA 4ILEA 1IXSB 5KTPA 4YP7A 1ZJMA 2DSNA 4ENQA 2OOSA 5F3RA 4RMJA 5IAGA 4UAWA 1ODKA 1HUZA 4Z5XA 1ND6A 4TURA 2QZ4A 4US9A 2OGTA 2VF2A 3WGTA 1W30A 3I53A 3VC7A 1RDFA 2HPVA 1W5FA 4ERNA 2VWPA 2D5BA 4BY9E 3W78A 1QANA 4ZV9A 5IUKC 1IN4A 2WKSA 1Q1ZA 4O1HA 3RRJA 3ZNQA 1U98A 1UAGA 4DQQA 4DR3B 5B6PA 3VO9A 1QK5A 1K7YA 3C15C 1GZHB 3JQ7B 3AFGA 1SQ5A 5J2CA 1MOQA 2YFKA 3ZHTA 1AMOA 1T2CA 4KTTE 1DWOA 3ZXYA 3RD5A 3PSAA 1NC3A 2X1VA 4KQJA 3NTXA 4ABYA 3AI1A 3E05A 3HYTA 2F8LA 3IJPA 3GEHA 5B1HA 5HYVA 4RQAA 3UJ6A 1CDEA 3PDCA 3NO4A 2F1HA 2GYUA 4XWKA 2JHFA 4RCZA 1SQSA 1PWEA 1B4DA 2H29A 4KN5A 1Y3IA 2H3EA 5JI3E 1D8YA 4NLGA 3T61A 3IEIA 2IY7A 3HWTA 2R11A 2V3WA 2Q29A 3PQCA 2EZ8A 3F7OA 4DSNA 3UO8B 3JAWA 3RTBA 2QL6A 2JBWA 4U2KA 1C4WA 4AURA 4IMPA 5A4IS 1G7TA 1KYYA 4WVFA 1T35A 2ZIAA 4QUGA 3D7NA 3M81A 4CLDA 3UFXB 1SY7A 3FI0A 2CUZA 3E23A 3K0AA 1OXMA 4NCBA 3DGFC 4JN6B 4QU5A 1C9JA 1UPCA 2CEAA 5G1OA 4J7AA 3N0WA 4HWOA 4PGFA 2BGNA 5AUPB 1AQ6A 4G2TA 4EGJA 4BP1A 4RZQA 5KVCA 3MWFA 4CQLA 1HEUA 2R1VA 2PUGA 3IQHX 1N7HA 1EFPB 4U6NA 3ZWYA 4X7BA 3WGNA 3AF1A 1CKEA 4GKAA 2Q41A 2B5VA 3QIVA 2E8MA 2XY7A 2WEKA 5KFKA 4UAYA 1YZFA 3BSYA 3BM5A 3UAOA 2ZTSA 4RPXA 3MWYW 4R71A 4KKVA 1QHGA 1Z38A 4BUJA 4BTLA 1EHYA 1Z6YA 3BGOS 4RQ7A 4GXNA 1WPXA 3WBBA 3K0KA 2ZWIA 1RC1A 3OLZA 3DCJA 3S5JA 3K35A 2GA8A 2WJZB 1TO1E 4MV3A 4PHTA 5BRNA 2F76X 3P4YA 3KAQA 5HE9A 3RSCA 2PRIA 2IEDA 1KZ6A 3E22B 5KAPA 3HYSA 1KQNA 3G9UA 2Z2KA 1TAGA 1YCFA 4L2IB 3TEMA 3A28A 4B9NA 1QIJA 3HPQA 1L5NA 3AIMA 1U3CA 2V59A 1RYDA 3B78A 3ZGYA 1HOXA 1PJCA 3J80A 3ABZA 3OJFA 3TIVA 2CFIA 1BVUA 1YCHA 4F3KA 4FLFA 4B80A 5K8IA 2J3DA 3ADOA 2DUWA 4RIFA 3GZ4A 5H8WA 5JASA 3T7CA 4Q24A 1USKA 1P1HA 3ULKA 4RPYA 4HWTA 4C4RA 5BNTA 4U6PA 2C9BA 4TZTA 5IM5A 2ESEA 3B9QA 4DMRA 3C0KA 2VJYA 4X24A 1QUEA 1VM6A 1TXGA 2BKEA 3RG8A 4EI9A 3EY9A 3O8BA 2H85A 1J90A 5FKJA 3L6OO 3OAAA 3LCCA 3U80A 3KZIU 4I4NA 3I6MA 3VKUA 2X14A 3RIHA 5CDHA 3DTNA 4YIHA 1SBYA 5CB4A 5CGZA 3V6MA 1SOVA 4BZWA 5G5GA 1TEVA 4CV2A 4JSRA 2GB4A 4YP3A 5TY0A 4P93A 4WZZA 1PYGA 2AU0A 5B1DA 2OKGA 4PG6A 1YXMA 4Q00A 1G9SA 4RGQA 3NONA 2VYND 1MEJA 2G3YA 1YKSA 5JHHB 2AN9A 3NB0A 2JKZA 5BT8A 1EP2B 4BQSA 2FN4A 2JGMA 1X7XA 2AOXA 1HE8B 4RA9B 1NK9A 4UBLA 4JUZA 1PWZA 1JE1A 3O4IA 1Z73A 4KXVA 1RAIA 4DJ5X 4M88A 3GRAA 5BURA 2IU0A 3UM9A 1I7DA 3SAGA 4YQEA 1ZM9A 5IT9A 1RQXA 3RKRA 1DO8A 1E4EA 1I1NA 4IMJB 5FBLB 1JNYA 3UOGA 1USGA 2P62A 1YS6A 3H2JA 2C7VA 1XU4A 1TNDA 2XAUA 4NBNA 3KKEA 4AN4A 3ABOB 4HN9A 4YP5A 5EWGA 4TXLA 4Q45A 1A9TA 2PN1A 3GVHA 2AMLA 2HVHA 1DBSA 2CHVA 1IN8A 1TTTA 3MD9A 3RRFA 1GA1A 5H2FU 2FRVA 7ICUA 4QWEA 3H0CA 5JNUA 1QVVA 4D9IA 4FONA 5LA6A 1VL8A 5DSTA 1CIPA 2XHZA 3VZRA 3TNDA 3HX0A 5EJ8A 4Y0AA 5LNK6 1ZUD1 1ZO8A 2PGNA 4YT5A 2ZTDA 1ZSYA 2CSXA 4LBVA 1C3LA 1YZVA 3ZBUA 2OT3B 2A1AA 5JPCA 121PA 3L4JA 1PVOA 1TF5A 1EUQA 4MWSA 1KR5A 3PZRA 3CRXA 2OFXA 3K9NA 4MRNA 1WV0A 3MWGA 1NKEA 2O59A 1ZD8A 4ND2A 2ZIXB 1BPYA 1NURA 4G07A 3ETGA 1CUVA 1D1QA 1ZVMA 5TMPA 2NOAA 1R8SA 1SKQA 5KOYA 3EX7C 4NFSA 3CR8A 4AMVA 1HE2A 3PEFA 2ZAIA 3WFJA 3WRXC 5AVYA 3N7RC 4WY2A 2Y6VA 1JXQA 4CI9A 2FK7A 3TLMA 8ICBA 4ZDKA 1E18A 1SVOA 2MSCB 4LRXA 2W6MA 4M9SA 4YRFA 2A57A 4NJEB 3MYYA 3IJRA 2RGWA 1QP8A 1JBKA 4XLLA 5CDSA 8ICEA 4EABA 4DUGA 1NUTA 5LC1A 4UXJA 1GT91 3CMCO 3VPCA 1ZVVA 4Y2PA 1QQTA 4NL9A 3R0JA 1A96A 3TBHA 2ZXUA 3W77A 4Z4IA 2YUTA 4OATA 4UTOA 4G5FA 3JS5A 1GPWB 4Y1EA 2Q2VA 4JX9A 1TCUA 1IG6A 1ZFNA 3DEIA 2PRSA 3ICPA 4UBCA 2PKQO 4RK7A 3A4YA 4UNSA 1CW2B 1NOMA 1Y6ZA 2RHRA 1G60A 4AZ0A 5IIJA 1E7QA 3HBLA 3W05A 2WAOA 4M99A 5KFIA 1NXPA 2VJCA 1RZVA 3U19A 4CM6A 3SC2A 1W47A 3A6HA 3V1LA 2J0VA 3I72A 4CQMB 1T34A 1YHYA 1GG8A 2WKQA 4BBPA 1TZCA 3DLCA 1X1AA 3UK6A 1WR8A 2B83A 1OXBB 3H5WA 5A9SA 2FQYA 1X7HA 3TAXA 4IS3A 1YZGA 3HCAA 2IUTA 3O8NA 4RWZA 5BR7A 4G81A 3QGMA 1D9DA 3CCFA 4YCLA 1B1AA 1Y9AA 3QX9A 4LX8A 2VNKA 4JI6B 4ZT6A 2QP3A 421PA 4MB0A 3KWMA 4YUWA 1DAMA 3ZWKA 1GZUA 3A1UA 1NKSA 2XECA 2J6IA 3T3PB 1QG2A 1WDWB 2AFIB 4IRKA 3PR4A 2A8YA 3A1WA 2YDYA 4L15A 1U2ZA 4GM1A 1CEQA 2O1SA 4UEOA 1KVUA 2NO5A 1LRLA 3I1YA 4NPAA 1E9DA 2Q2QA 5IYZB 3PGKA 3ADCA 5JALA 4ZQIA 3NC0C 3PYMA 2IYSA 4RY9A 3I42A 3V2IA 2BVNA 2NTJA 2UVPB 5B64A 2WE8A 3FB4A 4XDYA 5KG1A 4HZUA 4L7QA 4YPFA 3HYNA 4IHJF 3LZDA 4MWDA 1URPA 1VI6A 2I6SA 2IELA 3D4PA 1E1RD 3HR7A 2M9MA 4HKTA 2H3QA 2TECE 8ICTA 2XA2A 1MO4A 3OPVA 5IJXA 2D62A 2V4ZA 4DFDA 4TV9B 5A7GA 5KFQA 5LYJF 1X77A 1G19A 1ECCA 4HEQA 2PXIA 3TRKA 4C2AA 4RKQA 2CLCX 5I9SA 1P5JA 3T7AA 1L8AA 1NN5A 1JN0A 1AUQA 1YS4A 2Y2VA 4TV8A 4MQFA 5AM1A 3OFVA 5ELXA 1DOHA 4J9SA 4DIDA 2JASA 1A3CA 2BTOA 2OHGA 3FSGD 5HDQA 4DA6A 2CMHA 3ZQKA 5H3LA 1W0KD 3ZE9A 3EC2A 5KTTA 5CNJA 1YB1A 1IY1A 2W2KA 1W2HA 3OF5A 5JCXA 4RACA 1XE3A 1DMSA 1JDZA 3ZQUA 4I2IA 1U04A 5CAEA 2YYSA 4GFJA 3LG2A 2F1JA 4BN4A 4X00A 5JYCA 4IKOA 4G23A 9ICGA 5DX0A 7ICLA 1YFZA 5GMOA 4LRTB 4DE5A 3IDWA 4PHFA 5I9NA 1HA3A 4ZHQF 5B36A 4F21A 2GUGA 3OX3A 3AEKA 2H08A 4J1TC 4WKPA 3PX0A 5EMNA 4UE2A 3T5BA 4LGMA 1SXIA 4LZOA 4R1MA 1L7QA 5AH0A 4PNZA 2J3MA 2P3OA 3T52A 1V3TA 5F78A 2B2CA 4JGIA 3TG8A 1K27A 4NXZA 5A0VA 1U7DA 2F3RA 3KB6A 2EZYA 4MW9A 5AKKA 4XUGB 3FCXA 3G5MA 4J9OA 8ICIA 3FUVA 1PVDA 3CZRA 3OZBA 1UP6A 3EAGA 4PWYA 3ISTA 1VIDA 4KLFA 5GV8A 3TXXA 3QE9Y 1J8QA 1S3FA 1UDRA 2I4NA 3W7BA 2H2WA 4F2WA 2W3SA 5K0SA 2VVTA 3RKUA 2W2TA 3DO8A 3FM9A 2EBUA 3PHLA 1IHPA 1QTQA 4ZQFA 1SOWA 1OWPA 3AFHA 2V8BA 3RYIB 1H0KA 1QLJA 2JHAA 1XMPA 2CDAA 4G1UC 4R8SA 1TM7E 1B15A 4PHEA 4E15A 1Q14A 4M0FA 2C28A 1C2YA 5THQA 2N46A 1P3JA 3MMSA 1P61B 4KTQA 4OGFA 4N7JA 3COVA 3SF8A 1MPXA 2J5RA 1MIOA 1JI0A 5KVSA 1OIVA 4WIAA 3LDGA 5LVAA 4M60A 4Z9YA 5L4LA 4BNMA 3D0OA 5JYEA 1ML3A 1ZQOA 2P9HA 1US8B 2Q49A 3HHPA 3LVBA 2CDRA 4RLSA 1E7SA 2MSKA 2QYTA 1B76A 5HKKD 3A6PC 2P9EA 3UV6A 1D2NA 2JI9A 2FPLA 3WQHA 1U0GA 4FOOA 4F7DA 2GQ0A 3HDHA 3ANNA 2NU7A 3ET4A 2ZYUX 5HDBB 1N6OA 4MWOA 4JJGA 3FPGA 5CPBA 4C7KA 4BX2A 3N2IA 4RU9A 1BGVA 5KL8B 2VA8A 1DG3A 3WLSA 2RGEA 3VTFA 3NRWA 2DCMA 3IIIA 4EZ6A 2VTBB 4RUKA 3LX5A 1ZR2A 3IEMA 2R60A 4NY1A 2IA5A 1KAEA 4RV4A 1U7HA 2EJUA 3MN1A 1OI7A 2FWRA 2FV8A 3I8XA 3NAGA 3GA0A 5K3BA 4S05A 1FUYB 3AP1A 1JDPA 2BP7B 2FEKA 2BFOA 2KS6A 1D03A 1Q1QA 2V1XA 4U1RA 2OBYA 3JARB 4Q93A 4DEVA 3VU1A 2VHTA 1QYWA 4DREA 1NM5C 1W6RA 4ZZ0A 4R66A 2X4LA 1J0BA 5LZ7A 2ZJ6A 1XWIA 1MC8A 3T7IA 5CYPA 5DBFA 2HHTA 2MYTA 4J07A 1PGNA 2CJPA 4PAGA 3EWAA 3P0FA 4EFKA 3A1EA 5J2JA 3JQFA 1YU6A 3TTWA 3MTGA 2QSYA 3R3VA 4XD2A 1JEAA 1FMFA 1YRLA 1M2NA 1Q57A 1UBCA 1RQGA 3C3WA 1A2KC 1ZQ1C 1V9LA 3RJ9A 5J43A 1ZJYA 5CA1A 2ZUFA 4F9EA 1PR0A 3OKCA 5DM4A 5THXA 1RJ9B 1GZ6A 1N5DA 4XPIA 1WTAA 3UHPA 4DG5A 4B3BA 4IJQA 3OX2A 4AZVA 4PPQA 1NPTO 2EWMA 2Q0SA 4JVSB 5ERXA 2SHKA 2QTTA 5ALTA 2PV0A 4Z4QA 1JG4A 3D7KA 3NTLA 1LPBB 1X1EA 2F3PA 1FYXA 2C2RA 2EQ5A 2PGOA 3T4EA 3HDTA 3E9RA 3DDNA 2HWXA 2EFJA 2ZRIA 1NNUA 3OA2A 4CEJB 5K01A 3CGWA 2XWJI 2WJ3A 3BMQB 5K6AA 4Q4JA 3ABRB 1GQSA 4MKZA 3K6SA 3RUPA 4COKA 2IUYA 5JO0A 5IBPA 1FNDA 1FOEB 1C7JA 1N63A 2QXTA 3HGTA 4DSZA 3NBXX 4R01A 3O8QB 2IWHA 4F4WA 2PFGA 1NBOA 4MW6A 3S2SA 5J2TF 3JWIA 1FBTA 4I2VA 4N7RA 1N7IA 1B2LA 1UBEA 3I4LA 1F1BA 2MJLA 1ZQNA 3OG9A 4WBSA 3PRJA 3DHNA 4JQZA 3TKAA 1T2DA 3ZDYB 2HNBA 5AVKA 4N8DA 3L8CA 1O6ZA 4GYYA 5BSRA 5AKEA 4J0IA 1NI4A 4E11A 1N5IA 3E1KA 4AY3A 4YRSA 1RI2A 4Z2AA 1MQ8B 4MJ3A 2Z56A 4V0RA 3ZD6A 2PSFA 1SU7A 1DX6A 3LC0A 1UBFA 2LD4A 4UATA 4QFBA 3WWZA 1GSOA 4MVJI 2R18A 1AXGA 4JL8A 3QXCA 3GT4A 4IDNA 3TADC 3HKZC 4B6FA 1GKKA 3CLKA 1GPLA 3A1FA 1R7RA 2DFDA 4PHHA 3WB2A 4D4KA 1YAJA 3RTAA 3GG9A 3OP4A 3AINA 5LZ2A 1WXEA 4NOMA 5C7OO 1MT0A 3M4ZA 1YONA 4I1OA 4ZI7F 2MDTA 4BLVA 2QYOA 1BS9A 2OMEA 1RXWA 4JUAA 3BEOA 1N6LA 4TVOA 2WAAA 3F4LA 3MSCA 4PF1A 1L6IA 4KUHA 3IPAA 4DCUA 3FYUB 1ZK3A 3WL7A 4CF4A 4GP7A 3QE3A 1QE0A 3CVYA 4FX2A 4I8IA 2VJMA 4B7UA 1WD5A 3W2HA 1H42A 3M8RA 3BCUA 2I76A 3RAGA 4L5AA 2VDPB 1KL7A 3E0XA 4A27A 4X8HA 4KXFB 1L9KA 4RTRA 1NQTA 2V7QD 1L5QA 4NBSA 1FS6A 1BO6A 1R6AA 4OF4A 4EW3A 3A4IA 2BM0A 1MENA 4OB6A 3OCCA 4B48A 3PXDA 4RF3A 1FMCA 2E37A 1DVRA 4IC9A 1KARA 1NQWA 2FQ1A 4PQEA 4GPTA 1H69A 2WIKA 3UTDA 4Z0NA 1JMVA 1XZMA 2RGNA 1QDUA 3NG1A 2ORVA 1FYFA 4I08A 4MV0A 3P45A 2BHNA 2Q3MA 3VDRA 3WGOA 3ICCA 4DQXA 2IXFA 5C5IA 3LI2A 1R88A 4DEZA 3FI9A 1IN7A 2GPJA 3VKVA 2XKKA 4O5AA 1V3UA 4TWAA 1NKTA 1X1DA 3D7RA 3LX6A 1L3UA 1YFKA 5JC8A 5KFYA 1E8DA 3AHGA 4EH1A 2J6SA 2FWJA 2D8CA 1IEQA 5KHLB 1XMQB 2BI8A 2PX0A 4WSOA 4ID3A 1IHDA 4EX7A 4B9VA 1KZGB 3GLVA 1CK4A 1OLXA 5KX5A 5TPZA 4GGMX 2B92A 1XQ6A 4DV4B 3B5EA 4HY3A 1EEHA 4BO9A 4OFXA 4ZKDA 2Y1JA 1IMJA 1CUEA 3CB4A 1U8AA 1KO5A 4P4SB 5I9MA 2EXXA 1IMOA 1ST2A 4UBKA 4HAWA 3TLKA 3MTEA 5F73A 3GJ6A 3ED1A 2QVXX 3GIWA 4HP8A 2IBSA 4MI9A 3IUJA 1GILA 4RJ2A 4Z1MA 4RELA 2R62A 1EJ2A 2PZAA 1EVIA 2JIZA 4HB0A 2WWRA 3ROZA 4KE9A 3DLTA 1CUBA 2AQ4A 1H8ED 3PC3A 4Q3OA 4OMUA 4U2BA 2OV3A 3JPTA 3GQCA 2DFLA 3GNLA 4CLOB 2WHYA 3PGVA 4GOMD 4RV5A 4CCYB 5K0CA 4ZVMA 1KDRA 1CZKA 5BV7A 3TI9A 5FV7A 5BOLA 4MQEA 2PD4A 4KQCA 3EFEA 1WEHA 4PYKA 2DPHA 4S1VA 4XX0A 1K1QA 1SK8A 1BCRB 2ASJA 1U0BB 3CNBA 4Y7DA 1FNNA 1J2RA 2WY2D 1C20A 3ANMA 1QZTA 3RC7A 3GJQA 1A8QA 4FINA 1CJUC 3IJEB 3Q5EA 4C7BA 1H1DA 8ADHA 2D1QA 3HT3A 1X1RA 3GGPA 3TCNA 4FNMA 5FUXA 1JH9A 2F64A 4LWQA 1N75A 4BKUA 3SOPA 5JDCA 2ZIVA 3F97A 5JAPA 3JAMA 1TJNA 3GLGE 1Z6AA 4P36A 2RKBA 3HCEA 1TAHA 2B1GA 2OZPA 4BO1A 1E0AA 2JGAA 2FPOA 4L0QA 9LDBA 3I1JA 4LJAA 2ZUSA 4QTXA 2ZBGA 2XQVA 4XGQA 1LPSA 3RTGA 4YY3B 4MTLA 2NUAB 4UVHA 4HDAA 2JLVA 5EIHA 2UVDA 4G2NA 3BT7A 1BWPA 3IOEA 3U4IA 4Q9NA 3W6ZA 1VI5A 5KVQA 4GLJA 1P5ZB 2BHSA 1FXWF 4Y9TA 4DMHA 3JSAA 5KNCH 4ZQEA 1RHUA 4L0CA 2IZ5A 3ZK8A 4I55F 2HBYA 1CHDA 4WDRA 1MAHA 4WN9B 2ZTEA 1VJ1A 2SNIE 3V7YA 3IAFA 3FYCA 4IQWA 1F44A 3C3BA 4QZ8A 1R0KA 4J43A 2OAGA 4HMQA 1HYQA 3NHYA 3SQXA 1FTWA 1JIHA 2O6LA 2H7XA 3EZ5A 1VRVA 3T4UA 3R41A 1YL7A 2AG6A 1WVMA 1H94A 3GDOA 1FTSA 1AS3A 4N40A 1ECWA 3TLGB 1WHSB 2ZYVX 2V7WA 3QUBA 2PX5A 5EE9A 4IR9A 4GGOA 3NHPA 1GGJA 2ADFA 4IINA 3PD1A 3CSDA 3NYRA 1JKXA 5JZOA 1X86B 3JRXA 1L5MA 1QO0D 3JD3A 1A7UA 4I9GA 3UC5A 3MCAA 1A4IA 3TDNA 3R77A 4FCTA 4OXNA 3UAVA 1NJ1A 2C58A 2PZJA 3ZD8A 4RMGA 4G9BA 1RHMA 3R5JA 3LBHA 3HBNA 1DAGA 2XOKD 4WZ6A 2Y3IA 1IJFA 3T12A 1ZETA 1O6BA 3WR5A 1KK3A 1VOTA 1TFRA 5IZCA 4HLUC 3ZV4A 1HQKA 3FHCB 3HY3A 3SQOA 2REBA 4GQBA 2DBVO 2X8AA 1U47A 4PLVA 1PS8A 3KKZA 1Y6QA 4BX0A 4QYIB 4FGJA 3WAGA 4YP9A 4Q66C 3USES 4QHYA 4NAHA 1GQRA 3GAZA 2H2FA 4IG9A 1WEKA 3A9SA 4HDNB 2EDAA 3TI0A 5KHOC 2VRBA 2DSTA 4CKXA 5KYYB 1PTJA 4RE6A 3NHMA 2E85A 4YMOA 5L1LA 1GCGA 3UWDA 2B4AA 3I8SA 1N1EA 1LBSA 4TSFD 3RS2A 5EN4A 5FOTA 1W7AA 4YRIA 2HHSA 4Y6PA 3U4MA 5TR9A 1GV1A 1JALA 2C2OA 4CV1A 5FUQA 1ED1A 4GBED 4HYQA 4YWHA 2QSZA 4QG3A 4BB9A 2OY0A 4N39A 4S1WA 4MW1A 1BS2A 1MJ5A 1E3TA 4UB5A 3Q2IA 4OA5A 3ZS9A 9ICXA 5IJ9A 3TD6A 3GY0A 3SM9A 1JF8A 2MA1A 2F62A 3VXKA 4EUFA 4LJ7A 1Z7WA 1WDTA 4M04A 5G02A 2D0PB 4CKEB 4D3ZA 1Q91A 4DA4A 3KYIB 5F9LA 1P31A 1R0BA 1U1EA 2OCAA 3KXLA 4QBTA 1ZXBA 4HDMA 3OWHA 3A1DA 3OHBA 1C8BA 3OO1A 2NQTA 4OYYA 1SKAA 3MFIA 3UJDA 1X7ZB 1D5WA 4PLCA 4F45A 1M7GA 4JAVC 4XCVA 4RTQA 3KSDO 4D7AA 3BXZA 4UEJA 4YCNA 1EQAA 5F21A 2YHIB 3QFHA 3JQGA 5FTJA 3I2KA 4JC8A 1IFXA 4RJJA 3MUOA 5AVJA 1W581 4YPVA 1YS1X 4MPDA 5EQFA 1XTPA 3L41A 3KO8A 3PL1A 3WMFA 1T13A 3PUZA 3B3GA 4BGVA 4B9LA 4P81A 4HQKA 5L1IA 2QN3A 1P9RA 3FB1A 3R5FA 3A6FA 3D6UA 1HOTA 3BMNB 3ZWNA 4D97A 1ZIPA 2PBFA 1UBUS 4URFA 1H1LA 3O5AA 1J2JA 4N03A 5E7IA 5BY2A 3V8PA 1QGDA 1W1WA 2H0QA 1I3NA 4NICA 3HN6A 2O2YA 4KFTA 3MJDA 5K8CA 5GP1A 1Q22A 1FUEA 1QHFA 2UYCA 4F7WA 5TQ0B 5JNTA 5CR0A 1T3GA 2CFRA 5AP9A 3WYBA 3E15A 1YDGA 1GUAA 4RNDB 3N2YA 1H6AA 3QI2A 4CCSA 4EBDA 5I3ZA 5TB5A 5C7LO 1KBUA 2FWNA 1RZUA 1T6ZA 4MXDA 2EGUA 4Q0MA 3NRJA 2ZI4A 1ZH4A 5DVZA 4EPVA 5DZSA 1GO3F 1XWFA 2C59A 4FMDB 1Y7PA 4AROA 4LX0A 1KHHA 2YTZA 2X6RA 2A0FA 5CCDA 2B3DA 1II0A 4TTVA 2ZT8A 3QX7A 3MB8A 2V3CC 4M49A 2FWBA 2WYWA 5DEIA 4YT2A 1QRAA 1AK1A 3P1JA 3UT5A 5AVTA 5G0TA 9MHTA 5FBHA 2Q2OA 4LWOA 1J99A 1NLUA 3PKZA 3UMJA 4K28A 5KS2A 1DIGA 5DHUA 4OLHA 1P7VA 4UB3A 5AOCA 2CXYA 3HJEA 4UHKA 3V2GA 2D00A 5J58A 3ZY2A 3LL4A 4AB1A 5AXAA 4Z4GA 3WBFA 4U5QA 3AKEA 1KF0A 3TZHA 2NTVA 3PHJA 5D5PA 1CQIB 4HCJA 3AG5A 3AKCA 3S8EA 3M2PA 1OXTA 5K3CA 4KPYA 2E6KA 3LVWA 4UE6A 4D42A 3UQZA 5HIJA 3I04M 1H2EA 3ACBA 1OFTA 3LUFA 4WZBA 3TQRA 1JXLA 1H0HA 4FZVA 5JBQA 4RABA 3RT9A 2XE7A 2MINB 3E8XA 3PYXA 1SV4A 2DP4E 2WA2A 1H9AA 4TMVA 3TQ1A 2ZUUA 3OZRA 1M73E 5A0LA 4ECTA 2ACVA 3VZQA 3FPHA 2O8DA 3IL2A 1SAYA 3ASUA 4KN7A 1NVBA 2BRUC 3ME5A 4BMCA 1WBJB 5DMXA 1H1TA 5H5JA 4WACA 3DJFA 1VG8A 2GAAA 4LVNA 3G9XA 3LPCA 4BZQA 2HMAA 3X3HA 2DLCX 4A15A 4G0UA 4DIKA 3NH6A 3UAWA 2W9AA 4XYMA 3BVPA 1JR3A 4QGGA 3TEFA 1EUCA 2FFJA 5CRXA 1JR4A 4H6XA 3TEJA 1OFVA 3UPUA 2X4IA 3COPA 5B4VA 4G5HA 1DJOA 3B1YA 1Q83A 2GAIA 2M1ZA 1RRMA 3L49A 3DYBA 4EW6A 1XZPA 1ISRA 4LXUA 4ON9A 5A3VA 4YBRA 2VH1A 1JG3A 1MR3F 3Q15C 3SYTA 2W8BA 3WLJA 3PRKE 1Y6RA 2GCOA 3CZCA 4C3ZA 2FLWA 3UCFA 4N5HX 1UPBA 4MDYA 5MF6A 2NQ2C 5GONB 4FQ5A 1JHMA 1DBWA 4EAQA 1RT9A 3I61A 2GN8A 4OXKA 4FPXA 3CUSA 1SBZA 3LE8A 3D4BA 1RKVA 1J22A 3RVQA 3ZIDA 3I92A 1GYQA 4ADSG 2H63A 1U81A 3WL3A 1BDBA 4KQ9A 4L9AA 1ZQDA 1EK2A 3FUXA 4H7DA 1HYBA 3VR2D 3A9VA 5D7NA 3MCVA 5I4BA 3LRPA 4AWAA 1C29B 9GPBA 1UM9A 4GLOA 4UQLA 4GT1A 3VCBA 7ABPA 1EAMA 4GW3A 4H31A 5EJAA 1O6FA 1K08A 3X1KA 1WCLA 3RSQA 1Z34A 4AZSA 4DIFA 1BW9B 2FEXA 1Z88A 1EK1A 1O3YA 1TUBB 4MHOA 1VBFA 2A14A 1WQ3A 4DCPA 4RVGA 1ZISA 4U2EA 4ECVA 4YVZA 1ONBA 4AJEA 3E2PA 1N9GA 3RUIA 3TOXA 2LCFA 4QPNA 5DDMA 4RY2A 1M2EA 4JLBA 3RSSA 1YZNA 3KB2A 3R3YA 5LPNA 3FYDA 1SEPA 1XMXA 3IODA 2X5XA 4GXKA 4MA0A 1KI9A 4UTZA 5LP6F 4ZYYA 3K16A 4GZ3A 3BJMA 3V7NA 3IE1A 5KFGA 4OQMA 5LKRA 1D9FA 3PV0A 3DMHA 1WHTB 1JEQB 4G8DA 1U0FA 3W0LB 3WHIA 3NC4A 1T9BA 4XXHA 2BQ3A 1ACMA 1RRGA 1Z9BA 3EEIA 4PAWA 5LB2A 1WCNA 5D3MB 4YV0A 1CUDA 3OQ1A 4I5EA 4RLQA 1L7AA 3WJ7A 4QQNA 4PFJA 2Q21A 1GL9B 1H6CA 5UKDA 2Z2XA 5JSQA 3U5TA 5C0YA 1T4MA 3MA0A 4HQNA 2R8BA 4O4JA 3K72B 3THWA 8ICLA 3S6JA 2BTQA 1GPNA 1EFCA 4N82A 1X39A 2RKOA 4HFRA 4TTRA 4C20A 3MJEA 4J3FA 4Y3UA 4RUAA 1IZ7A 1AKWA 3MJ4A 4Z2YA 5DHTA 4KLZA 2L82A 3KTAB 1L7RA 4KXQA 4IHKA 1N36B 1EX7A 2POCA 3LVFO 3IIKA 3RT1A 4HTFB 4O8ZA 1YS7A 4WY5A 2JW5A 1UBNA 4IZOA 1VHWA 3REQA 1CY1A 5B2ZA 3I2YX 3T7SA 1WDLA 3E4DA 2Y1XA 3S40A 2W6IA 4MIKA 2OV1A 1BE8A 1BXRA 5BMOA 1GAJA 2DYKA 3V4VB 3WYCA 1TK3A 5TPWA 4A9AA 3U61B 3IEVA 2YWEA 1GN9A 4TXHA 2D6FA 4Y9DA 1IU9A 3D2NA 1NMSA 4BWJA 2OBFA 5FWXB 2FEAA 2G7MC 4W7HA 4B83A 2ZJ4A 3AL0C 5DI3B 1NK6A 1ZNZA 3JATA 5BNFA 1H2YA 3ZWOA 2X3YA 2AOUA 1GCAA 5LWHA 4V1CI 3TE6A 3BTOA 1XNJA 1OR8A 3PF9A 4H7HA 1FRVA 2PS9A 4KB5A 1KI6A 3VPAA 3O83A 1X8JA 1ZD9A 3RW9A 2IV3A 3D5TA 3CZ4A 4PRYA 4ZAWA 1U6JA 5ADHA 2AYYA 2P2GA 5TRTA 3QMMA 4KMOB 4TMTA 2X3UA 3O9ZA 4UHHA 4LZAA 2JD2A 1G1AA 2OO5A 2UXBB 2IHMA 2FPGA 3H7IA 5AI8A 4XVHA 3ZEIA 3ZI7A 4K8RB 3WYAA 2YWFA 3UMFA 2PX8A 4KNYA 2C2XA 3INNA 1NRXA 2PFKA 1IC6A 2L19A 3P2OA 4F11A 4YA6A 5AW8A 1W2WB 6PFKA 3L92A 3HR4A 4OJTA 4QUBA 1BNOA 4UDOA 3M6IA 3PZPA 2EDUA 3KQSA 2AQ8A 3VYUB 1GRNA 4O3NA 5I5EA 4GWKA 3GAMA 1FYVA 3LGSA 3HB1A 5DHRA 1EZZA 3FN4A 3H4VA 2QS9A 3ZX5A 2V5VA 5IHPA 4CIWA 2OXRA 1J9ZA 1X8KA 4S12A 4WA8A 2PX3A 2UYYA 2I22A 1M6EX 1Z2CA 4L85A 1Y1RA 4IV5A 5EKDA 1EDDA 5B7NA 1ESZA 2PUDA 2ZWAA 3I6QA 4P0PA 4FHDA 2M6KA 1NFFA 4DQ0A 2NUTB 1MO5A 4D8VA 2G76A 4F5RA 7ICQA 1TM5E 3EZXA 3FF1A 4TM7A 1YH3A 3D9QX 1MN6A 4ZEMA 3FLEA 4KZPA 5KEIA 5JU5A 2O3JA 3WLTA 4HNGA 3NBUA 2YWDA 3KSMA 4US2R 1B8VA 3CE9A 4MV7A 1OU0A 1HZZA 4B3GA 3M8KA 1GTG1 2IC5A 3O03A 5T8KC 4DMMA 3ZBQA 4BMPB 4YN4A 3QW4B 1SKRA 2V4MA 4FIZA 2NM0A 4WADA 2Q99A 4FDTA 5FLKA 1D2AA 3GFPA 1NJFA 4LYAA 4F4ZA 4P83A 3EVFA 2BL4A 2B8EA 3K9HA 4YO7A 3RYFA 2RGDA 4ENPA 1U2DA 1AHHA 4M7WA 2XRYA 3GGDA 4DANA 2GVZC 3D8NA 4R3WA 5BNWA 3D3JA 2CMDA 2R00C 1JYEA 3ZYZA 5KO2A 3F6CA 2WB2A 2PXCA 4EJFA 3AUUA 4GYWA 4ILKA 2BFBA 2GI4A 2ERYA 3KWLA 3DQQA 2IX9A 5J4KA 1N2IA 3QEMA 3ZXXA 2AVNA 5C1BA 1UPAA 3ZZUA 3Q3JB 5BSHA 1EXDA 1S0OA 4JC5A 2ZRQA 4ZIRA 3HILA 4XQCA 3VNRA 3U3KA 4XEHA 1SL0A 4LJ6A 4G65A 3E2IA 4M1QA 3X2FA 3JPOA 3C2KA 2P2YA 2ZJ0A 4OHKA 3OX1A 2W11A 1WXHA 4FGUA 2ZYSA 3CP8A 5B6IA 3FTFA 2V7GA 3ZIAA 4DL7A 1KZHA 4PV7A 1N1DA 3ZGLA 4TTTS 1JQEA 2GZDA 2PS1A 5AQ1A 2YOGA 3AEUB 2BEUB 1XTBA 4WLNA 1JMKC 2BT4A 5IMSA 4YXWA 1M1ZA 2VDVE 3TZBA 1PIWA 1DKUA 4IJWA 1UC5B 3Q5GA 5FBWB 2GVNA 1S7GA 1RFLA 4DA0A 4N49A 4JROA 3R7SA 2OFWA 4CCHA 5BVHB 3H6KA 2NNWB 4FKMA 2QBYA 1L6NA 2ECPA 1XA0A 3DLIA 1YQDA 1P2UA 1JBEA 1Y80A 4B3MB 2EX0A 3RK4A 4G4SP 4F38A 4DJJA 4YAFA 1HL3A 3LHIA 3E4CA 2AKAB 1KY3A 4P3KA 2RP5A 1D8BA 5ALVA 1SCUA 1MW8X 2X8JB 3U0BA 4W8HA 3QZ7A 1S2IA 2FPIA 1ABFA 1O6GA 2C2GA 4QGHA 1BD3A 1P4GA 3UUWA 2I4RA 5I7OA 1ZG3A 3JQ6A 1SULA 5EWFA 2Q28A 4Q21A 2VTDA 4RGYA 1ZBDA 5K6RA 4WH0A 3S68A 1VHQA 3DTVD 3TLCA 5KJEA 1QYXA 1YQQA 1HZJA 1GPYA 3D1VA 3K0EA 3ZXSA 3MRSA 5ALRA 2VJKA 3DONA 3EPKA 3HEAA 1V1RA 1UM8A 4RM2A 3PF8A 4F4HA 1N77A 4G89A 3A32A 3CR7A 4DLAA 1U5BA 3BXHA 4HVCA 4UCQA 2EKPA 4F5NA 1E1QD 3AJRA 2WMOB 5L4SA 1E0DA 2PMEA 1ULSA 4L4UA 4K88A 1LFAA 4GI2A 3JZMA 4YJ2A 4J9PA 2O07A 2F43B 5E7QA 2PWBA 3D1JA 3BWEA 2B21A 5ENDA 3DC7A 3AVOA 1J9GA 2Z95A 1S8NA 5AHWA 5LIRA 3D5EA 5GIOE 4K0KB 3PA6A 1LPMA 1R5OA 5KNCD 3IPCA 2ACEA 5FPPA 5ANRB 1M8JA 3IS3A 5JCJA 4HDSB 5JFOA 4MEJA 2XA1A 2QMHA 4LV5B 1BSVA 3C87A 3SU8A 3GVXA 4MWBA 3IUEA 3SYKA 2ZIUA 4I50F 2WYIA 3S27A 3PCXA 5DB8A 5IZ4A 1U3GA 1IWPB 2A5GA 3PC7A 1ZSNA 3L7JA 2YVUA 3A1CA 1WW3A 3QLUC 5F2EA 3ETEA 1KMIY 4BLWA 4WCFA 8GPBA 1I6MA 2GTPA 4AG3A 3ZZ0A 3J7AC 2NVUA 1ND5A 2XDQB 3P9RA 4WKGA 2RBKA 3C5VA 3HZOA 1GPKA 3IQZA 4FI3F 3RJ5A 5DE3A 3VR0A 1YC5A 1PL0A 4CF7A 2AEMA 2QJFA 5KT3A 1GUDA 4B6GA 1YOVB 1QGYA 3N7SC 3H6GA 3SKXA 3I9V6 2RGGA 2B4QA 5CMLA 3CPHA 1CQZA 1Q92A 2AH5A 4K4IA 2QW0X 1BWQA 1U8TA 1U0EA 4D82A 2IPXA 1NJZA 3LT4A 5ICFA 5EJ9A 1JXEA 4TTAA 4GBJA 4DV5B 3WHKA 5J9FA 4OI0A 3EZGA 3FKJA 2DHEA 4QZCA 2ERCA 4R6XA 4QSMA 4ED8A 3SIPA 4EIWA 4LKOA 2GYWA 2C99A 1QUFA 1X7WB 3H4MA 2NO1A 2OENG 2QAGC 2XI9A 1IXYA 1QCZA 1MP0A 3KQWA 1HQYE 5BVGA 5JD5A 4EJSB 1VHJA 5CD9A 2II6A 2G5HB 3AR9A 1LFDB 1L3IA 1OYYA 2XSZD 2GDJA 3VU9B 2UVVA 1VGRA 2RAFA 3FKSA 4G8CA 4NBUA 2ZWVA 1RAGA 5EKXA 5J2HA 5FV4A 3NJ4A 2YYAA 2VTVA 3L7OA 2ZTHA 1V8OA 3S7ZA 2KLBA 4NMHA 4EKYA 1NDQA 4EPXA 3UXEA 3UICA 1MB3A 2HW3A 1ZP6A 2AG0A 4IQ8A 3EIWA 1A2OA 3AR5A 4ALMA 4UPEA 5FX2A 1ZMTA 4TKUB 4CZ2A 1BMFA 1U45A 2PEYA 5EPUA 3TLXA 1NUSA 4IQTA 1UANA 1LDYA 4AXBA 3NWEA 2BGWA 1VKHA 1FVXA 4YTEA 4W99A 3WGMA 1GKUB 4AW9A 4QZIA 1ZQVA 1NDUA 2CC2A 1PK3A 3BQMB 3K1TA 5CFLA 3IVRA 1MT3A 4TKVA 2XUGA 4EW2A 4UD6A 3DAOA 1M2GA 4YBZA 4P86A 5CCEA 4D9HA 1EXVA 1N7JA 2FKAA 1D7OA 4P33A 2OQRA 3R0ZA 2EGHA 5EZ6B 3GLIB 1ZQEA 4RPCA 3GFFA 5TGZA 4EP1A 2HMVA 4CM8A 1VCHA 1PV1A 2HHXA 2GBLA 4EG1A 2A7XA 3JALB 4YECA 1GTMA 4C3VA 5B6JA 4ZHSA 2D1RA 2WICA 5A3RA 1GU7A 1KH2A 4F93B 3L8ZA 2YN0A 3QP9A 5BN5A 2CBGA 2BW0A 3K0SA 3M6WA 3DV2A 4KVGA 4R2KA 5B7PA 4ED2A 1CP2A 3HO8A 1FIUA 3W2GA 2Z6UA 1WUHS 3PGMA 4F56A 4W5HA 3C85A 4LBYA 4GOKA 2CXOA 2P27A 1QFYA 4P58A 1AXRA 2WVGA 1RLTA 2GXQA 1DCTA 4JLJA 1GL7A 3CURA 1Z5VA 2GPNA 4F4KA 3TE7A 5SZIA 1ICEA 2VP0A 4D6PA 3RJZA 4KWIA 3MDCA 3L1VA 4F5PA 1NJYA 4FT2A 4FMCB 4QXQA 5AW0A 1DTWA 4A8JC 4IIFA 2PU5A 4P98A 1EFHA 3NTRA 3M6FA 3R7NA 1AZSC 2C07A 3OZDA 3T5CA 4AKTA 1TK0A 4FZJA 1LKZA 1YV9A 4JJ7A 2CJYA 2B5OA 4EF6A 2ZETA 5ECWA 4AO8A 4DIUA 3WTCA 2XUIA 2QZPA 2FXVA 1FX0A 3OZSA 4MAAA 2Q3BA 2BDUA 3F46A 5JH7A 1SXGA 4IJ5A 3VI3B 1GARA 1XAHA 7GPBA 2VN8A 2IIBA 2WTAA 5I47A 4W5QA 4P5DA 4ACBA 2Q5HA 1DAKA 2CNLA 1TEXA 1KFDA 1N6PA 1T0HB 2K4IA 3F9RA 8ICFA 3VNQA 4HEA6 4Q3EA 4M1ZA 1S8OA 4Q4LA 2NZ2A 5ESRA 4V1CB 1MX5A 2F3SA 3O8OA 3ZNNA 4YONB 5IDVA 3U9TA 4B2LA 2C4VA 3N4MB 1VIMA 1KY4A 3UKOA 2NP7A 1IUNA 1VMIA 5HIAA 5IARA 1E99A 2GHTA 3G68A 4YCXA 1LKYB 4JR1A 2IYQA 2AJCA 1UDCA 3AL3A 4XUEA 4MARA 4LSGA 1RNLA 4PRLA 3EYZA 2DWPA 2Y76A 1KQPA 3MWJA 4KVAA 4D3SA 1R50A 1ZVQA 2NXJA 1UHUA 1Z8NA 2GEJA 1GPJA 4YJFB 4QPDA 4DDHA 1IATA 5JMTA 2FCRA 4DR2B 3WLPA 1OLOA 4CLRB 1QGAA 1KR2A 3LDFA 3RIYA 4BV3A 3CZAA 1SVIA 4D4IA 2I3AA 1XZFA 2A0XA 4PLFA 1TKAA 4MR8B 2NVBA 4RLHA 3LYSA 4II2A 4P2BA 1YVRA 3Q72A 4ZJUA 5NULA 1W8IA 1DKRA 1I7PA 2XIDA 3ZK7A 3MFHA 1DXOA 2AMVA 3CMMA 1XQXA 1ZQTA 4LMRA 1R0SA 3U4DA 2ODBA 5LZ4A 2CCKA 1EWRA 4R16A 1ZYQA 1IHUA 3TQIA 2XXJA 3AUXA 3RAPR 4AWXA 4P7KA 4ZTZB 4XOIA 2P9YA 3I3SR 1XDUA 2DUMA 2UU9B 1AUVA 2P69A 4Q1CA 1S9DA 2I6XA 1YI8A 1C80A 4DMGA 1IHOA 5JJKA 3HP1A 5KTYA 3KIPA 4NJOA 2Z6AA 3SI8A 1RS0A 3QX3A 5A4DA 1P0MA 2HR1A 1MQAA 5KFOA 4GAEA 2CY0A 4BZXA 2Y4NA 4DN6A 5KU1A 4QODA 3BQ2A 4YRGA 4M76B 9ICKA 3M9OB 1VLHA 1QHNA 3LC2O 3R0QA 1P1BA 1APBA 4LRUA 1EGMB 5E1MA 3TRHA 1JX4A 1D1TA 2A1UB 2MIIA 1C9KA 2ZKIA 1PL6A 4FD3A 2AFVA 4UCFA 3K71B 5DN6D 4D25A 3JPQA 5IAJA 1X1TA 4NSNA 4EYSA 2PVCA 1OD6A 3QWHA 3SJBA 1D2CA