4KX5A

Cytosolic 5'-nucleotidase iii complexed with cytidine 5'-monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
b'AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Cytosolic 5'-nucleotidase III complexed with cytidine 5'-monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx5A01
3DV9A 4Y2XA 3U7EB 3N8GA 2EARA 4UARA 3AR6A 1NNLA 1L7MA 3ONNA 1U7PA 1RKQA 3WKBA 3U7HB 3WK4A 2Q5EA 3ZWDA 3HLTA 3L0BA 1SWWA 3B9BA 4BEWA 3KBBA 2PKEA 3L8HA 2I33A 1N9KA 2I55A 2C8LA 2C88A 1Z4JA 3NASA 3FZQA 2YFYA 2YMQA 4IG4A 3L0YA 2MSNA 2NO4A 2B1QA 4DW8A 2CFTA 1ZD3A 3QU9A 3SD7A 5AVTA 1QQ7A 2B82A 3MC1A 2G80A 5AW3A 4EENA 2VKQA 2I54A 3WK6A 3BWVA 1RLMA 5A3SA 3ZTYA 5JJBA 2G07A 1RLTA 2OBBA 4AP9A 4YGYA 2R8XA 3ZVMA 3DDHA 4BX0A 3NUQA 3OCXA 5IS2A 2GMWA 5AI9A 3U7FB 4CF3A 5AIAA 4Y2VA 3WGUA 4UATA 3E84A 1RQNA 3WKEA 4FFDA 2YJ6A 1J8DA 2O9JA 4ZEXA 2P11A 4UAUA 3R09A 3AR9A 2JAWA 3QYPA 5AICA 1RKVA 4YIHA 1XP5A 3L1VA 5AKKA 3EF0A 3KC2A 2FPXA 4C4TA 1S8OA 1NRWA 1YNSA 2ODAA 3PGVA 1O08A 1YS9A 2YMLA 3OCZA 2R8YA 3I28A 3ESRA 5ALXA 4I9FA 2G08A 3WK8A 4HYTA 4ZEWA 4YCMA 3I76A 5ALQA 2HSZA 3PDWA 1JUDA 4KX5A 4HGRA 2G06A 2FPWA 4YCNA 2ZBDA 1TJ4A 5ALMA 1WR8A 3R4CA 1EK2A 2QYHA 4O8CA 4AS2A 2WFAA 3MPOA 4L57A 2CN1A 2IOFA 4NABA 4FE3A 3E58A 3SF0A 2FDRA 4Y2RA 1L7PA 2W11A 4BBJA 1Y8AA 5AIBA 1YDFA 5ALTA 2HI0A 5AW4A 3U26A 2YJ3A 3L8EA 2B8EA 5AM5A 1QQ6A 2YMMA 4Y2YA 4QJBA 5E0OA 3ZTWA 3FGOA 3ESQA 4L6AA 4CF4A 5AI0A 1ZOLA 3W5BA 2ZBFA 4Y2UA 5AM1A 3WKCA 3ZWKA 1YJ5A 4GIBA 2DQSA 2EAUA 1QYIA 4KNWA 4BNDB 2O2XA 2FEAA 3OCWA 2B0CA 4GXTA 5ALSA 2HX1A 4YCLA 5AI6A 5ALFA 4YH1A 3S6JA 5IT0A 2GHQA 4J2TA 3QU2A 4DWOA 5ALJA 3OPXA 2Q4TA 1RMTA 1Z4QA 4QQFA 1NF2A 1RMYA 5AVVA 3ZU6A 4OHFA 1T5SA 4NFLA 3D6JA 2ZG6A 1KYTA 4L6CA 2B1RA 4UMEA 4OD0A 2HDOA 3U13A 3PCTA 2WF7A 2G0AA 5AK3A 1ZS9A 4EELA 4G9BA 2Q4RA 4HGOA 3B8EA 3AR3A 5A3QA 3AR7A 4G63A 5AK5A 2R8EA 3NIWA 5ALZA 4B6JA 3E81A 3QU5A 4EEKA 3MN1A 3QUCA 5AKZA 1Q91A 5AHXA 3KDPA 2P27A 1Z4PX 3M1YA 5AVUA 3A1DA 1TE2A 2WF6A 2ZOSA 3M9LA 2RBKA 1WVIA 4KNVA 4UU1A 3AR8A 2ZBGA 3OCVA 1ZD2P 5AKIA 3NAMA 3QX7A 2OM6A 5ALUA 5AVYA 3OCYA 3OTQA 4HAIA 4DFDA 2JAUA 5FP0A 1LVHA 3N1UA 1T9ZA 2ZXEA 4MUMA 4CNQA 1RLOA 2QLTA 3W5DA 4J03A 5AKGA 3WK9A 2CFSA 2JGAA 2AUTA 3ED5A 3IJ5A 4OFZA 3ZVNA 2JAOA 3ZX5A 3AR2A 1U2TA 3ZI4A 2EATA 1ZD4A 1X42A 1Z4KA 3FPSA 2NYVA 1Z5UA 2RAVA 1EK1A 5ALOA 3ET5A 4Y3UA 5AVXA 4BX3A 1L8LA 3WK7A 1SWVA 1SU4A 2C9MA 1O03A 3BA6A 5AM4A 3QNMA 2JARA 2FUCA 4Y2TA 2WHEA 2I34A 1PW5A 4UW9A 4EZEA 3WK5A 3N28A 1RDFA 5AKXA 2D2VA 2MU1A 5AW0A 2YJ4A 2HHLA 5A3RA 3SLRA 4UM5A 4KN8A 3N5KA 4XQ0A 2NO5A 4EX7A 1ZRMA 2IOHA 3A1CA 4XE5A 2B8JA 3B9RA 1Q92A 3P96A 1Z4NA 4IFTA 2GO7A 3L1UA 1K1EA 2IA5A 5ALEA 2FUEA 2HOQA 3DNPA 3ZUPA 2FPRA 2C8KA 2BDEA 3CNHA 1QQ5A 3UMGA 4UU0A 2G1AA 2AH5A 1RPZA 3L8GA 3L7YA 3QUQA 4UMFA 5ALRA 2G09A 1L7NA 1U7OA 4C4RA 5AW2A 1WZCA 4XOUA 1MH9A 3RFUA 1CQZA 2R8ZA 3QLEA 4UASA 1QH9A 4DCCA 4CF5A 2YJ5A 2HCFA 2GHTA 1Z88A 4Y2SA 1Z4OA 3J7TA 3SMVA 3SKYA 5AW1A 3EWIA 1Z4MA 3AR5A 2WF5A 1XVIA 5AM0A 5ALNA 1YMQA 4BYGA 1RRCA 3I6BA 5AI4A 3WKDA 4NV0A 3ZW7A 5AK6A 2AMYA 2BY4A 3NRJA 4JB3A 1N8NA 4OCZA 1IWOA 1L8OA 1TJ5A 3E8MA 1TJ3A 4BEVA 5AKHA 2WF9A 5ALGA 4NAVA 2RARA 2GFHA 3N07A 3ZVLA 3K1ZA 5ALLA 3U19A 3F9RA 3EF1A 5ALHA 1TA0A 3L0CA 1LTQA 4F72A 4YIKA 3QGMA 3UMBA 4ZEVA 3TLMA 3QUBA 2YY6A 3UMCA 3FM9A 5AK4A 3SKXA 3I1YA 4BKMA 5AI5A 5AKYA 5AM3A 5AW8A 2PR7A 1VFPA 2W43A 3WKAA 2CFRA 1F5SA 3L8FA 4MWOA 5ALDA 5IT4A 3W5CA 4HGPA 1ZD5A 2ZBEA 5ALVA 1WPGA 1J97A 2C4NA 2HO4A 2I6XA 4Y2QA 5AVZA 5AW6A 4BNDA 3QU7A 4UMVA 5ALIA 3DAOA 1VJ5A 4CE6A 2B30A 2YBDA 4RETA 2P69A 1Z4LA 2WF8A 3A1EA 3NALA 1AQ6A 5AVRA 3WGVA 2HEGA 1U2SA 4UAVA 5ALYA 1ZRNA 4H1WA 3IRUA 3UM9A 4BX2A 1S2OA 1RMQA 3QXGA 3VAYA 4Y2JA 1Z4IA 2FPUA 1XPJA 3ET4A 3EPRA 3RF6A 5AVSA 2AGVA 5AESA 1Z5GA 5AKJA 3FVVA 2IYEA 3L5KA 1RQLA 4C4SA 3SHQA 5ALWA 3W5AA 4XPZA 5AI8A 3U7GA 2RB5A 5AVWA 2FI1A 1CR6A 5AVQA 2OYCA 3NANA 4Y2PA 2IOFK 5T41A 3ZX4A 3MMZA 4AS3A 3KOOA 1L6RA 3CZ4A 3IB6A 4HGNA 4I9GA 1YV9A 5ALKA 2PQ0A 3QUTA 2FPSA 3PGLA 3AR4A 3OCUA 3HYCA 4UM7A 4KX3A 1L7OA 3KD3A 4UMDA 1FEZA 4E88A 3KZXA 5AW9A 3GYGA 4HGQA 2WM8A 2W4MA 1VJRA 4F71A 2OA0A 2X4DA 2P9JA 3FPBA 1RKUA 3R9KA 1RC8A 1ZJJA 5AKLA 5AM2A 5ALPA 5AW5A 3A3YA 4PNHA 1T5TA 2HF7A 4FYPA 4JDPA 2I7DA 5AKEA 2YMPA 1U02A 2HF2A 4NWIA 2YN4A 3QU4A 4EX6A 5AW7A 4RESA 2BDUA 4KYTA
chains in the Genus database with same CATH superfamily
2VPYA 3LYSA 1OYWA 2FWIA 2VH5R 3ZWDA 3EOZA 3BORA 2DLCX 1LPOA 2ZYHA 4I08A 1OXMA 3CP8A 1V96A 3W6OA 4NBNA 5C35A 1BZYA 4RD2A 4EKEA 2X0KA 4LTDA 1AKUA 1F2UB 4WZZA 5AVTA 1RW4A 4NG5A 1SC1A 3IDQA 2HHHB 3HO1A 4P93A 1PQUA 3A8TA 2X0IA 3D4IA 4FDMA 4DFPA 3E03A 2EIXA 2H2HA 4QO8A 4LDRA 4NENA 4FMCB 3I76A 2Z56A 3HZHA 2HHWA 2ZWVA 4QWCA 2W3SA 1P4JA 5KHOC 4DM3A 1SUEA 1XZAA 4L08A 2W37A 4WBSA 2E8PA 3VKGA 5A4IS 1IOLA 3PC6A 3TPZA 2CB0A 1YZFA 4N49A 5LC1A 1U3VA 2G04A 3TO5A 4K4GA 3EJ6A 1FNMA 1K7EB 2CB9A 2FR1A 1YOVA 4E21A 1PK8A 4Z7QB 3SSAA 2JLUA 1CK4A 4PV7A 1XMPA 4U2CA 3DHYA 4IEIA 3ZWVA 1E0SA 5FI5A 4UBCA 2E7ZA 3S2ZA 4P3NA 3JAMA 3EC7A 2AJLI 4GYJA 3STYA 2XLBA 4PGAA 4BNUA 2NZ8A 4NZPA 4WADA 3E7FA 7ADHA 3K70C 3UUGA 5K0JA 2PUCA 4IFIA 1DELA 5BN5A 1XFAA 3MJHA 1SC4A 1W5FA 2G5TA 2WHPB 4GYKA 4IQGA 2R25B 4HKTA 4BMXA 1W1UA 2VXBA 1V25A 2JIBA 5K3FA 4I5EA 2HBKA 2YDYA 2YQZA 2NG1A 3KPWA 2GXSA 1Q17A 4R7TA 4GC5A 3GPDG 1Y9DA 3KLBA 3KT6A 2PD3A 4RYLA 3RVBA 3UB4A 4TKUA 1DAPA 3S1AA 2ZRIA 3HJAA 2RAUA 1PVRA 2GHRA 3GDFA 3H8MA 1VMDA 2H4YA 1JILA 4RQAA 5KT5A 5ER9A 1N5OX 4QGAA 1T9CA 3V2HA 4UW9A 2H7VA 1DAMA 2Z08A 3LUCA 4AJKA 2VPXA 1GTVA 4U6NA 5H70A 3JPYA 4PQGA 4O1HA 4I4NA 3ESZA 2QMZA 4GOOD 3BSSA 4YP0A 3ZCSA 4JOCA 4KQKA 3TGLA 2ZPTX 3CNHA 2IMWP 3E35A 2C57A 2FN8A 5AJYA 1F2DA 2D3WA 2W03A 3CYMA 4MFAA 3F49S 4GE0A 3JZMA 5KNLA 4JLUA 3V46A 2ECQA 2AE1A 3PSHA 5ESXA 4LZZA 4BNWA 4MRSA 4OP1A 4FDUA 4B46A 4JD5A 4OUDB 2FZ4A 3KYJB 2QMEA 4P4UA 2O07A 3USCS 4Q4DA 5CYOA 3C8MA 1K8RA 3G17A 3K4GA 1E5VA 2R97A 3STTA 1B74A 1A50B 1VMKA 1WL8A 2D3DA 1Z1VA 5BY2A 2BH9A 1D8AA 4QFMA 2OT3B 4QUHA 4LJXA 3EN0A 1Z4LA 4FOTA 4KQ2A 1T2CA 4AJLA 3O83A 4EJ6A 4UAVA 1WCV1 3T4EA 4UB2A 3TR5A 3W9YA 1KHHA 1YR1A 3SAFA 2J4DA 3KR2A 2A5JA 1JYEA 4IF6A 2B6GA 4LXGA 2P2DA 3OF5A 2AJTA 4X24A 5C3MA 4MQ4A 1FSZA 1F0NA 4HD8A 4DQUA 2ZBVA 1F17A 2G17A 4OQEA 3IE2A 4EI9A 1QKJA 1ZMXA 4US0R 3UT0A 4ZCIA 1EK0A 1FS4A 3DT6A 3NIDB 2QE7D 4R1SA 5B12A 4WUVA 1NASA 4ETWA 2VJPA 3IPRA 2G1JA 4LRUA 2XYRA 2R5WA 5IDVA 3LXRA 4QREA 1NYQA 3HUEA 1SL2A 2EERA 2Y9MB 5BW5A 2ERXA 2GF2A 2QE7A 5B1SA 4DDWA 2FX3A 2HA4A 5BSTA 4WKGA 2A7QA 4EA6A 1H4QA 3G5AA 4CL8A 3B9BA 1OYYA 5H7XA 3U80A 4ZQIA 4HV4A 3ZNOA 3KR1A 2MSNA 1J0BA 3QBEA 2WWWA 4K81B 1Z6ZA 5CVDA 1Z68A 3T1HB 2F8KA 3TMAA 3ONDA 4QBFA 1MT3A 3ENNA 1M6YA 1Q15A 3HLYA 4KR6A 3CUWA 3KDAA 1JXEA 4RQ2A 1GD1O 3GGJA 4B44A 5C1OA 4G5HA 4DSOA 4HXGA 3K20A 2JK1A 3SN6A 3FDJA 5J2IA 4GBJA 2E21A 2QW0X 2E3TA 1NK7A 3DDZX 4Q00A 4U7WA 4I9HA 1TM1E 3OX3A 4NE9A 2JH9A 3ELBA 1G5PA 2GN4A 3PITA 1SXJB 3BFPA 3KHHA 2P9FA 4EJSB 4K6MA 4KLSA 1Q7EA 5IIOA 2XWSA 1T4MA 1O54A 2QZJA 4RH0A 2XE8A 3FSEA 1DCTA 5IFKA 1ZM9A 2OB1A 4J7XA 3RIMA 1NY5A 1KRWA 1T6XA 3QUAA 4LGCA 1G59A 1N0UA 1KL9A 4AZWA 3PNLA 1B43A 3B82A 3JZDA 3H2ZA 1KY3A 1NN5A 4OXKA 4WKBA 1PQYA 4Z2AA 1LJ8A 4WW0A 3LWDA 2WMYA 2RHBA 3HA3A 1NFFA 2KJQA 5G5HA 2R8KA 4X44A 3NMUF 3OHMA 3TM5A 2X0NA 3KXKA 4WKOA 4KIGA 4L16A 2Y66A 1NNEA 2XNSA 1U2GC 1ZEJA 1JSCA 3JQAB 4OGFA 1EFVA 2IH5A 3BGDA 1KN5A 3JD1A 2BZSA 1R4ZA 5CVTA 4BP3A 1P1RA 5ICCA 4IICA 3FCYA 4YV0A 1YR3A 3GV8B 1ST2A 1KJ9A 3E81A 4D9MA 2X5XA 3C21A 3HPOA 4WE3A 3EYWA 2EZ4A 3DULA 3WLFA 1PJ8A 2HBQA 1SJ9A 3JSXA 1NVVR 1H9BA 5FPHA 1U2QA 2MMCA 3NAMA 1P62B 4KPEC 2BCGY 1MOSA 3N1UA 3VSBA 2YXEA 4UXHA 1K2WA 3LG2A 4XGKA 1A2KC 2QW1A 3U7JA 4NV1A 3KZKA 1O6GA 4Q9NA 2AFVA 1AB5A 3ZY6A 5DZSA 4YHHB 3W5IA 3AJRA 5BOVA 4PWZA 2I6SA 3RUPA 4MLZA 2J5QA 2VATA 3AEYA 5E38A 4NCHA 3NUGA 2C7RA 3V7KA 4DJAA 1JAHA 4G1UC 3EAQA 1UJ2A 1YL5A 1OROA 1T0JB 4YONB 4RV9A 4B32A 4G2TA 1MU0A 3DNPA 1YZHA 5H1YA 2AMLA 1OLSA 2Z4TA 1ETUA 4MXDA 5KPDA 2B7CA 4PSKA 2QZ9A 1N78A 4HPWA 2ZI4A 5JS6A 2ONJA 4EPWA 5THQA 2DQ4A 2R84A 3TCKA 1RWOA 3IIEA 1TJ5A 3ZDAA 3ROPA 3BMOA 5CVVA 1O5IA 3AUTA 4CZ2A 5T14A 3PFKA 2FEPA 2A9JA 3Q85A 4TT8A 2Q1SA 4Y7DA 2YJGA 1SR8A 1UIRA 5M7EA 5AHKA 1I24A 1B0UA 1B00A 2WUFA 4PRKA 5GVSA 2V7QD 3K8YA 3DH0A 2PO7A 3JQ9C 1JEOA 3C2LA 2UZAA 4UMVA 1FMLA 1T9KA 3P9XA 2ODQA 3ZGYA 3BIWA 2V7QA 1M2FA 1GYRA 4QASA 3B60A 2KZMA 3D6AA 4LN1A 5CJ2A 1W4BA 1OGJA 3PTZA 3WIEA 3A58B 3JW8A 2K87A 1UM9A 2IODA 3ES9A 1YRYE 4PYLA 3MHPA 4KLEA 3VR3D 3GFOA 1T8PA 5JDCC 3CPSA 2VHTA 1NXWA 5C37A 5IJAA 1GGHA 3VR3A 4NC9A 3TZHA 2L82A 4O4LB 3KPVA 2GRAA 1K9VF 1QYRA 3NDJA 3A6ZA 4EK9A 4DOBA 1LDNA 1CSEE 3EFOA 4CMGA 3H1BA 3WXBA 1EWQA 3IC5A 3AESB 1F0MA 1FFBA 2BD0A 2X3YA 4EZ9A 2DE0X 2ZYWX 1GCAA 5B4UA 3DAYA 3H4MA 2V0NA 1NZFA 1GKKA 4ESVA 4HZGA 1NXSA 4TWZA 1F48A 1R6VA 1QPBA 1PI3A 3H0LB 1KZ7B 5DJ5A 1NSTA 4O4HA 2HK6A 1S9FA 1KDTA 2Z3VA 2XF2A 5KS2A 4G0ZA 2I1WA 2VTBB 2LKCA 1AN9A 5AKKA 3DMFA 3UG6A 4Q39A 3OE4A 3LQ2A 4WK2B 1WB5A 3AUKA 5FKJA 1QC5A 5C8VA 2G83A 4BFZA 4QPJC 1J06A 3FNHA 4X61A 4J1TA 3FWHA 4O3OA 4DRXA 1D2RA 3KYCA 2EW8A 4MPPA 2J30A 4EEXA 1R4NB 2AFIA 2BKVA 3R6WA 1KETA 1DOHA 4PHAA 3AKDA 1A72A 3IJEB 4MITA 1E3EA 2QTAA 1ESNA 2ORIA 2IOFA 2F67A 3VX4A 5KTRA 2L18A 3U4HA 2W11A 4JBGA 2QTCA 2XB4A 1Y9EA 2DQYA 2WYHA 3M2TA 3HP7A 4IKEA 1CDZA 3AFOA 1U9LA 1TUBB 1ED1A 1Y3DE 4YMGA 4BQSA 1J5PA 1FIUA 1T1JA 4ZODA 2RGDA 2IPNA 2ONCA 4I4CA 5TC4A 3BDVA 4YXFA 3GELA 1W6RA 4YJGB 3KZNA 4YH1A 2Z4RA 1UA0A 3EHEA 1WD5A 2HXYA 1RIIA 3VDXA 3LECA 1LKZA 4FHEA 4AG5A 1N2SA 3HCNA 2HDOA 3VO1A 1Q1EA 2CVZA 2O2IA 5AK3A 3ACCA 3TECE 3U3MA 3ANLA 3Q72A 1H1TA 3I30X 2WHYA 3IBCA 3ML1A 4RTLA 3FVTA 2GESA 3V42A 4LQ4A 4DYVA 2GPNA 1HQKA 4LV5B 2AGQA 2QPTA 3RD5A 2ID8A 5D51S 4M36A 1LVHA 3AIOA 1QRUA 9ICWA 1BXGA 1O57A 1BMFD 1Q0SA 2W9BB 5FQOA 1HT3A 2B92A 2P5TB 4AF6A 3I01M 2Q9CA 1EK1A 4ZOBA 1KOGA 2I87A 2WMDA 1R8YA 1SU4A 1GLGA 1LZKA 1BMFA 1Z7WA 3C3BA 3HGQA 1N5XA 5KWJA 1V8PA 2EQBA 1PT8A 1AXRA 1TK9A 5E7QA 1BWPA 1RDFA 2GA9A 4C89A 1IN6A 4YJHB 1A8UA 4IYJA 3DC7A 2F1JA 2DKFA 3GEIA 3E05A 3S7ZA 2J9GA 4DQQA 1BMQA 4XX0B 1FVFA 2V97A 3FW1A 3UHOA 2DHCA 5DLEA 3S99A 3PX0A 3IXMA 3LBAA 4FHDA 4F5YA 2KKPA 3KKOA 2J5KA 3DUWA 4HEJA 2I22A 2B1IA 3SF8A 5G4KA 1XDWA 2CJFA 3OIGA 3SIRA 5DCLA 3ZVRA 2R1VA 4MW4A 4CKWA 4GRIA 1XSLA 2R7KA 5TQ2A 3NW9A 5LM3A 1CDDA 5HR6A 4ETMA 1AE1A 3GJ8A 3KOYA 1IG3A 1ADYA 2ZRFA 5IVKA 1CQIB 2A86A 2A9PA 3T35A 3GH1A 1QYXA 2XY5A 3L7BA 3U9LA 1H66A 9ICBA 1ZRNA 3R0ZA 4P3PA 3H5AA 3JQ8A 4N7RA 2ZWAA 4X90A 4O3SA 5BP7A 3VOAA 1SM4A 2QP9X 7MDHA 2DTEA 3KR0A 3NVKI 3O4IA 3C3PA 4DDVA 3RJ9A 4MUXA 4R05A 4L9AA 5H83A 2AXEA 5GONA 3OCUA 4CM6A 3V9PA 4FWTA 1Z38A 3TMKA 3WL6A 2YFHA 3ICVA 5LD2B 1RABA 1KJQA 1DEXA 5FNVF 4NBLA 4EMUA 4GI2A 3L82B 1ZEMA 1T3HA 1RWVA 5HQ3A 4PZCA 4IY1A 1ZCAA 4JP1A 3FMGA 2QPOA 4TKMA 2GOYA 3RC2A 3KBBA 4MHOA 1Q44A 5IBRA 1PX0A 2JLYA 4US1R 2I8CA 4KXLA 4C6TB 4DJTA 4W9MC 4E1BA 5L3SA 1O77A 4AZ3A 2FE1A 3WJ7A 3THXA 1P3Y1 3K1TA 2ZAYA 3H7AA 3RUIA 1KFTA 4H6WA 4CL3A 3FOEC 3U2QA 5JG7A 4BFLA 3CUYA 4CRXA 3ZKAA 3SV4A 2NIPA 4URXR 2MSWA 5DTJA 3WNZA 4KRYA 1W75A 2HRRA 3Q7PA 3A3OA 4ND8B 2AJDA 4LFAB 2YV5A 3BK7A 5AFSA 3EK2A 4D46A 3C3KA 3WWYA 2K7FA 2GASA 3PNVA 5LYYA 3PW5A 3V1LA 1KQGA 2Z2IA 4UOZA 3B20A 1MRZA 3QMMA 4XVCA 3LYHA 1WY7A 5NULA 4PICA 2WT4A 4NZ9A 3GT0A 2Q9BA 4MF2A 1NN1A 4N76A 1A82A 1KQ3A 2QX6A 4YALA 2YTZA 5LVAA 1O96A 3UAOA 5DGTA 2FEMA 4DS3A 1FXWA 5AK0A 4P3KA 1NURA 2VT3A 3KKQA 2FQWA 4WXYB 1ONOA 1MO2A 4HWGA 1ZXXA 4HLNA 1R66A 2F44A 4U6PA 3D5EA 4RVSA 3LUPA 5FTJA 2JCYA 2OHXA 1QXSA 2OFFA 3GP8A 2P30A 1GAXA 1BYIA 2OHOA 2YVQA 1CJMA 3AI7A 5EWJB 2GI4A 5HILA 2H4JA 3ZJ4A 2VSQA 4LTNA 2XF8A 2IH4A 4PQFA 1OSNA 4AX8A 1S89A 3AUOA 1P29A 3TQ1A 4ZJZA 3D31A 4B6OA 2RBEA 2HDNB 2O1EA 1RM6C 3W5DA 1QVZA 2A67A 3FKQA 1D8YA 3L7JA 2WIFA 1HDEA 1L4BA 4IJMA 1XCBA 4WMLA 1JVBA 2JLQA 1VE1A 3FHOA 5JNTA 1LS6A 3IR5A 5KOJA 2ZS7A 1XCMA 3QNMA 4KW7A 3WGZA 1SA0B 2YWEA 1MC1A 3I9LA 3IAS1 1T9GS 4U7HA 3KT0A 4IMRA 2PZBA 4NS1A 4KHPB 2B4YA 1X0XA 1F14A 3KSBC 4S1WA 5I45A 2QUKA 1KBOA 5ALRA 2G3YA 4KWEA 8ICJA 4WQMA 5JV5A 1EPUA 3OF2A 4DDMA 4LJLA 5B4TA 2P75A 3KQKA 2GFHA 1FYDA 4D9IA 2Z2KA 4DJFC 1J2MA 5E3IA 1KZGB 3UMBA 4RANA 1MAWA 2KD1A 5ITWA 1GG9A 4JC8A 2BFBA 4FWIB 3RC7A 4IO0A 1DV1A 3KJEA 1N6IA 3RSHA 2XB6A 3NVAA 4BO3A 1Z3EB 3RC8A 3OC6A 1X77A 1JP7A 2HIGA 1YC2A 1RWMA 2EKQA 1CY0A 4QU5A 1C20A 3RKUA 4WZBA 4PGXA 4OUKX 4LJ7A 4DIFA 4FEAA 3HACA 3OLXA 3FUTA 4H1WA 4TSRA 1N4DA 1PX2A 3H8JA 3IOYA 4FDLA 2A2ZA 3EZNA 2ZWPA 2A5DA 4D97A 4C3OB 2C5EA 1LI4A 1L4NA 3WJAA 1VL1A 4YMTA 1C0KA 4BVKA 2AX4A 3Q10A 3KD3A 1ZQPA 4CMEC 3GYGA 1JLHA 5I7OA 3VZRA 3SDSA 2ZYGA 5EKUA 4GL4A 2QQ0A 4RT2A 3IPLA 5ARCA 2Q1WA 4IGAA 4G84A 4YMSA 1AGPA 1PR3A 3EF3A 1RHQA 4LZNA 3A1SA 5B2EA 2YFKA 2QVBA 3USES 2PIAA 3D4LA 5C31A 3UT5A 4ML3A 4X97A 2DEUA 1A2OA 4HQ0A 4PRZA 3AHDA 1BQEA 2FN9A 4JVMA 4M0FA 3ZJYA 4RZIA 3UJBA 2OXOA 1T3GA 1FOEB 2VAXA 4M47A 1F60A 3AIKA 5IBCA 1B8VA 4ZCLA 1NI5A 3A14A 1PZHA 1UXOA 4ESEA 3K4PA 2G9RA 2FXIA 5BUCA 8GPBA 3D8TA 5JS7A 4D26A 1TV9A 2FDRA 1MDBA 1CRZA 4Y2RA 1KQPA 3WMXA 2QBYA 1TIBA 4H6PA 4FE7A 2AMFA 2YXPX 1A7KA 3L8YA 2P7IA 5IWAB 1H93A 4NLZA 3PVZA 4XWTA 5IDQA 5K1ZA 5JAZA 5FBQB 2QN7A 2VP2A 4DLTA 2GN9A 2WIAA 2H8KA 4II2A 4B3BA 4JI4B 1KKLA 1W4ZA 1K97A 3N8IA 1T9DA 1Q14A 5C9ZA 2ADOA 4G07A 3X1DA 4UU7A 4YRMA 4ALLA 4E32A 1T1IA 3U0BA 1U0RA 2VP4A 2CV0A 2QNRA 3FNEA 3INYA 4UCWA 4EJFA 2Q4RA 4AZVA 1EVJA 4BQFA 1OZHA 3RFFA 3BE5A 5KTKA 4ZGGA 4ED3A 3NKFA 2VPZA 4A36A 3JSAA 3L92A 2F00A 5CA1F 2O19A 1S4MA 2RBKA 1QYDA 3KT3A 4TLCA 4OHWA 5JRJA 1U7DA 5JAPA 5E79U 3JQEA 4UQLA 1HE3A 3QX8A 1NBHA 4AUMA 3ORYA 2LTAA 4KLHA 3VVCA 2ZXEA 3OZCA 3DZHA 7ICKA 1R9MA 2FH5B 2QIOA 2DPJA 3P2JA 1ORWA 3ET5A 4V1CA 1PVPA 4LOIA 4Y2TA 4K05A 2HA2A 3TEJA 5K5EA 2J07A 5CBKA 2OV8A 1NC1A 1G6Q1 3EZGA 1CUWA 4FEYA 3ROZA 2QHXA 4R4JA 4QJIA 2ZRNA 1WUTA 3BIXA 2JGLA 1JJIA 1U0JA 1U7OA 3DT8A 1SUBA 2I2CA 3RT1A 4I8XA 5EJ7A 3R3YA 3LWMA 1DIRA 4IHJB 2ZVJA 5EHNA 1DAHA 4B3XA 4P86A 4FYYA 3LFHA 1Z6AA 1Z18A 4F5PA 2CHEA 4N5NA 5LQJA 3O92A 5IAEA 1OPXA 3FBGA 3M6IA 4OMDA 1II8A 1GGVA 2VS1A 2BFDA 2G5IB 2I2AA 5KFQA 1PK1A 3HP1A 4A27A 3OEHD 3B7GA 4JYMA 4L51A 5LU8A 4HAVA 2XE7A 1ZNXA 3QH4A 1JDTA 1BD4A 3HKCB 3STUA 4Q01A 1J07A 1FTYA 3CX6A 5JD4A 3OEHA 4QLAA 1I1QB 2FDCA 1XVVA 4R7ZA 5BYAA 3ZCPA 3U4QB 1JDJA 1CE8A 1WUHS 4B34A 1VKRA 3A1EA 1FYXA 1UBJS 2UAGA 2PL1A 3A6KA 3GPIA 1B15A 3D7LA 3K1JA 3EYZA 3HDHA 1E0DA 1KPHA 1BFDA 3H4TA 3O75A 3FOAA 5DLGA 3U39A 3L5KA 1YF3A 3USZA 1LK7A 5H68A 4YG2A 3CCCA 3GEBA 1C3OB 4BLTA 3N0WA 4Q9LA 1L5HB 4W9NA 3IB6A 1VBKA 4V03A 1EFDN 2AC4A 1DX6A 4G0PA 5CRIA 2ZDHA 1H1LA 2N47A 1TK5A 4LOJA 4NK4A 5TLSA 2QUZA 1AQUA 5C7YA 2WWRA 5HIJA 3SGLA 5K51A 1JIXA 4U2DA 5JTUA 3LY5A 5B3JA 3KB1A 1ZM2A 3GQBB 4W8GA 4QVGA 1V5GA 2PGAA 2I2DA 1WCYA 4EYIB 2I55A 3TB6A 1B3BA 4RCVA 3UW1A 3SDZA 1Q7RA 1F0KA 4YT5A 2IBTA 2J67A 3IG5A 1FNNA 4IIHA 4LYHA 3LPLA 4EI8A 4TUQA 4RGVA 1MCZA 2Z2YA 4WNAB 2VH1A 5F1KA 4FD3A 4CF3A 5JE8A 5J2FA 2OPHA 1HDCA 3AY0A 1QHHA 1ECJA 4OQ4A 3GLRA 4S12A 5C7OO 3T3HA 4ZZ1A 4HTFB 4EF5A 4J0DA 4C4TA 1C1DB 2WZBA 4J49A 3H6KA 3TW4A 5FPPA 3VRHA 3WYBA 3OOHA 1X1AA 3UJPA 3IHTA 4ZVOA 1SPXA 4IIBA 5FT9A 3L8MA 2Z98A 4MICA 2WE7A 3IAM6 4HDRB 5AOVA 2XD9A 2RRDA 2IYWA 2JCGA 4PO3X 2VNJA 3JQBC 3FCOA 2RC6A 3OZXA 1SIOA 7ICMA 2ZBRA 2RH4A 3LHIA 3SQMA 1S2GA 3STXA 4F9EA 4F5OA 4YA6A 3THYA 3V5NA 3UB2A 1PGQA 5WRFA 1SB8A 2DQSA 3GFPA 2UU9B 1EA5A 4XWYA 3SEIA 4O25A 3KKPA 3Q6IA 5CLLA 3TTSA 4EZBA 1OOEA 4ITRC 2ZE5A 4W63A 1Q1GA 1MZPA 4OHFA 1NMYA 3L0ZA 1K9SA 3NXSA 3WYEA 4F4XA 2HHUA 1TO6A 2C3MA 3BREA 2ZITA 1AKYA 3WAJA 1AU9A 1N2CB 2QRPA 3GZ4A 3TZCA 1UK9A 1JKXA 4GWKA 2B36A 3RS9A 1N3LA 4QG3A 3CNLA 2P9HA 3O84A 2WAYA 1S10A 5T64A 3UUWA 2XOKD 2QYSA 8OHMA 4D41A 2AUTA 1MB3A 4BP8A 1U2TA 2XAAA 2CUKA 3ROQA 3AETB 2XAUA 3PUKA 3LKVA 4F3OA 4INZA 4ZV9A 2XDYA 2XOKA 3QNUA 2W4QA 4EA8A 4M6WA 1WXFA 1X1BA 4NFYA 1T1RA 1YKSA 3AM9A 5HVNA 1EESA 2A92A 3A1CA 2MR6A 3JWGA 4XRRA 4W6QA 5E3JA 1L3UA 4PPGA 2BDEA 4ZMRA 2NU6B 3AXSA 3BFJA 3RH0A 3Q41A 3RFVA 2EZTA 1ZQWA 3D6FA 1U8CB 4YFKA 1HV8A 1G20A 1N6LA 2X9QA 5FBWB 2PANA 1QO0D 3QQ5A 3SMVA 1NVWQ 3NDRA 4WZAA 2HBLA 2XDQA 3NHMA 3QE4A 4AIRA 1NG1A 3C5VA 3K9CA 4DCGA 2NAPA 3TXYA 3ZV6A 1SBCA 3Q12A 4V02A 1F8FA 2DLNA 4TVSA 1CF9A 1KAOA 5J43A 2PH3A 4C0BA 4RD1A 2XQKA 5SYMA 4TVKA 1ULBA 2H3FA 1TO1E 4HQOA 5ESWA 2CLHB 3KFLA 1NSFA 1XAJA 2PLRA 3VPXA 1ADBA 3L4BA 4C4OA 5EE9A 4CHTA 2Y9PB 4CQJA 4RTJA 4RDCA 5DQGA 1EYZA 1M34B 1N34B 1ZD5A 2JGFA 4RPCA 1VJCA 3LPCA 2Q2OA 4M8KA 1AUQA 2AYYA 3TCXB 3PLNA 1FDWA 3IURA 3N8NA 2YN0A 1AQ6A 1W96A 1WZ2A 1U2RA 1J09A 4FFNA 4F06A 4X62B 4D9EA 2IZ6A 3MPUA 5C5IA 4NHEA 1V9CA 4HDMA 2Z9CA 1KLNA 1JE1A 3WO1A 4MWTA 2AE2A 1PJCA 5DKWA 5JEEA 1VI2A 1G3MA 1Q0RA 4GPD1 4JJKA 1KQOA 2JVJA 2FLWA 3O8RA 2J33A 2UZ4A 1I3MA 3EVAA 4AJHA 4IIJB 4BZQA 3UJCA 1LBSA 4YRCA 5FBKA 1UKBA 5AW7A 3IQFA 3T5GA 5A4JA 2ZU6A 5DB7A 1NMSA 1DEOA 3O3CA 1DKPA 2V6MA 2PRSA 4RNOA 4RNNA 4R63A 5JQGF 4X64B 2KVSA 3BMQB 4AW9A 4ZN6A 5IJ9A 3VYSB 1QVWA 3NT4A 4R9NA 2P4HX 1X38A 4C06A 2I76A 3FNRA 3JPTA 1H6DA 1R00A 2B3TA 1ISRA 4D6YA 2R7LA 3WGUA 3FAZA 3ZCRA 3A6HA 3FC4A 2W9CA 4MRPA 4R84A 1V5EA 3JWEA 3WP1B 4PS1A 3ESRA 1IY2A 1QYCA 3OFND 2G08A 2A19A 1ZH0A 4M9RA 1IOVA 4NATA 3HVUA 3PNMA 4J7AA 3AJ9A 3DP9A 4O2BF 2P2YA 1DTWB 1PW7A 4IVPA 2AMVA 1O6ZA 3L0OA 4N65A 3ZE8A 4F86A 2H31A 3WISA 3OFNA 1FDTA 1T29A 4LJ8A 1ZICA 2PXCA 1L7PA 1SPBS 3B9PA 4D0RA 1W0KD 4IS7A 1EFUA 1C0EA 2F3RA 3T5LA 4HAUA 1UC5B 4JMLA 1GHTA 5FJJA 1PNTA 1YE3A 5F5LA 2IEZA 3GLHE 4Q9JA 4H3VA 1W0KA 5LLDA 3F7MA 2XT6A 1QRAA 4U0JA 5JAMA 2IYTA 4HBZA 5G3YA 1OGYA 1QYWA 3M6ZA 4YR0A 2V98A 4LJ6A 3CW9A 3PVXA 3D3WB 3HXOA 1WOYA 3KLOA 1ID8A 1KQQA 4DLGA 1OI2A 2FR0A 4Q47A 1YIOA 2FCAA 3AEVA 4JUDX 3LM8A 1IQRA 2OYSA 3A6LA 1ZS9A 3HVJA 1Y1SA 4XH9B 4A2PA 2A0FA 3JYHA 1DKNA 5E3HA 3M33A 3Q3EA 2VF2A 4LWQA 4A26A 1W76A 2HB6A 1NBIA 2M98A 5BVHB 1M1UA 1QQAA 1FX1A 3DFKA 5MN5A 1BSVA 3SS7X 1Q3KA 3G0GA 2ROQA 4DNOA 3G9UA 4Q21A 1S1CA 3TRDA 1MJGM 2ONZA 5BMVB 2OHVA 5DTEA 5IEBA 5KYTA 3HY4A 1WCIA 1TKBA 1VLJA 1C7YA 3H1PA 4HB4A 4EBDA 4EYOA 2GJ9A 2W2KA 5J2AA 1QKIA 1XTIA 3VUEA 2NRWA 3LT2A 4BO0A 2JCSA 2REQB 1ZINA 3FI9A 2AOWA 4B84A 1GFIA 3QVVA 2G1AA 4AROA 2W6MA 1QGUA 3AL0C 3HFSA 2HT6A 4IBOA 2Q1XA 5K6RA 1JQAA 3TQOA 3EQ2A 3I5MA 4WDQA 2WKPA 3IILA 3TL6A 3DXZA 3LZDA 4OL9A 4Q18A 2J85A 5LBUA 1C7EA 1A5SB 1DGQA 5AI4A 4MWSA 3NBZC 5JC1A 3OZEA 4H7EA 5CG1A 4J0HA 4HY3A 5CB8A 3OT5A 3W77A 4PZUA 1TC2A 1QGAA 4JXKA 2NLOA 2JLWA 4TQSA 3C5WP 3HXKA 4FVTA 4A0HA 3B9QA 4ZEVA 2O2ZA 1RIFA 3UMCA 3N58A 4UHKA 4AJ9A 2C2HA 1YAJA 2LMRA 3KHGA 1HSZA 4UEOA 2OWOA 2HF9A 1KMMA 4DQXA 1JLRA 5BSFA 5DTRA 4M7PA 2V5VA 2Q3LA 1RFGE 5I4BA 4MGZR 4KXQA 3GIIA 1QIKA 1Z6GA 4NG4A 2H11A 8ICTA 2YC2C 2ZTDA 3NALA 3HB9A 5DBHX 3WLJA 3IP3A 4I55B 5MHTA 1E3WB 2I2XB 3A06A 3AF3A 3NIFB 4EM6A 3LFTA 3R7LA 4N3NA 1JAZA 3T3FA 3V1MA 3CEHA 1Y5LA 1SQFA 2LD4A 4R8SA 3DMHA 2N42A 4R8UA 3OEYA 3QPBA 3FGZA 3V4FA 2VSNA 1SKYE 2BCJQ 2A3RA 4MO2A 1FFSA 5JBIA 2ZIEA 1UFKA 4JYPA 1U2DA 1P4SA 1RBYA 4QWAA 1B0AA 3SM9A 3J7AC 1RAHA 1NYLA 5EXTA 3DVQX 5P8WA 8ADHA 1FXSA 5LZ4A 4M98A 2J4CA 1TK2A 1L9XA 1U45A 4BEWA 4EMSA 3BSYA 5KDLA 1PIWA 4HH3C 1NNI1 1XCOA 4DIOA 1UMBB 2D54A 1XVUA 4LI3X 3KB2A 5DXFA 2CFTA 3CTMA 3MUEA 2H65A 2P5YA 3QFHA 5A3SA 2Y1EA 1SK9A 1QJ4A 2PBRA 1P6QA 1AMNA 2VDNB 4UOEA 1IHYA 4LDZA 4MQ6A 2GNPA 1PV4A 1R0XA 2PX2A 4KLCA 3ZN2A 4POOA 3E9CA 2IT1A 5FTMA 4MJLA 4B6FA 3X1XA 3QEAZ 2MSLA 1R8QA 3PT5A 1WEKA 3TRFA 2GK4A 3HBAA 4MDFA 2WLSA 4QNLA 4LX8A 2C4UA 3B8HA 1QQBA 4FJ2A 1UFOA 2ZTHA 1Z17A 2JEOA 4N18A 2RHLA 3KX2A 1LKYB 1DL5A 3V9AA 5LZ2A 3I8XA 4OXRA 5AW4A 3OUZA 1GU0A 1YASA 1ZQAA 3N39C 1ZVMA 2W6ZA 4ED1A 1P19A 2Q50A 2ZT6A 3DXXA 2WKSA 5I47A 1QH8B 5ANRB 3LY8A 5E6RA 4ZCTA 7ICIA 4LC9A 4AYBF 4QG7A 1XQXA 1ADCA 2FFRA 1CJSA 3OFKA 5KAFU 3BS7A 2XUAA 4Z6FA 2GCNA 1WEHA 3TVYA 2HYDA 1TCVA 2P4EA 3ANXA 3GUVA 1LI7A 2OQIA 5HHIA 4ZIRA 5CBPB 2GKSA 4QQFA 2B83A 1KMCA 1H94A 3L9XA 3MSXA 1W94A 3T7AA 3ZU6A 3F71A 2AQIA 2XQJA 3IIJA 5I5EA 2WTMA 1ZQCA 4ZRDA 3FB1A 1JDBC 4TTQA 1KRXA 2XQVA 3BZUA 2IF0A 3M9NB 1NJXA 4JT4A 5FI3A 3NRBA 3HB0A 3EVDA 4JUCA 3BMCA 1XOIA 3DE0X 2Q8QA 4JA0A 3ZQ6A 3DOCA 3RYTC 2YY5A 3TNDA 3V6MA 1RLOA 2BGMA 3KTDA 5KFOA 5CFZA 3NT5A 4LNHA 3L7OA 4BMPB 1J9EA 2R3SA 2GERA 2RAVA 1N0HA 1T6NA 2K4PA 4R40A 4M9HA 4EZEA 2O7SA 3A9SA 5B7QA 5DWVA 4OIMA 3LOQA 1UWKA 4UAZA 1MABB 4I7EA 4LNUA 2WSBA 3C6YA 4FS2A 3KRTA 5T5QA 4DOMA 5A5VA 1X6VA 3L8GA 3FPLA 3PUYA 4XDZA 1SXDA 4CLOA 4BN5A 4YAEA 3OQ1A 4G4IA 2PZKA 4J9NA 2FZKA 4B43A 1W52X 1X9XA 4H6VA 4AU1A 1ZMTA 4IL5A 2AZXA 1WLYA 2XCPA 5AKHA 3C6KA 2WF9A 1QTIA 4EZIA 1WDTA 2F77X 2A57A 1R0WA 3SXJA 4DB2A 5TMBA 3M8SA 4Z8YA 1DOAA 3PWZA 1TRKA 2X4LA 2FA9A 3WKAA 2O6LA 3OURA 3ZLUA 3IV6A 2I4MA 1L5KA 4UTNA 1MEJA 2AFHB 4J43A 4D4LA 4J1QA 1Q0UA 3EXIA 4GH5A 2XITA 5DPMA 4I6EA 3EGEA 4D6XA 2ETVA 1UEXC 4C4YA 3S28A 2FZVA 4C04A 4OFXA 1XEAA 4EL0A 4WBNF 2R96A 3C3AA 3HADA 4D43A 1Z4IA 2ZCVA 3WTCA 2VZLA 2XMCA 1YU6A 1KDHA 2G5PA 2Q9AA 3VVMA 3JAKB 4CTNA 4MV5A 3LBHA 4M7RA 2J5RA 4FTWA 1E2EA 4ZJUA 5D5QA 4M1SA 3U60B 2VYVD 4Y9SA 4WK0B 1URJA 5AW5A 3MOGA 3DPIA 4LF6B 5BQXA 3WX0A 2F9LA 2R1UA 4R2LA 4DSNA 1PV1A 1J49A 4WFJA 1IVNA 1LGYA 4NLKA 4DADA 1DARA 2VYVA 4M21A 4M9SA 1JKFA 3P2EA 1DKUA 1HZZC 3HRIA 4TTSA 3ZDXB 1KR2A 2ZJOA 4ZI3A 2A88A 1NV9A 4D79A 2V9WA 3R3ZA 2WTEA 4JJ6A 2PXHA 4ACBA 2O0KA 9ICQA 3JRXA 2RBGA 3LA6A 3RVDA 2VZ9A 4CMKA 1WYGA 1QZTA 4BUCA 2H1FA 1LFDB 1QF7A 1Z16A 2QD2A 2C3PA 1UKEA 2DGDA 3B2NA 3QWIA 3C3JA 4TN1A 3TGPA 1DC7A 3IFSA 2DBYA 1TEXA 3UPQA 3SC2A 2Q0XA 4ES6A 3I28A 3SENA 4PAMA 4ZO9A 1ABBA 1RWPA 5B2FA 4AZ0B 2OY0A 4WFIA 3GNTA 1KZYC 4Q03A 3DO5A 1HX7A 5IXJA 3BWBA 1B42A 1P73A 5I7AA 3QG1A 2QVGA 2W7TA 1SUFA 4KLAA 3FPEA 4NABA 4NZYA 3PIRA 1UZUA 2FMTA 3EVFA 3EMKA 9GPBA 2CUTA 1V45E 5ICFA 4MROA 2OCEA 2O8FA 3R7DA 3ZY2A 1YJCA 2FEOA 3TYXA 3O4FA 4ABTA 1FDIA 4E2WA 5CA0F 3FDZA 2OLKA 3PSIA 1MO3A 3H16A 1JMSA 4H16A 2X42A 1WXEA 5EE1A 3LQRA 3STWA 2Q4TA 1YHZA 3ER9A 4YBRA 4WGFA 1HDYA 2JBAA 4BFSA 4FQ7A 2WY2D 2ZJ0A 1ZQGA 3R0JA 3A7DA 2WF7A 3A1UA 4PC1A 1VHWA 3EIFA 1E1RD 4OBWA 4HVTA 1OASA 2YKGA 5LQRA 4HZUA 2PWZA 4XDHA 3QW2A 3FCSB 4ER0A 3AR8A 4GOLD 4J8PA 3PHBE 2W6ID 1E1RA 1TLTA 5IYZA 1E1YA 4KV9A 5FF9A 2VJKA 3BQ2A 3D6UA 1GTRA 3V4PB 3AR2A 1GZDA 2W6IA 4RMJA 3H3FA 1ZISA 3O91A 3LVVA 1GV1A 4Z9BA 1G5TA 1LNQA 4BWYA 4CG0A 4Y0VA 1XZFA 3C1OA 2Q5LA 1K4YA 4H59A 3MTEA 3EQ7A 4NCIA 1C1HA 1O7JA 3OPYA 1OXVA 16PKA 3C7CB 2FUEA 4Q05A 1XN1A 2W00A 2B99A 4OBXA 4OB8A 4KAJA 5J2TA 1UJBA 3LVRE 1HC7A 3R7WA 1RRCA 4C30A 3T1VA 5JROA 1Y88A 1QR2A 1IWOA 3GZJA 3N7PD 3I9OA 3CVUA 5D7NA 1DXOA 2FLPA 1DK2A 1M8PA 5EYPB 1ZK1A 4MUNA 4AIIA 1G42A 5CCEA 3R8XA 2XA1A 4HSEA 3IKVA 4EGAA 3DOOA 4PHGA 4BATA 4ZVKA 3ZHRA 3UK7A 3VNAA 4B7AA 3VM6A 3WMRA 5KYUA 2ZUEA 4L3WA 1G19A 1CHNA 5JWHA 9ICIA 1MN6A 1NJ2A 2PD6A 4V0NA 3HBJA 3BH7A 3BQMB 3OICA 2Q62A 4TLEA 1QZXA 3OM1A 1VKHA 4FOLA 1DPGA 1JQEA 4Y1RB 3TW8A 3H4VA 1TZJA 3SHQA 4JJFA 1ENYA 5BUZA 9MHTA 4R3UC 5BO5A 2GCEA 5T41A 4W9RA 2XUGA 3PCXA 3RUCA 4JVSB 4RJ2A 3NTVA 1FEZA 5LYJF 1IUKA 4U2GA 3BMXA 2JLBA 3V4OA 3JATB 1YS2X 3KVVA 1FRVA 4EB8A 3UT6A 4MVJM 4BLSA 4RPIA 3RSSA 4OHXA 3WR5A 3PPYA 3U4IA 5I9LA 4HYKA 1AN0A 3AT1A 1B6RA 2HUNA 2R6AA 3UJ8A 1EP9A 5F2KA 2O8EB 3ACDA 1UP4A 4TRRA 1KHTA 1ZUD1 1NATA 3I61A 5L9XA 4V39A 1ZUNB 1Y6RA 1DEAA 1EP3B 2ERCA 3LK9A 4LXUA 3O94A 4LHSA 3RYFB 2OM2A 2G28A 4HGYA 4DL4A 4TS3A 5T67A 1TIPA 4XM0A 3EFBA 4A6DA 2D1SA 1O94C 3ANSA 1PEAA 3HX0A 2TMDA 4JH0A 1O8CA 2L5YA 3EBPA 4Y9DA 4IINA 4DLKA 1AO0A 2GOLA 2WIKA 5LQNA 4E5SA 4NPAA 3K0SA 1ADJA 4FE3A 2YYYA 1CCWA 3KKEA 1ML3A 1L8AA 3BGIA 2AQ8A 1FFYA 4EMBA 7REQA 2WQ7A 4JJEA 1SU8A 4Y2YA 3FBWA 3C39A 4G0UA 1WBJB 5KVCA 4K9DA 2W6QA 3Q7QA 1NJGA 4R81A 4WAUA 3PQ4A 3WICA 3DE4X 4B71A 4COKA 4K9OA 3UC9A 2IXEA 1QOPB 4CF7A 3JWIA 4MQEB 3LUKA 4DWOA 4ZRMA 8LDHA 2O2JA 3QZUA 1FSFA 4LQDA 4AL4A 2PLFA 3W6PA 1YBFA 1A8QA 1AGXA 1DJNA 2AXNA 4IDEA 1KNQA 1X94A 3RIYA 1EQAA 3PX4A 3QUCA 5SYNA 1KSHA 4O4JA 2C2EA 3P9RA 1P6UA 4RVCA 3OSZA 3NYRA 3B6MA 4CDGA 3TNFA 4NARA 2O8CB 3MAJA 2ZSJA 5T8KC 4MR7A 1AKTA 3ZK9A 1JYSA 4M37A 2Y67A 3QI7A 2PFQA 2RHHA 4YRTA 2DHDA 3S27A 4J1SA 3U7QB 1FMJA 3WNVA 3V7JA 1XTZA 4RGYA 1BTOA 3PJFA 4RU1A 2R8OA 2YXNA 4JMPA 5HIAA 2ZRCA 4B8YA 3QWHA 3AY7A 1AJEA 3DOHA 2QWXA 2OQ2A 2R1ZA 4OJ5A 2Y1IA 4ZT2A 4IDCA 3T5JA 4G5YA 4P7FA 1D2EA 4KO4S 5C1PA 2B8WA 1PNRA 2WUDA 1WZCA 4DDTA 1SEPA 1TU4A 4Q6BA 4UPDA 1DB3A 4YO8A 5EZQA 4BUZA 4GLOA 1OTXA 2XXAB 3WJ1A 2WF5A 2DCUA 1JJ7A 5D5HA 5E8RA 4HDKB 3AUXA 2VJMA 3T7CA 4M55A 3VNBA 4EVRA 5ES4B 1IXYA 1K27A 1M1ZA 4LVNA 5FIUA 3CW2A 5CM9C 1MNQA 1WAMA 1T2VA 3Q9SA 1N77A 1KYXA 4OF4A 5AP9A 1QH0A 4UJ5A 5EOVA 4HMPA 3A4NA 4HWTA 1N60A 2VJOA 3S8MA 4XM1A 1HYGA 1U8YA 5A3VA 3M6WA 1DAIA 4Y2QA 5TJHA 2NO7A 2RGEA 2R0QC 2ZYVX 3E8XA 3MBKA 4QFDA 1NQOA 1JDNA 1L4MA 8ICWA 3IOCA 1FJGB 3U3ZA 1NZDA 3FCXA 1KMHB 3FDIA 3UM9A 2I62A 1UBKS 4UBBA 4DR3B 4PCUA 3G7NA 3RNOA 3QVGA 1TDJA 1C30A 2VDKB 4YJ2A 1ZUIA 1G8PA 5CB4A 1PR5A 3LIPA 1TO2E 4HGNA 3DEYX 5CCDA 1Q1NA 1AHPA 3C0KA 3DWIA 4CG1A 4Z0TA 4UM7A 2VQEB 5EL0A 1EZZA 3HJUA 4W99A 3SXPA 2QQFA 3I9KA 7ICLA 3RYCB 1P61B 3T3MB 1FDRA 5KVQA 5JZBA 5B37A 2KK0A 3K9NA 3UJ9A 1KSFX 1UC9A 4BMCA 5F4BA 1S2IA 2MINB 3H40A 4UZEA 4ID3A 2WIBA 3U7HB 3HLTA 2HNKA 3QTLA 1ABFA 4AYBC 4YJFA 2PZGA 3LCMA 2PY6A 1DKQA 4P98A 1IRXA 2PAAA 2W7OA 1T9BA 3HSYA 3I2GA 4F46A 1SBYA 2VUSA 4RUKA 2CV1A 1HEYA 2A5YB 5F3XB 4II3A 4LOHA 5EGNA 4PLPA 1RLTA 3GBPA 4PGGA 4KGDA 3ROXA 2GBGA 1Z8DA 2BAGA 1AQLA 3O3OB 1VPWA 1H6BA 3E84A 4GM0A 4NOLA 4A8HA 3QV1A 2QXUA 4LECA 3MCVA 4YJ3A 7ICPA 4DIDA 5HJ2A 4FZMA 1BXRB 2JFBA 3H17A 4IRKA 3DMDA 4G5XA 2Y1JA 3ZIUA 5REQA 5L1IA 3CE9A 1G2QA 2C1XA 3GGOA 4TV9F 3DYIA 3SHWA 4M9ZA 3DOUA 2CHGA 4YAFA 4A8JB 1ULHA 1EQUA 4W5HA 2GVDC 3IMFA 2JCBA 2V1XA 1G8JA 1MUUA 3RAEC 3TBKA 2OGSA 1OHHD 2DKOA 4UZFA 2X9LA 3S70A 5LMCA 2YJNA 5ARDA 5ED4A 5KHAA 1TM7E 2QL5A 1NZJA 4OGLA 4IDOA 1YTUA 3OKPA 5HNKA 3AB7A 1OHHA 2DKZA 4MRAA 1V6SA 1P2FA 2F8TA 5IARA 2KJ8A 4YV2A 4DXHA 5KTTA 3NJ4A 4WKPA 5JZMA 3GMSA 1TYBE 5TPWB 2ZI9A 2PPLA 3LYAA 2RGXA 2CNNA 3IO3A 5EP2A 4CM5A 2E0IA 2PUHA 2GM4A 5F9LA 1DRVA 4PG7A 4MWEA 2AN4A 2YOHA 1NOKA 1A9OA 2QD1A 2C31A 1Q12A 5EZ5A 1IAQA 3GGPA 2AXPA 1UOPA 4DL7A 1KOLA 1DUSA 3R41A 4JBWA 3RC9A 3CEJA 4M1MA 1DDIA 1MEOA 4K9QA 5DHSA 5DX8A 1YDHA 1B22A 2ZZKA 4XUEA 3H5NA 1AMOA 1RI1A 1WTCA 2QTMA 2RDIA 1WP4A 4BB0A 4ZO7A 1NQAO 4NECA 3UAXA 2PPVA 5IVIA 2JG3A 3U44B 1COKA 1VRVA 1O87A 4IWYA 3A2NA 4UULA 1GGKA 3WRYC 4IQVA 4GS5A 3W3AD 2E1PA 3FF1A 2XV1A 3VR6D 4OOFA 5L3QB 2V7XA 4G65A 3UJ3X 3VZPA 1U11A 4KRGA 3HJCA 3RFUA 5AD1A 3W3AA 2HA6A 2GARA 3HKZC 3VR6A 3NXKA 4Q3BA 1VPDA 3CJTA 2QOEA 2FVYA 2OZLB 4FMDF 2EZ9A 2Z83A 3WL7A 3NGMA 5JPDA 2PMZC 4RQMA 2WW8A 5K0TA 2XHEA 5LA6A 2O3SA 1AO3A 4HUQB 3FOZA 2GYYA 4JAVC 4AICA 5FLEX 4JA2A 4DVGA 2ASVA 5EIEA 3W8DA 1H2YA 1U5AA 1M75A 4K2HA 5KCMA 4ZDWA 4JWMA 2FMSA 4I2FA 3FWNA 4D99A 9ABPA 2A94A 4MP3A 3T5CA 3KWJA 1XU7A 4HH1A 1U2SA 4QM7A 3AYZB 1RMQA 4X60A 3KAPA 1QIHA 4BV2A 2WD7B 1FP4B 1KWGA 1V1MB 4W7SA 3EXG2 2UYCA 4QM6A 3L7MA 2R86A 4WY2A 4PFJA 4HLCA 2FLVA 5HE8A 4FYXA 4QSMA 1YE5A 3X1WA 1DC4A 3DBRA 2EJWA 4PN3A 3M8RA 2UZ3A 3QKIA 4PCVA 3DUFA 1VL0A 5DBIA 5J0OA 4XUCA 3GWGA 1BHSA 2N75A 3UZUA 2R85A 5LNK6 1TKRA 4YRLA 1TLFA 3NHSA 1L8XA 1LW6E 1KEZA 4IDGA 5IZCA 5C5EA 3WWPA 4JQYA 3ZXIA 2GPJA 3IGFA 2HF8A 2P4SA 2KHZA 3TE7A 1N5WA 3VHRA 4N82A 2V54A 1QQ7A 1BEZA 4OHZA 5AUOB 4BGUA 2D0IA 2R11A 3NBYC 3OQVA 1U2EA 4RSGA 1E66A 4QZVA 3PI7A 4IXTA 2WE8A 3D8RA 1R10A 5CW2A 2HYIC 1PUIA 3GR6A 4I8IA 3CKLA 2ORYA 3Q0IA 4AJ1A 3BDIA 4P0TA 3NLLA 2O50A 4DIEA 4DS4A 1QTNA 3KUKA 3A25A 4LI0A 4YXMA 8ICGA 1TAUA 1E2UA 4O5AA 2PUGA 1XA3A 2QTLA 5FWYA 5A71A 3R9WA 3NETA 3QVTA 2IYQA 5JUMA 1UIMA 1N1GA 3EASA 3SC3A 1TM4E 4OO3A 4TMTA 2BEWA 3RSZA 1QFYA 4D0LB 2I6QA 2H9AA 3KJHA 4D9BA 2GCOA 1Q74A 1Y8ZA 2H1IA 4PFKA 1XRNA 1WMAA 5IJ0B 4H0NA 1ZQVA 1ZM3A 2Q21A 3HU5A 2XIQA 3NNNA 1SV0C 4TSKA 1WKVA 1K68A 3CO0S 4ZK6A 2OV6A 1C81A 3RS2A 3MWDA 5KJ1A 1RJ9A 3IAUA 4OIFA 4I5GA 1EEHA 4MRMA 4KTTE 1GGMA 5EXSA 4MGIR 2F7SA 2JJ1D 2DC1A 3BX1A 3T15A 1WUYA 2X0EA 2R6GA 3TUIC 1E77A 1H6CA 3RVNA 2TMKA 4R5HA 4J9SA 4TUYF 2Q6LA 2JJ1A 2IYXA 2XUJA 5IIJA 4DWWA 3DBHB 3U3RA 1OTYA 2R47A 1K4KA 3NHFA 3OWHA 3CWCA 1AKWA 3OQMA 2MOKA 2X9NA 4EPXA 3PC7A 4CEJA 2BZ0A 2VEOA 4JSTA 2YX8A 2OZVA 2NXNA 2FAXA 1H22A 4DUYB 1T9ZA 4TXMA 2CXQA 2ZCJA 3LX8A 1Z5OA 2GWHA 4RVUA 1EM8A 2GXQA 2BPGA 2FSVA 5H9WA 4H0FA 1L8LA 3DV2A 4XVHA 1SC9A 4KR3A 2XI9A 4O3MA 4MUAA 2I34A 3PHJA 3FJYA 1XDBA 3CRQA 3E9YA 3MUNA 4XQ0A 3PPXA 1Q2UA 2HPZA 1M5UA 4N0QA 3R75A 2HK9A 1VG8A 2UXDB 3SEFA 4BVJA 2X3FA 4HPJB 5GP1A 1T36B 1EWTA 4YECA 4K1LA 2Q28A 1L7NA 3QPVA 4RPXA 3SCZA 3QLEA 5GM2A 1YVEI 5HHTA 4OQZA 1XD2A 1VB5A 1G7CA 4EW3A 3DYVA 3QPAA 4L3OA 2Z1MA 3VPDA 4QATA 1W9HA 4K46A 2CLSA 1DV2A 3EGXA 3HKDB 5BQPA 4MEYA 2AQKA 3M1IA 4W5OA 4H17A 4WX2B 3F3MA 4LVUA 4WNIA 1ENOA 3AUAA 1PNQA 1U8EA 2PUWA 4BZZA 4ARSA 4Z7NB 1NLZA 1LNZA 3MLBA 2Q3FA 4JMUA 3K94A 2H7YA 3T4UA 1NLUA 4KR0A 3GUUA 4PCLA 3AUYA 1F1JA 4RQ4A 2HO4A 3MMXA 3WLLA 4C8NA 4UHDA 1LPNA 1RSZA 2AJBA 5F64A 5J2UB 3VH2A 5GTHU 3M82A 3FD8A 3I2YX 4G0XA 3LC7O 2OO5C 3W8RA 4CYMA 3IM1A 2EC5A 1Y8RA 4EY7A 2F55A 2NVWA 5EJIA 4QX6A 1Y1LA 1LPSA 1IBRA 5BSWA 2P1ZA 1E89A 2G6TA 4CMIA 2H1CA 1E79D 1X7ZB 4F4YA 1NVGA 3LBFA 3WB1A 2PK3A 3RFTA 2XVXA 3R9KA 2NUPB 2BFFB 3EIXA 1X7XA 3RIGA 5KFHA 4WN3A 1E79A 2BDUA 4KPFC 3H3XA 3LHFA 3N0RA 5K99A 1VLVA 3I9JA 4ZMBA 5DB4A 4NJEB 1Y33E 1WVMA 1XKQA 2SKEA 1M2EA 4RPHA 3ZWQA 1ICEA 3THVA 1S2MA 2X1MA 1DUIA 4KI7A 1HR0B 1ECCA 4Y6PA 5ESDA 2D7JA 2R9VA 4CG3A 2BDPA 4QIWC 1S5PA 4F8JA 1R74A 3Q2IA 4GVLA 2UUCB 3RWBA 4EHDA 3GDOA 2JB9A 1C3VA 1AB6A 3CYFA 3BCRA 1IU9A 2ECPA 5IH7A 2Q0QA 3A4YA 2NUTB 4P7BA 1ZP6A 3Q3CA 4GMDA 3JQGB 2IS6A 3KC2A 2JBWA 2C77A 2XBMA 5KI6A 3I12A 1ZZGA 4OAPA 4K87A 3C2KA 3JWHA 4MYTA 2G5CA 3OJOA 4F5QA 4BVBA 3LPDA 1CS0B 1Y9JA 4UAWA 1ZD1A 4M0LA 2JFUA 1GVHA 4X7RA 5JO0A 2GAOA 4R1UA 5HCIA 3MABA 2R44A 4ZCRA 1HQCA 1THMA 5IHPA 4JVNA 2JJYA 3V1NA 3B6KA 3JYOA 4AUNA 4RY9A 3UWPA 5DCYA 4C0SA 2W22A 2J9FA 4L22A 4JEHA 3AW8A 4G1EB 1N4AA 3CR8A 1E1KA 2OGZA 4PRYA 4MZXA 1KC3A 4Q19A 1W8DA 2HLHA 5EJEA 2WJJA 3F2VA 1N7IA 4PL2A 3ZYCA 3V6HA 4M53A 5IINA 4DOAA 3RSGA 2KSOA 4MW9A 5JSZA 3TFQA 2I71A 3PCTA 3BK2A 4W1SA 3KKKA 3GA7A 3UFXB 2LV8A 3B3GA 1BNOA 2ZLBA 4I2HA 1RHRA 3U9SA 3UW3A 1ULSA 4J0GA 4JBIA 3L0DA 1YJBA 4PIVA 4CKEB 1E9BA 3CF4A 4P4SB 1N48A 2G9ZA 1E1NA 3ZD6A 4M0DA 4QC2A 2F43B 1EVKA 4MHVA 2P9EA 1YC5A 4IIGA 4DLBA 1YR6A 1X87A 1OIWA 3H0MB 5DBFA 1NAIA 2XZPA 5AQ1A 3O8NA 2OEPA 2XT0A 4IMJB 1P60A 5AJXA 2BQRA 2E48A 1F2UA 5DTQA 4ZVNA 5HW0A 5TGTA 2O2EA 4JDUA 3G0OA 3FFTA 1CJBA 1YKGA 4IH4A 4QUAA 1SXQA 3RF9A 2NPOA 3N7SC 2OCKA 1UBFA 1CUEA 1XEWY 1KK2A 1WKCA 5BR8B 3BQ1A 3IAEA 4B3MB 2ZTMA 1TAHA 4MI6A 4JLMA 3MBYA 1XZGA 1THGA 4NM1A 2L0XA 2JIPA 1KWKA 3CCBA 2VLBA 4NQRA 3GNQA 3ZW8A 3D9QX 2QE6A 1MA7A 3DF9A 3UV6A 7ICSA 5C32A 4OVKA 1TYDE 1JHZA 5DV9A 2KMDA 5K03A 3AY3A 1JI0A 4HWSA 3FUVA 3IXLA 3UXNA 1MB0A 4E0DA 2GJ4A 4WBXC 1GKUB 5JXGA 5F7OA 4GMKA 3OE5A 5ALIA 2VIIA 5HJEA 2PMBA 4NLNA 2UVUA 2OEHA 2IW1A 1HXHA 1CLUA 3OX2A 4P80A 4C05A 4GLXA 4KREA 4MGYR 4WFQA 1J0DA 4BQPA 2C2MA 4F6CA 4E5VA 3C8DA 4EYEA 2W7PA 1JN0A 5H3CA 5EC8A 4KPGA 4D80A 4E5UA 4IOMA 3AKYA 3I62A 4D5EA 3LLCA 4GNRA 1C9DB 3A2MA 5IJZA 1FDVA 2BM8A 1XEWX 4DSKA 1YZKA 2MSCB 3SJCA 3QF4A 3WV5A 4EHNA 1W0CA 2HPHA 2PCJA 1NOMA 1YZUA 3OLZA 2BEJA 1XDDA 1GJRA 1YGYA 1RJGA 1D1TA 1LC0A 3DNFA 3H84A 2D1FA 1JG6A 4UB8U 2RMKA 3AQ4A 1V35A 2JIRA 2ODNA 3ZZ0A 2E4AA 5A2GA 2X8AA 2HHTA 6Q21A 5FFFA 4OLAA 4J29A 4WPGA 2W2MA 1H1DA 4IMPA 2OO3A 4KLOA 3ORSA 2G07A 4Z4HA 4TMKA 5CYGA 4R1OA 3M3HA 1HT0A 3T5MA 3MG9A 3ZW9A 1XMSA 2OWDA 2VRNA 2VPTA 1AQIA 3I92A 3GRRA 3SXUB 2JW5A 3OMWA 2A58A 4KLIA 3M5CA 1B7GO 3D3EA 3QQPA 1E64A 3H8VA 8ICAA 2SECE 3RAQA 3ICPA 2LWIA 1BEEA 3R3HA 4FNAA 4ZAWA 5EJ8A 5HUQA 1T4GA 2AWOA 3F1LA 1E3QA 1F20A 1K6MA 1JFFB 4K0RA 2DT8A 3R3JA 3PFBA 5DN9A 2CDAA 3UJ7A 5FTWA 4OUDA 1I4LD 1TT5B 1G8SA 2CE2X 2ZYAA 4RV5A 3RBXA 1P9RA 1B8NA 5HR5A 3IUNA 1OBFO 1Z0FA 4GOND 2OPBA 4IXMA 4MOWA 3JPRA 1E3JA 1KYQA 3KQHA 2G67A 5KJEA 3UK2A 2BFOA 1HG1A 5J4LA 4BQIA 3UJ6A 1D6SA 1TEVA 2M1XA 1B26A 4E5NA 1SCUB 2OP0A 3F6SA 2NO1A 3V2GA 1Z4QA 3DQPA 1G2PA 5KB3A 2J3JA 3TUZC 4KUHA 3PFCA 2XCRB 4KR9A 4MHSA 4BJ3A 2ZSHA 4GX2A 3RWOA 2QARA 3AY6A 2DT5A 2CBZA 3UXEA 5AKZA 4Q8FA 2XUZA 4YLGA 2CNDA 3KHTA 4UREA 2GM9A 4RV4A 2IEDA 1L4FA 2HQOA 4L5CA 4EHKA 4RULA 1W9MA 4RPYA 4HT3B 3A9RA 3NYQA 1HG0A 3RADC 2IYRA 4AJIA 3PFWO 4OJMX 4PZ9A 4LYFA 3WTBA 5ISMA 3RGWS 1SU6A 2XY7A 2JGJA 1UINA 3G2NA 2IVFA 4I4TB 4I1YA 3F74A 3K4QA 3PYMA 3OU6A 1X7YB 1W2HA 1RE0A 1AKRA 1O6BA 1A7AA 1RNLA 2RH5A 5DKFA 5K8UA 1RRGA 3PDIA 4QWBA 5IJXA 4K6GA 1ZIYA 2JFVA 4CEIB 2R8HA 1Y7LA 8ICHA 3HKEB 1CQZA 3PGA1 3T7SA 2YHAA 1SXJD 3SM3A 1YR8A 4KQWA 1DZIA 2FPIB 4C7VA 3EWIA 3VMFA 3P97A 1EVLA 1IM2A 4U2EA 3E8MA 4YDRA 1SXJA 2LE0A 4EJSA 4K03A 3G2HA 4QRHA 3I1IA 3W6NA 4BLWA 4CCYB 2P90A 3C43A 5ENZA 2O1SA 3DVAB 3K0AB 3J81j 4DCUA 3HYTA 1E8MA 5BWNA 4OU5A 2E85A 4RF5A 4TT3D 3QTBA 3LX6A 2V7GA 1G64A 1JLLA 1Q3HA 1QM5A 4MULA 1XDGA 3NBMA 4FXPA 2WDPA 1T3SA 3Q7IA 1QAOA 3JQAD 2O59A 1WP9A 1XZQA 2GD1O 3ONFA 2C7PA 3TFSA 1WQ3A 2DBQA 4TT3A 1N92A 2ZIFA 3OQ6A 1YONA 2O23A 3JQAA 1DBVO 1YNOA 3T5PA 2V6FA 4XQEA 1ZIDA 1KXJA 2FPUA 4ECSA 2MTBA 5DDIP 3SSMA 1RXUA 1T2UA 4IP0A 1SNYA 4YY3B 1XVTA 1EXMA 1D5WA 4XDGA 4RK1A 5IJWA 2WJGA 1DXHA 2HJSA 1XZ8A 2NU9B 5IIIA 2BE7A 3NVYA 5CD1A 2RIPA 4S3MA 4M0MA 4DVJA 1NR1A 2OCAA 3KALA 3ICXA 4ZKDA 2E5FA 3I2IA 3W1WA 1XCJA 4TMFA 4EB0A 1YB7A 1SKRA 3QXCA 2IYNA 4IGKA 2V4UA 3K9HA 4IWXA 3ZHOA 3ZKWB 4JGGA 2HRCA 3RS0A 4TZ6A 3INGA 1IZYA 1DT3A 4FS1A 1NUUA 4EY8A 4AKIA 1W88A 4FLFA 4Z3DA 3T1OA 1LSUA 1NV8A 2D8MA 4N48A 5FA8A 3BXFA 4Y1FA 4QJFB 4HG2A 3QA3E 3G9XA 1KPIA 3QXSA 3Q3IA 1TCCA 4Y9TA 5ABPA 4OH1A 1Q16A 1T94A 3GH3A 3W2TA 2WAXA 4TQUS 3F9IA 4AS2A 1CR1A 2EFCB 4H4CA 2H7CA 5LZ9A 2OZKA 1YRWA 1IIPA 4OQYA 3I9V1 4IQTA 4W8OA 1DMSA 1IEXA 2QD5A 4LHYA 2A4KA 3EDQA 1LTHR 2P2LA 1E2LA 3QE2A 4L6AA 4MUIA 3KE8A 4KGZA 1GN9A 4JB0A 4I50B 4K6OA 4RQ5A 4RVFA 4RABA 4A23A 4D82A 1HJPA 4Y9UA 2RGUA 3H13A 5IT0A 2F8LA 1T4BA 3RJHA 2M9MA 2HTFA 2ZJ6A 2AOTA 3HWTA 2QF7A 2YXBA 5IX8A 3CV3A 2JKZA 5EIBC 4BV8A 1SD5A 3ZS9A 3JD2A 2C94A 1ONSA 1N3BA 3BJIC 1U7UA 3BD9A 3T0IA 5BYKA 2VAVA 4RZXA 1WUKS 4GU5A 2P27A 4GPEA 4O4LA 2XY6A 2IBMA 2JA1A 3GP3A 1OPRA 1W48A 3TVDA 7MHTA 5JATA 4ZMSA 3CNOA 4RZSA 5AJHA 4YRNA 3B6IA 1ZN8A 3K5PA 2WKQA 4DXAA 4LJSA 3EZ5A 2FWPA 4JVLA 1JX6A 1PW5A 1D6MA 2BRUC 1JXLA 1LD3A 1QLNA 3B3AA 2X7JA 2ATLA 4HNHA 1F38A 3WQRA 1N2EA 4EX7A 4CMJA 3NM5A 1QO9A 1WF3A 3IHLA 1YACA 2Q2NA 3SKVA 3HKZF 2DFNA 2VTBA 5D86A 4E4RA 4C4RA 1G2OA 1ISFA 4QT0A 3EZ7A 1RQGA 2GBLC 1HOTA 2ZETA 2QJRA 5EP3A 3RB6A 4EYSA 3RS8A 3CW8X 2PMZF 1R4NA 2FKAA 3HMQA 5DWQA 1R4MA 2OENG 1A88A 3D3JA 1USUA 2B5OA 2P4UA 3KV1A 1LTQA 2DPYA 3EUFA 4OHOA 5AKYA 5TS3A 2ESEA 3N2LA 4MEXA 4JLWA 1TUBA 3GQVA 4KE8A 2I1LA 5INTA 2EZ8A 3RBZA 1FU7A 3ZJUA 3UV3A 4JJZA 3IN5A 2NTJA 3HJGA 1BPEA 1QCYA 4YJGA 1QOZA 2BPOA 2PZ8A 3BN3A 4TLLB 2KHVA 4OQXA 2OHJA 1E2HA 1L4KA 4UEKA 1XPJA 2PFGA 1KP2A 4I5IA 5HFJA 3RVJA 3BL8A 4EY3A 2W2VA 4QZIA 2DFVA 3FYUB 3RQSA 1OE0A 2FI1A 4DSTA 1NXXA 5K2OA 2F9FA 3B85A 3R5KA 4ZT6A 3PQEA 4WLVA 3TAHA 4BMVA 4PC2A 1JAYA 2VKTA 4C7ZA 1FJ2A 3MCZA 3WSVA 5CMLA 1TUIA 4IJWA 4E88A 4Q44A 2ZT8A 1OVGA 3LT1A 3SQOA 4A6EA 4IFEA 3FETA 5CEEA 4B82A 3AHGA 4UBMA 4P83A 3A3YA 4HAOA 4Q3AA 3SQXA 1WZNA 3MINB 2IKQA 1OAOA 3N2KB 5B1EA 4HVAA 3T3NA 2PAFA 5CFQA 2W9BA 1HPLA 3TADA 1U80A 3O4GA 1OLXA 1KEEB 1G1MA 1EA7A 3Q0TA 3FTNA 3SR4A 2V6IA 2FE4A 4HNGA 4RE5A 3O1IC 5E2IA 2QRQA 4UM8B 4YJHA 4RMIA 2WD9A 4CTMA 3ZTYA 1OYVA 3URMA 5C81A 4Q8EA 4L28A 1NDUA 1EIZA 2BM1A 3RAPR 1XJWA 4FFDA 2E4VA 4XX0A 1WDWB 1YIAA 3B1VA 3AR9A 2CNLA 4U7FA 3ITDA 2GEKA 5KNIA 1S8OA 1RPJA 4O0LA 1E98A 2IYSA 2R8YA 3CH4B 2ZM5A 3Q5EA 4FYIA 3T7IA 1PFGA 3C1ZA 1G5FA 2IXAA 3ZD7A 1Z47A 2GDJA 4U5XA 4E22A 2C3OA 1DLIA 1I4OA 1HLPA 4IIVA 1L3VA 3FHTA 3AP3A 4JJ8A 4NTZA 5BYJA 1ZH8A 1YAHA 4I9UA 4U63A 5AIBA 4CFSA 3DC2A 4TXLA 3PQ7A 3WGQA 4XLLA 1LI5A 4OBBA 4RY8A 1H8HD 2J59A 2WYWA 7ICOA 2AEMA 3MGHA 4RZ3A 5IKXA 4OATA 4D6PA 1GYPA 3ZBQA 4A8TA 1S2DA 5LXTF 3CZCA 3O1LA 4MIKA 2Z0MA 1D07A 4XCQA 1H8HA 4FINA 3DHWC 1E3TA 1CQIA 3AZOA 1Y5MA 3NEPX 2V0CA 1CZOA 4BO1A 2D5AA 3S81A 4S1PA 5JAQA 3UTCA 1VYHA 4HPXB 4LBYA 4D45A 5HCNA 2ACVA 2HXGA 2ZG6A 2FPOA 2O2SA 2A5FA 3CLHA 4B4VA 1ZETA 1PK3A 1AGYA 4BNXA 1GPH1 3WIVA 3TNYA 3IUQA 4EELA 1YCGA 4Z4EA 1NN0A 4XR9A 5DCUA 2P8JA 1PO7A 4K5QA 4EP1A 4EGQA 3HY3A 3EUAA 1NU8A 1NJ1A 4K9PA 1VL6A 2QP3A 2EQ5A 2OBXA 1P2BA 2MUTB 3FOWA 3PUIA 4NU5A 2Y2VA 4ME6A 2PJRA 3CZMA 1ICIA 4BY9E 3NR2A 5U4QA 4BC0A 5DGIA 3EX7C 1TQHA 2KIWA 1V11B 1PR2A 3PENA 4C6TA 3SYRA 3QLTA 4PXAA 1YIDA 5DO9A 2X2EA 2F59A 2MU1A 1P5JA 1U9ZA 2X0JA 3NVZA 1X8XA 4ZO8A 2YX1A 3IA7A 1NVKA 1U0FA 4HQLA 1VSUA 3INNA 4J94A 1ZH4A 2NXEA 2HGSA 1EWVA 3WIDA 2YIVX 4GO1A 2PBFA 4QBHA 1IBKB 3GF4A 4ND8A 3E18A 1IHOA 1LWOA 3PEVA 3NTUA 3ZW7A 5DM70 3DBLA 4LDJA 1JEYA 2WAQC 1MG5A 1NJ6A 5D6NA 2DWUA 3AVWA 4NZMA 3FYSA 1JZTA 2B9VA 2DWOA 4ELVA 3HBLA 5FHQA 3SEQA 2A9KA 2FTKE 5MGBA 3O2SB 3DLCA 1Z5VA 4PZNA 4GZ3A 5B57C 4IDNA 5M2QA 3DE6X 4XFDA 1HUOA 3TD9A 3SWWA 5A04A 3MTGA 3QZ7A 3PNBA 3MRTA 1IULA 3QUSA 2JLRA 5P21A 4ECXA 1NK4A 4E5KA 4XWGA 1I5EA 1P18A 2AKYA 2RGNA 2C5AA 1VJ5A 4I1UA 1H4VB 2AU0A 4Z5XA 2DBVO 3TI7A 2IEGA 4PIPA 4MW5A 3OECA 1PL6A 3ON5A 3G2IA 3G6XA 2XVZA 3O9VA 1I4WA 1Z74A 4KO1S 3L7LA 4Z8XA 2GAFA 1IXRA 5B3LA 2BCUA 3BWXA 1RYRA 4E3WA 4O2AF 5EWJA 4KSBA 4TV8F 3JWPA 3JASB 4PR0A 3MWGA 1L5UA 3DOJA 4FYWA 3DGFC 2YWJA 3RH5A 3NRCA 4IH1A 1U5BB 3T7TA 1UWCA 2BUBA 4WL0A 1CR2A 4DBZA 4DLAA 1HFKA 2JEYA 1DX9A 2NO6A 4XLTA 3G8AA 1JR2A 3QLVA 3DONA 3ANMA 1Q83A 4IRMA 2P6OA 4H1HA 1VLLA 1HA3A 2LNDA 4H0CA 4W7IA 4AF7A 3ITNA 4OAQA 2NO4A 4QIWF 5IDWA 1F6WA 4E09A 3D81A 2H29A 4XZ3A 4QE3A 4R8RA 1SA0A 4FYJA 1Z6PA 2I91A 1L6IA 1I7PA 2ODTX 4RJJA 2V7TA 3BPSA 5HGXA 1XV5A 3OOSA 4MYSA 3G88A 4KN6A 3VA7A 3ZE6A 4OJ6A 1IE3A 1V7CA 1KFJB 1YS9A 2A0YA 3CA8A 5KWSA 3BDPA 1D0VA 1N5JA 8ICMA 1FNDA 1QG4A 5FUXA 1RKXA 1W1IA 4O5EA 3NCTA 1U48A 3DYBA 4M0EA 2O5CA 2C29D 4YPFA 1KH3A 3DW1X 1XX6A 1QQ6A 3QOYA 2ACKA 1MXFA 3SNHA 1PJZA 2P4QA 3NKVA 4LDQA 3L6RA 3UPTA 1TMOA 3LYUA 5B1IA 4ZO6A 2OCYC 2QRHA 4XJTA 1J1ZA 5B6JA 4ESHA 3Q8PB 3V6JA 1JWBB 1VXRA 3BL5A 1DSSG 2H5LA 2KIVA 4U9HS 1ZSYA 1JEQA 1PYOA 4YV7A 1ZC3A 1J2JA 4UMEA 5KKNB 1QUFA 1O58A 3KFVA 2NVBA 5SZIA 2J3HA 4ED6A 3I45A 3AF0A 4OBEA 1N7GA 4A6PA 3KKAC 1FSPA 2NU7B 1XN4A 2ZDQA 1ISSA 3L79A 1FS5A 1YQEA 1R88A 5IUJC 3K0FB 4QQNA 2PMWB 2HJWA 4CLDA 1CZHA 2V7UA 2GS9A 3OTQA 4IRXA 3HA5A 5ERXA 1R4AA 4HS9A 1D1SA 2BFCB 2FZEA 5F23A 1XP8A 1PT5A 3THOA 3D8BA 4DC0A 2BR5A 1WW8A 4P4OA 4FDAA 3SZ2A 3I9MA 1Z25A 3DE7X 3FNBA 4EG3A 1N5LA 1UZLA 1N6RA 4DO9A 3GPBA 3MUOA 1XYYA 1LBIA 1UMDA 1NMXA 2ZJ3A 1FFXA 1CUGA 3RJJA 1UPBA 2CNKA 1QU2A 3KJIA 2JAHA 1M10A 4JUFA 4JC5A 1ZIPA 1XR3A 1L8QA 3O47A 5J2EA 4C8LA 2O3TA 4LZGA 3G59A 3F7TA 3M5PA 4MKZA 3RC3A 3OGUA 1O5OA 1BN7A 4MTCA 1V47A 4L4UA 4B6PA 1OBVA 4G81A 2OGWA 3K8ZA 4HGPA 3FNQA 2PUEA 1MX1A 2VZEA 4GPIB 1P91A 2WV7A 4QYSA 4B6EA 5KINB 4LCEA 2CXXA 1GPUA 2OESA 4JSYA 2YW2A 1I36A 4PSDA 8ICNA 3I73A 2PXXA 4L50A 1FTWA 3FHLA 5CAEB 1LX7A 2YWGA 3C4QA 4KDEA 5TMDA 1PAUA 1V2GA 3G3EA 2GD6A 3ECAA 9ICVA 3RSCA 2Q5OA 1HI9A 1H5UA 2AI1A 1M9NA 4LMBA 1GM5A 1Y6ZA 3KG2A 1CDOA 3GLGE 4MUFA 4GR4A 3ZG6A 3IJPA 1P5RA 1CUJA 4WKNA 3WB0A 1GPBA 5BWLA 2Y71A 1RYEA 2IPAB 5CR9A 2B34A 1UBEA 2YN2A 1KFEB 2PQMA 1MR3F 2I7XA 4OMUA 1TMKA 5K01A 2RJ3A 1IXZA 4DSZA 1PHPA 3OLCX 3HDVA 2Y1XA 4FUQA 1VIYA 2H08A 1JDPA 4YD1A 2BYTA 1LDBA 2FG7C 1XPUA 1PGOA 4LPSA 5TT1A 3TVTA 2RGRA 4QOIA 5AHRA 2K7ZA 4MYUA 3A05A 3IVAA 3SHVA 1GDDA 2HIHA 3H65A 4XQCA 4Y18A 1B8UA 2GZRA 4TYYA 5HE9A 1Q8KA 4X93A 1QFJA 3WMEA 4E6EA 3B6JA 4MKRA 3FPGA 3O7WA 3BILA 2NRXA 3KELA 2P2GA 4MPRA 4JCCA 4IHJA 3WK8A 2NMVA 5KX5F 1U1EA 3NU1A 1WSBA 4M1OA 2JRLA 3ZC3A 5CLGA 5ERYA 1FDOA 2QYHA 4WTOA 2PIDA 3LT5A 4XUDA 3G8YA 5DBEX 3A37A 4F5ZA 1M3SA 3RRBA 2HL6A 4EUFA 3PJEA 3AEUB 2VPWA 3WHLA 1SQSA 1SY7A 5EPUA 1S2NA 3O73A 4JODA 3KOUA 3HKCA 5JRTA 1LDMA 4ZI7B 3C5HA 3IO5A 2ZJ5A 4C8OA 3K0CA 5KYXA 1R6DA 1JQ3A 1QYIA 3OM0A 3AI2A 3U4QA 2ACWA 4W4TA 1JMVA 5ALSA 2NSDA 2WV9A 1QU3A 3E1GA 3GEDA 1FFDA 4D4IA 4ECAA 1F8YA 5F1YA 4FN4A 2VUIB 2FSIA 1BKYA 1GQOA 1QP7A 4HGZA 1WVGA 2NWQA 1C3OA 2H4WA 5DT2A 5JBNA 2L2QA 2YWRA 1L5HA 1N2ZA 1Z7EA 3Q7TA 1Q0ZA 4ALNA 4X45A 4DFMA 4ADSG 4M76B 1ENPA 4PNEA 2J0EA 4XFJA 2PSDA 2V0GA 4RAOA 3ZDZB 3CU5A 2GA8A 3CB4A 1GNLA 1KSGA 1WJGA 1JQJC 4PG5A 3KDSE 2BW0A 2VF4X 1LSJA 4WV3A 3GQBA 2BI4A 2CT8A 3RLFA 4X1OA 5JD6A 2E55A 4A0QA 4RNCA 2NYVA 2YFQA 3N9IA 4PZPA 4OXXA 2C9MA 4DMCA 1ZJZA 4NU8X 3IQWA 4PBRA 3CC8A 1ECGA 4WNAA 2HK8A 1KVQA 3G2MA 3JWJA 3OHAA 3I58A 1KGDA 3CXRA 5IN5A