4KX5A

Cytosolic 5'-nucleotidase iii complexed with cytidine 5'-monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytosolic 5'-nucleotidase III complexed with cytidine 5'-monophosphate
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase 3
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx5A01
3U7EB 3OCYA 4YH1A 3CZ4A 4OHFA 3B8EA 1J97A 2MU1A 4BBJA 2PKEA 4XPZA 3DAOA 4BNDA 4CE6A 1S2OA 4HGQA 5A3QA 4UAVA 1Z4OA 3N8GA 1TA0A 1AQ6A 1Z4NA 4BX0A 2OYCA 3I76A 3SD7A 2P11A 2W4MA 4EZEA 1F5SA 4Y2QA 2WFAA 4UU1A 2WHEA 5FP0A 3QU9A 4KNVA 4AP9A 4YGYA 4C4RA 2IYEA 2ZBEA 3EWIA 1SU4A 3SHQA 1LTQA 4OFZA 1Z4LA 2RARA 3AR5A 1T5SA 4BYGA 2BDUA 3L8EA 4EEKA 5AI0A 1O08A 4XOUA 1Z4PX 4EELA 2NO4A 2EARA 2ZOSA 2JARA 3L0BA 4BX3A 3QX7A 5ALGA 5AI6A 4OD0A 2B1QA 1RQLA 3WK5A 3QLEA 2FPWA 1K1EA 4MWOA 4HGOA 4F72A 3AR9A 5ALJA 3PGVA 1RRCA 3L1VA 4NWIA 1LVHA 4IG4A 5ALEA 2YBDA 4JB3A 3FGOA 4UMFA 5AM1A 3WKEA 3KD3A 2R8XA 4Y3UA 2OM6A 4AS3A 3I1YA 1L7NA 3WK9A 3U7GA 1X42A 4RESA 1NF2A 5AIBA 3N07A 5ALFA 2FUCA 3AR7A 3MMZA 3N28A 3QUBA 5AK6A 5ALPA 3ZU6A 5AKYA 3J7TA 3U26A 2B8EA 4AS2A 3ED5A 1WR8A 5AESA 2IOFA 3OCUA 5ALOA 1Q91A 3ZTWA 2C4NA 2QLTA 5AVZA 4Y2VA 4PNHA 3L8HA 2JAOA 3R9KA 3HLTA 1N8NA 5AW7A 3ZW7A 3OTQA 4JDPA 2HCFA 3QUTA 3L5KA 3WK8A 4UMDA 1QH9A 3I28A 2AGVA 4UU0A 3AR3A 3AR4A 1J8DA 2ZBDA 1L8LA 2GHQA 4QJBA 4BNDB 4CF5A 3E58A 2B82A 5ALTA 2HI0A 3I6BA 3BA6A 1XP5A 5ALRA 5ALKA 3W5AA 1U2TA 2BDEA 4EENA 3NASA 3UMBA 5ALVA 4UM7A 1Z4IA 2FPXA 2B0CA 4I9FA 2FI1A 4BX2A 1SWWA 3A3YA 5AM5A 2EATA 2GHTA 5AW6A 2GMWA 2YY6A 4F71A 5AK3A 3KC2A 5AVSA 4HAIA 3ET4A 3IB6A 2IOHA 3SKYA 4DW8A 3L7YA 3QU7A 1RPZA 3OPXA 3N5KA 4MUMA 3MN1A 1ZD4A 3U7FB 1YJ5A 3R4CA 2O9JA 2W11A 5ALNA 3PDWA 5AW2A 4XE5A 2B1RA 4UW9A 1U7PA 5AKIA 3W5DA 4Y2JA 3UMGA 2PQ0A 3SF0A 2JAWA 4Y2RA 1Z4MA 4GIBA 5AVVA 3KDPA 2C8LA 2YN4A 3ZWKA 4J2TA 3WKAA 3WKCA 2WF9A 4C4SA 4YIHA 4L6AA 2Q5EA 4UATA 5AW9A 2G1AA 1RC8A 4DCCA 3DDHA 1TJ3A 4BKMA 4YCLA 3FM9A 1Z4QA 2MSNA 4UMEA 4Y2PA 1XVIA 1L7MA 1RLTA 4G9BA 2OA0A 3QU2A 2FUEA 3MC1A 3NAMA 3PGLA 5AK5A 5AVWA 1S8OA 5ALLA 3EPRA 1WZCA 3SLRA 1FEZA 3QGMA 5A3RA 2GFHA 2G07A 1KYTA 5AIAA 5AW8A 3B9BA 2OBBA 2G0AA 5AW5A 2ZBFA 5AKXA 5IT4A 1L7PA 2I33A 5AI4A 3WKDA 2VKQA 4C4TA 3ESRA 3L0CA 5AKZA 2AMYA 4G63A 2FPUA 4CF4A 3NIWA 2YJ4A 3E81A 3L1UA 2R8EA 2YJ6A 2HOQA 4YCNA 1QQ5A 5E0OA 5ALYA 1Z88A 2RAVA 3D6JA 2B8JA 2EAUA 2I6XA 2IA5A 2YMQA 3RFUA 4Y2YA 2ZXEA 4ZEXA 4OCZA 5AKGA 5AK4A 2WF8A 3GYGA 1RMTA 2IOFK 4B6JA 5IT0A 3S6JA 2AUTA 2G80A 4Y2SA 3KZXA 1Z5UA 1VJRA 2PR7A 3NALA 3NUQA 3TLMA 3R09A 4KX3A 1NNLA 2YMLA 4FFDA 2G09A 1L6RA 5ALHA 1JUDA 5AKLA 2D2VA 3WK6A 3A1DA 1QYIA 2FPSA 4RETA 2ZG6A 3OCZA 1YMQA 3OCWA 2O2XA 4BEWA 2G06A 4UARA 3KBBA 1ZJJA 3HYCA 3W5CA 2JAUA 3P96A 4L57A 1YNSA 2NO5A 4KX5A 2NYVA 4UASA 5AVTA 3QU5A 3WKBA 4NAVA 3ZX4A 2I55A 3AR6A 2YFYA 2B30A 3ESQA 5AKHA 2I34A 5ALQA 4UAUA 5AVXA 2FEAA 2WF6A 1YDFA 2BY4A 1L7OA 5ALXA 3QNMA 3QXGA 2C9MA 3QUQA 2HEGA 4Y2XA 3WGVA 1ZS9A 4XQ0A 2GO7A 3ZTYA 3QYPA 3MPOA 3U13A 2WM8A 4Y2TA 5AM3A 4E88A 3K1ZA 4YCMA 5AI5A 1U7OA 4H1WA 3NANA 1VFPA 2I54A 3U7HB 3E8MA 2YJ3A 4DWOA 4KYTA 2C8KA 5JJBA 1WVIA 2CFRA 4BEVA 5T41A 3M9LA 3OCVA 1ZD3A 3M1YA 2HDOA 1RDFA 2HF7A 2C88A 2Q4RA 3N1UA 2FPRA 1U2SA 1VJ5A 4QQFA 3ZVNA 1L8OA 3QUCA 2HSZA 2G08A 1CQZA 2ODAA 1RKVA 2I7DA 3SMVA 2JGAA 2FDRA 2YJ5A 3SKXA 1RLOA 5AICA 4O8CA 3BWVA 3OCXA 1Z4JA 2P27A 3DV9A 4GXTA 5AM0A 3UMCA 5IS2A 3IJ5A 1ZOLA 4CF3A 2RB5A 3L8GA 2CFTA 1NRWA 2HO4A 2YMMA 4HGPA 2DQSA 3KOOA 5AKKA 2P9JA 1T9ZA 5ALUA 5AKJA 5AW0A 2R8ZA 4Y2UA 4NV0A 3B9RA 5ALMA 1CR6A 1WPGA 3W5BA 3ET5A 1PW5A 3E84A 3ZWDA 4FYPA 3DNPA 5ALDA 1O03A 1YV9A 1RQNA 3WK4A 4J03A 2HF2A 4I9GA 3ZI4A 4KN8A 2W43A 3WK7A 1YS9A 3ZVLA 1SWVA 3ZX5A 5AM2A 1T5TA 5ALSA 5AW1A 1RLMA 4ZEVA 3L0YA 1TE2A 1Y8AA 2HX1A 1TJ5A 5AVUA 2YMPA 4NFLA 2Q4TA 5AI8A 4HGNA 1RMQA 1N9KA 3U19A 1EK1A 3PCTA 1QQ7A 4UM5A 1RMYA 3ONNA 3UM9A 4EX7A 5ALZA 4KNWA 1RKQA 3FPSA 2HHLA 5AVRA 2P69A 1Q92A 3IRUA 3EF1A 2CFSA 3A1EA 1ZRNA 3A1CA 3NRJA 2CN1A 1ZRMA 2ZBGA 4HGRA 3AR2A 2WF5A 4CNQA 1QQ6A 2R8YA 1MH9A 3CNHA 3AR8A 3ZUPA 2QYHA 3VAYA 1TJ4A 1ZD2P 5AHXA 5AVQA 3QU4A 4DFDA 5AM4A 5AW4A 5AW3A 3FZQA 4UMVA 2RBKA 5AVYA 3EF0A 1ZD5A 4IFTA 4NABA 1EK2A 1IWOA 3WGUA 1XPJA 3F9RA 4YIKA 5ALIA 4L6CA 5A3SA 1U02A 3ZVMA 5ALWA 5AI9A 4ZEWA 4EX6A 2AH5A 4HYTA 1Z4KA 2X4DA 1Z5GA 3L8FA 3FPBA 3RF6A 4FE3A 1RKUA 3FVVA 5AKEA 2WF7A
chains in the Genus database with same CATH superfamily
4YPVA 1ZU5A 1E2FA 4GE3A 3NC0C 4PLCA 4P08A 4LVCA 7ICPA 1P4GA 1I1OA 4UUBA 4BUJA 3AM3A 4KMRA 2EAOA 9ICNA 3Q6NA 3RIXA 5CB4A 1UK9A 5F1YA 4YXJA 4GDFA 2B0JA 3PLRA 3ZG6A 4DR3B 2O8EB 1UAGA 2O8FA 3MFIA 1L2TA 2FZEA 2G5PA 1AZTA 2ZSBA 1Y37A 3TOVA 3G2QA 5CH8A 4Y9DA 1XG5A 1XIVA 1RPLA 2EZUA 3C5HA 3ZU2A 4CLXA 5B2FA 4URYR 4EKEA 4Q4CA 4XGKA 1W34A 3X1XA 3O83A 1Y9EA 2OYCA 1PN3A 4QYXA 1NXVA 4WZBE 2X1VA 1I5OA 1HE4A 2EYQA 5LZ4A 5JPCA 4UQOA 2OXFA 3BFVA 4ZOBA 4TROA 1J42A 1QRDA 3LCRA 4TTVA 3IIEA 1IG6A 3BIWA 3DDSA 4OJPA 3U49A 3QPWA 1BGWA 3U60B 4UAGA 3WTBA 1IK4A 4LKOA 3KPUA 4MDHA 3N2GB 4D9IA 1EB9A 2FE9A 1QCYA 2H0RA 3WX0A 4ZI7A 4DGSA 1JRPA 1KDZA 4I8DA 2KI5A 3AUTA 2Z3WA 2ZRAA 5EZ5A 4S0XA 4PG5A 3WLFA 2ZWMA 3OA2A 4H27A 2F77X 1I3KA 2JJ2D 5DBFA 3E0FA 3USES 2XSZA 4KN7A 1E3EA 3I30X 2WUVA 2RH5A 4ZV9A 2PFOA 1ONOA 1Q22A 3MCAA 1Q1BA 3AJ9A 4ETWA 3JARB 4I3FA 3OT1A 3FCOA 1M34B 4HGOA 1G0NA 3FETA 4QXOA 5C1PA 5HUQA 1VHTA 4XJXA 3V4OA 1Z8HA 3PQDA 5IBQA 4UNQA 2QK4A 3Q88A 5FPYA 1J9ZA 3UMJA 2O5EA 4TLMB 1IY1A 1LVHA 4RKYA 1MMFB 1BCRA 1E0JA 7YASA 2QJFA 2J0QA 3IMFA 3K9QO 5A71A 3KD3A 3IX7A 4BGIA 4DBZA 5J0YA 3OTHA 2QTLA 3PD0A 3V46A 3HBMA 1Q0QA 1SCIA 4II7A 4K7JA 1E18A 5FPKA 3PSIA 1U8UA 3LO5A 1RM0A 1GPJA 3ENQA 1THMA 3T3IA 1OUQA 4BMYA 4WBNB 5JASA 1ECJA 1QH1B 3DZGA 4KLQA 4A2WA 4D3YA 3N07A 4DAEA 2DXIA 2QBYA 2R00A 3AV0B 3GK3A 3WGLA 3AEYA 3I1IA 1NN1A 1OLSB 4KLSA 3KPVA 4NIMA 2CMHA 1RAHA 4X8LA 5IUKC 3CEJA 5IF3A 4AP5A 1PD0A 3OHBA 3MLEA 4IIVA 4O08A 4POOA 5J4KA 2QXUA 3D81A 4WZBA 3ZGYA 5KQMA 3OQIB 5B1IA 5JS2A 2QJWA 5LIPA 10MHA 1GLVA 5AESA 5A7GA 2SBTA 2YR0A 2P6NA 2HNKA 2XR1A 4Y98A 1Y1RA 4NCKA 3N0RA 4PNHA 5BRJA 1N5IA 3GWZA 1N5RA 4IBOA 1SBTA 2CSXA 1YUNA 3T0IA 2ZDQA 3ER6A 1SOMA 3ZDZB 1G0OA 1TW3A 2O3QA 3LBNA 1UBJS 4ZEOA 3N2KB 3WK8A 2Q3HA 3IYLW 5UKDA 4ZTZB 4GI1A 1QG4A 2WHXA 1TLFA 4M83A 2Q7DA 3HKEB 4JXJA 5BSGA 5JS1A 4IJ5A 3MJEA 4B6SA 2RJ3A 4V1CI 1FMCA 4UM9B 2CJFA 2HDHA 3I6BA 3OVMA 4IINA 3VQTA 5A0LA 3M6FA 4I99A 4TQ9A 2BHRA 2QVCA 4DDMA 1IONA 3RFAA 1HG1A 1TT7A 4ASUD 1KPIA 2CSUA 3H0LB 4MQUA 2IYPA 2YWCA 4KQKA 1C41A 5DV9A 2Z8YM 5J2UA 4DQ0A 2GMWA 3EVGA 3CE6A 3PXDA 4FFBA 5DYTA 4KWTA 3MHPA 1XF1A 5P8WA 5CGZA 1I0ZA 4V03A 4ZGBA 4LJYA 1GDDA 3FR8A 4PS0A 5K3DA 2WWHA 2IXAA 4H7DA 2W42A 4ZQIA 5G02A 4ZZ0A 2HQOA 2VA8A 1C0IA 2AR7A 3L7IA 4G4SP 4U2GA 4XEHA 3T35A 3B13B 3CWZA 4OO3A 1KFCB 4XH9B 1S0VA 1R3UA 5JNTA 1II8A 2DY0A 3T7RA 1U7XA 4TLEA 1T1IA 4IIYA 2AYXA 2E4WA 4N5MA 3Q8KA 4NHOA 4F4YA 3T5CA 1RXIA 2XA1A 5BYAA 4I2NA 3U44B 1KIMA 1PJTA 1RC1A 2B4QA 2P9BA 3CUUA 4X3PA 5H1YA 1QFSA 3UWPA 1ECWA 3JXEA 3PBKA 4WCFC 1A4UA 1DKPA 2WHYA 2Z8YA 5G0VA 1JG1A 1X7WB 3EBOA 1XMSA 2D1RA 1FNSA 3B12A 2YN4A 3S2IA 2V97A 4IF4A 4NFSA 4ED3A 2LBPA 1EVIA 3K8OE 4ZVLA 4XWGA 2KHVA 1YS1X 2VPWA 1HEYA 2XUOA 4F2WA 4DR2B 3VRHA 4RM3A 1LJLA 3QWIA 3E70C 2Z1DA 2E2WA 4TQUS 1QAMA 1S8FA 5JS7A 5FA6A 1B23P 1A96A 1L7XA 4QO8A 4Z1MA 2VWPA 4GOJA 3UAVA 4BNFA 4F2DA 1UBTS 3TBHA 5IHXA 2IYAA 5AK0A 2D1YA 1NUQA 3E9QA 4WA8A 5B37A 2PYZA 3VR5H 2A78A 3G0DA 2PE5A 2Y0EA 3R3XA 1FNMA 3F1KA 1I7DA 4LF8B 1Z37A 2GBFA 1MN6A 2O3TA 4EB8A 1GFSA 2VJAA 2ZPAA 4YX9A 4BRUA 2W70A 3I2KA 3TD9A 3ROXA 1V38A 2PGDA 5FCDA 2Y0CA 4RULA 1U8YA 4CMHA 1S8OA 1ZVQA 5K8VA 3GLUA 4CLOA 2RCYA 3OURA 1WKBA 4KCGA 4U3JA 4XD7D 4ZT4A 3SBDA 4OB6A 3SLRA 1GCIA 2HDNB 4NCXA 4R9RA 2PJRA 1F7UA 4LJ9A 3AUSA 1K3FA 4KVZA 3LL4A 4WY2A 2DZDA 5JCZA 5J23A 3QEMB 5HE9A 3STTA 4EPTA 3VKGA 1VL1A 2ZS7A 1Q8KA 4KGZA 1AX9A 2G25A 2HRQA 1H3EA 3GH3A 2VDQB 1W46A 3AM4A 3AW8A 2FX2A 3LPLA 4HEA6 4H16A 5FHRA 5JQGB 4RVUA 4OHKA 4B3JA 5F78A 3LUHA 3E3AA 3S4YA 1WX1A 2PS3A 3JWGA 3PHCA 3V9PA 4AQDA 4IMIB 4L3OA 3PQCA 5F5LA 5SY6A 3AL0C 3IUBA 3HADA 2FRDA 4OKIA 4AAYA 3ZD6A 2IUEA 3B85A 4Z6EA 3EGWA 4MVJH 2XICA 4NXZA 8ICYA 5KFXA 1WY7A 3KOXA 4BMPB 1U7WA 1VZ3A 2KFZA 1XHFA 1SUPA 4QIHA 5ETJA 2FFRA 4C3VA 2YMQA 2CLSA 4MCJA 5JAHA 1MKYA 8ICOA 2Z9DA 1G98A 3B5JA 4JKYA 1OY1A 4L1KA 5JNLA 3L92A 3OD1A 4CKCB 2KN7A 5AXDA 121PA 1ZSYA 1QKIA 2D62A 2DQZA 4FGSA 4KMSA 1TLLA 4MWEA 4Z9YA 4ZVVA 4X00A 4BFVA 3WNVA 3F53A 3C21A 1NBME 3MSCA 5EVJA 2XMCA 2DGZA 4F4CA 2P0EA 2ACKA 3GJXC 2EQAA 3EPKA 1COWA 2P6OA 2VRBA 2B3DA 3D7RA 3GQBA 4BO0A 1NIPA 5TY0A 2XVYA 2AG1A 5C7LO 1TA4A 3JAWB 1N62A 1G41A 3JYHA 4MP3A 1KQ3A 2X8JB 5I01A 3VJRA 3H9EO 2D2XA 4LQCA 4DYDA 1PZFA 3OZRA 3W3AA 4YRIA 4UQLA 1L7EA 4WJLA 4DV7B 4U2EA 3WLPA 2BFWA 2AYYA 5KYWB 1DBQA 2NQ2C 1GUAA 4ALIA 3SK0A 5CEJA 2FJ6A 4F4ZA 2BM0A 2L82A 4EG1A 4JP1A 4YRQA 4UARA 2C2DA 1CUAA 1EBUA 1O6ZA 2NPOA 3OJWA 4ED9A 4QPDA 1PVQA 1C5KA 2XO7A 1P7VA 2JCYA 4DSUA 1F9AA 4CQMB 1BYIA 5EL0A 2IP4A 3OZAA 4HRAA 5KTYA 1DAKA 1JEEA 1VJGA 3M6LA 1AZLA 2R8GA 3C6YA 5CCEA 3QU5A 5TT0A 2DFVA 4JI3B 1T9CA 3IJPA 4J0KA 4NS1A 5JNSA 3A26A 1DX4A 5B1HA 3HPOA 2VF8A 3D31A 4EGSA 4UAUA 3O8QA 3N87A 1Y6JA 4PHGA 3O4IA 1P17A 1I32A 5FO0A 5F9LA 4KAFA 1FFEA 2LW7A 1E0DA 2Q3EA 3QV2A 4B8ZA 3HEBA 3EYZA 3H1AA 1PFUA 3AFIA 4QX6A 5KTOA 4Y2GA 2EW2A 1DTWB 1P9WA 1R6XA 3IURA 2JAXA 4Y2XA 4DAOA 1IHUA 4UUAA 5K9ZA 4AMYA 1S0MA 1P3JA 1XTKA 1JKJA 1WOMA 2FJPA 3W1VA 2DLCX 1BGVA 3KVRA 3U13A 4HRYA 3TR6A 5CA1A 3U6BA 3DCJA 5DB9A 2WQ6A 4UDOA 5AR1A 2J6TA 1JTFA 1BVSA 2OQ2A 2CXHA 3OLVA 4Y1GA 3EGVA 2IIQA 4F3YA 2H06A 4YCMA 1E61A 4YUYA 5HK9A 3IHWA 3G9UA 4OAQA 4G86A 2X3YA 3BCHA 4FW8A 2P6UA 2AEEA 1DC7A 4NCJA 1G291 2BFBB 3MGHA 3UUWA 1IEVA 1XYGA 3EOBI 3EVNA 3E8MA 2D1SA 2TMKA 3FNRA 3KPJA 3OICA 4Q3EA 2PUAA 1MB4A 1I9CA 1R0WA 1UMCA 4HXFB 2FLLA 1VIYA 2MSWA 1T9DA 5EFZA 4GBMA 5JCPA 3JS5A 2BEVB 4CUJA 3SE7A 3SICE 3G8DA 4E1AA 3WYDA 3OFSA 4QDJA 4EL5A 4ER0A 2VJDA 1ULZA 5EE1A 3TLGA 4D4HA 5DNYB 3ZWCA 1DVRA 1O87A 1GZ6A 1SCDA 4UM8B 4DJ5X 1N1EA 3N7AA 2RH9B 4QYTA 4ZRNA 1CY6A 2PLWA 1FU8A 2DYKA 2ZDGA 4FINA 2B92A 1R0KA 4YQYA 3HO6A 3K4QA 2V4ZA 3S44A 5A5DA 4QVIA 3OEED 4MMXB 1Q84A 1XTJA 5C5DA 1Z33A 2ZVPX 4MQ4A 4PCLA 4B79A 5FBRB 1WHSA 4CLEA 5KTPA 2O54A 5B7NA 4XYBA 1SA0B 4MK4A 1RM6C 4ETIA 2YJ5A 3PQ8A 5LZ2A 3BE5A 1A72A 1W2HA 3COPA 4HB4A 1XJCA 4CMKA 3M83A 4DV1B 1JYFA 1QDLB 2K4HA 1I80A 1Y33E 3ENKA 1UJNA 2P66A 3GLFA 1EQ2A 3OZCA 1O0CA 5KMGA 1PHRA 1DGJA 4O2BA 3V55A 1AO0A 5JCOA 1HKUA 3P0FA 3RAQA 1B3BA 3V7JA 2F00A 2HLNA 2ZKIA 1E2KA 3E2EA 3LDUA 4JEIA 4GMHA 8ICAA 1KOJA 2HAEA 2J0UB 1YJQA 4J16C 1MJ5A 5F4ZA 2WIGA 1NBAA 7ICVA 1ISIA 3SS7X 3T41A 5JS6A 3H5RA 1JECA 3D1JA 2QMOA 4PYRA 4IRDA 1Y8CA 4FKMA 3UJBA 3WZ2A 3T38A 4XM1A 4BDSA 3QA3E 4IQFA 4ALNA 4E2FA 2V7PA 3OZGA 5IT9A 3BKXA 3ESCA 5EKSA 1ODKA 2VXCA 4MS3A 1RP1A 1YZ7A 1WWVA 1RYSA 3BULA 3MAJA 2XWBF 3ML1A 3CRMA 1DXHA 1DBVO 1E1YA 2WSSD 1WXHA 3G2IA 3NBXX 4FYKA 3BFPA 4TXNA 5CPFA 3W3ZB 4NLLA 4PR0A 4U00A 4CEHA 3UICA 3CLUD 1VOTA 4H7FA 3O2JA 1LSUA 4EG4A 2B8NA 2ZPTX 3ETDA 2CE2X 4BUGA 4OPMA 5FPTA 1LLFA 2KZMA 4EBBA 1U99A 2ZYVX 3IS3A 3NAQA 4JASB 1EE2A 2XRYA 3A4NA 3RH6A 5ILGA 2AG8A 3VAAA 4FDTA 4I2HA 2ONZA 3C3MA 3EIOA 4EGQA 3I3OA 1U48A 3C43A 2FN7A 3JWHA 4L22A 1MAUA 1RCFA 9ICLA 2HF2A 2OV8A 2P5SA 3C1ZA 1YZHA 1E5XA 2FFHA 3IILA 3QK7A 2Q4DA 1A8QA 4KN8A 4OJYA 3JWIA 1XZBA 1B0UA 2QYSA 3BSYA 4RYDA 1HE1C 4UCWA 3CX6A 3Q3EA 4F8RA 4HBZA 4I2IA 3HY3A 3L0PA 4WOBA 1CQIA 1J7JA 2XIDA 3B9JA 1EM8A 1L8XA 1L0BA 4DQRA 2Y1OA 1JG2A 1N3IA 2XXBA 4MWZA 4QJ5A 3THSA 4CM4A 3ACDA 3TUZC 3KXKA 2D2FA 1O57A 2D1FA 2J3LA 3LBAA 3O31A 3IHKA 2DFDA 4BFCA 3KSRA 4BB9A 1ZXLA 1XCOA 2ID9A 1M0WA 4TWJA 4CMEC 4ZK6A 3KNZA 1RQ2A 3QX9A 3N6XA 1LRJA 1R0ZA 3A6JA 2VQFB 2ISOA 2FSVC 3ACCA 1ZJZA 2F59A 1FNDA 1TU0A 4X91A 1SVWA 3ZDXB 3BX1A 1VL5A 5KFWA 2JLXA 2GPJA 4E2YA 5EJ6A 1HXHA 3O82A 1JQLB 5TPWA 3TBKA 1WMEA 3VR3A 1U8ZA 4KE6A 4YBRA 3SSAA 3HJHA 5JTIA 1JMSA 2FETA 3WGTA 1MF7A 1L4YA 3DW3X 4MW9A 3ORHA 4GC6A 4UDNA 4XD7A 4ZODA 5D84A 5IM5A 1LS1A 2NSHA 2R8YA 2B5OA 5F33A 3T7AA 3K1YA 3IVRA 4YRCA 1AF4A 5K0BA 3OE7A 3W6PA 2H1SA 3IDAA 2P7HA 4QRHA 3HB7A 3O94A 2BTQA 5K6AC 2RP5A 3AEKB 4IZIA 5J5CA 1QRUA 2GZAA 4EY7A 5DG9A 4W5HA 2BP7A 1GGMA 2DP4E 4YQFA 3K9FC 3SC4A 4JROA 2W03A 1HUZA 1ZD8A 3PTAA 1PNQA 4M7PA 4WNAB 4GWLA 5K0JA 2H0AA 1FOEB 1OT5A 3C2QA 2XB9A 3DCYA 3UPUA 3GPCA 1A7UA 2WIBA 1HIWA 3HR7A 5BN5A 1I2MA 1AIPA 1X7YB 3ZDFA 3OLYA 2ASVA 4K9LA 2VUIB 2FN9A 4OHOA 1IC6A 3P1JA 4EFNA 1BEUB 4IDHA 5KNCA 1VMAA 4Q9KA 3TRFA 2XEDA 3RF6A 1J1UA 4X1OA 3DDCA 2XZTA 1HTBA 2RIRA 1X1BA 1NVAA 5HHIA 1XNJA 2BTOA 3JQ9A 4PR3A 1OYVA 1ZGHA 3PQ4A 3TE7A 3DMFA 1BDJA 4UZFA 2R11A 4O6VA 2C2MA 4MO9A 2FMXA 4JJFA 2XOKD 1MAWA 1OLOA 2OHVA 2EIXA 2ASJA 2HUNA 1KEVA 4DMFA 1SVIA 2VUTA 5KX5A 3EGXB 3KWJA 1XB2A 1UP6A 4FE7A 1NVKA 4JGBA 4YN3A 4B7XA 3EPJA 2XTMA 4N9WA 1A8SA 2Z6VA 4HVAA 3JALA 4GOMD 1B1CA 2XWJI 1C3JA 3EMKA 3NGMA 3L7CA 3A1NA 4IIBA 4BFLA 3EIEA 2G72A 2R6GA 3FYTA 3KX2A 4OHWA 1GGNA 4YMWA 2WOOA 1Y9JA 3ANNA 2PUEA 3CGWA 1M0SA 1YVEI 3EWIA 5F3DA 3RW9A 4BRSA 1E98A 2FPGB 3V1LA 4D9GA 1R5JA 3OZVA 2QRZA 2VDLB 4Y0NA 4YJFA 2VDRB 5J58A 5DLPA 2E21A 4HV4A 2QN1A 1FFYA 3KKNA 1QGYA 1EVEA 3C1AA 3VV2A 1QIHA 2VJOA 2ZRBA 3E2IA 2QX6A 1R4MA 1SIWA 3L1IA 4P2GA 3BXFA 1KE2A 1PJBA 1SIJA 1ILEA 4H35A 5K3AA 3MINA 1GTZA 4XOUA 3T34A 2J5BA 3RU7A 4X8OA 3TOSA 2FQ1A 1CUCA 1EQUA 1LPNA 3GP5A 2JRLA 1ZWLA 4KMOB 4FIZA 5COAA 1MO4A 3L0BA 4ZO9A 5D8DA 4PIMA 1J2EA 4O4IA 3OMXA 3PEFA 4OKSA 2GPYA 3HSKA 2D1QA 5TGZA 2NUTB 1JQKA 4F11A 1SKAA 2H1CA 5D49A 4LRWA 5D3MA 3ZK9A 3ZV5A 4OLBA 4F72A 1ZCBA 1FLDA 1KORA 1JBKA 3UBMA 4BV2A 2EEPA 3L1VA 1JEOA 1U90A 4F91B 3OHAA 2YZKA 3IMEA 4UTXA 2BV3A 1W48A 4IEFB 1RZVA 3WKEA 3TMAA 4IZOA 7ICTA 1ADCA 4RNNA 2PGLA 1WLSA 2JIZA 4XTCS 4Z7NB 6REQA 2UV8A 4IDPA 1M74A 3BQ1A 3DLCA 1CS0B 4DILA 5L4NA 4WCVA 3RT9A 2DTEA 1L7NA 3C41J 3MABA 4YB8A 3MRTA 3NDIA 4EYOA 1Z8FA 4LCJA 5BN4B 2H57A 4UCXA 3T5TA 3L6CA 3ZQKA 4YRPA 1K06A 1ZGBA 1IBRA 3OE4A 4Q1CA 3BB1A 4A36A 3R5XA 2I1WA 1WCXA 3E9YA 4RYLA 4WW0A 5F7OA 3K70D 4Z7QB 1F8GA 3IN5A 5C3UA 5AJHA 1KBUA 3FNHA 1T2CA 3BWXA 4URXR 3I9KA 1K0UA 4K6HA 4OMFG 1TYDE 2QAJA 4NZMA 4M8NE 1M10A 1CCWA 5KAFU 3LJKA 3E2MA 2E9SA 4Q01A 1Z0UA 4DMRA 2CGEA 3Q85A 5GIOE 1PV1A 1KZ9A 2PBRA 4C88A 1CVRA 3J80A 4KMMA 1ZQKA 1TCUA 3ZW7A 5T5QA 2C31A 4GQAA 4CDMA 1MZPA 5E6UA 5K01A 2ZIVA 4W6QA 2P9YA 1L8AA 1ZQCA 1C8BA 1R4NA 2IPNA 1CE8B 2PVSA 2QG4A 3RSZA 3FSJX 2EJVA 2F3PA 3NX4A 4QHTA 4CF5A 1CUDA 1ZGZA 3F6RA 3RJ9A 4DL3A 2HVHA 1IN1A 2B82A 3JZIA 1JA0A 4P0PB 3D54D 1QH8A 3QY0A 1NX9A 1TM3E 2IZ7A 3HU1A 3LPCA 2A5LA 4BUZA 2IH2A 2VCEA 9ICIA 3RABA 1U3TA 2HHTA 4RC9A 4D44A 3UXMA 3V1NA 5L4SA 2AKAB 3JU3A 3QW4B 4M8IA 2XWSA 4RF3A 8ICIA 1E2MA 2WD8A 4ECRA 3BE8A 4J3FA 1HSOA 2BCJQ 4JQCA 2HRDA 4QPPA 5CX1B 1ADJA 2IYYA 5EGSA 2CFIA 5FBHA 2NU8A 4DQDA 1KAHA 3IUQA 1Z73A 2PBFA 9ICVA 3KVNA 2WQZA 3OFNA 5AUPB 1BMDA 3IB6A 3QELA 3F98A 2O3UA 3AP1A 4X71A 3SGLA 3LQ1A 1P81A 3QEOA 3ZDAA 4JCCA 2HHXA 3B52X 2Y99A 1ZK1A 2O9JA 1JJIA 5JMWA 3IALA 1PR0A 1R27A 1A5AB 1JL3A 1I7QB 5KOJA 2BQUA 1PK7A 3GVHA 2R97A 3D4OA 2YZNA 4H6PA 4IOJA 1KJ9A 1OILA 4L8YA 4WN9B 4ZCSA 2AJBA 4O4IF 1JFRA 5KBYA 5KWIA 3S3TA 1DX6A 3ADPA 1USGA 3AX6A 1V48A 1DIGA 1UK6A 1ENYA 1ZFNA 2C04A 1NJ1A 2J5KA 4FMBB 2H3IA 4ZU6X 5AWFC 2XKKA 3KQQA 2JAWA 2QVBA 3AM1A 3C6ZA 3BE6A 4KO3S 1Z4MA 4GIBA 4DCGA 4UEWA 1GAQA 2H9IA 5J2IA 4RVSA 3TOXA 4B80A 2E3TA 3GLSA 4H1TA 4JOCA 1TEHA 3EC7A 5K0SA 2ZEJA 1YJCA 1REQA 2UZ3A 3GQCA 4HAVA 2XUJA 2AOVA 2AZ4A 1O54A 3EEIA 4NZNA 4R4JA 5EHGA 5F1PA 1XZQA 3GYBA 3KFXA 3NBYC 5DTMA 3V5NA 3M89A 4A2CA 2ETVA 4ACOA 1K75A 2Q5HA 4JL6A 3H84A 5ITWA 1T8YA 2YHBA 3NO4A 4JB8A 3BDPA 2I4LA 3IPRA 1VG0B 4OVKA 3SYKA 1V45E 4KQ9A 3RH4A 2Z58A 1ZM7A 3I2HA 1XVIA 4UUOA 4YRGA 4G9BA 2C2OA 1QBGA 4YJ2B 4CCSA 2PGIA 4HNRA 2AQKA 2EG9A 3I1FA 2LV8A 2Z83A 3KKAC 3FLAA 2CZCA 1WQ1R 1ZG3A 5ALLA 3EPLA 3EPRA 4B3TB 2YZ7A 4ZHSA 4JK3A 2DKZA 2R2AA 3LT5A 3PQ5A 2BGIA 1HF3A 2AI2A 3QF4A 4PPGA 3WMXA 3SV3A 4BNKA 2G07A 2ZIEA 1Z34A 4O4HA 2QN8A 3ROEA 5GONB 4MVJF 3DC2A 4HZGA 4FMCF 2XCUA 4B9UA 3LNCA 2I8LA 4E31A 1FX0B 5JAIA 5JTUA 2V3VA 5I8PA 3H2GA 4QYIB 2QTVB 4LC0A 4PZLA 3EIQA 1IXRA 3WKDA 1GZ3A 1Y1PA 2A9PA 1EBFA 2JD1A 4LK3A 4OFXA 4CMGA 4D79A 3EH1A 2C3MA 4LWQA 5JWRA 4GMXA 3IT3A 3K73O 3GLIE 1E7QA 2HEIA 1A50B 4MQFB 1JI7A 1ZQVA 3FPJA 5KPJA 3PSAA 6ABPA 3IG5A 1E59A 2Z3ZA 1WS6A 1V5IA 4C07A 5HHHA 2FMKA 7ABPA 4CCYA 3I5UA 5BUCA 4ZKDA 4QZBA 3UJ7A 4EHHA 5JYBA 1X8JA 2ZUEA 3BQ9A 2RKWA 5LP6F 2GFQA 3OTIA 621PA 3WI7A 1Z88A 3DPIA 3SHOA 4LDAA 1E9VA 4CLOB 2CXUA 3CGGA 1X7DA 2QM7A 1WSAA 1A4IA 1TF5A 2BDTA 2CMKA 4YJGB 3KQNA 2OYRA 1F8YA 3BS5A 2JRZA 3OQ1A 2OG1A 3GROA 3U2QA 4B3BA 5T14A 3WDMA 2X8AA 4UPEA 1OVMA 1ACMA 1BU5A 1CDOA 3L40A 4R8KA 3T9EA 4ESOA 3UTDA 4H60A 1EESA 4RJTA 1FMJA 4RNMA 2HTEA 4O4JF 4C7BA 1S2NA 1Z0KA 3NALA 5CX4A 2RGDA 3NUQA 3K75D 4IO1A 4NMLA 1WNFA 4FD2A 2ACEA 4LY9A 5LLTA 3K70B 1KJJA 4FQ5A 4TLCA 2I9GA 3FPHA 3KHLA 4GPIB 3GILA 1S3GA 2INGX 4I36A 3VPXA 4DIBA 1CZNA 3A27A 3H1EA 3Q7RA 4U5XA 3CVXA 2PJZA 2VYND 1YI0A 1SCNE 1YMQA 7ICGA 4G1CA 5H8WA 3LKZA 3ZHRA 2PA0A 4BEWA 4YRAA 4MUKA 1K3UB 3HWTA 1YXMA 1NQ5A 5KG2A 4AX8A 2B98A 2DTDA 3UFBA 4IQUA 3LUBA 4MVJG 3DOHA 1INLA 1Z7EA 1EX6A 4JV0A 2EW1A 3ECAA 3PNKA 3B1FA 4EZ6A 3A4MA 3ICCA 3QF7A 3K9NA 3P94A 1UXGA 3LNTA 3QUSA 3PX0A 4LC1A 1JFFA 4BO2A 5AXBA 5JZVA 1QLJA 4EB3A 2PL9A 3GUHA 2VDVE 4YUVA 3DTNA 2PL3A 5AQ1A 5IG2A 2VSOA 4JD5A 2KSQA 3THRA 1DADA 1Z68A 5JXHA 3HYSA 3QBTA 1P5FA 2EBWA 2QLJA 4LXIA 2ZXHA 2V74B 3N5CA 1KYIA 4KLFA 2BONA 3H9GA 4UC0A 5I7UA 3O3CA 2XXAA 2Z5VA 3GV8B 2DJ5A 3CB2A 1KEEA 1CJVC 3AF1A 2K89A 1NUHA 1U5CA 1E96A 3O1IC 4JYMA 3DAHA 1GJRA 4BZQA 4F3NA 4ZIRA 2GZ1A 2A0XA 4FS1A 4LSGA 2FE4A 5L95A 3IXMA 2VHZA 3KUKA 4ZYXA 4DCOA 2WM8A 1EVZA 3F6BX 3AG6A 4QUDA 1OPXA 1PVPA 3GUUA 1TW2A 3PTLA 2AX4A 1JSCA 2XE7A 4R8MA 2O50A 3EVCA 1M2OA 1Y6RA 1KFSA 4G97A 1Z8NA 1ZZGA 4JI1B 2Y68A 2ASLA 3B51X 3R0XA 2ATLA 4HN2A 5DG8A 1W76A 2H3EA 5IDYA 2WG2A 2BI4A 1PSZA 2WE7A 3S1AA 3G8AA 1LVGA 4RV5A 5HR7A 1IM5A 1N2EA 4ZXFA 3ELWA 3K5HA 3TZQA 4Z53A 4B4WA 2G7ZA 2QAGA 4HDOB 4L8WB 1F0MA 4J9UE 4UHHA 2Z4TA 1T4MA 2PUTA 4KQIA 4Q3KA 3FBGA 5IXSA 4CG2A 2WWGA 1TQHA 3AWIA 1OBOA 1ZQZA 4ZOLB 2PFKA 3KQPA 4CCAA 1BHQ1 1NJZA 2I7XA 3QKRB 5F7JA 8ICSA 2ZJ6A 1P61B 4IHJB 4DS3A 4O9MA 3JTMA 3N1UA 2X42A 2JB9A 1P44A 3L8MA 4IIUA 2AQHA 4JT9A 4N5NA 3QVOA 1ABFA 1GKYA 4PRZA 1S3IA 2WSBA 1P4RA 2BMDA 3PVCA 1SQFA 2B25A 1HDGO 3FPEA 4MUHA 1DO8A 4XYGA 4L5BA 1AV7A 1YIAA 3FHJA 1TGVA 3FSEA 1FRVA 2F44A 2AG0A 2WFLB 2OK7A 1F2TB 1VI5A 3CC8A 5IYZB 5JALA 2VR1A 1C3VA 2KBFA 1XNHA 1YR6A 2O2DA 1TFRA 3FDZB 1J2YA 2G8LA 4TOIA 1NQWA 3IMKA 3SR4A 1D0VA 2YWJA 4OMUA 4IRCA 1DBRA 4PSUA 1IIBA 2A5YB 2PWAA 1Y81A 2Q29A 3MRVA 4FPXA 2G9UA 2BDPA 4RHEA 5KFMA 4WESB 4C01A 4S04A 4UFOA 1YBHA 1G3QA 1EUCA 1CEXA 4LF6B 1GQSA 1F8FA 4JWNA 1RI5A 1OU4A 3GVPA 3CW8X 3TR5A 2Q4EA 4BLTA 3TLGB 2QTTA 2EVWX 1NATA 1ZQIA 1KDRA 2HY7A 1JJ7A 1NKVA 2I2XB 1E6KA 2QPAA 2ZSUA 1W6RA 2PRKA 3Q9UA 3O95A 4YXMA 1MAVA 2EEZA 2XV1A 5EKUA 2JFFA 3G23A 1LU9A 5MN6A 4NV0A 4ZQBA 5I5GA 5A5GA 4X60A 4ZXPA 1RRGA 2OKCA 3IAS6 4RGQA 3BREA 4RIGA 2M32A 1EKXA 2NT3A 2ZTCA 2JFWA 4BC1A 4K86A 5FTWA 4DOMA 3WLJA 1WPGA 4YPOA 1ID8A 2XE4A 1YTUA 3T4XA 2UXBB 2V7BA 3OIGA 4FMPA 2M6LA 3LCMA 3VVCA 3ASZA 4P38A 5ALDA 2IP1A 3R5HA 3LP8A 3KSDO 1C14A 4YEDA 2H1LA 3MFQA 4HDNB 2W7PA 1U1IA 4B35A 3PVSA 3U48A 3O21A 4QT4A 4JEMA 3GFTA 1G3IA 4L85A 2PMBA 4ZANA 4ZVKA 5JD3A 3JQBC 4BZZA 4EGJA 3RAJA 1YS9A 3GGCA 3K9GA 3BSSA 7REQB 1AA6A 4MQ5A 2OWOA 2A9JA 2N3ZA 3LWMA 3EGDB 5AW1A 2Q2VA 1UC8A 2I2AA 4QUKA 1T7PA 5JY1A 4L50A 5JDCA 4BUCA 4FGZA 1KJ8A 1O1YA 1IUPA 4C8NA 3VMMA 1V35A 2GM4A 2VAXA 1VQ1A 4PXSA 2DQKA 4DCNA 1J2UA 3ZJUA 1JIUA 3C24A 2HU7A 3PUZA 4ZI2A 1ULHA 3AU9A 4I3GA 1KSFX 2ARKA 1T9KA 1E5VA 1JIVA 2BEWA 1F6WA 3JATB 3O84A 5ALZA 1L7RA 2XDAA 3BD8A 4GLJA 2W9BA 2HHLA 1T2EA 1EFVB 1VIVA 1NVFA 3U9TA 1IPEA 3F7TA 3PL5A 4RJKA 4LJLA 5FL3A 4ZJPA 1QUFA 4LY0A 4P4GA 2OXTA 3WTCA 5ARBA 3MFHA 2G17A 5IVIA 2ATIA 4M0KA 5KNBA 1TCBA 2JEYA 1ZRMA 2GD0A 3NHUA 3LECA 3T5GA 4BNUA 4EBEA 1YK1A 2IQIA 4S05A 2HN9A 3OM9A 5TV2A 5CCDA 1Q0TA 2ECQA 4D25A 2FOLA 5LYJF 1TJPB 3KWMA 4LTMA 3SFVA 1T26A 5GJBA 3ZV4A 2AXPA 1DAPA 3C3JA 1BWSA 1O6CA 5C9ZA 4M0FA 1Z06A 2CKDA 2R6JA 2BL4A 2CBGA 1NL3A 3WWOA 1AV6A 3ZIDA 4KQ1A 1J0AA 5FT9A 4D56A 2KHZA 1CEZA 1UT8A 2CE7A 1KQFA 4N48A 4G23A 1ZN8A 1ZUWA 4ERXA 4JH0A 1O96A 1FBTA 5CG1A 4USAA 2C2ZA 1DIRA 1YH3A 2R96A 2ZT7A 3R3WA 1OLSA 3GFGA 3NORA 4L6IA 1R00A 2Q9UA 1A0PA 5CNMA 3OFJA 4TQRA 4Y1FA 2VJ4A 1OBCA 4OM7A 3SDBA 3ZE9A 4E1VA 4PGYA 2KIWA 1BYUA 2DWUA 1PR4A 4FBTA 3DS8A 4MIOA 3W8RA 4KKXB 3WV4A 1T1EA 4MI6A 2YXDA 4QZFA 3MUOA 4Q21A 4LBYA 2AGPA 3BL8A 1U9ZA 1RWKA 1HJPA 5FWDA 4UD6A 5D1NA 1DP4A 1A27A 2LZ0A 1VLLA 4JBIA 5EYPB 1M5RA 2QSYA 2P1ZA 4UHDA 2QM8A 4CLRB 1DEHA 2WSMA 3N7RC 1VYVA 2KLBA 1N5KA 1AMNA 2FLWA 2V7GA 4IVRA 3KTQA 4PGAA 1FUYB 4TMTA 2R751 5JHGB 1QTRA 2MYTA 1FMFA 1AE1A 5J2KA 2XWQA 4LXUA 1JR3E 2BGJA 3EZ2A 2W04A 3WMRA 2OV6A 3ZXXA 1Z7BA 4RHCA 2VPTA 3GV5B 3GLTA 4UREA 3TZ6A 1D2EA 4PO3X 4W5TA 1EXMA 2QYOA 3AHEA 5KYVA 2HHCA 4GEGA 1YBFA 1PDOA 2DUWA 3NIDB 1ZCFA 3KJQA 2BQRA 4OXRA 3O4VA 5AFSA 5HKBA 4PF1A 3S81A 2WHEA 3ND7A 5KOIA 5FP0A 2QF7A 1LLUA 5LZ9A 1OXSC 2NV2B 2RDIA 3IPCA 3OPVA 4K46A 1XMQB 3Q3IA 2JGRA 1YT5A 2BR5A 1QOZA 2QL5A 2QKYA 3VGJA 3BWYA 5HXAA 5EN4A 4WA7A 3V48A 1JXEA 3VVBA 2FWNA 1U8TA 2KZZA 3K53A 3IVMA 5E8JA 3FWKA 3S1SA 5D46A 2YS7A 4W9NC 3O1HB 2V5AA 1IZ0A 2IKQA 3DE2X 3K1RB 1II8B 3DO6A 1L7AA 1SBCA 1T0PA 2G4LA 3CXRA 2FQXA 2JEFA 1H5UA 3BJMA 3IOEA 3KOYA 4YAJA 1W88A 3AI7A 3BHIA 3TQIA 3USZA 3FKQA 1YULA 4E94A 3OC6A 3A05A 5LP1A 4BX3A 1V25A 2WTUA 3M4JA 3K4GA 4I50A 1FS4A 5BP7A 5I7EA 3JVIA 1ZKDA 5JAUA 2ZBQA 3U3ZA 2X15A 4ESVA 3OT4A 2W54A 3WJAA 5KFHA 2E8OA 5FUYA 3GUVA 3RRJA 4EFMA 2X0IA 1SUFA 1G8GA 1WYGA 3ELBA 1Y88A 1RI1A 4LDQA 4R8UA 3TIVA 4BJHB 2YBDA 1GA6A 1NKTA 1NI5A 3FGOA 3PPYA 4I5EA 2FJ0A 3EZYA 5BORA 1U1GA 1JS1X 4DL5A 3RFVA 3E23A 1B6GA 4ELUA 4I2AA 3BF8A 2ACWA 3ONFA 3QVSA 1IB6A 4Y9TA 4M47A 1C7YA 4HAZA 3KWFA 4P7KA 4ZARA 3W2IA 4MW2A 4KTQA 1NAIA 4INPA 2UKDA 3AOEC 4WADA 3LIIA 3AMVA 4TQGA 5YASA 3WAJA 1HQCA 1UXOA 4RQ6A 3HNPA 4PXAA 1L3TA 1EVYA 2BC9A 4R9VA 4WZZA 2Y9PB 4NP6A 2XUHA 4KO2S 2AFIA 3MMZA 5AK6A 1NJGA 2E1PA 5ALPA 3OSUA 1UKZA 1V26A 1UFRA 1J0BA 1UMDB 2XLCA 4BMSA 2IQ5A 4G9EA 4DQVA 2C92A 2R84A 1WP9A 2I1VB 2AVDA 4EATA 2QNIA 4NQRA 1OX5A 3HWRA 5EEGA 3TLKA 4UTOA 2FN3A 3TNLA 5AVZA 2C42A 3IV7A 3L4KA 1OI4A 2BFNA 1NSTA 3KZCA 4H15A 2QP3A 2D2IA 3D4PA 2R6DA 3R23A 4Q9AA 4QEKA 3UTCA 3K0FA 5FULA 4KDEA 4DANA 4FLMA 1JEJA 2I0FA 5HQ3B 3E7DA 1XDWA 4GYKA 5BSVA 2QP9X 1N2JA 3EQ6A 1JKFA 1TC1A 4MKHA 2O8DA 3D9QX 1MUUA 4BNDB 1SO8A 4XCQA 2Q9AA 4HNVA 1YIOA 4XIGS 5JIBA 3GB9A 1T3GA 4LE1A 4WCDA 5ALRA 4O1IA 4FYWA 4YCDA 3G2MA 5EMKA 3R9XA 1VPTA 5HCIA 4JP2A 1D1QA 3W90A 4ND8B 2ZZNA 4M0MA 5IWCA 5D86A 1WY5A 2AN9A 5CVEA 1SHTX 2WVGA 3T4EA 2QW8A 1WB4A 2WA2A 4TSKA 5EPUA 3A3YA 3MGAA 1WCV1 3Q8RB 1EK0A 1QK4A 1PJRA 3FYUA 2YY6A 2VHYA 4C4ZA 4KU4A 4MUYA 2PTGA 4OGKA 3E27A 2GJKA 2C2YA 1KH1A 1RLJA 3CEHA 4NBRA 3VBEA 4KXMA 1IY8A 3BDVA 4A8PA 1ENZA 4BO9A 5CA0F 1F48A 3S5UA 5KQGA 4XQ8A 1T5DX 2IOHA 4ETMA 4J9SA 4FGJA 3WAGA 1ESDA 3V34A 4ENTA 3AF0A 1CRXA 1K68A 4P33A 1TDJA 2J48A 3EVBA 4MVCA 4Q05A 5DB4A 4GMDA 3VH4A 1GRVA 1VM6A 4KSBA 5AW2A 1ZICA 1G16A 4CMIB 4OIMA 3H19A 4UW9A 3P8ZA 1L3CA 4LOIA 3WIVA 3JQDA 5AKIA 2K2WA 4YJDA 5L9AA 1YR9A 1ZQ1C 2ZRLA 3SIXA 4ZZ1A 3HL0A 1JXQA 3QENA 2R4TA 4BXOA 4GC5A 3C6MA 5CEEA 3TIXB 3GIMA 3EFHA 3KHTA 2A2ZA 1QM5A 1ONNA 4OFBA 4QZGA 1ODCA 4NBVA 4CQMA 4F3RA 2M2IA 1U4BA 1G8JA 1NQVA 4L75A 4N18A 3S68A 3TFWA 4XR4A 1O6BA 1PEYA 3CZAA 4G2NA 4RADA 1S7CA 1FCJA 5IINA 1WEHA 2W8ZA 4HDAA 3UKOA 5AW9A 2G1AA 5J0WA 3DLIA 4N3GA 2IS4A 5LA6A 5FPPA 1DWOA 3H8JA 1GVNB 4XWAA 3P9SA 4JR0A 3T5BA 2CDBA 4K0KB 2YW2A 4RANA 1UDBA 3ISCA 1JTEA 2EL7A 5B6PA 1Y8ZA 2JFZA 4Z0HO 3P5SA 4IFBA 5GZ6A 3WHLA 4EUFA 4ECYA 3NVDA 2W9MA 1D4OA 1E20A 1QNLA 2Y67A 4MWCA 4PSCA 4ALLA 5K8IA 1IM8A 2OO5A 2BTEA 3A0RB 4PFJA 3I52A 1F2UB 3AP3A 1SKYE 4NONA 3IT1A 3QE3A 5AVWA 3V7FA 3VU3A 2NTYC 4O4JA 3PR3A 2DKOA 2M98A 2NTVA 3AF4A 3I2IA 1HETA 2NOAA 13PKA 3A6DA 3L4SO 5BW6B 1IOZA 2QL9A 3UVEA 2PO5A 4R16A 3UJ8A 5AW8A 4S1NA 1KEJA 3DMTC 1JKIA 1VXRA 3L8ZA 2ZBFA 2O2EA 2O8FB 5ECGC 1T9GR 2V58A 3FSGD 4F5WA 2KS6A 2R1UA 4NICA 3IBYA 4H1VA 2OHIA 3ESRA 4RHFA 5E7JA 2I2WA 1T6XA 5CG2A 1R3DA 2XZLA 5C8VA 3D7MA 5KFGA 5LSAA 1I2CA 3MBYA 3CXUA 3D3EA 4RIFA 2UDPA 3RVKA 1LW6E 3SNKA 3WVNA 4I4CA 1D09A 1U3GA 3RTAA 2DR0A 2H8KA 3MGBA 3X2SA 1U3FA 2QMQA 4G5RA 4B8YA 1QQTA 3EHEA 4DL9A 1X14A 1MG0A 2QGFA 3KEMA 2BIFA 4DCVA 1C3EA 2G0NA 5F51A 5IBRA 1DAIA 3FGNA 1UBCA 4B3SB 2RAVA 2LCIA 4I46A 1J90A 3G88A 4E21A 2WWXA 3EMBA 5A0TA 3I5XA 4ZFNA 1IIPA 2FAXA 4MCHA 3PE6A 2HSJA 1C3OB 1FTQA 1UCFA 2BZFA 4QOFA 2DWPA 2LMRA 1Z13A 1P4JA 2I4NA 4D0GA 5K05A 2J3HA 4A9AA 1D8AA 1GU1A 3U7RA 5L45A 3BBPA 3Q5EA 2I1QA 5U4QA 2PFNA 4YJ3F 4R54A 1VBKA 3RVBA 1L5MA 2VXOA 1N32B 2XYGA 2GAJA 1T0UA 3KG2A 5ICCA 4RWZA 3MWEA 3N86A 4UBMA 4KX3A 1N2BA 4YV2A 3TTVA 5CVVA 5C8DA 1L6RA 1JUDA 1OVGA 1ZLYA 2VHEA 3GPLA 2BR4A 1JN3A 3HBFA 4R8LA 3ZDQA 2XZDA 4EQ6A 5K6AA 2DLNA 3AWDA 4FFNA 5DTJA 3RM3A 1ZM4A 1P77A 1V5EA 3AF2A 2IYQA 3L9WA 4IYJA 1CUYA 1T1GA 2JHCA 1JIJA 5AVJA 3K20A 8ICHA 3ODPA 1U1EA 3H2YA 2DBZA 4RL4A 4JJ7A 3NYWA 4JENA 5C7YA 4F6RA 3HYCA 3UAOA 1P18A 1X9IA 1QANA 4RVNA 2CJYA 1KO4A 1F2DA 2VA2A 1KK0A 2DU8A 4CGZA 1ZQAA 3LWZA 4BAUA 4KX5A 1JKMA 1QMGA 1GQOA 2ISCA 4G0YA 2N1BA 4S0ZA 1V16B 4RK1A 2RG1A 4OQMA 4QLOA 2W6IA 1XA4A 5ALQA 1ZGGA 3TOCA 4AJNA 4D97A 3I9V1 3DB1A 3H4BA 1NZFA 3HG7A 5CP8A 1PK8A 4Q3DA 5E3HA 4CM9A 4B43A 1YDFA 2V4MA 3AVOA 1PGPA 4HX5A 1KZ1A 3HUTA 5ALXA 2YZGA 3M3HA 4GWGA 1V9PA 1IFXA 4R0NA 5G4KB 5HIJA 3VPHA 4EHNA 1PVOA 3PPVA 1W49A 2VNKA 2B3TA 3OQ6A 3HB9A 3L0ZA 1UPUA 5CLGA 4D9FA 4TTAA 5JDIA 1QS0B 4FMCB 2E8NA 4XQ0A 3G9ZA 5JMOA 3ECSA 3F7OA 4LA4A 4QBTA 1O4WA 3QYPA 4IUYA 4C1NA 1E3WB 4FCWA 2H3FA 4G9GA 3DE5X 1KGSA 2GBLC 1M2VA 2QTCA 1DKOA 1RWQA 1V47A 4I8XA 2BCVA 3AJAA 5KSOA 1CPYA 3L3BA 4V24A 3O73A 4RTPA 4EKIA 2B5WA 2JAHA 3NTQA 2D7JA 3TCXB 2HBRA 1BKSB 2CV0A 2YX1A 4U39A 4ITUA 4B46A 2ZWOA 1IOWA 1Y1SA 1QLNA 3IAAA 4PAWA 4RO0A 5I51A 2CFRA 2O8NA 4ED6A 5DXFA 4DJAA 4EP1A 1WJGA 2Q3FA 1J5EB 4EMSA 3BWEA 4IQWA 2VFAA 4LS3A 2H48A 1U0JA 4OHPA 2Z2ZA 2HH9A 4OH1A 3X1WA 1AXGA 1RZUA 1TMYA 2EF1A 3CJTA 3GRFA 2ZBPA 2ZSIA 4XIIA 5EXPA 4ZCMA 5REQB 2J4CA 3T79A 1RYBA 1UKVY 3IXQA 2C88A 1KY3A 3KOWA 4LV8B 4R69A 5B7GA 4NNJA 1MXHA 1JTVA 2ZYTX 3BDAA 3OE7D 1U2SA 4KP7A 4UHCA 1SZHA 2CJWA 2Q1SA 1WO8A 4DDTA 3KTAA 1DQZA 4Z7JA 4ZC1A 1BHJA 3T94A 1Y3BE 2HMAA 4J0QA 3CINA 3A7EA 3OHSX 4NBKA 4Q39A 4Q48A 4Y6QA 4IFIA 1GA1A 3WGYA 3QSGA 1O97D 4PHCA 4DKJA 2VYQA 1E1RD 3IUEA 2HMWA 4FZNA 2VF4X 3SKXA 4B75A 4WNAA 4BFSA 1RLOA 1SBZA 4O8CA 3D3WA 5B53A 5LLSA 2VEDA 4G09A 2DAPA 3WADA 1NN3A 4DM4A 3FROA 2UVPB 1DBSA 2YVUA 4J1SA 4OMDA 4RMIA 3G79A 4X54A 4AJLA 2GGSA 1RAIA 3CWQA 1J06A 4D9HA 5J0PA 5AJWA 2PGOA 4AMGA 1XBTA 3EEQA 2P35A 2IPMA 3I2FA 5TISU 1QGAA 3THYB 2XEXA 4M9XA 5TMPA 2QVLA 4Z49A 1AKTA 1J6UA 1FFHA 2RB5A 1PK9A 2VC2B 3IIJA 3QOYA 3FDFA 3PHJA 4UTZA 4ABTA 2C7OA 1IE3A 1T24A 3E5HA 4F1JA 1JLKA 4HGPA 4RELA 1UMBB 3KOOA 3OETA 2UUPA 1B7GO 3FE2A 4Q9JA 4BFWA 4IP0A 5DQIA 2XKJE 4MJLA 4YJHA 4RUAA 1JNYA 4FDVA 4W7SA 2EFYA 2WA1A 1GPAA 2COKA 4TS1A 4X85A 4R7GA 3M8RA 2GKOA 1P2GA 3VNVA 5C0YA 2AF4C 4XUEA 4ECAA 3JWEA 3PXUA 5MN5A 2J3KA 4C5BA 1SCBA 3L7MA 4PNPA 3VYWA 3DV0A 4DG9A 4RD6A 5FTLA 3VX3A 2NAFA 2HXYA 2WPNA 3DL4A 3EOAI 2BOVA 3ZJ5A 1GY8A 4CLDA 1JJVA 1XVVA 3MMPA 2HPAA 1PR1A 3MJTA 3WXMA 2C5BA 4GT1A 1MB2A 4AQYB 8MHTA 3FJYA 3V9AA 2HQ1A 4HQ6A 4IICA 1JE1A 1DAHA 4N9QA 4MHOA 3T5DA 2JCVA 2W43A 1PLLA 4RZXA 1L7QA 3I6QA 2P8JA 2SKDA 3BWMA 1VDZA 1KEEB 3SSNA 3K6SA 1U8FO 2P3QA 4RDHA 4P3OA 2BR0A 5DGDA 1KYQA 2KJ5A 1W2GA 2HCJB 3OM0A 4Q9HA 3GCGA 4OHVA 4DV5B 2JH3A 3ZWYA 3WNZA 1YHNA 3EBLA 3U61B 4HH4A 4IL5A 1M2HA 1Y8AA 4QUJA 4E2ZA 3RTGA 2BMWA 3MINB 4F5DA 3LY5A 1ZHHA 1QGUB 1GZVA 2H31A 4M0AA 4YLGA 4BNTA 2OXRA 3EZLA 2OCBA 1X9GA 4RKWA 5AJZA 4AUKA 5JC1A 2C4UA 1LVUA 3UM9A 3EXIA 5L1IA 3R4VA 1EDZA 1O94A 4B44A 5L6MB 3FCAA 1STOA 1MW9X 1SIBE 5COQA 1PHPA 2CFSA 3IPXA 2YIMA 1ZIXA 3ZZUA 4ZC8A 2EP7A 2MOKA 4MYHA 4UJ5A 2BKLA 7GPBA 4BVLA 1WA5A 1XP8A 2UZ0A 4KK3A 1SL1A 1CF2O 2CVPA 5JY6A 4QVGA 4QJFB 5E9AA 5JI2E 4I4IA 3BD7A 4CKXA 3H1TA 2BGWA 4ZT7A 4IXMA 4TWIA 1PWZA 3C70A 4WNYA 4DSTA 1AUPA 2BHLA 1YRAA 3D7KA 5G5GA 5DLDA 2NUAB 1U7ZA 5EJ9A 1YL6A 4MRVA 5F9NA 3WIBA 4BY9E 1ZOIA 5DFAA 5LB4A 1CVIA 1CZRA 3CX4A 3NCTA 4KW7A 3SZOA 2R79A 2WU3A 4QPJC 2FV8A 1F20A 3FMGA 2J31A 3EDOA 3OOEA 3QNUA 4HZUA 1C7QA 3CLUC 2IV7A 3RROA 3EQ8A 3UV7A 5K2OA 1RJWA 4Q47A 3SAJA 5HBGA 3VPFA 4EGFA 2OV2A 3VMFA 2Z98A 5KT2A 2AN1A 1V1MA 2XRFA 2RBKA 5JAZA 1OA0A 2EH9A 4L0DA 4Q9DA 4H4CA 1SHZA 3ZHBA 3U31A 4D6YA 3DFUA 2V4QA 2OV3A 2GARA 1Z63A 1VSVA 1YZ6A 3C7TA 4CFYA 3LDFA 4US8A 4RPJA 4ZQGA 2BFEA 1Y0BA 4XVHA 3CPEA 4R71A 4GP9A 2FK7A 2WDZA 3G9XA 3PI6A 4B9EA 4TVKA 4NSNA 1DFGA 1HFJA 2ETXA 1DXSA 1A3CA 1EZZA 1QDEA 4H59A 4HB2A 1EXVA 1X3SA 2Q1TA 4TSFA 2JI8A 4ONEA 5IEBA 4GX1A 4I6EA 1KU6A 4V0RA 4HGYA 4KTTE 4AY4A 3JPQA 3IDZA 3B6EA 2GBPA 4DIDA 3LOUA 1RXEA 5HR6A 4HLUC 2VSNA 2DC1A 4ZAWA 3HN7A 4D9CA 3VNUA 2XY7A 3RUCA 5LKRA 1KJWA 2G4CA 4RQBA 3FNGA 3DMRA 4Q9LA 2FGKA 4HEJA 5KC8A 5HZMA 3IKVA 1XUOA 4L3VA 3HDVA 3VPBA 3COWA 1E7WA 4R1OA 2P2ZA 1Z4NA 2XQGA 3O8RA 4Q4JB 2GPNA 2HHSA 3WGZA 5CLIA 4PYIA 2OT3B 3DLHA 4Z9XA 1AKMA 1Y3IA 3MMXA 3NZEA 4J76A 4NJMB 4EITA 3D6VA 2ZTUA 1D3AA 2ZVJA 2VJPA 2BBOA 3AP2A 4MW0A 5LDGA 3DEYX 4GGMX 3LAWA 2IYEA 1LSSA 2RGNA 3LUAA 3PQFA 4R2HA 7REQA 2DUJA 1U3CA 3E9DA 1XLTC 5A9SB 2XVAA 4L0QA 1IN4A 2BFCA 2RARA 3DVLA 3MGVA 4MJXA 1TK8A 1T5SA 3GZNB 3L6EA 9ICTA 3A6KA 1R74A 4V0KA 2E1FA 1UM9A 5DK6A 3RWMB 3BZBA 5EYPA 4CG1A 6ADHA 3H5NA 2P9FA 2W98A 4EG3A 2B94A 4IIHA 4PZYA 4WN9A 4IWXA 1O3YA 1UM8A 1OH8A 3DYBA 5CJJA 2C4WA 2NO4A 1MQAA 1P9OA 1SV0A 4CQLA 2O8BB 5EZYA 3V4PB 2DCMA 4R2WA 3R7AA 1B8OA 1XZIA 3BA1A 1XCJA 3NVVA 2QWXA 3T9FA 1HNZB 2XODA 4AF8A 4LI0A 3A31A 2ZULA 4IUDS 4TLBA 4Q3NA 1S2GA 1J0DA 2AE2A 1HFWA 2YN2A 4XFKA 1U0OC 3I23A 2WIKA 3H1GA 1RHJA 2CVHA 2HLPA 4EQZA 2W55A 4MB6A 1GSHA 1N2CA 3I9V6 4KL8S 3CEAA 4WCFA 5DLQC 2FE1A 3BAZA 2IU3A 1X38A 3GLFE 1RYEA 5JISA 4RQ4A 1KL7A 1X3LA 3B2QA 4YJKA 3PF8A 5DSZA 2FDXA 2I4RA 2NUPB 1E77A 1NDQA 4JB3A 1OSNA 3DXFA 3KQSA 4M4SA 4ARBA 3D4IA 4F4HA 1OX4B 4FQ7A 3S0JA 3X43A 2HHWA 4IQ4A 2WLTA 4M46A 2YWGA 2IIBA 3MGIA 1T8TA 2ENUA 1A82A 3ISVA 3LSTA 2RK6A 4MZDA 4RJ2A 3HI6A 3N74A 4C6SA 3C4JA 4QE3A 1JWBB 3ZQ6A 4FZRA 1I7PA 2J5XA 1XD2A 2GZRA 3CM0A 3ORFA 1V2HE 3IVXA 4M38A 3UENA 4NBNA 4EW1A 5F2OA 4Q6BA 1FSSA 2GLUA 5I5EA 5F2KA 3L7AA 4BWJA 1TKDA 3GFVA 4E4YA 2J9YB 2PX2A 1KDVA 3VYVA 3G2KA 3DKVA 2WB2A 4QYIA 2Y05A 4JI4B 2P4EA 2Y8EA 1ZNWA 5FWNA 5TJ9A 2A86A 4ESEA 1KY5A 4FQ8A 4F04A 2Y9TA 2ISPA 2C4NA 2FN8A 4DC0A 5EHZA 1XPRA 4Q4LA 4FOLA 1VBMA 2HT6A 2HBLA 2RD2A 1KARA 1LNQA 1BE1A 1I6WA 4JN6B 3NHRA 1X40A 1R6TA 2B1IA 3ZE1B 1M54A 4KOAA 5MHTA 2P9CA 2WTXA 3K0EA 4CEJB 2GTPA 1PF7E 3NT4A 1I4DD 4O2RA 4BEBA 2XMGA 2VYNA 4G07A 4IIJF 3VM6A 1ZH8A 5IW8A 3B5IA 2QIPA 3FMOB 5F3XB 4IV8A 5CBKA 3RS8A 3HFRA 4QJBA 5DLEA 2LM1A 1E5LA 1XEWY 2JGEA 1Z35A 2PTHA 2ON6A 1ODFA 1L4NA 3BA6A 3NP9A 2FPKA 5A4DA 2I6UA 1SC3A 1W8IA 3UMBA 3QFFA 4YDSA 3GJ6A 4NY1A 4MV3A 4UBCA 1RM3A 4RY9A 4DF3A 4DCTA 4P84A 5G1OA 1BD3A 3MD9A 4L8VA 1UP4A 3WISA 1X80A 3CPJB 3W8FA 1Y7TA 4X0EA 1Z0FA 4OXKA 5FAKA 3F5SA 4AYBF 4MR8B 3AGPA 2X8LA 1DJNA 2J7PD 3AONB 4KWIA 3NTVA 5TRTA 3RRNA 2R3SA 1C9YA 3JVEA 1DIOB 4XPIA 3ET4A 3AEQA 1UKAA 1XLVA 1OBFO 2D54A 2TMYA 3A06A 5IANA 3KLMX 4FCVA 2ZR0A 1G6KA 3UA3A 5TQ2B 5KOYA 1BA2A 2D5CA 5IDXA 2R1TA 2X86A 4Q1AA 2Q7XA 4X7MA 3IAEA 4WVFA 1XQWA 2ZK7A 4ZJYA 2WAAA 2EKBA 3RNOA 1YKGA 3W5DA 1YHYA 3ORQA 4IVPA 1C7RA 5IZ4A 2QSUA 1FS6A 3ICWA 4P7GA 3INNA 4F86A 1C81A 1M6WA 2PQ0A 4OX9Y 4AZWA 5HOEA 4O29A 2Z7JA 5IIOA 3KCNA 4RPLA 4S1VA 4Y30A 4DGQA 5EAIA 2WIDA 4EFKA 2O4CA 4A27A 1MIHA 1TT5A 3AM5A 3G0IA 4M8KA 5L1LA 4QTZA 5M3BA 3WB1A 1E7YA 1JVBA 4XCXA 3SDZA 2YWEA 4EZEA 4C4SA 3JRNA 3H13A 5G3YA 2HV8A 2Q5EA 4HN4B 4EHJA 4DJFC 1JROA 2RRDA 2Y1FA 4RGBA 5LXTB 1J39A 5IVHA 2BCRA 3IAHA 4HATA 3GGGA 1HUOA 2YDYA 3BSWA 4A2PA 1J2RA 1AB5A 1GFIA 2O1XA 2Y6UA 4OHXA 3ANXA 4TKLA 4AJ4A 3Q3CA 2B9EA 1YZYA 2A1IA 2ZJ8A 4OX9B 3HK2A 2BEJA 1L1FA 3CEMA 3C3AA 3F6YA 3LXUX 3QVUA 3R7WB 3EYWA 2QE6A 1VIAA 5EE3A 3BORA 1M7GA 2JV3A 1VKJA 3JPNA 2LVBA 3A70A 2I7TA 5FORA 1PNRA 1S4MA 4HNAA 1XLTA 1RBQA 4N7RA 4ILEA 3SS9X 4D3DA 4WFJA 1JFTA 4US0R 3U56A 1I13A 5JADA 1PL0A 2PZMA 5LJLA 4ZAXA 3UYKA 4BXOB 5JXGA 3GT0A 1GGEA 4UZEA 2BGUA 1RE1A 4GXJA 3CZ9A 4B82A 2CUKA 5DCWA 3VPSA 1EGHA 3DBOB 2C9DA 3C3YA 2QEQA 1EFRD 3IT0A 5SZIA 5HRCA 1G5PA 1QHXA 3DEKA 2F8LA 4CL3A 4DC9A 4C4TA 3K1AA 2VA3A 4RK7A 2IXDA 1JBEA 5B4UA 1RZTA 4G0PA 2ECOA 3A28A 4ZD6A 1O9GA 5IXYA 4QOSA 3AK4A 1VA5A 2I7VA 3UUEA 5CYOA 3VJMA 4RZUA 4JBGA 3VZCA 1U9YA 3PKJA 2YVQA 4PYKA 4OBWA 3IUPA 1T0HB 1RQRA 5LCXA 3ZHTA 1FW6A 5DKFA 3K96A 4K6FA 3RSOA 2QUZA 4D98A 1SIOA 1C8VB 2YYZA 1VCHA 1VMDA 2CYBA 2E4UA 3EJWA 3FTNA 3GUZA 3IPYA 4TXJA 3ZH9B 2G1KA 4RY0A 3MT7A 5HR5A 1NG9A 1SMKA 3E5NA 5CXXA 2VJCA 3VVMA 1YMUA 2I6XA 2EAUA 2Z2JA 4P7FA 4GSLA 1ZVJA 2PX5A 4GR9A 3OZEA 1PCXA 4F7DA 5IVKA 2I3DA 4EYQA 5EHNA 1JDBB 5CA1F 1WQ3A 3Q87B 3TRHA 3GNTA 4Q19A 3VYRB 4YMVA 3E48A 2JAPA 4FIDA 2DTXA 2Q99A 5F73A 2WUWE 5CITA 3OFKA 4GYWA 2XTAA 3WO0A 1DC6A 3EARA 1LC0A 3Q12A 4M0PA 4WGFA 1EVLA 3SZGA 4CEIB 1UKBA 2IOYA 5TC4A 1E1QD 1QB7A 2Q21A 1SXJB 1ESCA 2C9CA 1THZA 1P7DA 2QQEA 1GGJA 3FFWA 4LWPA 2R1VA 2WD7A 2FUNB 4K9NA 5HK8A 1BXRB 5AQEA 5DEOA 1EUCB 4LJ4A 5IJZA 3GGJA 4FO6A 4TV8A 2PMZF 2HGSA 2ADOA 1QYIA 1N1DA 1H6AA 2WTBA 3A6HA 3KOZA 4XB6B 3Q8QB 2ZSJA 4CG3A 5K0FA 4L5CA 1SIUA 1CUIA 1JZQA 3BGIA 2MUTA 2HJVA 1O5IA 4FVTA 4P82A 4PTYA 4X20B 4BJ3A 3CR8A 2NMVA 2HWWA 3PR4A 3DG9A 5KFTA 1X94A 3STYA 5J0UA 3PC8A 1Q46A 2FPOA 2IDJA 3VKVA 1X7GA 2YJZA 1Z6ZA 2Z30A 2KYRA 1WDKA 4BNMA 3TKLA 3PT5A 3VZQA 1ARZA 4JR2A 3PNVA 2Q3LA 2NYVA 1FYWA 4LSWA 2BCUA 1JT9A 2E4YA 1AHHA 2WVJA 4GX0A 1Q0SA 1FZTA 1RFGE 2M6SA 3OQIA 4CDRA 2FEAA 4WK6A 3U3KA 1LDYA 1TMOA 3PDIA 3RRMA 2D0IA 1I3CA 4HDNA 4WDQA 2BY4A 3UT5B 2F8TA 2Y1JA 3DP9A 2CEKA 4LY6A 5IARA 1XRLA 2PT7A 1TIPA 3RODA 3R6LA 1EXWA 1JXAA 3ZVRA 5KQPA 1SVLA 4KLCA 5HRUA 2YVAA 2PPVA 4FU0A 3EGDA 4QELA 4TVOA 3LCVB 5AVOA 1DRUA 2K4PA 3HP6A 1WXQA 1CHNA 4RE5A 1RSZA 2B2NA 1NBWB 3TH5A 4G0WA 1QUEA 1ZI6A 4QARA 4TZTA 4F5PA 2PD4A 3GZ4A 5KG5A 1K8QA 5THKA 4WKCA 3O9ZA 3KYBA 5J2DA 1Z08A 2VAMA 4Q1BA 3IP6A 3G6WA 3QMWA 1IL0A 1X1TA 2G88A 4Q4HB 2ZSAA 1PIWA 2YJ3A 3L6UA 4LNUB 3S1LA 4F5YA 5JJBA 1V16A 5JECA 4MV4A 3PW4A 1BMFA 2Q1WA 4INJA 3E82A 1XTUA 3GCXA 3ME5A 3HJTA 3JQ8B 4WKBA 5KFQA 3N7UA 1BDMA 3MR3A 2Q46A 2VNAA 2DWCA 2RHCA 2CHVA 2V9CA 3NHLA 1M1ZA 4QPZA 3WG9A 3EX7C 2B99A 1GPH1 1OI7A 2HCBA 2ORIA 3PNOA 4U6NA 5CLLA 3KOMA 1O5TA 1QHSA 4XX0A 3FMVA 3VHRA 4Q18A 1IEQA 2BJHA 1D6NA 4EA9A 2LYBA 2ATVA 4NCIA 3NHYA 2A9RA 1SQ0A 1T15A 4LE0A 4B76A 4PZOA 4QRIA 5JWOA 1P91A 4G41A 4BGDA 5I9TA 2BGGA 2A0FA 5EKTA 3OZDA 4BN5A 3FGZA 4JBXA 3QKUA 2GSDA 3SR6A 1JDVA 1SCAA 3CW2A 4MULA 3DDZX 5IIIA 3HM2A 4YJ3B 5EQFA 3TI9A 3TLEA 1TTHA 1RKVA 1U2DA 3I0NA 5L1JA 4JYBA 3I32A 2Z0MA 4LVOA 4UJ3A 2QV7A 4JUDX 5H3CA 4YRMA 5D2CA 2ZTLA 4BE9A 2W22A 2EXXA 4RCVA 1G21A 1DOHA 1H3NA 2QVXX 2XYVA 1ESNA 3M5CA 4Y2HA 4BNYA 4A8HA 4F85A 3KE9A 4EVIA 4OSOA 3MWEB 1Y48E 4YACA 3FOEC 1U9JA 1V3UA 2QTBA 3EXEA 1REQB 4DBLE 3IJ5A 2FOXA 2Z4SA 3PV8A 4LVNA 4R5MA 4H0CA 2R6HA 4M9SA 1JFSA 5GOTA 3ND6A 3FPKA 3LFUA 4A91A 1OKKA 1RXVA 1RYYA 3BWDD 3E1KA 1I3NA 3QZUA 5LXTF 5I4KA 1ISHA 2BFMA 3LY7A 1S9FA 4HYQA 4WLFA 5KFIA 1QYWA 4RZIA 4TYMA 2OEHA 1KPHA 5EWMB 4QOEA 3UWSA 4DIUA 2PLAA 1RRVA 3DUWA 3GJYA 4UBJA 3KQTA 1P80A 1XRJA 3B6IA 1DG1G 2CXNA 3C45A 4H0NA 4RPHA 1RVV1 1TAUA 4XOIA 2WD9A 1CR6A 4X6YA 5HSGA 2Z1MA 2QTGA 5C1BA 1KDOA 1H2YA 5EKDA 2WG1A 1C2TA 3GMDA 3A9TA 1QK3A 3TQTA 3DHNA 4RDCA 3TVTA 3U0VA 1A2KC 3RBVA 2IX3A 5ED4A 3DEJA 4IDEA 2HVIA 1Q5PA 2HRRA 3DLPX 5E6SA 1N6HA 3COSA 1ULTA 3WK4A 4IH9A 1NK4A 1H93A 1R88A 1X1RA 2AUMA 1D8YA 3C15C 3IUJA 5KG4A 4K1LA 1ZI9A 4JC0A 3DTTA 2FEMA 1XZGA 4AS1A 4G4IA 1A8UA 4ALJA 3IP8A 1TYZA 5BOLA 4PSKA 4PCVA 3ZX5A 3HXKA 1XN4A 4ZYVA 3A0HU 3W7VA 1GNSA 4KAXA 2VHCA 3ULKA 3I9MA 2RGEA 4FI3C 2BELA 5HQTA 2YYAA 1FX1A 1UMBA 2EF0A 4HQNA 5DCUA 5K4AA 5C34B 2FVYA 3O3MB 1NOJA 1KZ6A 5IASA 4EZ9A 5HPYB 1CQPA 3ZDCA 2ZT8A 2OAGA 3F9CA 3ZKAA 3NATA 1TQ2A 2PSJA 5D51S 3RFTA 3U16A 1YVDA 2FX3A 4GPAA 5FNZA 3RUDA 3HKCB 1ZETA 3VR3D 3J81j 4P4OA 1E4VA 1RMYA 4R41A 5HCUA 3EODA 3S7ZA 4B3XA 5HJEA 4ZOEA 4Z0PA 3FPSA 4AZ0A 3QTBA 3IKTA 1BFKA 1FYXA 2ZT5A 3O7WA 2UYGA 4V0SA 4WZAE 1RXCA 1Q6ZA 3AEUB 5LZ5A 4UOEA 5KTTA 4GM1A 4EWLA 2FHPA 3HCRA 3OA0A 1IJEA 3IODA 4HHEA 4NZYA 1DAEA 4G6ZA 4JLVA 5FI0B 1WEKA 1FA9A 1UWKA 4AURA 2RB4A 2IYNA 2SCUA 4UNSA 4FUTA 3OJOA 4QOGA 2FLNA 1TX4B 1XEXA 2RHOA 1QORA 4QAQA 5B1SA 2OHFA 3EDRA 3NNNA 4N8DA 2KP7A 1QWSA 2HMVA 4EGCB 5D5HA 1L5KA 4QM6A 1W5FA 4PHHA 1LV7A 5EIWA 4C2BA 2MDTA 1VMKA 1ODSA 3ZWWA 4NF2A 4BV8A 4CW7A 3L4JA 5IT5A 1KOGA 1XDGA 2W2KA 2Q62A 3QU4A 2QDKA 3HVHA 2WM2A 5BW5A 4KNYA 2WZBA 2GWHA 2BE9A 2V7WA 1OLXB 2YV1A 3G5AA 1L5UA 5EFOA 2PA3A 3B6KA 4IX1A 1OZGA 2XIQA 4C4XA 2F3UA 4R05A 2BFFA 5B30A 1ZO8A 4AO7A 1LPBB 4NOMA 3GAFA 1M8JA 5DP1A 2LPMA 2W2MA 3WP0A 3K2BA 1JJAA 4OQQA 3ZVMA 5GMOA 1LKYB 3VJKA 2FPIB 1E1KA 1H05A 3EQ9A 5ALWA 3FVQA 4GD3Q 4A5SA 4TRJA 4IIXA 3LVFO 3WFJA 4JI6B 1TK5A 5K4LA 4C3UA 3MM4A 1O5OA 3CRVA 4BGUA 1AVTA 4D46A 1CUZA 2WSSA 2F9LA 3M6ZA 2CL6X 3WYFA 3S55A 4J6EA 2XD4A 5DEIA 2V3CC 3GMIA 2XGPA 3AIIA 4DA6A 1QLHA 3GJ0A 3RKUA 4P4PA 4BE4A 1S8AA 4CMJA 4PLZA 3VSCA 5HQ3A 2BRUC 3H5IA 1JQBA 4RGVA 4QGBA 5FFFA 3MDCA 3A2KA 1G20B 2MU1A 3KV1A 4BNDA 1LJUA 3A6ZA 3SIRA 2FWRA 1UPXA 3DT6A 4DLTA 1S0OA 1V85A 1E3TA 1K9VF 1Z07A 4RENA 4AZ3B 4Z4HA 1VYTA 3T15A 1KTVA 4BAGA 4C89A 3IDOA 5GWXA 4JC4A 4MNTA 3LGSA 1M2OB 2HLDD 2FMQA 2VHVA 1NVUQ 3OG9A 2PX0A 4PE5B 1EXDA 2H4HA 1RYNA 3P0JA 4PQFA 4TZKA 4ICAA 1A2BA 1MRZA 3V1YA 1F5SA 2ZJ1A 4CM5A 2H17A 3BGVA 3FNIA 4WTOA 5CMLA 2FK8A 3BHNA 1HMYA 2V6GA 1EGVB 3CUEF 3FYUB 3NEJA 1NJFA 5KKCA 1UPBA 3CNOA 1VHJA 4YGYA 3RIMA 4PTLA 2FX5A 1GZ7A 4XB1A 4AY2A 4DL2A 1DARA 2E37A 1ZK4A 4MWDA 3SHQA 1DS6A 2B83A 2QAGB 4KBYA 4HMQA 1CR0A 1ZXIA 2GSWA 2CPRA 1T43A 2P41A 4HADA 4I2VA 4RMNA 3DLTA 3F6CA 3I01M 4B5LA 2YTZA 4BZPA 4ENRA 1BZYA 2FMTA 3I3SR 1GL6A 4HD8A 5AI0A 4C06A 1IATA 4JLJA 2FPLA 5T8KC 3EZ7A 2EFCB 3H6HA 5EMNA 5K5EA 3VHXB 1DKLA 2GA9A 1EH5A 3H11A 5DGCA 4NAHA 1JDSA 2Z43A 1PR9A 3KZNA 1J7KA 2AEJA 4RXTA 2WLSA 2JARA 4E5KA 3KT8A 4CVNA 1U0HC 4N12A 3S2FA 3UB4A 1WETA 3SCZA 2C83A 4OD0A 3EIWA 4ZO4A 5AUOB 4G0VA 1T29A 4KAAA 2AWNA 2FPWA 1OBVA 4ZDIA 5IJ9B 5IAJA 3ZGZA 3GX1A 4BNNA 4MWSA 4EDHA 1IBMB 4DMMA 1NE7A 1Z2PX 1X0VA 3RS9A 2ZZMA 4MVJM 9ICQA 3PGVA 1TECE 1XVLA 2GAAA 2I8AA 3FDZA 3A9SA 4MKFA 4RZQA 5IK2D 5J4HA 1VSTA 4ZCQA 3CO0S 3GPDG 1LV5A 2ECKA 1V6SA 2BQ3A 3E9NA 3CW9A 5AM1A 3OU7A 3P5BA 4P8RA 2ID8A 4RL6A 1D9ZA 4H6XA 4BYMA 2PIDA 4B84A 5EI5A 2C94A 1DQSA 4W5OA 5L3QB 5EE0A 2VPPA 3K1TA 3WSWA 3EBPA 3QNWA 4M36A 4R1LA 3TSZA 1KH2A 4NZPA 5DOVA 4C08A 1ZW6A 2C5EA 3M8SA 1XSNA 4WKNA 2H2GA 1ZQTA 2X9QA 2ZIAA 1A5ZA 4CEHB 1G2OA 2GUGA 4M0LA 2AN4A 2VO1A 1W29A 1Y1QA 2ONCA 3Q5DA 4B3IA 4PYJA 3ENVA 3N28A 1X13A 3H99A 4PO9A 4UBBA 1LDMA 2GEJA 2IPXA 3BFXA 4JV1A 4IZ6A 3ZU6A 1ED1A 1K7CA 4OYRA 1IQ0A 1DLJA 2R7AA 3BIOA 2L18A 3F5FA 1BOOA 3HLKA 3JAWA 1NVEA 3K6JA 4LYFA 4DQPA 4CQJA 5JZSA 3N97B 1L3BA 2XNSA 1KKLA 2YIVX 4R1TA 2PZ8A 1KVRA 2AJ8A 4TWZA 4Y2VA 5M2QA 3R9KA 1JLLB 4F5NA 1N0IA 2JAOA 4MR7B 1OTHA 2C54A 3JD1A 4G36A 5KOHA 4JMUA 1ZU4A 4F12A 3I58A 4ZOAA 1V41E 1AM4D 2UUOA 1JQJC 4H7HA 4ZVPA 4Q7MB 1QH9A 2IYZA 3WLAA 5FF9A 5KIAA 5IJWA 1OZAA 2HSDA 2GHQA 4FGWA 3ZD9A 2OXEA 2O05A 3SNHA 3TL3A 2GBLA 3ZY3A 3EGCA 4PRKA 1FDVA 4EA8A 2VPZA 2DH5A 1XP5A 1TUBA 3PT9A 4HWKA 3BEDA 3HDJA 3V4RA 3O7MA 3IEVA 2E4XA 2IIVA 5ALVA 1Z4IA 4NKRA 3ZE8A 3NDBB 3PMLA 1MOSA 1COWD 5IJ0B 1W0JA 2NW6A 4JVSB 5JXIA 5E79U 8ICNA 3QA9A 3OQNA 4O2AA 2O8VA 4N5LA 4NZ9A 5LLDA 5KG0A 5DDMA 1JHQA 4HAIA 1XCGB 1MV8A 2WFMA 3W4IA 1Z0DA 221PA 4RS3A 5F3RA 1RKBA 1RKXA 4PPNA 4DUYB 2B20A 3WDLA 4NFHA 5FWYB 2W11A 4WDRA 3RHSA 2JLBA 1J07A 1C30B 1UQRA 3PRHA 2JZBA 1MO6A 1HEIA 3VXKA 4QTTB 3MJRA 4BQOA 3U7IA 4DKXA 1RRFA 1Y6FA 4AO8A 4W5WA 1JHMA 1YQ9A 4MV9A 1Y4DE 1W8DA 3LWNA 3RASA 4EPRA 2Z9CA 4YQEA 4XWYA 2IE8A 5KG6A 3UB3A 3L3FX 1ELOA 1GIAA 2DE0X 3PCRB 4WERA 3TWOA 2DUUA 4IJWA 1LBTA 3AVYA 1YU6A 5I7SA 4ESHA 1BX1A 1ND6A 1GILA 1ZNZA 2PUHA 4UATA 3NHJA 3BL5A 5KC9A 2BI8A 3TRIA 4FTWA 2J3MA 3I9JA 4WCFB 2PUGA 1NX6A 1NVBA 3FTEA 1DAFA 3RUAA 3ANYB 2YB4A 3TOZA 4AU1A 1LBIA 5LNK1 2VP0A 1Q0LA 3OTOB 5B7PA 1CUGA 5KJEA 2GX6A 4Z99A 5J0SA 4DG8A 5BYJA 4BEJA 3CWCA 2GM9A 4CV3A 1NOMA 3GT3A 3QU2A 3HA3A