4KX5A

Cytosolic 5'-nucleotidase iii complexed with cytidine 5'-monophosphate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase 3
publication title Cytosolic 5'-nucleotidase III complexed with cytidine 5'-monophosphate
rcsb
source organism Mus musculus
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4kx5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4kx5A01
1YMQA 4BEVA 4Y2VA 2WF8A 3GYGA 3B9RA 4Y2YA 3KZXA 2B1RA 1YJ5A 1MH9A 3OCYA 4BX0A 2G0AA 4HAIA 5IT4A 3SHQA 2RB5A 2YMPA 2G06A 3WK9A 4CF5A 1Y8AA 4UATA 5AKHA 2FPUA 2JAWA 4IFTA 1ZD3A 4Y2XA 3SKXA 4G9BA 2O9JA 3M1YA 3QU9A 3WKBA 2P11A 3UMBA 2I7DA 2IA5A 1EK2A 4AS2A 2P69A 3FGOA 5AW9A 4NV0A 1SWVA 4YCNA 5AW6A 4KNVA 2YJ3A 2HF7A 5AK3A 2C9MA 1RQLA 1JUDA 1O03A 3L8HA 4EELA 1ZD4A 3ESRA 3NRJA 4EX6A 1QQ6A 1TJ3A 1RRCA 4JB3A 2HSZA 3NIWA 2IOHA 5AVYA 1WR8A 3VAYA 5AW0A 2G09A 3U7FB 2WF7A 4AP9A 4FFDA 3N07A 4UAVA 3U7EB 5ALXA 1Z4QA 5A3RA 5IS2A 5AVZA 5AVVA 3WK7A 3IB6A 3WK4A 3WK5A 3DV9A 5AKZA 5ALGA 3R9KA 2YJ5A 4UMDA 3I28A 3D6JA 2I55A 3QUQA 1U2SA 2FEAA 5AI6A 5AHXA 2R8EA 5AM4A 3QYPA 3U26A 2O2XA 1U7OA 2HX1A 2G80A 2RAVA 3MPOA 1RPZA 1N9KA 2EATA 1NNLA 4HGPA 4C4SA 2IYEA 2FPWA 2C88A 3ONNA 4I9GA 4UM7A 3BA6A 4Y2RA 4XOUA 2FI1A 3WK8A 1TJ4A 5AW7A 4UM5A 4UAUA 5AIBA 1RLOA 2BDUA 4DW8A 1O08A 2PKEA 4L57A 4CF4A 5ALLA 3IRUA 3AR7A 3PCTA 3AR6A 3E8MA 2GMWA 1VFPA 2AMYA 2PR7A 5AKKA 4YGYA 5ALUA 2R8ZA 4BBJA 1ZRMA 2OA0A 2JAUA 5ALVA 1Z4LA 3FVVA 3QNMA 1Z4NA 5AKXA 3HYCA 4CNQA 2B30A 3ZX5A 2GFHA 2I6XA 3I1YA 4KYTA 4BNDA 3ZWDA 1SU4A 3AR2A 4MUMA 5ALWA 1U7PA 1VJRA 4UU0A 1TE2A 3KD3A 5ALYA 4HGRA 5ALFA 3QXGA 5AM5A 2B8JA 2NO4A 5AK5A 5AM1A 2R8YA 3U19A 2AGVA 3A1EA 3OTQA 4OD0A 2WF5A 2I33A 1VJ5A 4HYTA 3ZVLA 5AW3A 3L0CA 2JARA 1RQNA 3PGLA 4UMVA 3TLMA 2HF2A 3I76A 1Z4JA 3U13A 4YCMA 1Q92A 5AW1A 3L7YA 1LTQA 1YDFA 3MMZA 5AKIA 2YMMA 5FP0A 3ZVNA 4B6JA 3W5AA 1CQZA 1Z4PX 4HGNA 3AR8A 1RKVA 4Y2TA 4F71A 3E58A 4EEKA 3QU7A 2GHTA 3QGMA 4GIBA 1NF2A 4O8CA 2G1AA 2NO5A 4CF3A 4ZEVA 1SWWA 1F5SA 4UW9A 2HI0A 4DFDA 5AI9A 2FUEA 5IT0A 3KDPA 2OM6A 2HCFA 3QU5A 3L0BA 5A3SA 3DDHA 2ZBEA 5AVQA 3FPSA 4BYGA 2IOFA 4IG4A 1Z88A 1K1EA 2G07A 3U7GA 3W5DA 3NASA 3L8FA 1Z4KA 5ALZA 2EAUA 4Y2JA 4CE6A 2HOQA 3ET4A 2ZG6A 3KBBA 2JAOA 2Q4RA 4YH1A 4AS3A 2ZOSA 4KX3A 3QUTA 4J03A 5ALIA 3B8EA 3N28A 3AR3A 1ZD5A 3NAMA 2FUCA 3N5KA 1T5TA 1QQ7A 1S2OA 3ED5A 3S6JA 1S8OA 2D2VA 1ZRNA 5AK4A 3UMCA 2YMQA 4EENA 2FPXA 1XPJA 5AESA 3L1VA 2WF6A 3QU4A 3EF0A 3U7HB 3CZ4A 1T9ZA 4Y2SA 2P9JA 5E0OA 3HLTA 4I9FA 4QJBA 2AUTA 5ALTA 3L8GA 3PGVA 2HO4A 3FZQA 3PDWA 1Z4MA 4E88A 3RFUA 5ALMA 4UASA 1CR6A 5ALOA 3J7TA 5AKLA 4FYPA 1N8NA 3WK6A 1L7OA 1ZOLA 2HEGA 3R09A 3KC2A 5AKEA 5ALJA 1NRWA 4GXTA 4L6AA 4QQFA 3OPXA 1L7PA 5AICA 2B1QA 3K1ZA 1FEZA 2WF9A 2G08A 2MSNA 4FE3A 4BX2A 5AVWA 2HHLA 4Y2QA 3F9RA 1RDFA 3NALA 4KX5A 2QLTA 2Q4TA 2JGAA 2C8KA 2HDOA 3OCVA 3L0YA 3EWIA 3SD7A 2B82A 4MWOA 2FDRA 5AVRA 1X42A 4EX7A 3FM9A 2ODAA 4Y2PA 2B8EA 4XPZA 1YS9A 3QU2A 1U02A 5ALPA 1KYTA 5ALDA 3EF1A 3ZTYA 2PQ0A 3ZX4A 1QQ5A 2Q5EA 4UARA 3M9LA 2WFAA 3WKEA 3W5BA 1XVIA 3NANA 2BDEA 3ZI4A 3A1CA 2MU1A 3WKAA 1RKUA 5AM3A 4KNWA 4ZEWA 1WZCA 2YN4A 3E81A 1L7NA 4NAVA 1U2TA 1YNSA 2FPRA 5ALKA 4OCZA 4BX3A 1RLMA 3QUBA 3WGUA 4DWOA 3NUQA 2CFTA 4JDPA 3I6BA 2YFYA 4HGOA 2WHEA 3AR4A 2RARA 3A1DA 2B0CA 2DQSA 1Z4OA 2ZBFA 3CNHA 3OCWA 3ZTWA 3ZU6A 5AI4A 5T41A 2BY4A 3QUCA 4RESA 5AIAA 4PNHA 1L6RA 3ZW7A 5AW5A 4Y3UA 3WKCA 2YY6A 2CFRA 5ALQA 1QYIA 1T5SA 4ZEXA 1WVIA 5AI0A 5A3QA 3N1UA 2OYCA 3N8GA 3SF0A 5ALRA 2I54A 1RLTA 1QH9A 2YJ4A 2YMLA 3ESQA 4G63A 4KN8A 4NABA 3IJ5A 1EK1A 2I34A 1L8LA 3E84A 4OFZA 2W4MA 4F72A 3L5KA 4DCCA 5AVXA 3ZVMA 4YIKA 5AW2A 1RKQA 5AVUA 3FPBA 3L8EA 5AVTA 1LVHA 4L6CA 2AH5A 2ZXEA 4XQ0A 1TA0A 5AKGA 5AKYA 2IOFK 4HGQA 4YCLA 4C4RA 1RMYA 4J2TA 2C4NA 1PW5A 3MC1A 3SKYA 3SMVA 2CFSA 3DAOA 1ZD2P 4XE5A 4Y2UA 5AI8A 3AR9A 3WGVA 4NWIA 3WKDA 2W11A 2X4DA 3OCUA 5AM0A 4OHFA 3W5CA 4UMFA 2ZBDA 5AVSA 1AQ6A 5AK6A 3DNPA 3QLEA 3UMGA 2QYHA 3R4CA 3ZUPA 2P27A 2GHQA 2W43A 2NYVA 3ZWKA 3QX7A 2RBKA 5AW4A 2YBDA 1RC8A 1ZJJA 1YV9A 2C8LA 3RF6A 1Z4IA 1ZS9A 2R8XA 1IWOA 1J97A 4UMEA 4C4TA 3SLRA 2FPSA 3UM9A 1XP5A 2OBBA 3ET5A 4RETA 2VKQA 2CN1A 5AKJA 4YIHA 5ALSA 4UU1A 4H1WA 1J8DA 2EARA 2GO7A 3OCXA 3B9BA 1Z5GA 3KOOA 1WPGA 2ZBGA 3P96A 1Z5UA 1RMQA 2YJ6A 3A3YA 5AW8A 1L8OA 5ALNA 5AM2A 5AI5A 1RMTA 4BNDB 5ALHA 3L1UA 3EPRA 4BEWA 1Q91A 3AR5A 1TJ5A 4BKMA 3MN1A 5JJBA 1L7MA 4NFLA 4EZEA 3BWVA 2WM8A 3OCZA 5ALEA
chains in the Genus database with same CATH superfamily
1ZYQA 4RJTA 1C9NA 1C30B 1CU1A 1YJ5A 3SAFA 3L7LA 4E32A 4BO0A 5IKXA 1Q2XA 1E18A 2ZUWA 3MTJA 4O3NA 4WLOA 3PW0A 3D0OA 4PGHA 4D46A 3E35A 3BN3A 4RTMA 3VNUA 3EVAA 2C9MA 4J3FA 4BXOB 1J2RA 3QKSA 2C1ZA 3KNZA 1CNMA 4BNIA 2AKAB 4XVRA 1T4CA 2IOHA 3LBHA 2YVKA 4US9A 1D03A 4TSFA 3OEWA 4Z9BA 1JG4A 821PA 1SXIA 2ZIXA 3NLLA 4RK4A 1UMDA 1KOLA 5TMEA 3DV9A 2AG0A 4LF9B 3A05A 3D6JA 4KXQA 5IVPA 4N39A 1WHSB 1O96B 4FX5A 3MPOA 2XGMA 2XCTB 2R96A 3RKUA 1DDOA 5L4NA 4RMJA 5D87A 5JY1A 1JT2A 4UM5A 4XB1A 3UAYA 1UT8A 2X5KO 3ZWCA 4FB5A 1S2MA 1RWQA 3MS2A 4NDAA 2Q50A 4IIUA 1M5UA 1E89A 4G25A 6NULA 4ZAXA 3R5FA 3PWKA 4LYGA 2H1LA 1DRGA 1K7SN 3GLFB 5KB3A 5HUQA 5AM5A 3BS5B 3ITEA 4HMPA 3A1EA 3FUWA 3KSUA 5CXXA 1BPEA 4I2AA 1APBA 4F11A 9ICQA 1Z0SA 4J1SA 5IF9A 4JMPA 2EYQA 1TB4A 4US1R 2REBA 4TMXA 2QUBA 1EBBA 3PJDA 3I64A 1OROA 3IMCA 5KG7A 3H2SA 5CTJA 3BRCA 2P6NA 2WB2A 2JK0A 4LOAA 3PWSA 1KS9A 1W581 5JI2E 4DJAA 4EFMA 2PMZF 3GDXA 4TMYA 1N0HA 1A0PA 3A1VA 4I55A 1G6Q1 2A4MA 2D2VA 4W1QA 3AM9A 4E2ZA 2VUIB 4EY8A 5BOSA 4DL4A 3IH5A 2LR0A 2AG6A 3ANYB 3C2KA 4IIJB 3TRKA 3BMQB 3JATB 1WB6A 1VMAA 4EEZA 4FYPA 3BRWA 2RAUA 1TRHA 3W5HA 4ZTBA 1BH6A 5G1PA 4EYEA 4BX2A 2Y67A 4MKXA 4EY6A 4UNNA 4H59A 1IB6A 4DPKA 4X61A 1QJ4A 4KAAA 3O75A 4ADSG 3GPLA 1CP2A 1E9DA 3KOZA 3V6MA 2P75A 1SCDA 3PQ3A 5ECYA 4B3DA 5CM8B 3BXZA 4E08A 2XNSA 2HQSA 2KI5A 2W4QA 1RKUA 4PHTA 3A25A 4INOA 1H5NA 5DW3A 1U2TA 2FPRA 5T4HA 1KO8A 2HSEA 4PZCA 4PQEA 1E9AA 4C2AA 4JB8A 4WOBA 4R2KA 4BFYA 3B6EA 1PZGA 5AIAA 3V4VB 2FOXA 2UVWA 1JQDA 5JUWA 1HQCA 3OFVA 2I54A 1U6IA 1L2TA 3DDSA 5LNK1 4OMCA 3Q1KA 3WXMA 1P8JA 1AG9A 4MUKA 3GLIA 3WXBA 4CKZA 2NU9A 1DG3A 1VKJA 1Q74A 2PJUA 3WWEA 2VKTA 5K6AC 2PZAA 4GPTA 1VC2A 3QUSA 3A31A 4EPWA 3HCRA 4WZBE 2GZRA 1I33A 3L7CA 3QE3A 1JW9B 4RXMA 3DNPA 3QA9A 3QLEA 3UMGA 1RLUA 3NWEA 3ZUPA 2XNDD 3ZNQA 2EANA 1E4EA 2H5JA 2WSYB 1ZN8A 1S96A 5G1OA 2RJNA 2Z6AA 5J2TA 1KJJA 4Y30A 1U9IA 4TXNA 3H5LA 3UFXB 3VA7A 3EPRA 2KMLA 3LUAA 1I3MA 2R85A 2LMRA 2PL5A 3TI0A 1US8A 3ILVA 1H23A 1MOPA 1UMCB 3HQ4O 1P1JA 3CG0A 4Y8VA 2H85A 2NVUB 2YQEA 3IQHX 2ZRFA 4NQZA 4YCJA 4FFRA 4H3KB 3ETCA 2VRCA 1D2GA 4RY8A 2E1FA 3PLRA 3AZQA 4PAOA 1QX4A 5FD8A 3SS9X 3GT0A 3K6SA 5C52B 1PEDA 2HEIA 2A5DA 2HSZA 3ORRA 1PWYE 2QHXA 3LCJA 5H0IA 1W4RA 1FDTA 3KT6A 1W0KA 4O3PA 1E3TA 1Z35A 3CIOA 1HNWB 2UDPA 1Y3IA 1MIOA 4DSAA 1EXVA 3A0UA 3LUKA 2NTNA 1N2IA 3I9FA 3NVYA 4UQPA 1OI2A 2W03A 4HCJA 4U02A 4US2R 1JIHA 4XOUA 1M1XB 4JYPA 1LPMA 1IN1A 2QVXX 4TN5A 1JE0A 3DDNA 2KBEA 1GPJA 3KUXA 1SD5A 4UCFA 1HEIA 4G2NA 3RVLA 4G0UA 4IX9A 3R41A 3ZDAA 4CMBA 1MRNA 4FCWA 5NLLA 3CH6A 1VKRA 2XGQA 4F2PA 4ZK2A 3OT4A 2RB4A 4IF6A 3QTBA 2VUHB 1SD1A 1EWTA 2CL6X 3W5AA 4H3SA 1ZKMA 3W6UA 1XHLA 4F4WA 3K1RB 3PPVA 1E3DA 1OTYA 2P91A 4QL3A 4CF3A 2C4KA 3LRTA 1A97A 2XCRB 4BFVA 3IEKA 5IT0A 1E1CB 2KHVA 4QJFB 4MS3B 4Z99A 5LU9A 1L5VA 4KQ6A 1AK1A 4WNYA 3TCXB 3KU4A 1N61A 3AVUA 2ZWVA 2KM1A 1F5NA 3KFUF 4LFCB 3I61A 3SSNA 2HAEA 1EUCA 4X93A 3WNCA 4I66A 1W73A 3UBMA 3ICEA 1J5EB 4QG3A 3C5CA 5JAHA 3CP8A 4MUFA 1GRQA 1T9BA 4O2BA 1ZGJA 3MCZA 1KL7A 3L92A 2ZIUA 4IVNA 4LECA 5E0OA 5AT1A 3LL7A 1U3GA 3S55A 4BN0A 2V9ZA 4G2TA 4MW7A 1DIGA 1LDNA 3FOCA 1T5DX 2R68A 2JH7A 2M1XA 1X7DA 3JVDA 4TSFD 4ZP1A 5CEEA 3O4HA 1PLLA 3ZBTA 3CPEA 3BD7A 4NAHA 1GGMA 1J1ZA 4R65A 3C97A 2A0KA 2ATXA 5DNYB 4NLGA 1UINA 1V11A 4XWOA 1AKRA 3PMNA 5A03A 1PL8A 3DGFC 4LSGA 4W5OA 3SS7X 4YMGA 1FDSA 1NJ5A 2I62A 4NK4A 1TAUA 4N49A 4PTYA 1RKBA 3GLFE 3CUWA 3T1YB 1PJLA 1NMXA 3HV0A 3HXQA 1I4LD 3ND9A 3I6BA 5JJ5A 2E5WA 3RIYA 2V7GA 4PN3A 5G40A 2CSUA 3KEQA 4TLCA 3KEOA 2K5UA 2GRAA 2PX4A 1GARA 2WE8A 3DC2A 3B20A 1NF8A 5HUJA 3VR3D 1AK2A 4XCQA 4FLEA 5JAIA 2DGZA 1YR8A 4N40A 1ZPDA 5EJ5A 3QH4A 4Z51A 2C8JA 1NE7A 4CIXA 1PGJA 2VAMA 2V5AA 4GGOA 4TLAA 5J63A 2ODTX 3O47A 2MYTA 1TZBA 2AE2A 3OZSA 1AKWA 1W19A 2BFAA 3KFVA 5ED0A 1NOJA 1ZVJA 3AU2A 4M0CA 4OQPA 1SBQA 2J0QA 1GJRA 4BX9A 3N6VA 3AWDA 5E1DA 4QJ3A 3KCQA 2ZUTA 2KE5A 4EZEA 1UOEA 4EBBA 3BRWD 3KP1A 1KEZA 1KEVA 4G89A 4J0HA 3RD5A 2W0MA 4PGQA 7ICKA 4YJFB 1NSTA 4IDDA 4JCOA 3DOEA 5IJ0A 3BQ2A 4NOJA 3ZGOA 4HL6A 4PPQA 4UAWA 4PYLA 1TZKA 5I9BA 3ANNA 2R7MA 4MIYA 4QVKA 3HW8A 1Q20A 1OZ0A 4D3YA 2FFJA 5IPFA 3AJDA 5EJ9A 2FWRA 3VSAA 4QZFA 3GL9A 3OLYA 1WKVA 3SVZA 3KWLA 2XMQA 3K6RA 2VP4A 1F1JA 1TU3A 4BLSA 3DP7A 1KDRA 5HXAA 3N3AC 4E4TA 3CMMA 1DC7A 2L69A 4OLBA 2VC2B 4QU0A 4XYMA 2AN4A 3WFIA 4W9RA 5EJ2A 3HH8A 1U9IC 2D1YA 4M3NA 5JVDB 1FSZA 2LPMA 1B73A 3H5RA 3CVXA 3PF8A 2A86A 4Z6EA 1F6BA 1YRBA 1N4AA 4S2EA 2IWHA 3DD5A 1WXQA 5KX5F 4RKQA 4ETNA 2X9QA 3LY9A 4Q00A 4QZVA 2R8ZA 3B12A 1Z4LA 1GUBA 4BUZA 3AZOA 2GFHA 2AB0A 7ICOA 1E2EA 2QXYA 1F7UA 1ECFA 1KR5A 4HGYA 5LIRA 2W6OA 2ZSEA 3RC2A 5G5GA 3HCAA 4OU5A 3JQAB 2FUG6 1NJZA 1D7AA 1DCKA 1K6JA 3A3PA 4DMKA 3DEYX 3OQHA 3T15A 3G13A 1E77A 4AT1A 3NOQA 3PNPA 1ZL2A 1U0EA 3K0FA 2QP9X 2IEDA 3AEQA 2G8LA 4JI1B 4KQXA 2RHFA 1C3EA 2VDRB 1OT5A 4G86A 5DBGA 3TW4A 3G0DA 4JU8A 6AT1A 2I2AA 1WB5A 3THYB 2VRCD 4M1TA 3UKDA 1DGJA 2WAQC 4UEJA 3MTAA 3C5WP 4CLRA 4X54A 1ONPA 2W70A 2SNIE 2LZ0A 4RPZA 5K3CA 2WD9A 4WOKA 1L7PA 1W0KD 1SL2A 1H1LB 3UAWA 5B57C 3NNNA 8ICXA 5KYWB 5LP1A 4KP7A 1PIWA 5M3BA 3PD7A 4JK3A 1V5EA 3CPHA 2RH5A 3FTQA 4X20A 3S1AB 1LU9A 1E7YA 4P08A 2QY6A 1SC1A 2WZDA 2J3IA 1NMEA 5JYEA 3E5MA 2Q6LA 2IHJA 4YDQA 1JFRA 1TTHA 5TPZD 4BASA 5TLSA 3QZ8A 2PGLA 2PX5A 5LB4A 1LBHA 3PKZA 3EG9A 3PQCA 4LIPD 2PZJA 3IAS6 2QGNA 3T9DA 4GVLA 1ZQKA 3LPMA 4KQ9A 3PIRA 3ZU6A 4C8NA 5IVKA 3EFOB 2H4XA 2JZOA 4PU0A 2W04A 4G36A 1AKEA 4JV0A 4CL2A 3JPRA 4FQ8A 3RAPR 1TK2A 3DT9A 4BLOA 1LFDB 3M89A 2A9PA 4DLEA 1D9XA 3RLIA 1IM4A 4L6CA 4GBJA 5AKGA 1C7EA 1WHTA 1K68A 2BSXA 3NH9A 4OAOA 3LXXA 1AXEA 3K8YA 2X2EA 2G71A 2NSJA 1BCSA 2N1RA 4JH0A 3OVMA 2FOIA 5IINA 4WKGA 5ADVA 4DRYA 4UHHA 3KOUA 2J6TA 4KYUA 4Q1CA 1KFKB 3QSGA 2QT0A 5J2BA 3CZRA 2NRXA 1GCOA 2Y0SF 4N82A 4DMCA 1Z5UA 2PS1A 3QMMA 3TSWA 3S1LA 1RXUA 1BKSB 1JAZA 2C22A 4H1VA 3EK2A 5BRAA 2OVBA 3REQB 1H85A 3OF2A 1JHZA 3PFKA 2Y4NA 2AI2A 2QARA 1H65A 1CULC 3NRBA 2J45A 1WOMA 5D85A 3CM0A 3Q7PA 1R5JA 2DAPA 1YT5A 3OI7A 3P27A 3JQEA 1UC4B 2DWOA 3AW8A 3SAGA 3LKZA 3GRAA 5ELMA 3OLXA 1PTKA 16PKA 2SKEA 2XAAA 2HF7A 1K08A 1XWLA 3NIWA 4ZCRA 3C48A 4YCCA 5KTRA 4MKFA 3BD6A 3LKDA 2C8VA 2C3OA 1ZWKA 3FKJA 3U7EB 6REQB 1PJSA 4ECRA 2Q29A 4XYGA 5YASA 5IANA 1P1BA 3PUYA 2YC2C 3EYWA 1H2XA 2X77A 3M3HA 1MTOA 4BX9C 1GFIA 2Y76A 1EQUA 4YT4A 2K4HA 4GSLA 3QMVA 4H3VA 2BCGY 2X0JA 1Y9ZA 4FC7A 1UKZA 2VK1A 3EGDA 3KUUA 2WJAA 4OLHA 4A7PA 1UQRA 2WKQA 5KFYA 2WUFA 3LH5A 3CXRA 2RHTA 1EA5A 1QIIA 3RTCA 3CF2A 3ZV3A 4RUKA 4A92A 4Y98A 3KOYA 1MH1A 2B25A 2FWAA 4MW2A 4B83A 2V4ZA 2ONJA 1XEXB 4MLDA 1K6XA 1CQIB 4ZFNA 2QAGB 1AJEA 1A7AA 4DA0A 3WHPA 4FOSA 5MFZA 3C24A 4K9NA 2X9LA 4QNNA 1J8FA 3OC6A 1AS2A 3QWHA 4X41A 2CW5A 4Q9NA 4ZI7A 1UR5A 2OY0A 4PX9A 2GPYA 1I4OA 4JR0A 3M8SA 2M1ZA 4XWYA 2AR9A 3ZWNA 3BL6A 4QU5A 4KTQA 1JDBC 4CM3A 3KSBC 3ACDA 3OWXA 1I3NA 3ELYA 3WIUA 2HDWA 5J2JA 3RF7A 1E60A 5JSYA 1PT5A 3CZ4A 1AOXA 4H7JA 2W6MA 1WPQA 1UBSB 1ONSA 4FI3C 2B1JA 1J0BA 1EZZA 3GN2A 3BXHA 3TJZA 2J7KA 4QJIA 2VSOA 3B1ZA 1ZWLA 4LVCA 4H7IA 1C4KA 4R9VA 2X9GA 4N3AA 4UTZA 3QV2A 5FTNA 1LS1A 4C4ZA 2EKDA 1U48A 5BUSA 2IODA 4YAOA 4E5UA 1G291 3HR4A 3NR2A 4UNRA 3NJ4A 3GQCA 1BROA 4XD7A 2VHTA 1FQKA 4S04A 3HDJA 2YWFA 1FOEB 1GG8A 3KB8A 2G1JA 2FMIA 3F8WA 2NW6A 1A27A 4YCXA 4D57A 3TJMA 4HBZA 4FGZA 1W9MA 2O3SA 1PK7A 3W90A 1H4TA 3NDJA 5HS4A 4NMLA 2IY8A 2IGTA 1HOTA 3E9EA 2GLUA 4ZYXA 3K70C 1JR4A 4OX9Y 2EP7A 1EU1A 2H8KA 3T3MB 5GJBA 3MTGA 4OF4A 4OJNA 3OPQA 4YXJA 4ZYTA 3TMAA 2DFTA 3VISA 4D9JA 2W2KA 1L3TA 1RMYA 1DDIA 4WFKA 2EW8A 2P4HX 3LT4A 2CYBA 1C3OB 1RJ9A 3E4CA 4GX2A 3JSAA 5AK6A 1T6XA 4NNOA 3N8IA 3HGMA 1XAIA 2SICE 3FWYA 1FMFA 4G4IA 1X80B 1WVGA 5K3BA 4P9NA 3JR7A 4I1RA 4KMOA 2LM4A 3V4OA 2L19A 1KDYA 2R86A 5KNDH 5I7OA 2V7VA 1SU7A 1KKLA 2GO7A 5CYOA 4MEAA 4F5OA 3WGJA 3K70D 2AJTA 4EPVA 1BPXA 2CLIB 1G4AE 5A0FA 1TJ5A 2JFBA 4HWGA 5IDXA 5FOQA 1G5HA 4BEVA 3FYCA 5BSFA 4LX8A 3OOHA 1LDMA 3I52A 3TI9A 1FNMA 3VPDA 4C8OA 2D0IA 2XE7A 5LDGA 2I2DA 4AJOA 3IPYA 3ZVRA 5EESA 5EQTA 2P65A 5K9ZA 1PKEA 2EQYA 1RWWA 4UDYX 3SS8A 5JJIA 3AEKA 2FYTA 1V3QE 3AEVA 3QXJA 2KIWA 4EOGA 1KL9A 1GNVA 2EIXA 5SZHB 3MBKA 9ICMA 4XM0A 2IPAB 4M9JA 4FNOA 3IV6A 4M9CA 1ETHA 4CCWA 2GOYA 2AFIA 4O1HA 3W9BA 3M0EA 3TAUA 3V8QA 4BWMA 4L5CA 1DAEA 4NSNA 1RIFA 4DY6A 4L4XA 1DPGA 3RREA 2HX1A 2JFOA 1N9KA 3KJGA 3T79A 3GG9A 3WJ1A 3CWCA 3AIKA 3DPUA 2XRYA 2ZYAA 3GJRA 3K9HA 2BFWA 1UZMA 3OFJA 1BMDA 3NJ8A 4Z6CA 4P34A 2YJNA 1KJIA 5DGAA 2Q6IA 2OYYA 3HU1A 1RPNA 1CZKA 5B2EA 3TZQA 4QICA 5CCDA 4TTVA 2HA6A 1N8KA 3H7IA 4US0R 1GG2A 1DUIA 3H3FA 2YWXA 2OORA 3KLPX 1P5HA 1K75A 5CEJA 4CCHA 4QDTA 1QYVA 3OTQA 2PFPA 4PAMA 1A9QA 2Q07A 2E4AA 3FGNA 2C78A 3MMZA 2FPPB 2ODBA 4PLCA 2X19A 2PSJA 1RHMA 2HMYB 3AG5A 1LK5A 4ETMA 3G9ZA 4JWTA 4DSEA 4GX5A 4C14A 3HUUA 2DCMA 1IXYA 3H0LB 2PBRA 2LBOA 1YRWA 2NAPA 2J4DA 3MCAA 4J0JA 4B3TB 3OLQA 2B4QA 4D43A 1CHNA 3GBPA 3SX2A 3HTXA 1R8SA 4GRDA 4NMXB 3F6EX 2IXFA 1XO1A 4I2FA 2YV5A 3OKAA 2EZ9A 2NXWA 3Q15C 3IBFA 3VU0A 1EP3B 1VLZA 5EKDA 4PZLA 3Q0EA 4R3NA 3RC1A 1TT5B 3DE5X 3SGLA 4UVEA 2O8FB 4H1TA 4WNAA 5EJFA 2DPIA 3A0RB 4HZGA 4ZVKA 1QH1B 5KJ6A 1L4MA 3UJAA 1OZFA 2Z8YA 4TTTS 2C8KA 1XE3A 2FSGA 3INTA 1ZQSA 3AM3A 1A4XA 2JLWA 3SYTA 3H87A 4R9RA 2ESEA 4HN4B 4RTKA 4J9OA 2QPAA 4CCAA 4TL9A 3I9OA 2VNIA 4HATA 4PPYA 4FMCB 1JV2B 2V6FA 4D5GA 4XYBA 2XA2A 1CUKA 3ZU3A 1DJQA 4G67A 2CWWA 2YX1A 2OBYA 1YQ9A 5B5EU 2HJHA 3S0JA 2YVLA 4TQUS 5EZYB 2BY4A 4BQIA 1U28A 2XGJA 3I62A 3DBOB 3QKRA 1QE3A 1YJAA 2CUZA 4M9UA 2RDMA 1LGYA 2EF1A 2E87A 1E62A 4RTJA 4E5MA 1PJCA 4L8GA 1MAUA 1DQYA 4ARCA 4P3YA 2V5VA 4JSYA 3CNOA 4RFVA 4BNFA 2WEKA 2YOFA 4ES6A 3W5CA 5KMGB 2PLRA 5BV7A 1HSOA 3JPPA 4A9AA 4N4AA 4X71A 3CLRC 3PITA 1D0SA 3AFOA 4UMEA 4MR9A 1M74A 2QLJA 3WMFA 3VR6H 2NGRA 4KSCA 4EMBA 1IY8A 3N2GA 4ZCSA 4C7JA 4QEZA 2WB1F 4G09A 4F1WA 1TEHA 2XODA 3V2GA 4ILKA 5TJHA 3PJRA 1CQJB 2F3RA 3FLAA 4JEIA 1SXGA 1JIQA 2XCOA 3C98A 3C5GA 2IXEA 4DV2B 3EIFA 2IZ0A 3BJEA 2AN1A 1KK2A 4E2FA 8ICAA 4W5TA 2GPJA 5KSWB 3WIDA 1X7XA 1OLUA 2AMLA 5AJVB 4K5QA 1EDDA 4TOIA 1DOZA 3TB4A 5KWSA 4DRXB 1MLDA 3UW3A 4FBTA 2I65A 1IOWA 3AI2A 4XD7D 1DTWA 2IHVA 2FQXA 2P9BA 1RU3A 2H1OA 1UBHS 2H52A 4H16A 1GL3A 5EWEA 2J41A 2KSOA 2EVWX 1LB1B 4OL0A 1RBQA 3OTIA 3OA2A 4RPIA 1K8QA 1G41A 3MWEA 1C0KA 3KSRA 4CKBA 4LBYA 4UAUA 1L5HB 2JLSA 3C15C 3ROTA 2QTFA 3CVWA 2Y1DA 1EGHA 4E11A 1HEYA 2HK6A 3IX7A 2AMYA 2IYTA 1ZJNA 4F4XA 1C8BA 2EWVA 3UK0A 1YZVA 4Q4DA 2JAUA 2IL1A 3QBDA 3SC6A 2H3ZA 1VDMA 3B38A 2BM9A 1ZD9A 3HZOA 5IUKC 3WAJA 4D99A 1UKCA 1MZPA 4FM9A 1OA1A 2HLHA 2Z7JA 2R6GA 2J6IA 3CH5A 2AQIA 1JPUA 2ISQA 4GMFA 3T7RA 4EAQA 3RFXA 2QIOA 2O8EA 3LQRA 5DYWA 1YDFA 4B17A 4FS8A 3JYHA 4RIIA 5IP5A 1COKA 4ZAZA 3M7DA 4YP5A 3JARA 4EB3A 4ERNA 5CD1A 2B4AA 3GEHA 9ICIA 4M8IA 3RVRA 1GTJ1 3KT3A 4GMXA 4CQMA 3RJEA 4YK7A 3T5HA 3C16C 3OJLA 5D1HA 3ALRA 1M9NA 2O2GA 4OLFA 1KRXA 4PS0A 2AEEA 3G9TA 1AQJA 2O0JA 4ZOCA 2MSKA 3G9UA 3V1UA 4JLPA 1KLNA 1HYBA 1TKCA 1ZQCA 2C2DA 2XH8A 3O90A 4QPDA 4J9LA 2OCYC 1Z4MA 3COPA 1XZNA 3D2CA 1AKQA 1IY2A 4W5QA 4MKZA 1PYOA 1GRNA 4GICA 4R2IA 1JXLA 4OQLA 1DO8A 2P40A 2W37A 3V4FA 3WGLA 1B6GA 4D9KA 2IBTA 5M7EA 1PNOA 1GPDG 4I4TB 1Y8CA 2N42A 1AX9A 1W46A 4KO2S 1JAHA 4M47A 3MWDB 2IITA 2HBYA 4E03A 4D02A 5FA5A 5HR6A 4Y2PA 1U2ZA 1URPA 4ZYYA 5KJFA 2O7VA 4QWWA 5JRDS 5CLFA 4KBYA 1D7OA 4KRGA 1TTQB 1W25A 3CZMA 1GADO 1CY6A 2YBEA 4G5HA 3OY2A 4G6ZA 3I2GA 2XJ4A 4PNZA 1Z9BA 2KTQA 4GAEA 4FC6A 4G8DA 1U9JA 1K1SA 3TDMA 1LXCA 4CFYA 1MPXA 2VJ5A 1ZQ1C 2WSLA 2ZROA 1A9YA 3O4IA 4KR0A 3LPLA 3ANTA 4XTRA 4FFBB 2G7ZA 1Q3KA 1XEFA 1I6LA 4NENB 3T9BA 3DKVA 3ZGVA 2QG6A 1OFTA 2OXIA 1JSLA 1W49A 1VP9A 1M76A 4IH9A 5L53A 3GNSA 2ZBDA 2H7VA 3A9RA 4XKJA 1IE3A 4R5MA 2ZULA 1S77D 2ZTVA 1CDEA 2W2NA 1VHTA 1ZJJA 2Q21A 4OX9B 1KK1A 4KR2A 3G59A 1EUZA 3H9CA 4CI9A 1E6KA 4D4LA 3KQVA 2R25B 2AFVA 4KXMA 1ZZEA 4JBXA 2A1IA 3T1VA 3GEDA 2RKBA 2CXHA 3UGQA 2O6KA 5KWEA 2BFOA 1U28C 2RGBA 4RQUA 4JUAA 1HO3A 2P6PA 1C2TA 4MULA 1JFSA 4OFBA 1CDDA 3KR1A 3TQTA 2AE1A 4JGBA 3PUJA 3V7YA 1L1RA 4DQKA 1R9MA 1YDEA 5LP6B 1AKYA 4D98A 2QM3A 3BGWA 3HKCA 1E1LA 3JQ7A 4IIYA 4TRRA 5IIIA 2BLLA 4IH4A 4G5SA 3HPRA 3FCOA 4FN4A 4MYDA 3K9GA 3L8YA 5CVVA 4FUQA 1XMPA 4H7DA 3RSLA 5G4LA 5GY7A 3EVGA 4LWPA 3RW9A 3FPKA 3WNQA 4A6PA 4RVFA 4WSOA 2PFKA 1IULA 5CK4A 3H4TA 1Z82A 5EXEA 1NX9A 4AIIA 4A10A 1HDXA 5JW6A 2BL4A 1NLZA 3UMMA 1ISIA 5BSGA 4N7BA 1WWKA 3T1NA 3FYDA 1XV5A 1OAAA 2FFRA 1NXPA 5JD6A 4TSRA 3K1JA 1G21B 4JVMA 2WG0A 3C29A 2WP8J 4AYTA 4ENQA 4ID9A 1KF0A 2AN3A 3OJCA 2J5BA 3D3EA 5GONF 3DS8A 4XGNA 3LSTA 5B12A 3EGOA 4BQFA 4BNYA 4AO6A 2NM0A 4IQ8A 3K2QA 3EEQA 5DTMA 3FSRA 4RF4A 1I7DA 4UHDA 4CLOA 2OILA 4UTNA 1PX2A 2WAMA 5IT9A 2FKAA 1SVWA 3U7JA 1MO6A 3UK6A 4M0UA 4YUXA 2BKEA 2DTDA 1P5ZB 1T0IA 4FT2A 1J8VA 1R6UA 2VDVE 4KFUA 1VXOA 2D4AA 1PHPA 4CE6A 2RDJA 2Q7DA 4O1MA 3C1ZA 4KX3A 4MDEA 3SEQA 3WA7A 2UXCB 2H48A 2Y0SC 1SRRA 5EP4A 1KEKA 1KFCB 2H17A 3WSVA 1QIFA 1B1AA 2B0JA 3I9V6 1T4DA 5JNUA 4UREA 3PGKA 3PEUA 4FZNA 4BZXA 2HMTA 8MHTA 3K4QA 1SA0B 3R09A 4KPYA 1RYDA 3TG8A 1J6UA 1OWOA 5L1KA 2G5HB 3RYHB 2QG9A 2AC7A 3PV0A 1HX7A 2ZIEA 1H1TA 5HPYB 5DB8A 2FW7A 2D2FA 2YHIB 2JGAA 5K45A 2FR8A 4OVKA 1CUCA 4NHEA 2V9PA 2H1VA 3TAHA 4WBNA 3HXMA 4R8RA 2WG2A 5C53B 1NBIA 4LX0A 2Z0MA 5CVJA 8ICUA 5ERGB 2JZNA 2BF7A 2B7CA 4M1OA 1WZCA 4EMUA 4LDNA 2CHQA 1S89A 2G4CA 4N3NA 1ZQQA 2EX4A 4YR3A 2JGIA 4LN1A 1G8GA 2ASVA 3QYFA 5KFCA 4QFMA 2OYCA 4KWTA 1Q1GA 1FFXB 4RTPA 3PC3A 2CDBA 1Q7TA 1U8ZA 2JC3A 3P94A 4KO1S 1IEXA 2HWKA 4M55A 5K8VA 3CF6R 4KLZA 2RFLA 3AUAA 1GLVA 3CE9A 1AHNA 1NE2A 1R0RE 2YOGA 4TTAA 2WTBA 1OJ7A 2BFPA 2PIDA 5I6DA 1TW2A 3KRTA 3HVUA 1NXQA 1PGOA 2G9ZA 5BSKA 4CQMD 5LLTA 3UGKA 1M75A 3GP5A 5KDOA 5K7SA 1MO3A 2W43A 2FHSA 2PRYA 3IVAA 1VE5A 1XCGB 3PT5A 3MTDA 4OQXA 4TZKA 1N5OX 1JS1X 2ZUCA 4Q8EA 4F91B 1ICIA 4LYJA 5DW0A 4D9GA 1IIRA 5HJ5A 4V2IA 4RO0A 4D6XA 1DSSG 2ZYRA 5D00A 3FY4A 2HWXA 2HPAA 5JISA 1W47A 4Q3BA 2VPQA 1ADBA 1UK7A 5KFSA 1ZQ9A 2D5AA 1DC8A 3JU3A 4WK2B 3VMMA 1KAOA 5ICMA 4NIMA 1CR4A 3GLSA 5DN6A 5EGNA 1JQ5A 1IONA 5DWQA 3QITA 1U94A 4X8MA 4FLMA 3O4RA 3PZRA 4B9AA 2ON6A 2IHYA 4EGFA 3MZ0A 3UGJA 2O48X 1R8JA 2BPGA 4QZHA 2VDKB 1QGYA 3JPTA 3D6VA 2ROQA 3LLMA 1H3FA 2AZMA 3DCJA 3GHYA 3FAZA 4EJSB 2VJMB 4KMRA 1PUIA 3N53A 4UB6U 4TGLA 4WN3A 5ALXA 2PT9A 3DHNA 1CFZA 3WK5A 4YMHA 2FZKA 1N2BA 3SJZA 2NUBA 3L6RA 3EXG1 1A1VA 2F9LA 1LPNA 4N8DA 2SCUB 5TQ0A 1IAQA 3D2NA 1SZHA 2DR0A 2CXOA 3PR4A 2A6PA 1QQAA 4WMLA 2WQ7A 3AF3A 1NJ1A 4D5EA 4I1PA 2H2GA 1Q83A 4GP7A 5JRJA 1JG3A 1U2DA 1IZYA 5D1NA 3DE3X 3FNHA 1KEJA 2FX2A 3IS3A 5CB4F 2BUBA 3P9QA 2D7JA 2JCGA 4V0NA 3HO1A 1U3WA 3D8TA 3DFIA 5TQ2B 4ALLA 3LKBA 3W4IA 4TM7A 1CB7A 1E3LA 4HGNA 2Z4TA 3E58A 5JZMA 3G0HA 2VI5A 1IPEA 3QRWA 2NO5A 2OSBA 1L3VA 3GLUA 3E05A 2D06A 4KLCA 1B8UA 2BBOA 3O31A 3VSBA 4UB2A 3EEOA 4O4JB 3RCBA 1IJFA 3NRCA 3GPBA 4IG4A 1PR3A 1Z39A 2P2SA 2ZW9A 4RVSA 1QGAA 3KBBA 3OJWA 4UPVA 2V3VA 3HBFA 4F8EA 5FOVA 3F7TA 2BFFB 2IU6A 2RSLA 1FSPA 2Z3VA 3ISCA 1S2NA 2I76A 4IS7A 1J33A 4XUSA 1AXRA 2EAPA 4YN4A 5I7EA 3RLFA 1DMSA 4MR8A 2NUAB 3BEOA 3FZQA 4O3MA 4AZ3A 2P7HA 3KJFA 2HWUA 3TFSA 5ADUS 3NYRA 2WF9A 2UVPA 3LHDA 1Z6QA 3BMCB 1SOAA 2IU3A 5D3MB 3AP1A 1EFHA 4FZ5A 4ZODA 3TPCA 2WHYA 1T1SA 1LNSA 3J7AC 4DA7A 1R18A 2FDRA 4MAFA 1QNLA 1X0VA 2NV2B 5A6VA 2UYQA 1G21E 3ZZ0A 1Y33E 1JXQA 2IIVA 1F3LA 3GFQA 1YQXA 5LBTA 4HX9A 2P4EA 2P6OA 5KNDA 4GLXA 1HC7A 3PDIB 3T3GA 2R1VB 3E5RA 4LK3A 1RI5A 2GPNA 5AI4A 1IC6A 4FHEA 2AOTB 4Z4CA 1B3RA 3CNQS 3UJ6A 5FAKA 5DGBA 4WJZA 2CY0A 1QO9A 4PGFA 3VR1A 3MWFA 3GEEA 1DC4A 4G63A 5E4FA 3KVVA 3TH5A 3USZA 1MG5A 4CJXA 3PS9A 1ZGAA 3KQQA 5HKBA 4TVBA 1BE8A 4DCUA 1TKRA 2VAWA 2E8PA 4B47A 3OUZA 4Q9JA 3MTBA 2DFKB 3JYNA 5DI3B 4Y2HA 5ARDA 5EHNA 3DV0B 2FR8C 4OK5A 5DOVA 5EFOA 1PG0A 3MFQA 1MQSA 2JGLA 3QUAA 4Q0MA 4CUKA 1UKYA 1OCEA 4BKPA 4DMGA 5H81A 3RT1A 3DKRA 4OKSA 4B81A 2DHEA 5EMHA 2ZI7A 1NDUA 2NVBA 1RT9A 2QVBA 3FBTA 1UA0A 5LYJB 2J4CA 2JRLA 4PINA 5LQSA 4CMAA 4DMFA 3GZFA 5F3DA 4L7QA 1ZICA 4BB9A 2UZ4A 1N0VC 4ZO4A 1X7HA 1JQEA 2RHGB 2XQIA 4M9QA 3KO8A 3RJMA 2JJ2A 4FMDB 1XDZA 2G8NA 4EHNA 4HUQB 4Z4QA 3P52A 3RS0A 3EMVA 5I8PA 3P5BA 5IAAA 4PRKA 2P11A 4CG3A 5F76A 1BHJA 3FGOA 1AF4A 1NYLA 2GN1A 1EWKA 1CVIA 2N46A 4JJFA 2F3QA 5KYTA 5DGHA 6ABPA 2O0LA 3NHKA 2DUJA 2P6UA 3IOMA 4JYBA 4HVLA 1YE5A 1PJBA 1MTZA 2K89A 1MAHA 2JGJA 1H9AA 3O1LA 4CTKA 4WI1A 1VSTA 2H4HA 3T7DA 3KZCA 2WSBA 2GESA 3K9BA 3NVDA 1YK1A 1PO7A 2QTNA 3L06A 2IXTA 4RTNA 2HNBA 3AHDA 5AQEA 3IERA 2IGBA 3ETLA 2HM7A 2F3SA 4WZZA 4BHTA 1J56A 3DDUA 3BUSA 2IHKA 4D6YA 2GN0A 1D5WA 5I3CA 3PC2A 1Z5ZA 1JFFB 2Q3EA 2YS7A 3TTSA 3C28A 3WLEA 3GH3A 1SQ0A 7REQA 1WUIS 2H11A 1C0PA 4KSBA 4NH0A 2AOXA 2VYQA 3FNFA 4PSUA 1KP3A 4IXDA 1LW6E 1AHHA 3T06B 5IJXA 4JQYA 1HDCA 2ZKIA 2CGEA 2A9FA 3TW8A 4IS2A 4MICA 5FPSA 4KGVA 3D0RA 4UVHA 4U7HA 3R5TA 4E07A 1I13A 2XCAA 3NYWA 4KWHA 2KLHA 1TFRA 4LWZA 4HGZA 5FBQB 4NBKA 4OOFA 4QAJA 3NGXA 2HCFA 1Y1PA 3UJHA 5FPPA 3ZWWA 3B5IA 4JI6B 1P2BA 1IV8A 1XHFA 2O7NA 4NY1A 5DV9A 4P84A 5DN6D 4EM6A 1VMEA 1CY0A 1GFZA 1BPDA 4X6UA 3WP1B 3RPEA 4MP6A 3EUB2 2UZ3A 1V95A 2FW9A 3UMYA 4R1PA 3KVRA 3SQNA 2PGOA 5CHYA 4EZ9A 4C7ZA 2BGIA 2PUHA 1ED1A 1U2DC 1JEJA 1M2NA 1NI4A 4YFKA 3BB1A 2I6TA 3OTOB 3TVYA 4QHTA 2XCUA 2EAMA 4BNGA 4YRSA 1RYEA 3NBFA 1PJ2A 4MCHA 2HSWA 4U2CA 1ODLA 2ZRCA 2P2GA 4L8LA 2FPIA 5HK9A 2JIDA 2CYAA 2Y1GA 1DPFA 3JQFA 2HBKA 3ROEA 2AF3C 2GRJA 4JXKA 5B3KA 3L1KA 4YC7A 4EI9A 5C1DA 5EHZA 3ICVA 1UPBA 1ZQNA 4X95A 1ZVKA 3EZ7A 3VR6A 3TLGB 4Y1FA 4QGAA 1JZTA 1OQAA 2JA2A 1NK9A 1J8MF 3COWA 3DR3A 1RQPA 2CFOA 4OSOA 1CQXA 4B7CA 1W44A 1NBOA 3UCEA 4H4CA 1P7VA 1ZSNA 5KYVA 4BBPA 2HRZA 1QIGA 1HFWA 1UKVY 1JIIA 2QYSA 1EP1B 1XD9A 1A50B 1ULUA 4NABA 2FSIA 4F72A 4Y1GA 2R66A 4U6NA 5CIYA 4QZCA 3DBRA 2IZ5A 1HI9A 3PXEA 2AT1A 5ILGA 4I99A 4WDQA 3RASA 3DW3X 1ZNZA 2BR3A 3SKYA 4WADA 3T52A 4DA8A 4JIMA 1KP2A 5HMLA 1RJEA 1Q0TA 2PX2A 3WGTA 1NATA 2OPHA 1UOOA 2OKCA 2Y6UA 4LTNA 4DNQA 2LP4Y 1XK6A 3CUVA 5JR3A 4LXHA 2IW1A 1NW9B 1W34A 3KHKA 3D4LA 1N7HA 2NLOA 4H1WA 4RX1A 1R64A 1TKDA 3B9BA 3PX0A 1UBEA 2VP9A 5A3VA 3NT4A 2C9CA 3GCZA 1SAYA 5L7YA 2WUWE 4AG6A 1QKKA 1EVYA 4NMMA 1HNNA 1D6NA 1ZFNA 2DH5A 2QJFA 1DXQA 3RHSA 3B9RA 2JHPA 1E9SA 4J6EA 3PNMA 4AZWA 1N5XA 2A0XA 3EA4A 2KG5A 4ZAGA 2ATEA 3R5JA 3A1NA 3QKWA 5JADA 4D0LB 4YMLA 2I3ZA 1K88A 2O8BB 3EGWA 2VWHA 3G5UA 2O6LA 4TS3A 4N0EA 3NONA 2ZEJA 4Q18A 3I04M 1EWYA 5CW2A 5LDDC 3QPVA 4LXYA 3HJUA 1EFDN 4IXNA 2JLBA 3WGMA 4K0KB 3ZR4B 1LFAA 5KNDD 3DAFA 3O8RA 5IVHA 3EXIA 1QG4A 3AONB 2PJZA 4H3HB 3A9VA 2WTNA 4EJ6A 3OM9A 1H38A 1SBYA 1HE8B 4BGVA 2C98A 3K20A 4N5MA 4IJ5A 3PC4A 4AJNA 2UVRA 1SHJA 4XDGA 5JANA 4TWIA 1SKRA 2Q9CA 3KV3O 5I7AA 4GMKA 4FSDA 2QTCA 1BDMA 3R0ZA 3AXSA 1T9AA 4ZO7A 5JALA 4UU0A 1VJRA 3N59A 5C46F 2ZRJA 3UJDA 1USWA 2EF0A 3N7SC 4GOOD 3BFVA 3L0DA 2F6RA 5L51A 5ES4B 3L0CA 4MI1A 4WESB 4AKIA 4WEQA 4AC9A 2GK6A 2XYRA 1QF6A 1TZMA 2BFBB 3GIDA 1E1QA 2HR1A 3UHJA 2IV3A 4HVTA 2JJMA 1ETUA 2WQ6A 2ACWA 2JHFA 2Z3ZA 1L5YA 4LNUB 2JIRA 4YX9A 1CNFA 4RA6A 1PR5A 4B09A 3W5DA 2E0IA 2JJ2D 1WNTA 2Q4RA 4QTUB 1HL7A 2C2MA 3DD1A 2F44A 3CNBA 4OOEA 2F8MA 3LPCA 1A2BA 3C3DA 4JNCA 3NO4A 1KVRA 1ZRNA 3R6DA 1P45A 2VBGA 4H08A 3QWIA 3TIXB 5ALTA 2AMJA 3ROKA 3RRGA 5C8YF 3AINA 2VQFB 3DM5A 3ETNA 5A5EA 4I50B 1T1JA 4TQSA 1G3UA 3K1ZA 1PK1B 3AKYA 2PKYX 1EFCA 2GWRA 1MOQA 3W2HA 4NU6A 5CB4A 5DSZA 4S1WA 4EFDA 3C41J 5KKAA 2GCNA 2B6HA 4LAFA 3L49A 2AR7A 4NATA 4FZ3A 3GJSA 4FHDA 4UARA 3IODA 3G2OA 3KTAB 4E3WA 3FPEA 2I0FA 1ST2A 4X84A 4OQZA 2ALZA 1DXOA 3SXUB 3IVGA 1M2EA 4BU1A 1XDWA 4MJ7A 2GBLA 3CPJB 2Q8NA 5SZJA 1OH5A 3MB5A 3KAKA 1SULA 4WLEA 3PE4A 3L6CA 3LDUA 4Y6QA 1MPTA 1LPSA 1BTOA 4RXUA 2KJ9A 1U3UA 5DP2A 3HSYA 4DS5A 2O7RA 4ZMBA 3QVVA 1PZFA 5BURA 2G9NA 4UTPA 1NULA 1U4OA 4C0AC 1YRLA 4JJZA 4F8JA 1QK5A 3NP9A 3A2NA 4FR5A 1M6HA 3L82B 3DLHA 3ACBA 4TKVA 5DB9A 1XSLA 4XE5A 3PZBA 5THQA 3JQFC 3UJ3X 4A0HA 3DHWC 3PTLA 1Q0SA 5FR1A 4JZKA 2QPTA 3MF4A 5JLJA 3LA6A 4P0QA 3EAFA 5H83A 2XVMA 1XTTA 3LWLA 1XP5A 4RETA 4K05A 2QUJA 2VSFA 4EBDA 4EHJA 1BHSA 3NBYC 3HSSA 1J0XO 1BOOA 1X8XA 3EZYA 3GJ4A 5B58T 1M5RA 3LQ4A 3NPAA 2HREA 3HSKA 5FOUA 4NXMB 4TMWA 4DDHA 1GR0A 2AQHA 5EIHA 4C2UA 3DMYA 2RB5A 2PX0A 3TQIA 3GIMA 1GILA 1JSRA 4E5PA 3SKXA 1DIHA 3RFFA 4LC1A 4YWHA 4CRXA 4J9SA 1JKMA 4OQMA 1EBFA 5E79U 1MQ3A 3TQSA 3ILSA 3X1DA 1DKRA 3HS3A 1TXGA 2AN5A 3UANA 1W29A 2O54A 1JKIA 3VR6D 1VJGA 2GBFA 3FPHA 3AHEA 1SUFA 3U4IA 1OZAA 4NPHA 5G3YA 1KY4A 4HC4A 3TADA 1QFSA 4YB8A 4DMUB 2EATA 3MVEA 5KYNA 2H57A 4BFTA 1Z8HA 2NRVA 3D7KA 1RI1A 2YH2A 4NJ8A 3THOA 3GLVA 1YQTA 3NYIA 4UM9B 3U9LA 4RLQA 4JUDX 1GITA 1WM1A 2EIHA 4FGJA 3FSJX 4FCCA 3DM9B 3BMOA 1FVOA 4DOMA 2FJUA 1GNQA 1ZOOA 4CF6A 2BEWB 4BNDA 4DCGA 4GPAA 4IR7A 4B6FA 5BVGA 4LGYA 1T10A 1QHHB 1TL7C 2J48A 2YV3A 1IY1A 3E9MA 1YCDA 3HVJA 9ICHA 4F92B 2FP3A 3K16A 2HF2A 4NLBA 2G25A 3AUSA 4ZVVA 4IJKA 3WGNA 4URHA 1XAJA 3D7SA 2F1OA 1SWWA 3L7OA 5I7WA 1JQ3A 1AGXA 5JNWA 4HAUA 4QOJA 2C4HA 4F85A 2QTRA 1SR8A 1BDIA 1SPBS 3BBLA 1ODKA 2ZJFA 1UP6A 2PKCA 1ES9A 4G97A 5J40A 3RJFA 1EG7A 2NZJA 3PRKE 2FF5A 1LCIA 4QUJA 4ZJYA 2CXTA 2W6IA 2QV7A 3U2QA 3B6MA 4U2FA 2YXNA 1X9HA 5GMOA 1JSCA 2AUTA 3QF4B 4GKKB 5MHTA 1ZSVA 1HLGA 3E22B 1CC1S 4EG5A 1BYIA 3EDMA 1YMUA 4WL0A 5EHQA 2XXAB 4FINA 4ND6A 1A69A 3R6WA 3DP9A 5L9XA 2Y77A 5KYGA 4IIVA 4HNAB 1TF5A 4FW8A 2I6UA 3HO8A 4UBBA 2DMRA 1UJ4A 4I5DA 4TTJA 3TW0A 4V0ME 4C0HA 3HU3A 4MWOA 5L3QB 2CHGA 4F4FA 4KN9S 5CM9C 5TXGA 3DLPX 4TKUA 3T7KA 2WUEA 1K5DA 4URVR 4OLJA 2PMZC 3LW8A 2OZLB 5JASA 1CE8A 1V16B 4DCTA 2EZUA 1S0OA 2VBFA 3KPUA 4TM8A 3NIBA 3PX2A 3TFQA 1CLUA 3VFDA 1Q1NA 1JR6A 1NVUQ 3ZH9B 2C7OA 2IEYA 4N76A 3GV0A 4QSMA 3TL6A 1FLVA 3KOMA 5JSUA 4AJLA 5T41A 1Q19A 1T9HA 2X4IA 1F4PA 2M32A 1K66A 2W54A 4LYAA 3M2PA 1VSVA 4I36A 2WAYA 1QP7A 2J6HA 4QM7A 3C45A 4LXQA 3DEAA 1E1QD 5IWCA 2XY5A 621PA 4UULA 1H2EA 3VTFA 4DWJA 4Q7QA 3HWX1 1FFHA 4DSLA 5JTUA 2COKA 4KH1A 1GD1O 1DO0A 2Q2QA 1AB6A 5KG5A 2J6SA 4OP3A 3AUTA 4IIJF 3F5FA 5E4TA 3WFZA 1RC0A 3VI4B 3HA3A 1UBGA 5C1OA 3K1AA 1RFLA 2JEYA 3D2BA 1NJ6A 2CEKA 4HLDA 3DFUA 4EHDA 2GBLC 1IK6A 10MHA 1E1KA 5DX0A 8ICKA 2O8DB 3SZ3A 4DC0A 2XRZA 2H0RA 1TO1E 3MT8A 4F4ZA 4QGGA 1HE5A 3GUCA 4LQ4A 3FCAA 3EPLA 1ZM3A 4P3XA 1AURA 1IHUA 4AUEA 1N60A 1TFUA 1JQJC 2ZBUA 1A7JA 1PS8A 5I48A 4J0GA 3B78A 1ECBA 5HQ3B 3FMPB 3S70A 1E2KA 1MXHA 3F7OA 2Q9BA 2ZJ7A 2CNLA 5IVDA 3WHKA 1S2LA 5IABA 1QYXA 1OXSC 1JG7A 1K7EB 1EJ6A 3BREA 3DE4X 1U0FA 2J9FA 3GY0A 5DHQA 5DASA 3I28A 1H2HA 3T5MA 2XVYA 3U1VA 1AN9A 5KSYA 3OA0A 3GLQA 4UBOA 1OBVA 1N2ZA 1W36C 5L4LA 1XCOA 4M04A 2HL6A 3AQ4A 1BJTA 5KX5A 2PSEA 3DMNA 3QF7A 5IUJC 1ZQ1A 4I2GA 3A6ZA 3EVZA 4CMKA 1SXPA 3G2MA 3THVA 3UVEA 1Q12A 2YXEA 3PCTA 4Y1RB 1F2TB 1XNGA 2WINI 3I09A 3AFGA 1R0BA 2ZUFA 3IKVA 4BFCA 3M4NA 2QGZA 3AY7A 3GGOA 3LV8A 1R50A 2QX6A 5BQOA 5H82A 2XYGA 1UT5A 1F60A 5KFTA 2O1EA 3BXGA 3PX3A 4C89A 2C7VA 3UWSA 3DKPA 1I4WA 2BGLA 2HQRA 1RC1A 4DL6A 2XUAA 1GQQA 5B6PA 3F3KA 2RC5A 5KVSA 4JV5B 1UXJA 2QZJA 2RI0A 4I8DA 5FNVB 2JVKA 3SV3A 4AULA 2ZJ5A 4J2HA 4OXIA 4DCJA 4LDRA 4TT8A 1P7PA 4PQRA 1XCBA 4B1FA 2PA0A 4M1YA 2JIBA 4HF7A 3TADC 2RI1A 3V80A 1W36D 1Y4ZA 3OURA 5L4SA 3QU5A 4E70A 1PNRA 1MVLA 2DG2A 2ENUA 5KYUB 1HETA 1M6WA 1MSWD 2G9QA 2WKPA 2ZG6A 3OHBA 3ROPA 2B1IA 2FEMA 3VCBA 1FS5A 1RWNA 1T5TA 4HH4A 2UUAB 2XVXA 2NTEA 4PV7A 1N5KA 3TCNA 3MTIA 5AK4A 1DKPA 2A0FA 3UB4A 5F1OA 4H7FA 1IIBA 1KMHA 4MHSA 3QU4A 3V6JA 1A2OA 3CW8X 3ZJTA 3AUOA 4DSNA 2F64A 1EHIA 4HX2A 2HT1A 1U6KA 2EHJA 2IPXA 2WAOA 4DADA 1SEVA 2PFSA 4RPCA 5ER9A 4NE7A 5CLIA 2DKZA 1YO6A 2A1TS 1Y7HA 4IDGA 3K73O 3EQZA 3CUYA 1N8SA 2CHEA 3HJTA 5LYJF 1T6NA 2GYYA 3UPDA 1RPTA 4UVDA 5E8RA 2F1HA 4C04A 4MA4A 1H3NA 2EG9A 2O5CA 4W5JA 5CX1B 1U02A 3I5MA 1Y48E 3OFKA 2O2SA 4WW0A 1VE9A 2GBPA 1QGOA 3WGIA 2X9VA 3VNBA 4EJFA 1QV6A 3R7WA 3ZDQA 1ZUHA 4JD5A 2QYOA 4LVUA 1KSFX 1TIPA 3HVKA 2QL7A 1IPFA 3AVYA 1H0SA 1TUBA 4R2WA 2PSDA 1IVNA 5C3UA 5I51A 4JDPA 1EX6A 3ZQ6A 1NHWA 1RE1A 4QT4A 4N3CA 3OQJA 1U0BB 2IUFA 3H8WA 1PTJA 3U7IA 4MRRA 3A6LA 2DLNA 2ISSD 5JFGA 3U7QB 1V2HE 3UWDA 3OOJA 3CLRD 2KE7A 3VOTA 4L85A 3ZIAA 5DSTA 3M6FA 3LWZA 3TBKA 3PFHA 1BW9A 4HDRB 2PZBA 4YV2A 5C8YA 3FHTA 5JSZB 3AETA 3RUPA 5MN6A 2VJAA 2VDWA 3NG1A 1DOQA 4BO6A 1J20A 1KSJA 2ATCA 3GZ4A 2Q9AA 1W4CA 2CFSA 4LDZA 4MEYA 3MMXA 2Y27A 3WLAA 1P3Y1 3NVKI 4AO8A 4DUYB 2QTTA 3AQIA 2IK8A 1T3NA 3RBEA 1GG9A 4IQUA 3T7JA 1GU7A 3TM4A 5C80A 2Z2IA 1ZCJA 5FUBA 3C6KA 3OCJA 2RBEA 4QAQA 2FPSA 3FRHA 5TF0A 1C7ZA 2O7QA 2W6ID 3CMCO 3Q3CA 2OENG 3WQRA 4OQFA 3TOSA 3D8UA 2AEMA 2WIFA 2E4YA 4AMYA 4ECTA 2HK7A 1DX6A 2HRQA 1VCIA 3Q3IA 4FDVA 4UNQA 3OQIB 2B99A 4G5FA 1IFXA 4MQ5A 4G1MB 2VSNA 5A5FA 3RNLA 2XMZA 5G0VA 1FQWA 1OH6A 4YMNA 1ENZA 4F38A 3E9CA 4V0RA 2WM2A 3UK1A 1NTOA 1Y8AA 5BNWA 3NBXX 3HKEB 4HFNA 3REGA 4MVJI 2O06A 4CEHA 4V0LA 2ZTSA 1GAJA 5K8IA 4NX2A 1NU6A 1B8VA 1LLFA 3ZXUB 4POOA 4JAVC 4WZBA 1RJGA 3IHKA 1LLDA 3O82A 2P2NA 3DL7A 3FZYA 1QM5A 1WR8A 5KU7A 2AV6A 1T6ZA 5AJYA 4DSOA 2HZBA 3JYQA 2D8MA 2YY5A 3FAKA 2ISOA 4NJOA 2YJ5A 9ICNA 3DTYA 4HH0A 4G23A 3E9YA 5KDDA 1FJ2A 3WDMA 3G2LA 4YJGA 1O3YA 2J09A 2WJWA 5CDGA 4R81A 3TACB 5JNTA 3KG2A 5CRIA 2JGNA 3OT1B 2DUMA 1WBBA 3GI1A 1SQFA 4ML3A 1HT2E 4B9VA 1CJCA 2JATA 2J30A 2JH9A 3EPIA 4Y9DA 5SZKB 4ALNA 3I9JA 3RVDA 3O3CA 2AHOB 3CJRA 1VPLA 3L4KA 2ZIVA 3I92A 1E4VA 2PH1A 4R9NA 2AGVA 2P7IA 5F5NA 3CVUA 2B20A 4MP8A 5B4VA 5B4UA 2JLRA 3CSSA 4AXXA 3LOPA 4WTOA 2PVCA 4U8GA 2VZEA 4R7GA 4BQQA 3UJNA 1K86A 3O9ZA 4F6RB 4RVDA 4ZHQB 2VJ4A 2PPLA 3QEAZ 1OV6A 3MA0A 2F67A 4KI0A 3L7BA 1KARA 4AS3A 1U7ZA 2QM8A 4ZN6A 3SYZA 2PLNA 2JXJA 1O6FA 5B1HA 2F62A 2IIBA 1PR6A 4P5PA 2ASJA 4BUCA 4KQEA 4W8HA 5TSDA 1UWKA 1RHJA 1VJCA 2LKDA 3HFRA 5TS2A 1J07A 3FCXA 1B7GO 4DJDC 3B1JA 1Y89A 4F1KA 5D46A 3TZLA 3WK6A 5JVDF 4HQLA 1KS2A 3SU8A 1YL5A 3SY8A 4RVGA 4TROA 2UXDB 3T95A 4II2A 1J2TA 1NBHA 1QH8A 1DC3A 1FBTA 1V4BA 2MSWA 2PCLA 5TC4A 1KFBB 1C30A 1P2SA 2A1JB 2Y1WA 2GX6A 3SNHA 5EEHA 3NETA 4CLDA 3QUBA 5EIEA 1PG2A 3PSFA 4D74A 5CLLA 1QAOA 1PQUA 4BXOA 2ZYWX 3K0BA 4H7PA 4EK9A 2J31A 2JF0A 4M87A 1CRLA 4WN9B 5FHRA 5CFZA 2KFZA 1PQ4A 4NBLA 3DG9A 3H86A 4Y9SA 4LNAA 3FETA 3W8EA 3SIWA 2XVAA 4EYHB 1RKQA 2Z08A 4BFZA 2CLOB 3HJBA 5C8ZA 1I3LA 4HDNB 1WHSA 1O96A 2WE7A 4RYLA 2NG1A 5J59A 5EERA 1FSFA 2IJGX 3GWZA 5D4BA 2W11A 1J06A 4MCJA 1E2HA 5DHAA 3UATA 3Q6IA 3CO0S 2W5UA 1MVOA 4Z9XA 4BP1A 9ICUA 4LPSA 2DWUA 2IHBA 3EZLA 5A62A 2VKQA 1YKSA 2X7XA 1C9DB 4CV1A 3GLFA 2NU7B 3B89A 3IAHA 1N62A 3BS5A 5AW8A 3A0BU 3MJSA 5JMPA 5FBHA 3BZUA 1Z34A 1VLVA 3T6KA 4FGWA 4NXZA 5KQSA 1VLMA 4NMWA 1W5FA 4LY6A 1LJ8A 2Z6VA 4ZHSA 3I1JA 1PTJC 1Z83A 1RAEA 3IDZA 3H42B 2EZYA 1XMXA 1ANKA 4K6MA 4KUEA 3I2HA 3HT3A 3CR3C 3BILA 4YYEA 2H59A 3KPVA 3RAEC 1R0KA 4A23A 1SB8A 1X8LA 4JNKA 1MAWA 2CXNA 1XKLA 1AS0A 4X9XA 3QG1A 5JBNA 4BWFB 1TLFA 3U44A 1SWVA 3K94A 5CIWA 1QVAA 1RYFA 3ZWVA 4DQUA 3KZMA 4BNXA 2FPGB 3QYAA 4KSYA 5J0TA 1MXFA 4XWTA 5EXTA 4GWLA 2W90A 2VK8A 4YAIA 1V8FA 2RONA 5AKZA 2NXCA 1U47A 1P80A 1ISGA 1SXJB 3AEUA 1TW3A 1Z5NA 2QPLA 1KPHA 3R23A 3GT3A 1VMDA 1MDFA 1U2SA 3X43A 1OBOA 4GQIA 4J43A 2YZMA 5EJ7A 3ONNA 4PAQA 3AF6A 3AX6A 1W2WB 1DKMA 2QW8A 3UJ9A 1ZAYA 5EKUA 3QVUA 3ZIAD 7ICGA 1HG0A 4X0EA 4F6LA 1ZRMA 1KORA 3HJEA 3RQSA 3S5UA 5LLSA 4ICAA 1FFBA 3KHGA 2CFIA 2FCAA 3DNFA 5BV8A 2C1XA 4M7RA 4WXRA 3VO1A 5EQDA 2ET6A 3U13A 1PL6A 5F51A 1QRDA 2HJGA 2G0NA 3OCCA 1Z2AA 2OUIA 3NS7A 1Y7LA 2A9VA 4PYIA 4IGFA 4AECA 3GYBA 5LB2A 3R3XA 5DX8A 4F96A 1KQQA 4PSDA 5BUZA 1RCUA 3B52X 3WGGA 1IBLB 3U7GA 3FYSA 1IBKB 4BP9A 5IVIA 1JWAB 3OM1A 4O2RA 1JYSA 1XQVA 1L4LA 3ED5A 3RYCB 4B9UA 4I19A 1JJ7A 4EABA 1RXVA 1D6MA 2YIDA 3EF0A 3LTNC 3GB9A 2ZIAA 3HB0A 1KH3A 4I7EA 4MW1A 3C3YA 5TR9A 2ONCA 4S12A 5D5PA 4LJ6A 1W87A 2VF5X 2GBCA 2A35A 4I3GA 5K3OA 3SXPA 1U98A 4QUAA 3EAQA 3BG5A 4YQFA 4RPLA 4WCDA 1FFUA 1U7WA 4JBHA 5L1JA 4X7MA 1PR4A 5TF4A 3WJ2A 4DCNA 1NDQA 3UO8B 5IZ4A 1ADJA 2Z4RA 1F8GA 2RJ3A 1FNDA 1UMCA 3TIIA 3DYVA 1ILWA 3EF1A 1GG5A 4R1UA 1H4QA 4G5OA 2NVUA 1TLLA 4NBRA 5KTKA 2OSVA 2WIJA 4TYNA 1M1NA 4IYRA 3T5AA 3FHJA 4NAVA 1YCHA 4JK1A 2JFPA 4P58A 2GN8A 4K2HA 3SZOA 1ZRSA 1G0NA 4HMOA 4DF3A 2JGFA 3SYKA 1GKUB 4UXHA 2ZB7A 4KMMA 1A5ZA 4PRYA 2OV8A 3AM1A 3OSPA 2EERA 4PC3A 3BPSA 3I9LA 3MIZA 2A78A 2FLVA 4XFJA 4YRZA 1QB7A 5AKYA 1AY0A 4HLNA 1DRJA 3TOCA 1EZ1A 5SY9A 2ISCA 5CVUA 3DAOA 4LRWA 3R74A 5F9MA 2WVJA 1NW3A 1PSDA 3OQBA 1VL2A 2VK2A 3H5TA 1NR7A 1U1CA 1M72A 5LMNB 4RU9A 1PGPA 2ZYDA 1D1QA 1D07A 3VX4A 4B6PA 1CVRA 4C0LA 4ZQHA 3RTDA 2WJVA 1AO0A 2ZZKA 2JH3A 3CEJA 2FRVA 1I94B 4AYWA 2GCEA 4UM8B 3E3MA 1R6TA 1J2MA 3R3VA 5GPBA 3NDRA 2M0NA 1ZU4A 3Q3VA 4RVUA 2YZ7A 1DT3A 3NTOA 3K8ZA 3C23A 2J6UA 4X3OA 3TK1A 2I4IA 2Y9UA 3H7AA 4LHWA 4QNRA 2C54A 1UKAA 1RI3A 3E9RA 3SHQA 1EESA 3KJQA 3EOAI 2OWOA 1UANA 1QIJA 4EUHA 3PKJA 1J22A 4Q3KA 1FP1D 4D8TA 4MS3A 1MRZA 3TOVA 3H2JA 3MDAA 4ANFA 5HZGA 1TECE 3FBGA 3LY7A 4B6QA 1GKKA 4N5LA 4X1YB 4MAAA 3S2ZA 3IUEA 3TB6A 3WZMA 2BQUA 4NBVA 4DXHA 3M6IA 4M76B 4DPLA 1EDBA 3TRFA 1P9WA 1E2GA 1C7FA 1Q7EA 4EVQA 1S3SA 2EP8A 3FDZA 2MAXA 3BS7A 4YREA 4MX8A 1QDUA 5AHRA 4C4SA 2RGEA 4EY3A 3U62A 4E0DA 1II8A 1ND5A 1Z45A 1X8JA 1XXLA 2BQRA 4XI9A 3SEFA 2D5BA 3RHTA 1A9XA 4XASA 2I4RA 2AL7A 1VL6A 2YVAA 5DFAA 2WBLC 5DCLA 2F8LA 4F04A 5IM4F 4M1WA 5FWYB 4QGSA 4BMSA 2IHNA 2W58A 5CT9A 1HURA 4A91A 2NPOA 1HFKA 4HYTA 4YJDA 5JO9A 1DI0A 3U80A 3GJ3A 4ZVRA 4MV9A 1PJTA 3VGJA 4F5RA 2NO7A 5DNDA 2ZJ1A 5T3YA 1X7ZB 4UHBA 1C1YA 3IPCA 1T29A 4QOHA 1PK8A 1U1DA 2G07A 4BIIA 5CP2A 4XGQA 3PNBA 2KHQA 1FYXA 3GRFA 1E9EA 2D59A 5A5DA 2I3DA 1E63A 1T2FA 5KL8B 2VQSA 2PN1A 1DINA 1YVPA 3QX8A 5D5HA 3GDOA 4XVCA 3EB9A 3WG9A 3BGDA 3ONEA 2IKQA 1CJSA 4MS4B 2QMHA 5BV2P 4HXGA 4YUWA 1ORHA 4KIGA 3R3ZA 3ZHUA 1SXJE 1TOAA 1JR3E 4O1IA 1PEKE 3QEBZ 2F8KA 1D2NA 4X24A 4MITA 1JXEA 3IG5A 4DZRA 2DT8A 5A9SB 3NU1A 1RYYA 4L6IA 4ZTZB 4X45A 4DAEA 2UZ1B 1ZXIA 5IDYA 5FFFA 3FSGA 3ZHVA 4Q45A 3DMDA 3P97A 2PAAA 4OA5A 3EPPA 2IT1A 4DR1B 2Q5EA 2J08A 4JROA 1J9GA 4YJFA 4YRNA 4BKUA 4IEEA 3BFKA 4MYRA 3WQHA 2IXAA 3RR8A 3TM5A 1G8YA 4K86A 4GZ6A 1FTSA 2P79A 3FNEA 4HXFB 4N5HX 2YJTD 4CDMA 4ZYUA 5EIWA 1N7GA 3T5DA 5JFOA 4YCBA 4I0WB 4B9NA 5KFWA 3HZRA 5DLGA 2P5TB 2CVPA 2EH9A 4IXTA 2VTDA 4PLZA 1V1MB 3TQRA 3I01A 1GDDA 1CR1A 4A1FA 1NVWQ 3ASYA 3LUJA 5K6RA 1EK0A 3TFRA 2IXDA 4IOLA 4A73A 3EQ7A 1ZR4A 1OUQA 3M49A 1JEQB 1MEJA 7ICSA 3CEHA 4Q6WA 5JVDA 2Q1YA 3AO0B 4KPUA 4ECQA 3UJ7A 2AI1A 2FEXA 2FUG1 2PGNA 4IRCA 3DXYA 2UUPA 1DXSA 3FF4A 4FDTA 1UFQA 1HWYA 3MOSA 1PQYA 1LKYB 5A7GA 1CEXA 2PM8A 1QUEA 4F2DA 1CUGA 5EOZA 2NU6B 5DHSA 3IUJA 1Q84A 3DAYA 1WCIA 2GS9A 3W05A 1UDAA 1UC9A 5C8DA 3F98A 4KVFA 5AM2A 3JQAA 4JMUA 4X63A 2ANCA 3IEMA 3ADDA 1JEOA 5KUTA 4OMFG 1B0AA 3IE2A 3D4PA 2QTGA 4JWNA 5FNVF 1O57A 2WB4A 3RSGA 5HJEA 5L3SB 2NIPA 4CF5A 1E32A 4YQZA 1KO1A 4FMCF 3FZGA 3FPFA 2BKUA 4OXRA 3K9CA 2C92A 1M7HA 4BZWA 1QWSA 1PWHA 2CD9A 4OP1A 1UDCA 3OKPA 3J81A 4BO1A 1ISMA 1LJLA 1W8IA 2JIQA 2JAXA 2E6UX 4PO3X 4EX6A 5EZYF 1TIBA 3QIAA 1VJTA 1RI4A 2HIMA 3OZGA 4BFWA 3THYA 2BFNA 4GL4A 3VPSA 4P92A 3W5VA 2VUTA 1NVGA 1EIZA 4UAVA 2IY9A 3Q85A 2C5LA 3BYZA 1ZH8A 5ALGA 2EJVA 3C8DA 4XM1A 2CDNA 5JCPA 2WU1A 2WB1C 3FKSA 3UJPA 3PEEA 2ZVJA 5AHXA 3EXEA 1WETA 5JPCA 3ZZ1A 1BH2A 2J5XA 1HLFA 5TT0A 2FPWA 4TTIA 4WY8A 3PA6A 2HQOA 1HT0A 1DARA 2Y92A 5KYXB 4OP2A 1O0SA 1PGQA 5KYWA 3LHIA 2KKPA 3PVZA 3RSOA 5BN3A 3IAS1 3ILXA 3S1AA 3NFYA 1KI7A 4OB6A 5K0FA 5GONA 2KN7A 2CLKB 1UHUA 1U1IA 1QGZA 3TSAA 3KD3A 4EUFA 2VIXA 4OJOA 1KVQA 1L5RA 1Z0KA 1QPZA 4NECA 3O1JC 4UE3S 3M82A 4NZMA 3PP8A 3H3JA 4NL4H 3PCXA 3VU9B 1JQLB 4L4UA 4QWMA 1QLNA 3B5EA 1UOPA 4O8CA 5D3ZA 4C4YA 3G6KA 1GN9A 3EFOA 2DQZA 1BDBA 3GVPA 2YWGA 2VHQA 4HJRA 4JBIA 1JRLA 3PO5A 3P2JA 1RVDA 5AVQA 2AK2A 4F5PA 4Q3LA 3DEIA 4PYRA 3PTZA 4MQLA 1TAQA 1JTFA 2DKFA 5FBZA 4IS3A 4XVQA 2HBMA 2ICAA 4XIGS 4ALIA 1KGSA 5TDHA 3GW8A 2WSMA 1X14A 1HFEL 2D1FA 5J0UA 2VP6A 1K5OA 2FOLA 5F7ZA 1IK4A 4C8KA 1U1EA 1XC9A 2HCJB 1OB5A 8ICTA 1W88B 1CJMA 1VLLA 3PDWA 4JY7A 5IDVA 4JV2A 1GSAA 4CU5A 4NF2A 4DQDA 4WKBA 3ZE0B 4P0PA 4J8PA 1J7KA 4M9HA 3OU6A 3AWIA 5JD5A 5BPCA 5DH9A 4X85A 3SG0A 3U4HA 4B85A 5TMBA 3BT7A 3OOWA 2QJOA 3JCZA 4DTIA 3JVVA 3V2UA 3AERB 3MJTA 4HUJA 2C31A 5EIAA 5TISU 3CZPA 3BS4A 2HO5A 3PHIA 1JECA 1LD3A 3HBNA 3NB0A 2QNRA 4V24A 1XRMA 1G5TA 421PA 4S1NA 1Y1QA 1OW5A 4QPNA 2JH1A 1P1RA 5GJCA 3F47A 4DM3A 1SKQA 3E6AA 2G72A 2IBMA 2GF9A 4FR2A 1IUPA 4D81A 4Y6SA 1EGAA 2QR2A 6REQA 3L7AA 1YR9A 3VPCA 4DR6B 3WGQA 3UQ0A 4HQOA 3ROMA 4AWAA 5KVVA 4MGHA 3FGPA 1CUBA 4V0QA 1JVBA 3AB3A 2ZVQX 5HF6A 2ZDGA 4RY9A 2PLFA 5BOVA 4PZ0A 3FWZA 1MGPA 4UMFA 3ZGNA 2RIPA 1DBPA 3IUQA 1AQ6A 1A71A 4RDIA 1I2MA 4EBEA 4D9FA 4BQEA 1N2CA 2BAGA 4GX1A 4OI4A 1H4SA 2BI7A 4UUOA 3BWDD 5K0BA 1SVLA 2Y2UA 4Q24A 2AQ8A 4PRLA 1GL6A 2HRCA 2GN6A 2IH4A 4O2LA 3K5HA 3FOFC 1Q0ZA 1TPZA 2PJDA 4I4TF 2WHPB 3RV4A 5E6UB 1SBHA 4JJ6A 2R0QC 1GZSA 3UMVA 3DVLA 4RV4A 2WYIA 2RGXA 3UUGA 3ASVA 4JUZA 4NDZA 4UFOA 2C9DA 1IWPB 2YHUA 4NM1A 2GCPA 2OD2A 3NTLA 2J5RA 2IV7A 1LSJA 1NMYA 1ZUIA 2I4TA 3L93A 5KG2A 4PSVA 2AFHB 4UZSA 4CQLB 3DVRX 3T5BA 2QN1A 3ZXIA 1U2PA 1CEEA 3FSGD 1H93A 2YJ3A 1SCIA 3R3HA 2ODQA 5SY4A 4Q7JB 4QASA 2UZIR 3N2IA 2W6PA 3PNQA 1UJMA 3QJGA 4IOMA 4PCVA 4H6WA 1OFUX 3RBVA 4A27A 4N65A 4S2UA 1G5PA 4HFMA 2AWNA 3FPJA 4DLAA 4ZDIA 2FR1A 3RJHA 2VF8A 3F90A 1RTKA 4EA6A 3I6YA 4KITB 3MLBA 1KHTA 4QXOA 2POQX 3K5PA 1BWSA 1KQGA 4LJ9A 4OHOA 1P62B 4HAXA 1PT9A 3A4LA 3E48A 3D6MA 3EULA 5K0GA 4FDAA 1I14A 4U00A 4PGXA 5KCZA 2VBIA 1AA9A 3DDCA 4D9HA 4G1FA 1XRLA 3TGLA 4GMDA 5K05A 2YFKA 4LY9A 1ZQOA 4H0FA 3TUZC 3D4OA 4IRKA 4IDBA 2M6KA 5LQDA 1TM1E 2H9IA 1ZQIA 4QXAA 3D59A 4OJLA 1SOUA 1ZXXA 3L7NA 3HP6A 4KIJA 1W30A 3OF3A 1RQRA 4RNMA 1BGXT 3RRBA 2R60A 3KWMA 4IGEA 1U0NA 3HA5A 1KMIY 2VH1A 3NOXA 3M3DA 4GLBA 4LVSA 3GRVA 1XDDA 4PGAA 5LP6F 2X8JB 1J8YF 3V5NA 1K1EA 3DMFA 2QYTA 4IF4A 1U3CA 4L0QA 1V25A 5JDCA 4HWOA 3ZUGA 2WM9B 3KAPA 3M5WA 5CT5A 1G7SA 1C3OA 4RGYA 3L1VA 4D4IA 2Z3WA 4Z53A 13PKA 4I9FA 2Z43A 3KJNA 4DL3A 5L1MA 1N2OA 1X80A 3H84A 4F3NA 1CR6A 2XRFA 1T8YA 3G89A 1Z3CA 1YDGA 4YDRA 3L0OA 5IM4A 2JLVA 4BKQA 2QRVB 2FVYA 1WSWA 1HEUA 2YS6A 1TCBA 4ZOHC 4PGMA 2QQFA 3HG7A 2PO7A 4PNEA 2XGPA 3FKSD 5I4KA 2ZCVA 1C0EA 2OCLA 1C3LA 3WRYA 5F3WB 3AHCA 3KUCA 5ALPA 3AIMA 3IKTA 1S0NA 1O58A 3ZV5A 5KOHB 4DWIA 2PFGA 3L18A 4IIHA 1K5HA 2Z8ZA 4B4UA 1I1OA 1YCGA 9ICEA 1VHDA 4BNVA 2YW9A 4B6SA 2IDJA 4HZUB 3DVAA 1KFEB 1Z6YA 1RTTA 2ZJ2A 3RB0A 1UPUA 4NM2A 1K89A 5M5BA 3CRMA 1FZTA 3S28A 2P67A 4BTEA 4TWAA 2W6JA 1G2IA 1SUBA 3BXEA 1GAWA 1OLSB 4AL4A 1UBJS 4KWEA 4C7VA 3K15A 1T25A 2FLWA 1Y6RA 1TLTA 1JDUA 1B00A 5BQ5A 1FIUA 2WW8A 3PR1A 2HMVA 2QQ5A 1G7RA 3C74A 4HGQA 2BTEA 2HJ9A 1ZQJA 5FUYA 4PHEA 3L7JA 5CLQA 1K3TA 3R1IA 4ZCTA 4B6GA 3RIGA 1HIWA 5DBOA 2ZT6A 4U1RA 3DEFA 1Z2DA 4LV8B 3QMWA 4CDNA 3VPXA 1QORA 3BMXA 2E8OA 2D3TA 3PDHA 3TANA 4DLBA 2EBFX 2ZPUA 4ZQCB 3AYZB 1WEHA 3HVIA 5DLQC 4WAUA 6YASA 2Q1UA 4CNBA 3G9QA 2FPPA 2Q4BA 1KZHA 3FPGA 4FOLA 2AMFA 4GQBA 3DYIA 5K0TA 4NCJA 2FRXA 1EIWA 1CSEE 2HWYA 1QK3A 5I5EA 1E69A 3ETGA 1NK0A 1F0KA 2WIGA 1Y98A 3AI1A 1EK2A 1FP6A 1NV9A 3IT0A 4YLEA 3HU5A 2KIVA 2XIJA 3S2GA 5DG7A 4KNVA 1IM2A 1AKTA 1WCXA 3FFTA 3LOUA 3AKEA 1WUDA 1DAOA 3PFBA 1ICEA 4V39A 1BVRA 3JTMA 2VTVA 4LRUA 1XZAA 2HJWA 4NE2A 2VDLB 3BXOA 5K8UA 2BBTA 3FDIA 1NLMA 4MI3A 1OGJA 3RUAA 3QVSA 4ECZA 2QVLA 3L8MA 1E96A 1C7YA 1X19A 3IP8A 2DWPA 2O8FA 3PQ8A 1SUWA 1TD1A 2HHUA 4NYJQ 2WZQA 2QAGC 5JV5A 2XITA 2YDYA 1QH1A 3ZCUA 5IC5A 2KYRA 4EFNA 3P9SA 3E9NA 1NQTA 4KAXA 4XJTA 4OHPA 2PUAA 2GN2A 3W9UA 1ZC4A 3LCRA 1NFFA 5E1BA 4YQWA 1BVUA 4JBNA 4M0KA 2C83A 3RH0A 3GF4A 1M1YB 1DGSA 5J58A 2B6GA 4FJ1A 4GVPA 2NQ2C 3O2JA 3L7YA 3I8OA 1JWLA 5IK2A 4LEIA 4IZIA 2GXAA 4DQQA 4I6EA 5BVHB 4RKEA 4LGVA 2FUEA 1C3JA 3YASA 2HU8A 3MLAA 1G6OA 4NYIR 3AC0A 1VCMA 2LWIA 3L02A 2EAUA 2AFHE 5H3CA 4ENSA 3UV7A 1WMAA 3V8RA 4YP6A 2CT8A 3CSUA 5KMGA 2MIIA 2PQMA 3A1WA 4CMGA 2HO4A 3MSXA 3O8CA 2C2RA 4R69A 2YCBA 4S1TA 5DYGA 2V7QA 3VH1A 3BWBA 2P9TA 3OPXA 2J4FA 2OAP1 2WLTA 4IWYA 3F8SA 3NGMA 3Q6NA 1BO6A 2C5EA 1R6AA 5DWVA 1RDFA 3LDGA 4MKHA 4KC0A 4UUPA 3L6UA 1ZK2A 3AFIA 3GHHA 4FU0A 4OATA 3ZXSA 1MJFA 1CQJA 2H3QA 4LE2A 3MUOA 3FC4A 2C00A 4WHMA 1GVHA 4DR3B 3LDAA 3C6BA 3NANA 5ABPA 3OSNA 4KUGA 1X74A 4YRTA 4HNGA 2PVSA 3PPWA 3T94A 5JDCC 1SCKA 2UXBB 3UPQA 1DQSA 3ZDEA 3MJCA 3OLVA 4DRXA 3SM3A 5CP8A 2V6BA 4GUAA 4DS4A 1YFZA 1WXGA 4HNRA 3ZU5A 1QNFA 2DUUA 2X1VA 1RWVA 3SBEA 1L4YA 4KLQA 5MDHA 1TF2A 2YMLA 2IELA 4O4JF 2ZWPA 1F6WA 2VBCA 5CM2Z 4HPWA 1ORVA 3JAMA 4BJHB 4NMHA 2BFMA 1WBDA 4UBKA 1V26A 4NY8A 1KJ9A 3DFK