4KX6D

Plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
b'MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 41
structure length 119
sequence length 119
chains with identical sequence P
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02313 Fumarate_red_D Fumarate reductase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4kx6D00
3VR9D 3AECD 4YT0C 1YQ4D 3SFEC 2WS3C 2WU2C 2WDRC 3CIRD 2WU5C 2H89D 3AEAC 3AE9D 3AE5D 3AEFD 5C3JD 2BS2C 2WP9D 3VRBC 3AE8C 3AE6C 1KFYC 3AE1D 4YTNC 3P4PD 3VR9C 3AECC 5C2TC 1YQ4C 4YTPD 3VRAD 2ACZD 3P4SC 3CIRC 1QLBC 2H89C 3AEDD 3AE7D 3AE9C 3AE5C 3AEFC 3AEBD 4YTMD 5C3JC 2WP9C 4KX6C 2FBWD 1YQ3D 3AE3D 3AE1C 3AEGD 4YXDC 1NEKC 4YSYD 3AE4C 2BS4C 1ZOYC 4YTPC 3VRAC 2ACZC 3ABVD 3SFED 3AE2D 1KF6D 2WU2D 2WDVD 2H88D 3SFDD 3AEDC 4YSZD 3AE7C 3AEBC 4YTMC 1E7PC 1ZP0D 1NEND 2WQYD 3AEED 3P4RD 2FBWC 3P4QD 1YQ3C 3AE3C 2WDQD 3AEGC 1L0VD 4YSYC 4YSXD 3VR8D 3P4PC 5C2TD 2BS3C 2B76D 3ABVC 4YT0D 3AE2C 1KF6C 3P4SD 2WDVC 2WS3D 2H88C 2WDRD 3SFDC 4YSZC 2WU5D 3AEAD 1ZP0C 1ZOYD 1NENC 2WQYC 3AEEC 3P4RC 3P4QC 4KX6D 2WDQC 3VRBD 1L0VC 4YSXC 4YXDD 3AE8D 1NEKD 3VR8C 3AE6D 1KFYD 3AE4D 4YTND 2B76C
chains in the Genus database with same CATH superfamily
3VR9D 3AECD 4YT0C 1YQ4D 3SFEC 2WS3C 2WU2C 2WDRC 3CIRD 2WU5C 2H89D 3AEAC 3AE9D 3AE5D 3AEFD 4FJVA 5C3JD 2BS2C 2WP9D 3VRBC 3AE8C 3AE6C 4DHIB 1KFYC 3AE1D 4YTNC 3P4PD 3VR9C 3AECC 5C2TC 1YQ4C 4YTPD 3VRAD 2ACZD 4DHZA 3P4SC 3CIRC 1QLBC 2H89C 4DDGA 3AEDD 3AE7D 3AE9C 3AE5C 3AEFC 3AEBD 4YTMD 5C3JC 2WP9C 4KX6C 2FBWD 2ZFYA 1YQ3D 3AE3D 3AE1C 3AEGD 4YXDC 1NEKC 4DDIA 4YSYD 3AE4C 2BS4C 1ZOYC 4YTPC 3VRAC 2ACZC 3ABVD 3SFED 3AE2D 1KF6D 2WU2D 2WDVD 2H88D 3SFDD 3AEDC 3VONA 4YSZD 3AE7C 3AEBC 4YTMC 1E7PC 1ZP0D 1NEND 2WQYD 3AEED 3P4RD 2FBWC 3P4QD 1YQ3C 3AE3C 2WDQD 3AEGC 1L0VD 4YSYC 4YSXD 3VR8D 3P4PC 5C2TD 2BS3C 2B76D 3ABVC 4YT0D 3AE2C 1KF6C 1TFFA 3P4SD 2WDVC 2WS3D 2H88C 2WDRD 3SFDC 4YSZC 4LDTA 2WU5D 3AEAD 4DHJA 1ZP0C 1ZOYD 1NENC 2WQYC 3AEEC 3P4RC 3P4QC 4KX6D 2WDQC 3VRBD 1L0VC 4YSXC 4YXDD 3AE8D 1NEKD 3VR8C 3AE6D 4I6LA 1KFYD 3AE4D 4YTND 2B76C
chains in the Genus database with same CATH topology
3VR9D 3AECD 4YT0C 1YQ4D 3SFEC 2WS3C 2WU2C 2WDRC 3CIRD 2WU5C 2H89D 3AEAC 3AE9D 3AE5D 3AEFD 5C3JD 2BS2C 2WP9D 3VRBC 3AE8C 3AE6C 1KFYC 3AE1D 4YTNC 3P4PD 3VR9C 3AECC 5C2TC 1YQ4C 4YTPD 3VRAD 2ACZD 3P4SC 3CIRC 1QLBC 2H89C 3AEDD 3AE7D 3AE9C 3AE5C 3AEFC 3AEBD 4YTMD 5C3JC 2WP9C 4KX6C 2FBWD 1YQ3D 3AE3D 3AE1C 3AEGD 4YXDC 1NEKC 4YSYD 3AE4C 2BS4C 1ZOYC 4YTPC 3VRAC 2ACZC 3ABVD 3SFED 3AE2D 1KF6D 2WU2D 2WDVD 2H88D 3SFDD 3AEDC 4YSZD 3AE7C 3AEBC 4YTMC 1E7PC 1ZP0D 1NEND 2WQYD 3AEED 3P4RD 2FBWC 3P4QD 1YQ3C 3AE3C 2WDQD 3AEGC 1L0VD 4YSYC 4YSXD 3VR8D 3P4PC 5C2TD 2BS3C 2B76D 3ABVC 4YT0D 3AE2C 1KF6C 3P4SD 2WDVC 2WS3D 2H88C 2WDRD 3SFDC 4YSZC 2WU5D 3AEAD 1ZP0C 1ZOYD 1NENC 2WQYC 3AEEC 3P4RC 3P4QC 4KX6D 2WDQC 3VRBD 1L0VC 4YSXC 4YXDD 3AE8D 1NEKD 3VR8C 3AE6D 1KFYD 3AE4D 4YTND 2B76C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR9 D;  3AEC D;  4YT0 C;  1YQ4 D;  3SFE C;  2WS3 C;  2WU2 C;  2WDR C;  3CIR D;  2WU5 C;  2H89 D;  3AEA C;  3AE9 D;  3AE5 D;  3AEF D;  5C3J D;  2BS2 C;  2WP9 D;  3VRB C;  3AE8 C;  3AE6 C;  1KFY C;  3AE1 D;  4YTN C;  3P4P D;  3VR9 C;  3AEC C;  5C2T C;  1YQ4 C;  4YTP D;  3VRA D;  2ACZ D;  3P4S C;  3CIR C;  1QLB C;  2H89 C;  3AED D;  3AE7 D;  3AE9 C;  3AE5 C;  3AEF C;  3AEB D;  4YTM D;  5C3J C;  2WP9 C;  4KX6 C;  2FBW D;  1YQ3 D;  3AE3 D;  3AE1 C;  3AEG D;  4YXD C;  1NEK C;  4YSY D;  3AE4 C;  2BS4 C;  1ZOY C;  4YTP C;  3VRA C;  2ACZ C;  3ABV D;  3SFE D;  3AE2 D;  1KF6 D;  2WU2 D;  2WDV D;  2H88 D;  3SFD D;  3AED C;  4YSZ D;  3AE7 C;  3AEB C;  4YTM C;  1E7P C;  1ZP0 D;  1NEN D;  2WQY D;  3AEE D;  3P4R D;  2FBW C;  3P4Q D;  1YQ3 C;  3AE3 C;  2WDQ D;  3AEG C;  1L0V D;  4YSY C;  4YSX D;  3VR8 D;  3P4P C;  5C2T D;  2BS3 C;  2B76 D;  3ABV C;  4YT0 D;  3AE2 C;  1KF6 C;  3P4S D;  2WDV C;  2WS3 D;  2H88 C;  2WDR D;  3SFD C;  4YSZ C;  2WU5 D;  3AEA D;  1ZP0 C;  1ZOY D;  1NEN C;  2WQY C;  3AEE C;  3P4R C;  3P4Q C;  4KX6 D;  2WDQ C;  3VRB D;  1L0V C;  4YSX C;  4YXD D;  3AE8 D;  1NEK D;  3VR8 C;  3AE6 D;  1KFY D;  3AE4 D;  4YTN D;  2B76 C; 
#chains in the Genus database with same CATH topology
 3VR9 D;  3AEC D;  4YT0 C;  1YQ4 D;  3SFE C;  2WS3 C;  2WU2 C;  2WDR C;  3CIR D;  2WU5 C;  2H89 D;  3AEA C;  3AE9 D;  3AE5 D;  3AEF D;  4FJV A;  5C3J D;  2BS2 C;  2WP9 D;  3VRB C;  3AE8 C;  3AE6 C;  4DHI B;  1KFY C;  3AE1 D;  4YTN C;  3P4P D;  3VR9 C;  3AEC C;  5C2T C;  1YQ4 C;  4YTP D;  3VRA D;  2ACZ D;  4DHZ A;  3P4S C;  3CIR C;  1QLB C;  2H89 C;  4DDG A;  3AED D;  3AE7 D;  3AE9 C;  3AE5 C;  3AEF C;  3AEB D;  4YTM D;  5C3J C;  2WP9 C;  4KX6 C;  2FBW D;  2ZFY A;  1YQ3 D;  3AE3 D;  3AE1 C;  3AEG D;  4YXD C;  1NEK C;  4DDI A;  4YSY D;  3AE4 C;  2BS4 C;  1ZOY C;  4YTP C;  3VRA C;  2ACZ C;  3ABV D;  3SFE D;  3AE2 D;  1KF6 D;  2WU2 D;  2WDV D;  2H88 D;  3SFD D;  3AED C;  3VON A;  4YSZ D;  3AE7 C;  3AEB C;  4YTM C;  1E7P C;  1ZP0 D;  1NEN D;  2WQY D;  3AEE D;  3P4R D;  2FBW C;  3P4Q D;  1YQ3 C;  3AE3 C;  2WDQ D;  3AEG C;  1L0V D;  4YSY C;  4YSX D;  3VR8 D;  3P4P C;  5C2T D;  2BS3 C;  2B76 D;  3ABV C;  4YT0 D;  3AE2 C;  1KF6 C;  1TFF A;  3P4S D;  2WDV C;  2WS3 D;  2H88 C;  2WDR D;  3SFD C;  4YSZ C;  4LDT A;  2WU5 D;  3AEA D;  4DHJ A;  1ZP0 C;  1ZOY D;  1NEN C;  2WQY C;  3AEE C;  3P4R C;  3P4Q C;  4KX6 D;  2WDQ C;  3VRB D;  1L0V C;  4YSX C;  4YXD D;  3AE8 D;  1NEK D;  3VR8 C;  3AE6 D;  4I6L A;  1KFY D;  3AE4 D;  4YTN D;  2B76 C; 
#chains in the Genus database with same CATH homology
 3VR9 D;  3AEC D;  4YT0 C;  1YQ4 D;  3SFE C;  2WS3 C;  2WU2 C;  2WDR C;  3CIR D;  2WU5 C;  2H89 D;  3AEA C;  3AE9 D;  3AE5 D;  3AEF D;  5C3J D;  2BS2 C;  2WP9 D;  3VRB C;  3AE8 C;  3AE6 C;  1KFY C;  3AE1 D;  4YTN C;  3P4P D;  3VR9 C;  3AEC C;  5C2T C;  1YQ4 C;  4YTP D;  3VRA D;  2ACZ D;  3P4S C;  3CIR C;  1QLB C;  2H89 C;  3AED D;  3AE7 D;  3AE9 C;  3AE5 C;  3AEF C;  3AEB D;  4YTM D;  5C3J C;  2WP9 C;  4KX6 C;  2FBW D;  1YQ3 D;  3AE3 D;  3AE1 C;  3AEG D;  4YXD C;  1NEK C;  4YSY D;  3AE4 C;  2BS4 C;  1ZOY C;  4YTP C;  3VRA C;  2ACZ C;  3ABV D;  3SFE D;  3AE2 D;  1KF6 D;  2WU2 D;  2WDV D;  2H88 D;  3SFD D;  3AED C;  4YSZ D;  3AE7 C;  3AEB C;  4YTM C;  1E7P C;  1ZP0 D;  1NEN D;  2WQY D;  3AEE D;  3P4R D;  2FBW C;  3P4Q D;  1YQ3 C;  3AE3 C;  2WDQ D;  3AEG C;  1L0V D;  4YSY C;  4YSX D;  3VR8 D;  3P4P C;  5C2T D;  2BS3 C;  2B76 D;  3ABV C;  4YT0 D;  3AE2 C;  1KF6 C;  3P4S D;  2WDV C;  2WS3 D;  2H88 C;  2WDR D;  3SFD C;  4YSZ C;  2WU5 D;  3AEA D;  1ZP0 C;  1ZOY D;  1NEN C;  2WQY C;  3AEE C;  3P4R C;  3P4Q C;  4KX6 D;  2WDQ C;  3VRB D;  1L0V C;  4YSX C;  4YXD D;  3AE8 D;  1NEK D;  3VR8 C;  3AE6 D;  1KFY D;  3AE4 D;  4YTN D;  2B76 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...