4KXLA

Crystal structure of dnph1 (rcl) with 6-cyclopentyl-amp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
144
structure length
135
Chain Sequence
RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVAEAAGGDQFIHEQNLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
publication title N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 53
structure length 135
sequence length 144
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kxlA00
1PFKA 1S2LA 3PFKA 4FYKA 3MAJA 4A3SA 4WL0A 3K2QA 4JENA 1F8YA 3IMKA 2IZ6A 3O8NA 2IZ7A 2F48A 1F8XA 4I36A 4KXNA 2F67A 4MCJA 2A0KA 2F64A 1S2IA 4LJRA 4HX9A 1KZHA 4FYIA 1ZXXA 4KXLA 4RH3A 6PFKA 2NX2A 2Q4DA 1S2DA 4LJKA 4FYHA 3EHDA 3UQZA 1S3FA 3HNOA 1S2GA 4MEJA 2PFKA 4OHBA 4U1RA 2KHZA 4NPAA 2A33A 3OPYB 1MTOA 1WEHA 5AJTA 3O8OB 4LJLA 4I4IA 3F5MA 3U39A 2PMBA 3GH1A 3O8LA 1T35A 4KXMA 1YDHA 2KLHA 5AJUA 2F2TA 1WEKA 5ITSA 2HIGA 2F62A 2IZ5A 3OPYA 2Q4OA 4P5DA 3O8OA 4P5EA 4JELA 4JEMA 4I7EA 3SBXA 3QUAA 4PFKA 3BQ9A 1RCUA 4OHRA
chains in the Genus database with same CATH superfamily
4F8EA 3RVDA 1YRBA 1JW9B 4AO6A 2OFWA 5ALIA 2I6XA 3MMNA 1N8SA 4FB5A 1TYCA 3ZOZA 4YRAA 5JXGA 3RFXA 3ZVMA 1N4AA 3VH3A 1WCWA 4B6OA 3UJNA 1U1CA 2WRZA 2ZS7A 4V0KA 5J2TB 2RK6A 3REFA 4B7ZA 4HPWA 1K8XB 2JAUA 4EVIA 1K92A 2IC5A 2QXTA 3HCFA 1HO3A 4LJAA 1R9NA 3FW1A 4KDRA 5AKKA 3IVGA 4UU0A 5JAUA 1GGVA 4R1UA 1UWKA 2LIVA 3ASZA 1WMEA 4B74A 2I6SA 2DHRA 2YVQA 3SJCA 2XECA 3A1DA 2ZRMA 4HDRA 4QFMA 3TAHA 1WQ3A 4M1OA 3RFFA 1BH6A 1UKBA 1Q84A 5AVTA 2AG0A 3R5FA 4DLUA 4MVWA 3MCWA 1LUAA 3RLFA 4F2WA 4OGFA 4JT2A 2QBYB 2D3WA 1ZA1A 3MXTA 1LS6A 1HFJA 2QL5A 5BSKA 3EXEA 1UJ2A 1R6DA 2SCUA 1KO4A 3L07A 4PF1A 5I7AA 1PFGA 4YP0A 1C3OA 1HM5A 2Q5HA 3F3MA 3H7IA 3GXOA 3KZXA 1Q7TA 4JGGA 5K3FB 3R0VA 4IZHA 1N3IA 3GEIA 4YCAA 4R0VA 1S7GA 3OT4A 1T6XA 2QW1A 3MOGA 4C6HA 3V00A 4BO5A 1OX5A 2Z30A 1EEXB 4AJLA 4IBOA 4QXMA 3L0IB 3K1AA 4D4LA 1GPDG 3WL5A 5KX5F 4CLOB 2YFYA 2BLNA 1ORWA 2CJWA 3I3OA 4K46A 4B87A 3RUAA 3NWPA 1MA0A 2EG9A 4IVPA 4LGCA 4E33A 2G80A 2YUIA 1FTYA 4GMDA 1ZVMA 3OX3A 3JQFC 1D4OA 2OYRA 1QK4A 4BEBA 4F6LA 2BMJA 4PZ0A 2JGEA 4BZZA 1X9IA 3ZU5A 1IEXA 2IY8A 3TBKA 3C3MA 5IUJC 2O5RA 4G1FA 4WOJA 5AVJA 2I1LA 3MS2A 4TYYA 3EDYA 2BSQA 1A8PA 1SXPA 2FRXA 2YQ4A 2X86A 4IOMA 3WGMA 4WN3A 3L1HA 2GFHA 2VT3A 3V55A 2XMCA 1QX4A 2J7PA 3OOWA 2GESA 2ETVA 1XQVA 3WWCA 3MJFA 3JYHA 1TD9A 4PSDA 5KHAA 2VHUA 2ADMA 2F3SA 2WPNA 4U63A 4DUYB 1G7TA 5ALYA 2Y2VA 3KB6A 1B4DA 3UWPA 4TXMA 1EKXA 5G1NA 4ESOA 3OPYI 3RAPR 4LPKA 4E21A 4MO2A 2VTVA 1UIMA 4YRMA 1C30A 2CE2X 1EUCB 3K96A 1E3WB 1QGED 2Z4TA 1OHHD 4QDOA 3DCNA 2HFJA 4KO8A 3T41A 4BNVA 1UBRS 4JLNA 4R2WA 2WF8A 4XVRA 1Q14A 2B3TA 2VH1A 2QLJA 3O8DA 2QM7A 1AZLA 1U9IA 2JNWA 2YBEA 4L78A 4D8VA 2J0QA 4X8MA 4XRGA 1FFAA 1SR8A 4C78A 1SUCA 4QFDA 3A05A 4G0OA 1DBVO 3IUMA 1P29A 1TCUA 3RRZA 2EFEB 3MSCA 4WZAE 4K9OA 4BN4A 5AM5A 4FFBA 4MYDA 3H3FA 4NBKA 4MR8B 5KNDH 1DTWA 2FUEA 4KDCA 3I2FA 1K6EA 1YNOA 1T24A 3DWIA 2GM4A 3VOBA 1G2IA 3MF4A 1E9FA 3QUSA 3Q5DA 3ACCA 1EVIA 1BWRA 1W88A 2ZE5A 1X3SA 3LDHA 4AJIA 1BX0A 4L51A 1A71A 2QN3A 2EQAA 3BE5A 1QE3A 2QROA 3PHJA 1G8AA 5J2TA 4HGOA 2LP4Y 4X7PA 1DBSA 2AVNA 4GM0A 2BISA 4P5PA 4XVCA 3ZX4A 1A8UA 1ORVA 4CMGA 1IXZA 3LG2A 4GSYA 4KE6A 2NUPA 4WZBE 3FIUA 3FPJA 1U4OA 5DBEX 4NMXB 4YAUA 3G2QA 5FWDA 2JBHA 1KE1A 2HWYA 5M34A 5C8YB 2PGLA 3JQGA 2DM6A 3D7NA 4GQBA 4O4HF 1UBHS 4MRSA 1D0VA 2JJ2D 4GX0A 3KS9A 1EX9A 4PGMA 4MIYA 3L0ZA 1UPUA 3AUJB 3P9IA 1AHPA 1U3VA 1IB0A 2C4KA 3TLYA 4ADSG 2BHTA 5FYDA 1YUNA 1X3LA 2WKRA 3D4OA 1EFPB 4DR4B 2IHTA 2XF8A 1UIRA 2EL9A 2FZGA 1W19A 4M0MA 1J24A 4XTCS 5DXJA 3V7FA 1AZSC 3CNQS 3PGVA 1DLJA 1MV5A 4LXGA 4EW6A 1N5RA 2DKOA 2I1QA 1F51E 3HPQA 1HFWA 1YOBA 2B4KA 4YGXB 4PHTA 4E5VA 1HOXA 2A9FA 5TQ0A 2AJTA 3OIUA 4EMUA 1LA2A 2CYCA 1DQRA 1X0VA 3I52A 3L02A 3TOZA 2FZ5A 3AB8A 5GZ6A 5EMNA 2YMMA 1OXVA 1RXUA 2J09A 1E9AA 2E4WA 1ELOA 2QRZA 3I8OA 3DDSA 2WT8A 5GAJA 5B37A 3F6SA 3SIWA 1AF4A 2OXRA 2C78A 3N2KB 3L7YA 3GG9A 2RHLA 3OIFA 2R8BA 4IDDA 2I67A 1STOA 1VJ5A 2XSZA 1FU8A 4UU8A 3OQNA 1Q15A 4IYJA 4Q21A 3SOPA 4JT9A 4A8JA 2Q4BA 5FOVA 4HEA6 4OGWA 4TYNA 1QGYA 5JH7F 3JQDA 4RFSA 1V0JA 1XG5A 4G9GA 1LVUA 3GOHA 4G0YA 4K26A 1VG1A 3MMPA 4HR7A 4JT8A 3CVWA 1EHYA 5GJVC 4LHWA 4ACAA 1E79A 3KYDB 4R2IA 4F2HA 2OBBA 2P0EA 5ITSA 4CW7A 2BMWA 2H48A 1Z5PA 1CT9A 4X1YA 2VRNA 1B6RA 1MX5A 3BXGA 4YAWA 3CT4A 1Q74A 4LYYA 5TQ2A 4DLNA 5IJ9A 1DKRA 4P5DA 4CT4B 4HQOA 5DTIA 2ZR7A 3NHBA 5AQEA 2ZI3A 2CLDX 2IHKA 5IK2A 4R2MA 3UWKA 4LVOA 3WK9A 3UCFA 1LLQA 1E9CA 4LJ6A 1G4HA 3UFBA 3WA7A 1NUAA 4W5OA 3D8HA 1NJ5A 4OJNA 2VPIA 1B42A 3BAZA 3K0EA 4JMPA 1TVEA 4EGSA 3W3AD 1K97A 1NT4A 2Y67A 3E9RA 3WRXC 2Z9DA 5LUAA 2VWGA 3R9KA 3CT6A 5EVJA 4IMJB 1NW8A 3ZQUA 3KPJA 2P9TA 1JKJA 2HMYB 1SHZA 4B2LA 1QYXA 5A9TA 2P2YA 4ZQBA 4IMRA 1WCIB 1TAGA 1XP8A 4H2DA 4R1TA 3HK2A 4HQ0A 3OEWA 1FUKA 2H4YA 2PS1A 4CM8B 1PX0A 4GP9A 4RHUA 1SVMA 5ICMA 2WSYB 5L45A 3MM4A 4EZEA 5CJPA 4Z0NA 1IBSA 4URWR 4KXYA 5B1IA 1KTVA 3TN7A 5KTYA 4X66B 3HXMA 1FNNA 1JIIA 3O2JA 4F2DA 2BH9A 1R4MB 4YV0A 2BD0A 3KP1A 1MEEA 3RVLA 1TQDA 4R8RA 2B99A 2F1RA 2EKPA 4IAOA 4LWPA 1IUKA 2CNWD 2W2TA 4PX9A 3MRVA 5J2UA 1PLKA 3PI7A 3NWOA 3AW9A 4KVAA 3UQYS 4BP1A 4DMRA 5IX8A 1Y5LA 2GXAA 3ZY4A 2YNMC 2NSYA 3PGMA 4J0CA 3AR7A 5E8JA 4J91A 3A04A 2G9UA 3EHDA 4IG4A 4NV3A 1QG6A 4P38A 5G0SA 4LFAB 3QMPA 1Y7IA 2CNLA 3SJAA 1LI4A 1XZ8A 1DCKA 1MR3F 1OHHA 2WF9A 1V45E 3H5TA 3IPYA 5HHTA 1LEHA 2A30A 3AJEA 1SUBA 2HV8A 3KU4A 5DMHA 3ZKAA 2VC2B 3A1TA 4CMEA 1KMMA 2JF0A 4TGLA 1NNSA 2P9CA 4NWIA 1MOQA 3A6LA 1NI3A 3FUUA 4FCVA 4F5ZA 4G3XA 4RVNA 3QKRB 1NUQA 3C85A 2BEWB 4U0KA 1JJAA 3IEIA 5CM8B 2SICE 1QIMA 1QTIA 2VF4X 3HRHA 5DBFA 3BJZA 4O4IF 5FFNA 1DKUA 4WH0A 4CMKA 5A4KA 1T0HB 5M29A 2BFOA 2O7VA 3FLAA 3BQNB 1GA4A 4Q7QA 3NUGA 3V8RA 2NPIA 2HMWA 1Z25A 4NMLA 3AFOA 5IKMA 4TL9A 1ZK4A 4MSUA 3WHKA 4DVGA 1KZ9A 4Z4HA 3VKHA 1CETA 2BZSA 2QNRA 2R8RA 2VQ6A 4J29A 4TV8F 4C0WA 1M2OB 1EQ2A 1K63A 5IAAA 1OBCA 4EPWA 1TZ2A 2RBGA 4DLTA 3T9DA 4TXJA 3SKVA 3VU3A 2EKDA 3QKIA 1QDEA 2P5TB 4WXEA 4H6PA 4R7TA 3AY0A 1PZEA 1IRIA 4KRYA 3H11A 3DWFA 4WINA 1DEOA 3U4CA 3IIJA 3I0NA 1ST2A 3NVAA 4EA8A 2J9FB 4EKNB 1KK2A 2ZB8A 2P9ZA 3ONEA 2OCDA 3CO5A 2ZDGA 4ARBA 3OZVA 1MB9A 1ULBA 3VHXB 5JZVA 4BO6A 1B23P 2BI4A 1OIXA 2H18A 3OTWA 3EDRA 5SY6A 4BBZA 2R6DA 4PZZA 5BN4A 3JQAB 1H6DA 4ME6A 5AK5A 3O8CA 1Z5VA 2C61A 3O1LA 3ETNA 5TRTA 3AW8A 4D0LB 2GZ2A 3K6SB 3ESRA 2OA0A 2WFLA 2BH2A 4G85A 2X0KA 1XEWX 3HEMA 4OJKA 5AW6A 5IEJA 4Z1MD 2VZEA 5G0UA 3VHQA 4D6XA 4WZ6A 2O8EA 1U63A 2YN0A 5M5BA 5FNVB 1N7JA 2O5EA 2D74A 1YAJA 2HADA 4NBSA 1BD3A 1N34B 4TZ6A 3ZTWA 3HDTA 3FPCA 4EYOA 1RZ3A 2XYVA 1EUZA 3D7RA 1T5OA 1IK4A 1T2AA 3ZLVA 1G38A 3RVSA 4EY5A 3VX4A 3ROPA 4EHFA 2BGRA 1CJMA 3RVRA 1QH0A 2QT9A 3F9IA 4BFVA 4HDKA 4K87A 2B4TO 1FUEA 2W2LD 3H84A 4CV2A 3GFRA 4MVYA 3A6DA 1WW2A 5AMXA 5A05A 2YHBA 2B9VA 3L79A 3HA3A 3UGQA 3WDMA 1LC3A 2PMDA 3FSJX 3U44B 1ESEA 1KDOA 2ZTSA 2FAXA 1ZOPA 1U3UA 3DGFC 4LOLA 2GLXA 1W73A 3DM9B 3GRYA 4ALNA 3KLNA 1BXZA 2FPMA 3E9QA 2AXPA 4W63A 5FP0A 3LLCA 3RT9A 3TS1A 1CPYA 1DGQA 2E82A 2C9OA 3SM3A 4LGYA 1SXJE 4R05A 3X2SA 1NSYA 2BFFB 3HQ4O 3D43A 1GGKA 4DA7A 3KKLA 2ZCJA 4XVQA 1AM4D 1IXKA 1BRTA 1YASA 2VJLA 2R68A 4EVSA 3TE7A 2DCMA 3KELA 2RGNC 1F5SA 3ZPXA 1ONPA 2L69A 4KQIA 4AUNA 2X2PA 3H16A 3K4QA 4M1QA 1E1NA 1LU9A 1U99A 2ZBUA 1NUTA 3GFBA 3HUTA 3WZLA 4HNAA 5D6OA 4EGAA 1YL5A 3KAKA 5K51A 1OC2A 4J76A 3PXAA 2ECKA 5JPIA 2W6ID 1QH9A 2QKYA 4C1BA 1SH7A 1NXXA 2NVWA 4RENA 4RF4A 2CJFA 1Y37A 1K4KA 2EC5A 2HCFA 3BWCA 1WE2A 2VSNA 4CKEA 2V6GA 3K0AA 2WIJA 3ZBPA 2Y1KA 4BVAA 2OWDA 3IXMA 3UT5B 4DEXA 1NR1A 1RXEA 3GDOA 2JJ1D 4NRDA 3WKBA 4WY8A 3PF8A 3EVNA 2QUKA 1Z07A 2Q6KA 2XYQA 1NVAA 3JSAA 4BQSA 3C1UA 5DI3A 2V9PA 4FEEA 4AY6A 1PQPA 2QN2A 3AF0A 3CTMA 5E4JA 3JQBC 4WDRA 1Z35A 2IXGA 1JDZA 4W1SA 4FSXA 3RYIA 1W36C 4OI0A 5AHOA 2VRWA 3Q72A 4XD2A 3GMSA 3NHPA 4AUKA 1W44A 5AO9A 4AL4A 1EFUA 5TARA 1K75A 2VDWB 2GCOA 5KI6A 2FW7A 2Z56A 3OJWA 2EF0A 1BAPA 1H6BA 3KEQA 1X77A 2WVJA 4WQMA 3FKSA 3INNA 1HY3A 1NF3A 3K0KA 3NTUA 4H6VA 4KACA 4L9AA 4B7UA 4EJ6A 4A0QA 1F2TB 1G3UA 1K98A 1ZD8A 2ADOA 4G25A 1NOJA 4CMEC 2B34A 2KYRA 3FCSB 2JHGA 4I55A 4WJKB 2HJSA 3F1KA 1HLFA 2JEYA 4FCWA 4OAQA 5GPBA 2CYAA 4QOSA 4DY6A 2Z2JA 2XBLA 3QOXA 1DDIA 3DF7A 3MWKA 3AEYA 4YBRA 4TYMA 1Y8RB 4EG1A 4YECA 4ZV4A 1KYIA 3DMFA 4I14A 1SG0A 2C98A 4YGYA 4CLHA 2O3SA 2ONZA 2ZP1A 3HB4X 3PWSA 3BHIA 2WWYA 5C51B 1V25A 4E11A 1KZ7B 4MO9A 4BVEA 4QICA 1LZKA 3HDJA 1MBZA 1PFKA 1CY7A 2PLWA 2BVNA 3UK2A 1SIUA 4MW7A 1MEOA 1YIAA 3BK7A 4F71A 3ASYA 1RLUA 2GNOA 2XYHA 3LGSA 5IWAB 5EIEA 4MVJE 5JTUA 5D87A 2W8BA 1E6LA 2PD3A 3FYHA 4IW3B 2ZWOA 4ISBA 2HJ9A 1XMQB 1J09A 2ZT5A 1XDZA 4LN1A 1D6MA 2IQ5A 4NZYA 1ZM4A 1Y4AE 3AJ8A 4KC0A 5HNKA 3F73A 2YV1A 3D59A 3GNLA 1LPAB 2C9CA 1ZR4A 4EIWA 5EZQA 1P31A 2Y1EA 4IM7A 4O25A 4X65B 3QELA 2NT4A 4GNRA 2ZBGA 1E9RA 2XCRB 5JXWA 2GTIA 1Z74A 5I9MA 3DVAA 3KYBA 3OCCA 3NLLA 1PBTA 4U4AA 2MHCA 4L22A 5FBLB 3TL2A 3G7SA 1E3SA 3KSDO 4EB6A 5CITA 2IE0A 2YWEA 1CR2A 1FVFA 1KR5A 4TMFA 4KAAA 3V46A 2FZ4A 2H4ZA 1ZS9A 2ORIA 5TNXA 2VDUE 4BEWA 4JNCA 2ZIFA 2H7CA 2EJVA 1CUDA 4R9NA 4DMLA 5TVGA 4LNHA 3W1EA 3O4FA 4TKMA 1K3UB 3BIJA 3FCCA 5AR1A 1RC8A 3FVWA 1GA1A 3RJZA 3BS4A 2PS3A 4J1QA 4WK6A 3WSTA 5IXSA 1EE9A 3L8DA 1BG6A 2XJ4A 5G3ZA 1IWPB 1HKHA 1M83A 3A6JA 3A9VA 4MYUA 2G1JA 2J3DA 4L16A 5J47A 4MA0A 1M33A 4TLDA 1WP9A 5E0KB 5CVEA 2F1KA 1VA5A 3A4NA 1GL7A 3BG5A 1A76A 5AH0A 1NRJB 1B0ZA 2AL7A 3FIJA 4IMPA 4NBLA 5HILA 2JFWA 3FFWA 2UZ1A 3OM9A 3UJ6A 4PRLA 3UTDA 4Z1MA 1D0IA 4ZC8A 4I8IA 2HWWA 4PBRA 5DTMA 5BOSB 5HCNA 3GCXA 5F9FA 2CHVA 4BVKA 2B8WA 1XCLA 1JEEA 4G65A 2WV7A 3NC1C 5F2EA 1HYQA 3LFHA 3GR6A 4GH5A 4IXNA 5FPSA 4MGZR 4QPNA 3TB4A 2JCGA 3I6IA 2PUCA 1GTL1 3O74A 3WGHA 1O97C 4ZU6X 3S1AA 3FPBA 1DJMA 1BOFA 3FGZA 5T4EA 1RPAA 3TL3A 2GZRA 4UOQA 1EBBA 4YJGB 1V11A 1V96A 2H63A 2BKEA 4NBWA 4QVGA 3TZCA 3VBEA 4EY6A 4B44A 1PG0A 3QJGA 5JCJA 1A2BA 4ND1A 5TMEA 3N28A 4FC7A 4A0FA 4EA7A 2P0YA 1PR4A 2Z83A 1DHRA 1L4LA 2I78A 3KT3A 3QNWA 3G89A 4KAXA 4W5HA 2AW5A 5KTKA 2YRFA 5E6UA 3PUWA 4MW2A 4DA6A 4L28A 4BO9A 1AKTA 5F1KA 5DXFA 3UW3A 4I7EA 3KOWA 4B4KA 5JQGF 4EVRA 5IDYA 2IA5A 2JLWA 2AQKA 5H70A 4DGQA 2WDPA 4JQYA 2E7ZA 4XGIA 3WIUA 4RE6A 3AZOA 1J8FA 2GWHA 5E2AA 1NR7A 3ERCA 1NVEA 2J6BA 4CETA 1QYWA 1IC6A 2Y0BA 4YNBA 3GLFB 4BEVA 1L4BA 4O2RA 3IJ5A 3K70B 1PDVA 3FB4A 4DG9A 2JKVA 4D9BA 1G2QA 4UNIA 1P4JA 5FPHA 5IFLA 1D9XA 1U31A 3Q10A 2PLRA 1GQRA 4KGZA 2PAFA 3JVIA 4E12A 2P77A 2NTJA 3M9LA 1E1CA 2XCOA 1LPBB 1N2CE 4F4DA 1D04A 1GRCA 3S2IA 2DFLA 3QENA 2WINI 3ULKA 2RHWA 3D2LA 1GYPA 5FO1A 5EEGA 5HK8A 4EMSA 3HFRA 1KI9A 4B6RA 1C7JA 1F3LA 2JJ1A 2OCGA 4OYHA 2AOXA 2ZRCA 4OIFA 4RETA 2GUGA 1T6BY 3NBXX 3OAAA 1K2VN 1WLSA 2WSBA 3WRYA 1XIVA 4IIJF 4YRJA 1DFHA 4H7EA 2UZ4A 1Z2AA 1ZGZA 3LDFA 4KP7A 3AUAA 1Y1TA 2EBWA 1MGPA 1LWNA 3Q7SA 1OGJA 1ZXXA 3OJEA 3ZWPA 4LJ4A 9LDBA 2BEUA 1XPUA 4O6VA 5EKTA 2D8MA 1KIFA 1LSSA 3D81A 3LT1A 2I8LA 3CRVA 3CZPA 3PQ4A 2JZNA 4KL8S 2FQQA 4Q3KA 4YROA 1Z7EA 3OLVA 4KQKA 4ZI3A 2GASA 3B82A 3F4KA 1QHYA 4CEHA 4UTZA 2VAPA 1AA9A 4UUMA 5KYWB 3C8UA 3LQKA 4OF4A 1FU7A 4OL0A 2AX3A 5CLGA 1QQTA 3UK1A 2XVZA 5DF1A 4LJ5A 3WYFA 4XASA 5BSUA 3UUEA 2QUAA 3P9CA 3B1FA 2FEXA 3O6VA 4WOKA 2WNSA 5CLLA 3OSZA 1KSGA 4CODB 3P1JA 2CXUA 4S0ZA 2Q1WA 4FGJA 4WLOA 1YR3A 5ADHA 4MLPA 5HOEA 1AQNA 3AVXA 4IJMA 1Z7YA 5DV9A 4L75A 3ROTA 1XMJA 2QZZA 2V7BA 4K6OA 1XZCA 3IT0A 4BQEA 2Q99A 5EMLA 4J0EA 2YBDA 1YFLA 2BV3A 2JHCA 3V8PA 5JSZA 1P7WA 3GLVA 3L1UA 2QV0A 2FB9A 1EHIA 4KNYA 2X6RA 3D02A 1QRDA 3GJ5A 3LUHA 3RC1A 5CX1B 3RIXA 3LDAA 1C0KA 3K1YA 1VE6A 3UPTA 4H4DA 4E5PA 5H81A 2KW5A 4HDMA 4I4TA 2HMVA 5IVDA 1UDAA 2JAOA 5JBIA 2QA5A 2VF5X 1KSJA 2NO0A 1ONNA 3AV0B 3NBAA 4RMJA 5CH8A 4ZQGA 1OYYA 3E8MA 4WCFB 5SYAA 3ZDXB 3M1YA 5D3KA 221PA 3EGEA 5FLYA 4HHEA 4GWGA 4TMXA 3WBJA 1E1LA 5G40A 1AUVA 5D01A 2QLNA 4HLCA 1FYWA 1CDDA 3DFKA 2FN3A 2C99A 3IAM1 1H22A 3ESAA 3QE3A 3WGZA 3DLIA 1S3IA 4DR6B 1P91A 4YRSA 3SC4A 4AYWA 3C4JA 2FSIA 5JLJA 1P5JA 3KXDA 1W2HA 4IGEA 3DDUA 2R44A 3L7JA 4KR0A 5CLQA 1M7HA 1QUFA 3OKCA 4Q4AB 1KBZA 2WHRA 3GLIB 4KE9A 1N78A 2QE7A 1XAGA 5GZ3A 1LDNA 4O2AA 5AXBA 5BUZA 1CEXA 4PXYA 1QP0A 4X1KA 4PYMA 4DMUB 4G2NA 1IG3A 3EXG2 2AR0A 2QOEA 3JD1A 4KB5A 4OHMA 2ONYA 1L7QA 3E9EA 1A9XB 3BHJA 4JODA 4ZVOA 4C05A 2R96A 1R4NB 2EZUA 2VZLA 1REQA 4MRRA 4HVTA 1XO1A 2QK4A 4GPBA 2ALJA 2L19A 2ZI5A 3DW1X 5DGDA 1PL6A 4ZJPA 3ELWA 4QPPA 2XQIA 4ZT7A 4WBNB 2RAPA 4M4SA 4YAGA 5BMVB 2RAUA 1D4FA 3OICA 1Z12A 3BULA 5BWMA 2ZITA 2ZBFA 3WVNA 3L1VA 5BURA 5DGTA 2EF1A 1EDBA 4H77A 1Z4PX 4AKIA 4H1UA 4CPDA 5JV5A 2K6GA 3W90A 4BX2A 1JQEA 4V38A 2CLLB 3BRWD 3FTDA 5HOQA 1W25A 3GXBA 5DHRA 4WLEA 1YJQA 1YQWA 1E2UA 1JPVA 1LFDB 3EFEA 2JIZA 4OQXA 3G9TA 1JHOA 2HQRA 1X8JA 1I36A 4L72A 4MYRA 4HYEA 3DAFA 4K9PA 1Q11A 2HLDD 3Q7IA 3U7JA 3T8YA 2JLCA 4HFNA 4BV8A 2XCSB 3QHPA 1N5JA 3QF7A 4EQZA 5KQLA 2JGAA 3L0SA 3RVNA 3SF8B 3RAJA 2DUNA 3HBLA 1QFYA 4ZT3A 2YHIA 4ZMRA 5HKKD 3F6PA 4OBXA 5JROA 4JFRA 4EHIA 3E18A 1EXDA 5BWLA 3L7IA 1IWBB 2HDHA 1J70A 3QX7A 4A1FA 2FFRA 3ZOKA 1IZZA 2I8AA 4Q1EA 4F12A 2R6JA 2F3RA 1U2EA 2PGIA 3UB3A 2E37A 3CGGA 1G60A 2DYKA 5FQOA 4J3NA 4FMDB 3TX2A 2ZIVB 1V1RB 1JWAB 4RMIA 2NU8A 1Y6RA 1WM1A 3GHHA 4OBBA 4WACA 4H59A 3GZNB 2OZVA 4C6TA 2ZRNA 1AB5A 5DYNA 2AMVA 2ZQZA 3HXPA 2E4ZA 1KI6B 4O4LF 2AQ8A 5AK3A 5JQWA 1N3YA 1QOQB 2ZJYA 3FBGA 3UA3A 4BTEA 2KB0A 4Y3UA 4X94A 4Z4EA 3LLMA 2GMWA 3BE8A 4RZUA 4G8CA 4L73A 3KJFA 3ED1A 3LUCA 1B6TA 2P2GA 3LOPA 4UZEA 1E7MA 4IQ8A 1VBFA 3NVKI 1E4EA 1GILA 5BSMA 2VAWA 3Q5GA 2A9KA 1BE6A 2JLBA 3B1VA 4ZPXA 4EOGA 3RASA 1VP9A 1FPQA 4KHZA 3UMSA 5DTRA 1HDGO 1YZKA 2A9RA 5ARDA 4BFYA 4F5YA 2PV7A 1OYWA 3CO0S 4KXMA 2XDQB 4ER0A 5AHKA 5YASA 3DZCA 3PP8A 2FPGB 4FC6A 4KOEC 3ZV3A 3WLJA 4PIPA 4LZOA 7REQB 2BM8A 5AI9A 1BYIA 3VSCA 2X0NA 1XJWA 4HK4A 3ABZA 3MQ2A 1E7YA 2P90A 3W3ZB 4HLUA 4UUOA 3CSUA 4KBGA 3QNMA 1PX2A 3MD9A 4IF6A 4XTRA 3R8FA 3AM1A 2GSWA 3ETJA 4D9MA 4UXIA 1DX4A 2ASEA 1TQHA 1RPJA 4FX2A 2PO7A 2AEFA 3HUFA 3LUPA 1KSHA 4IILA 3OSUA 4JVMA 4GT1A 4JEUA 1NVWQ 2B37A 5BRNA 1HDCA 1I5OA 2IF0A 4ITVA 1LDEA 3G0CA 1UBGA 1E9BA 1FRZA 2BSXA 2ZG6A 3A6HA 3G23A 1ZOOA 3NFRA 3R3YA 3VNSA 2PSHA 3F7MA 2O05A 2HCJB 3ENKA 1NQWA 1RW4A 5KJEA 1W581 3LP5A 3QI2A 5AJXA 5HQJA 1XF1A 3FZNA 4XWGA 3A9RA 1P6UA 1GCGA 4RHFA 2FN7A 1FSFA 3LKVA 4DIDA 2IYPA 4MH0R 3BQ9A 2PUWA 3T94A 1XL0A 3GFGA 1N6OA 4MP3A 4PG6A 4ER7A 4ZODA 2EXXA 1DAKA 3THYB 2PHZA 1TQ8A 2Z4RA 2BZGA 4BUJA 3M9WA 3OUZA 3L77A 3L04A 2H59A 3WO0A 3HJTA 1KKMA 2EP5A 4RJJA 2D6FA 1KQNA 1G5QA 4FZ3A 3KJZA 2WFMA 2OL4A 2HJRA 4MINA 4E5SA 2IPOA 4RPKA 1VHLA 2QVYX 2FGKA 4JLWA 4M6WB 1E1YA 1RSZA 4EG6A 3AQIA 4LK2A 5TIIA 1ADGA 3U7RA 3QG1A 3AESB 4PSAA 5A4JA 5B1EA 1L5ZA 2ZBQA 1JXMA 4Y9TA 3SXPA 3CZQA 3COPA 2ZRFA 2DX7A 4ZALA 1FDOA 3EVZA 3U3JA 3ZCRA 1I6LA 2OLJA 4NYMR 4C2TA 1O95A 4J03A 5IJZA 2X8WA 2ZAMA 4DRXB 1Z4MA 4H7FA 2ZYGA 3N8IA 4E5MA 1OH8A 3T5TA 4OHXA 1R0BA 1OD6A 1GUZA 1JB1A 1CZRA 4GEGA 4P83A 3IDOA 2JS7A 1J4AA 5H9VA 5KAPA 3B48A 4DNPA 3NWJA 3CZCA 4O4JF 1KIMA 3H2IA 2GN0A 4LISA 3TCXB 3TFWA 4ALLA 2I4IA 3MWJA 1YA6A 3E2MA 1JYEA 1ESNA 2HA7A 1JEQA 3USZA 3G1UA 1Y1LA 3GQBB 4QBKA 3O93A 3LW7A 3CB4A 5FOTA 3SWWA 1UOPA 2DFKB 1EM8A 2ZJ8A 1C0IA 2LW7A 1M1YB 4WZBA 1WZ2A 5LLDA 4KQEA 1N9ZA 1CQJB 2CVPA 3QVLA 3DXZA 1GRVA 521PA 1KDVA 5HZMA 1L6RA 2QAIA 1JLKA 3VC3A 3CKYA 2Q6IA 4DCGA 3B7PA 4YI3A 3DUFB 1T36A 2VAMA 3IQEA 4I9GA 4DSUA 1RACA 4ZAFA 1U98A 1KRXA 2X6QA 3BXXA 3JARB 3KXKA 2VWHA 4OQNA 2FPUA 3LF1A 4RS4A 2O14A 1MLDA 4PQEA 3CVUA 1FYEA 1W85A 4FOOA 3BGWA 3MJVA 2K5UA 4QJ3A 1W5TA 3E7WA 1DMSA 3OHSX 3SEQA 3G79A 3CF4G 3ZX5A 1L3BA 3ZV7A 2RKBA 4ZCMA 4S1VA 2H08A 4TROA 1P1JA 4YXWD 2OD7A 4H1TA 1WY7A 1OUMA 2NZXA 4BKMA 1TZJA 1ABFA 3OX1A 4OHYA 3KHTA 3HKEA 1Z75A 4P4GA 1ONBA 2ACEA 2ZTMA 3VH2A 1U2DA 3S8YA 3CPHA 1M74A 1VPEA 4XOIA 1RYZA 3IUPA 3H13A 4D1YA 1FVHA 1DPGA 3ORSA 2ZBVA 4MIOA 2YWHA 4C29A 2W98A 5AVVA 1T5IA 4Q01A 1TJPB 1JEDA 5CT4A 1RQ7A 4CM6A 4MB2A 2ZRPA 3LMKA 1JL3A 2PJZA 2JGJA 3UPDA 4LYJA 4B5LA 4CV3A 1DRVA 3H8JA 3FN4A 3ILSA 1OLXB 5JISA 5E4TA 3O8OA 3ICCA 4UJ3A 5D7BA 3DEHA 1FFXA 1NVVR 2Z4SA 3ZJ4A 2AXQA 3KTDA 3V7WA 3IO3A 1P5RA 3VYSB 3S28A 3TD2A 3SHWA 3PDWA 4BX0A 5HKKA 2X1VA 5BSTA 2OK8A 3B85A 1SXJD 1D2HA 3A6GA 2YZ7A 3CVXA 4PZDA 1DAPA 1ZNXA 2I54A 1GZDA 4YWJA 4U8GA 5A7HA 3N0WA 4DYVA 4KO4S 1PZNA 1ZR2A 2GPAA 3EFHA 3IR5A 3DDCA 1NRWA 3F6YA 1Q0UA 3JQ9C 1VJTA 5D8DA 3RWBA 4KLNA 3AX6A 2Z8XA 3IUQA 4XM0A 1ZD5A 3MW8A 2GN4A 1W4LA 2HDNB 2X5JO 3FSEA 1ZSNA 2I4MA 2V6IA 1CJKC 1HMYA 1H23A 4J0DA 3EUAA 1FDSA 2W2KB 1UP6A 4NXMB 1RWOA 4E4YA 5LQRA 3Q9UA 5K4GA 1NDHA 2NXEA 4U7PB 3ZW9A 1Z5WA 4GX1A 3LCVB 4HWGA 1ZIDA 1KPGA 1EE1A 4IJUA 1EINA 1GFSA 2HRQA 3U4IA 1HNXB 1MIOA 1XJ0A 2IVZA 1E18A 3I42A 3P2OA 3GEBA 5FXMA 2OVBA 3RG8A 4B34A 4D43A 3HDQA 3F74A 4IXWA 3GDFA 4Z4FA 4L08A 3WSVA 2OAQ1 3PGLA 3LBNA 3VKUA 3EYWA 1ZW1A 4QRIA 4TMVA 1OOEA 3KLPX 5G3YA 1CJTC 1ONSA 1JMKC 3QV2A 4DKXA 5DN6D 2JARA 3G85A 4RD4A 4OM8A 2OFXA 4US1R 2W7TA 5ALOA 2GRJA 4AICA 1PGPA 3WDKA 1VIDA 3PXDA 5GOZA 2B2NA 1G9SA 3VR0A 1WCXA 1F14A 1F2VA 2C04A 3L7CA 1SCNE 4CM5A 4QVKA 4CM3A 4HAOA 1T91A 2C9MA 2H2DA 3DJFA 2BLLA 1ST3A 1LX6A 2ZWAA 4L8LA 4OGKA 5JMOA 2VBIA 2XR1A 5LKAA 5DEOA 3ZDEA 1M1NB 2YIDA 1WDLA 1MZVA 2V58A 5B1HA 4OJMX 1A4XA 3LY7A 5E6RB 1K4MA 2BR4A 1BEUB 3A10A 3TLGA 2BRUC 4II2A 5FUMA 4B9EA 1RWWA 1W5BA 1RXWA 3A6FA 1P9NA 3QLTA 3ZJTA 4P7KA 2JB9A 3GLSA 3RRFA 5KOYA 1NJFA 2AWNA 3PQ7A 4G0UA 4DWJA 2PUGA 1EVQA 4YALA 3LRXA 3KYCA 2PH5A 4EHLA 1HNNA 4YR9A 2RFLA 2Q2OA 4RW0A 4JI1B 3WMEA 1EZZA 1FEZA 2ID8A 4MV7A 2YJ4A 4TKVA 2O06A 2AZXA 1KU0A 3AF4A 1OKKD 1GYQA 1I3MA 3R5TA 1MH1A 2GBLC 1SKUA 3AWDA 3OQ6A 4GYKA 3GEDA 4MNTA 4PFJA 3HJUA 1JQLB 4Y2JA 4AJ4A 4BMNA 5IJ0B 1RC1A 1W94A 2QTHA 4N3NA 2VTKA 3EQ8A 2IPNA 4GR4A 4UNNA 3IR7A 4QTTB 4YRQA 5EGSA 5CB4F 1FFEA 2C0CA 3I58A 2AB0A 5G2OA 2VTBB 1AXEA 5CLHA 1NG9A 1PGNA 3BN3A 4Q9HA 4F86A 2J41A 1RRPA 3DMDA 1GSIA 4F38A 5JE8A 2J6IA 3CZ4A 3OFJA 1CFZA 3DTTA 2UYOA 1YA8A 4ZJYA 5KTSA 4LF8B 5BN3A 1QHNA 3LO8A 4M8KA 1CUWA 3ZHZA 4GZ6A 1NN0A 2P68A 2XUQA 4YWHA 4WLFA 4C3UA 3DUWA 4BOYA 6ADHA 2VHZA 1ENYA 2CDRA 1G16A 3JYPA 3EGOA 3FXAA 1GTVA 1EUDB 2VP9A 3ET5A 1LI5A 4FT4A 3KKPA 3UOAB 1A9OA 4G5XA 4DJFC 2RC5A 4DV0B 2APJA 1JEAA 1WKCA 1Z8HA 3OLXA 2UVPA 4EYQA 1JJVA 4F06A 4UUQA 5B57C 3O84A 5KVQA 4HDAA 5CAEA 1OU4A 4N3AA 2ERXA 2EBFX 4YASA 3ZDYB 4BMCA 5EJ4A 2WILA 1N2JA 1CV2A 2EZ4A 2OAGA 3FI9A 4FVTA 3E7XA 1PR1A 1XMIA 2G5GX 4JWTA 2QMZA 2V9ZA 1GZUA 2F67A 4IHQA 1KHTA 1YL7A 3SQLA 4EYEA 2Q5QA 3GT4A 4HGPA 4J2OA 4OO3A 3OEYA 5AVSA 2QR5A 4HX9A 3OEHD 3NU1A 4RPGA 3AI7A 4WOCA 4YXWA 2XZLA 1DC8A 3DT6A 5LA6B 2CZCA 1BHJA 1JQBA 1YHYA 4LXUA 2TMYA 2COEA 3LA6A 1RP7A 3OTHA 1LQTA 1N7IA 5CXXA 1JIJA 1NM5A 5T4HA 5JVDA 1IJKA 3H18A 4F6RB 2WMYA 4DIBA 3F3SA 3F5FA 1EVKA 5FL7A 4MPTA 4YJ3F 1XWFA 1XD2B 3O8QB 4BEJA 1N6LA 1ZD4A 1YZVA 2AW3A 5TY0A 1JHZA 2QAGC 3ZVLA 3QG5A 4B6SA 2IELA 5HF8A 2JFOA 1RQ2A 4M8SA 2O8BA 4B75A 1KEWA 4J0IA 4X3OA 2Z1MA 2ID4A 3AHGA 3QPBA 1WLYA 4NYIR 4FIDA 1UK9A 5C4MA 3L6EA 3KWJA 5LVAA 1NQXA 1UXOA 5CRIA 4IIBA 1GL6A 1K8ZB 1XAIA 1GNVA 1ZJ6A 1Z39A 3BZWA 1DC3A 3NHLA 2WD7A 4HATA 4LMBA 4Y7DA 5HCIA 3SYKA 4BNXA 5AJHA 5I7VA 1XZAA 2RGAA 3I12A 4OAOA 2O0JA 5K0TA 1NP3A 1NYTA 1SXJA 2IQIA 1O6GA 1CUZA 1M2EA 3AIKA 1K8YB 4IINA 1ZOSA 2R7NA 4QYMA 1Z68A 3SE7A 4HYYA 3VAAA 4Q3LA 4XPZA 1WV0A 4DT1B 4FDVA 3N59A 1W46A 3NEPX 3D6NB 1NMXA 5TE9A 3GUUA 4GOLD 1L8LA 1YI8A 2FMUA 1NOKA 2JGKA 3JVVA 3M1LA 3D4LA 1IHXA 5LQSA 1LVGA 3IUSA 5DIZA 1ZMBA 4QOIA 1HZJA 2GA9A 5LPNA 1V5EA 5CFPA 1E7QA 1RYNA 3JVDA 1DMRA 1GNPA 4KJZA 3LUFA 2ZXFA 3E9NA 5EKSA 5EWJA 4IHJF 3W2FA 1KDZA 4UULA 2PXAA 4YCBA 5K3SA 4BXOB 2PVCA 1MPTA 4EPRA 4QWWA 4C87A 2HF9A 3QXXA 5GVSA 1XKQA 2Y05A 1EUCA 1U8ZA 3HJHA 4LY6A 1ILWA 1W2WB 3DL0A 1E3WA 2XE6A 3E8XA 3NT4A 4J43A 4X91A 3RUCA 3OIGA 3ANSA 3TB6A 2K7FA 2PEZA 3BK1A 1PK9A 1FQWA 3NXSA 3OQVA 2G71A 1HQDA 1BC5A 1MENA 4NY1A 4B6FA 5AK0A 1QCZA 1XAHA 4UTPA 2J07A 1L5VA 2Z6AA 3CTPA 3HYRA 4HMPA 5CTAA 2FWNA 3NNNA 2JLRA 2YNMD 2YMQA 3KVOA 2D5CA 3OE1A 3D6FA 4ZIRA 1MNQA 4YT8A 1O6ZA 4NV0A 2RCNA 1MGOA 5FI1B 4NBVA 1MMFB 3II6X 3FYTA 3MTQA 4WKBA 4EX6A 2YW2A 5DN6A 1ZMOA 1QHEA 3NHJA 4RBNA 3SC2A 3U80A 5EJ7A 2IEIA 4MR8A 1MDFA 5BW6B 5JXJA 2NUBA 5KMGA 3K2QA 5AKGA 3LIPA 3V4LA 4MWGA 2SBTA 1CJBA 1NBIA 1FMLA 1P2VA 1VJDA 2VVTA 1CUCA 2YWBA 3UNXA 2YJNA 3H4MA 4N6OA 4B6QA 5K09A 4B4OA 1SU8A 2WWRA 5CLJA 3COVA 2I34A 3BB3A 1ZUIA 3QFHA 1EWTA 2R5FA 2EZ9A 4RD1A 3NUQA 1IBCA 1R0RE 4G86A 4X1IA 2H4FA 3DZDA 1Z06A 4M88A 4B6PA 4EGCB 5A6SA 3AF2A 1M73E 4EFLA 1OASA 4R51A 2E85A 4MCJA 3GEEA 1VMAA 3I9MA 4ZC1A 3EASA 3E9YA 3DJYA 5GP1A 3CC8A 2G5TA 2GAAA 3UAWA 3JWGA 2WA1A 4NV1A 1RIIA 1TPZA 3EK2A 5DHTA 3B2QA 1SFRA 2IUFA 2Q8QA 3DAPA 2QV7A 3LYHA 2IIPA 3D3JA 4MVJA 3SBDA 4G5FA 4KR6A 2WSIA 1OKKA 1QVZA 2C2HA 1C7QA 1USWA 5DP2A 1CQZA 5IAJA 4ZMSA 5A5VA 3P0HA 3HUUA 3A9WA 4AO8A 3NYQA 2PIAA 3VO8A 5EWMA 1JVSA 4JDPA 3WNQA 1QWOA 1JDUA 1NZDA 3RTBA 2AHOA 2FMKA 1Z6QA 1DP4A 1HQYE 4K9QA 1VCOA 1PTJA 3TOVA 1E2LA 4ARUA 4HNUA 5C0OE 3OPXA 2MR6A 1U90A 3ZC3A 3EXHB 3J81k 1ZI6A 3JX9A 1V7PC 2WMNB 3DTVD 4PZYA 4D81A 4F2GA 4GDMA 2BR3A 2JASA 5TS2A 4RJLA 2XA2A 4XEUA 2IXTA 2WJYA 1RADA 4Z4IA 3L49A 1T4DA 4CHGA 3EBOA 1BW9A 3GUHA 2RHDA 3PUIA 1Y42X 3G5LA 5AVKA 4AJ2A 3L8GA 1H9AA 3FKJA 1AGPA 1MAVA 4XQ9A 4ABYA 1IVYA 1KEVA 4WXMA 3HYNA 5EL0A 4IYRA 3AFGA 3QPCA 4XYMA 4ZHQF 3GX1A 4LNUA 1GPUA 2C9YA 5HJ7A 4IDQA 2ZYDA 1SY7A 1UPCA 4GS5A 1Y3CE 3QLVC 4UUAA 5FA5A 1NXQA 2OBNA 4MIKA 1YU6A 4Z9XA 4AZVA 3OIDA 5C8DA 2QP9X 4WN9A 3HV0A 1NPDA 1X8XA 4FUTA 4OHWA 5HMMA 5K0LA 4D46A 3OQIB 1ZW6A 2FP4A 1U1IA 2VHVA 2PKQP 2HO4A 3PVZA 2O8FA 1HBJA 3LL7A 4R6WA 2GCIA 2W58A 3A4LA 4G81A 3DAYA 1VC2A 2EQ5A 1M2GA 2J8ZA 1ND6A 4KPUB 4EMBA 1T9AA 3GEPA 3HBAA 2ZUFA 4Y18A 4E03A 2FH5B 3TIGA 5JPCA 9MHTA 3ILXA 1GZSA 1US8B 2XGGA 4WEOA 2XCLA 4WK0B 1O9HA 2RIRA 2XUZA 3BHNA 4ZJUA 1U8XX 4JV5B 4M9UA 5KYVA 3RFCA 4L74A 3HKDA 4L1KA 1TO6A 3EHEA 3UOGA 3A2LA 4RIGA 1J8DA 3OD5A 1ZAYA 5J4HA 3EVDA 2XE8A 4ID9A 4AP6A 2CJYA 2HEIA 3P9PA 4ER5A 2HH9A 3AHDA 3G59A 3TNLA 1MG5A 1XUOA 3OZDA 4C5AA 2FV8A 1U0BB 3KL4A 1AKVA 5DNEA 5DLDA 1NVBA 4HNSA 2ZRHA 4NCXA 1E6MA 3VJKA 3WK7A 5AW0A 2ZYIA 3I6YA 4X8HA 1JLMA 1KMIY 1Y6GA 3UMMA 3BERA 1Q0SA 2PZJA 4KSBA 3PE6A 4FHDA 3UJBA 1WG8A 4Z9FA 1DAOA 2W2MA 1XVTA 2YUTA 3CM0A 3IV9A 2PZBA 3FFXA 3AXSA 3QXJA 1P1IA 4KZKA 4QNNA 4QYTA 3KALA 1CUVA 5F52A 2AN9A 3C39A 1N3BA 1W4RA 4B3MB 1N5KA 1R4MA 4L8FA 1DRKA 1FS6A 3QBEA 1PZHA 2IUUA 1P9LA 1R8XA 1KI8A 2HHAA 2Y1CA 3QWHA 2JLYA 4YP5A 3CEHA 3AL2A 1W36D 1YDEA 1WVMA 2IZZA 4H35A 4LCBA 1WUYA 1C4XA 3TZ6A 2G1PA 3GL9A 3P5BA 1NATA 4PIMA 1N0UA 1WP4A 1JA0A 3WYNA 2QN8A 4AMZA 3VNAA 3VQTA 3X1XA 1M5UA 3HP1A 4K6HA 2XVXA 4EUFA 4BV2A 1IAQA 1V9LA 4EG3A 1JYSA 1FNBA 4EUHA 3QIVA 4Y9SA 4AY5A 4E7OA 5FV4A 5JAMA 4N48A 2ENWA 2W2PA 1PTKA 3N87A 1D6NA 4J49A 1OAOA 5CA0F 4C4TA 2RB4A 3E5RA 3WICA 1GLGA 2IW3A 3IMGA 3MMZA 3PR3A 4U3JB 2G88A 2I4RA 1Y8CA 1ZNQO 1RWBA 3EG5A 3R0XA 4QX6A 3TTXA 3V1LA 3H87A 2FF7A 2BTQB 4P22A 2L17A 3EMBA 5IW8A 2CXSA 3TDNA 4DHWA 1Q6YA 3W8FA 3GMTA 3FOAA 1LW6E 3IE0A 3CF6R 3GVHA 4MW9A 3CXRA 3QKRA 4QU0A 4FYJA 5CJJA 2UXCB 5LZ8A 3DBIA 1W87A 2OQVA 3P2YA 1O0BA 1S3GA 1XQ1A 3IAXA 5HRUA 2GPSA 5LC1A 3VPSA 4CTJA 3LD9A 2UVQA 4DZRA 2QQFA 5H4HA 1FFYA 1MB3A 4PW0A 3H5WA 2PZEA 3GPLA 4XA8A 5F9MA 4FE7A 4NMHA 2QX4A 3IMEA 3HM9A 3H1TA 4OUDA 5KYXA 2B1JA 4U2KA 1H8HD 3F6BX 3ZW7A 4AM8A 4E5NA 5DHQA 3UPUA 3DOEA 2HUPA 1EFHA 2JFBA 2N42A 4M8IA 3KQWA 1VPTA 1G2OA 3ISTA 1F1JA 1KQPA 3BZBA 4H0NA 4E88A 5BMOA 1VKOA 3ZZ1A 3I53A 3KG2A 3EISA 4RFLA 3IVMA 3A2NA 4U0JA 3SGLA 1FDUA 2B94A 4F5WA 1PR2A 2ZR9A 2M1ZA 5J4VA 3BIOA 1ZOLA 3LLUA 4HTFB 2P9JA 4LWZA 4Q4CA 1ZRHA 3JQAA 4ZQEA 4EHKA 3HZHA 1DELA 4NBUA 2C58A 2WBLC 1ACJA 1TEXA 4NZMA 4MV3A 5KNDD 1F9AA 2HIHA 1CIPA 1QPBA 2FNAA 3A1EA 4OHUA 3C5WP 1QRUA 4ZYZA 4K2HA 4B40A 1UMDA 2NXNA 1L7MA 1M6HA 1NR5A 1B15A 4JQOA 5F7JA 3RSFA 1Z47A 4INAA 4D42A 5AYVA 4FOTA 1DWQA 5AW2A 1PD0A 3TM5A 4Z7OB 1CE8B 3G0GA 5AKHA 5KKNB 2HRZA 4PEVA 1A50B 4MZDA 3FUCA 3KOYA 2WU1A 4MR9B 2JH8A 1MAAA 1SU4A 4R41A 2XD9A 3RRMA 5I8PA 4JDUA 2CB0A 1OX4B 4LSGA 3TR0A 4BMYA 2VNKA 3KXLA 3E4DA 2EL7A 5CCXA 4K8OA 2TMKA 3IBTA 4I6GA 3SZGA 2CFOA 3E22A 4CI9A 3DOJA 4D92A 5KQPA 1JHMA 5AM3A 1I0ZA 3ZTTA 1L7BA 1WDWB 4BVGA 5KNCA 3ICVA 4RNCA 2YWJA 4OIMA 1GPYA 3C3JA 2W9XA 4BMOB 2X4DA 3C3EA 3R23A 4L8VA 2XXAB 3K9WA 1DG1G 2XRYA 3EDMA 1H0HA 2XLBA 4M83A 3E4CA 4FFNA 1L8XA 1OLSA 3B3QA 3HN6A 4GXQA 2OZPA 2OQIA 1IN5A 1QQ5A 3F9RA 4PFSA 3WHLA 5JS1A 1O97D 2YASA 1FLDA 4CQMA 3ND7A 1BXKA 1R00A 2IKQA 2ZBPA 3RS7A 1ZESA 4GIBA 2V5UA 4Q9NA 1K0FA 1YQDA 1Z2CA 4AJOA 1TU0A 3DF9A 1WZIA 2I9PA 4HQRA 2C9ZA 3PC7A 1WUJS 3CCFA 4ZOLF 1MHPA 2ZIWB 4C7OA 3PCTA 3D8SA 5CJ2A 1XDGA 2NSHA 4Y9RA 2V55B 3E1KA 4P81A 4W5QA 4MDFA 2OOKA 1TVCA 1NF2A 2VK2A 4R8LA 5DM70 3S4YA 1U2TA 2Q3BA 2VYVD 4KAFA 4L76A 4MQFB 2ZUDA 4U7HA 3N2IA 1K8RA 4RPCA 3S2GA 4H1WA 3H9GA 3CE6A 3SVTA 2ZUVA 3WYAA 2DPYA 1Z2EA 4GO1A 2AMLA 4L4UA 1X2EA 4DS3A 5BY2A 4C7JA 4D6YA 1YK0A 2GK4A 3K4PA 1OAKA 3TJZA 2YOHA 5EJ8A 4FW9A 3D6TB 4W1QA 4KFSA 3U1VA 2CUZA 3ZZMA 1X8LA 1SCDA 2J4DA 2E55A 3WIOA 1OPRA 2Z5GA 5A3VA 3T35A 4PO3X 3WGJA 4R1LA 3BBLA 2R85A 4AZ3B 3MLBA 5BPHA 4HRYA 1JXOA 2REBA 5DBOA 1VRWA 4FHEA 3KZ1E 1FPMA 4IO1A 4TTJA 4YCMA 3Q2IA 2BGTA 5E3IA 5HS6A 2AIRA 1M75A 2IYLD 4P7JA 3RJ9A 5CB6A 1R8YA 3J80A 4LNAA 4AK9A 3MGCA 4EZBA 1GU1A 5DM0A 1R6XA 1Q1GA 4XYGA 5D3QA 1GDTA 2ZOSA 4F4IA 3JVEA 4UBOA 3QGMA 1ZSVA 1JR6A 5IVPA 2WJVA 1GPWB 2IOYA 2JJYA 4RZIA 3W9BA 2WMDA 1NQ5A 2WT4A 1XX6A 2NOAA 5GGXA 5L3VA 3I62A 5JZOA 3RAFC 1N5DA 1IPFA 3HKCB 5I51A 3K2BA 2X58A 1XMSA 2QJOA 3H86A 1CJUC 3O73A 4TL6A 5MN6A 1U5CA 1QFMA 1M1ZA 2BAGA 1D2NA 4NU8X 4POAA 4HPJB 1NXOA 1A0OA 4KAJA 5CDFA 4KI0A 4K9LA 5TPZA 2Q28A 1ADCA 1YR8A 3K1ZA 5AKLA 4JU9A 1DO8A 4ITUA 4QOEA 3BWEA 2PMWB 3S29A 3WGIA 3RYCB 2QJWA 3LCUA 3AF1A 3BXEA 4XCXA 4MCAA 4Z8YA 4AY2A 1ETUA 2QSJA 3D1JA 3COWA 3K72B 3LWDA 1AUQA 5LP6A 2FHPA 1P1KA 1NVDA 1EG2A 2IZ0A 4H31A 3UV6A 1CUBA 1G8YA 3GRFA 1P19A 1TK9A 1ZVJA 2JDID 4ZVTA 3RU7A 3L06A 3DBVO 4PAMA 1KAHA 4E51A 5IM4F 1WMDA 1ODJA 3OP1A 4J16A 4NR0A 4D0NA 1WD5A 4JITA 1XA0A 3CH4B 3EZ2A 4PBSA 3RHZA 3W2HA 5D3MB 1JIQA 2W2QA 1QK3A 3CH7A 2ID9A 4XJTA 2IP2A 4Q47A 1Y80A 3DYVA 4FYIA 4TKUA 5I5EA 5BVGB 4IL5A 4K2AA 1LV8A 4JUIA 2ZSJA 2VZ8A 1B1CA 3SZLA 3V4ZA 2G82A 3OWXA 1JDJA 4LE2A 4KR3A 1H69A 3PKZA 4A6EA 2ZDQA 2ZRAA 1W4ZA 3HYCA 1I3NA 3LV8A 3VYTB 3ZXSA 1W4BA 2FFBA 2ZR8A 3ESZA 4KODA 1UDXA 4MI6A 5DYTA 3PHBE 2GD0A 2AFHE 2F00A 3E15A 4KTTE 5GOTA 3B36A 4QL3A 4X63A 4DZTA 5JNWA 1JHYA 4XCVA 1G8SA 1TVKB 4LOHA 4XUDA 2PFSA 4RZXA 3B8HA 3I30X 2FWAA 3EA4A 4RZSA 4MQEB 2CCGA 4E5YA 2AMFA 4BDTA 2BKUA 2AE1A 4CIWA 4QXQA 3Q8LA 1BS1A 2DETA 4F1KA 3B6ZA 2X9GA 2FWPA 4WFQA 3BH6A 3SMVA 1SUFA 1AN0A 1AKWA 3PGJA 4P4SB 1E2IA 1W6UA 2QZ4A 1EFAA 1NV9A 2RGRA 1KVRA 1DFGA 3I92A 1E2PA 3GFTA 3B2EA 3FBWA 3E1GA 2K2WA 5MHTA 3G17A 1LRLA 3M4YA 5LN1A 4F04A 1LNSA 1CJVC 3HLKA 4N40A 1OMOA 3PX2A 1JR3E 1Q7GA 3MBKA 3UK0A 5BN1A 2I91A 1U7HA 3ASVA 3GNSA 3QEMB 1YJ8A 4RDXA 4BMVA 1HLDA 4OSPA 2WP0A 2MOKA 1F48A 2X2EA 3OQJA 1BE0A 1CY8A 2AUNA 2DFNA 3NNSA 3AGPA 3ET4A 3IB6A 4K5QA 3ZDBA 2DKFA 3K0HA 1A5TA 2OCKA 3LZDA 4IQ4A 3DDNA 4NE2A 3OPYA 2FSUA 3N3AC 4MRMB 1C3VA 3K2IA 5ENVA 4ZT4A 3JYOA 1U81A 1MQAA 2PPLA 2NWQA 2PZMA 4BU0A 3IFSA 3WLQA 3GCDA 2OQRA 1ECBA 2X9QA 2AC7A 1AO3A 1Y82A 4HLQB 1C1HA 1FP7A 2D06A 2G0NA 1DKMA 3E81A 1UKCA 3H19A 3I9JA 4WOPA 5BYAA 1C2TA 1S2NA 2EYUA 3ONNA 1Q1EA 4OHOA 1AV6A 4M49A 4HF7A 2WTNA 3AR4A 1LJLA 3VVMA 1TW3A 2VYND 2H6EA 4BQNA 3ZCVA 4YAJA 1PR9A 2N1BA 3W8EA 3VHRA 3CNOA 2QXUA 2WYIA 5KSPA 4CFYA 1KQFA 1V5WA 5IJXA 3B1KA 4LGVA 1JIUA 4LOIA 3RARA 1A9SA 3KFLA 1Q77A 4LRUA 2WKSA 2J85A 3PFWO 4AS3A 3IKTA 1WIWA 2QS9A 2V6FA 2VYVA 2ODPA 4MS4B 4NZZA 4JIMA 4FGUA 2RAFA 1A4RA 3NHRA 1KQ3A 2NW6A 3VR6D 2QUBA 2CUKA 3RVMA 2ODNA 4HH4A 2PXXA 4GOOD 1MQ8B 1N5OX 1C0PA 1PFYA 1U9CA 3QQPA 5F78A 1DC4A 3DEAA 4FGLA 1QC5A 5H02A 3HBJA 1SD5A 4Q18A 3ZR4B 3O95A 1P0CA 1E5LA 4QRDA 4BE9A 2HF7A 3CPEA 5DLEA 5HTOA 1F2UB 3IOMA 3FCUB 1JG4A 3S5UA 1UKYA 4RA6B 1Q3HA 1T6ZA 1LJ8A 1R0XA 4KQCA 4B73A 3KBOA 3P97A 4UHEA 3KJGA 4HWRA 4BNKA 1CQWA 2DT5A 1CDEA 4KIJA 4YRZA 2V96A 3VKWA 4DJAA 2O8DB 3HJAA 4DWOA 4MIEA 5JYDA 1KZ4A 4R9RA 1NRIA 3A1UA 3WFJA 6CHYA 1PWYE 2HPVA 3FFAA 4PPNA 3M4JA 4G1CA 4F5DA 2Z8YA 4KE7A 2Q27A 2G77B 1J2UA 1ZL2A 3VR3D 4N4AA 4BLPA 1ZIPA 1E92A 2JAWA 3PS9A 1QH1A 5EPOA 4K6CA 4MROA 3A6ZA 1SCUB 4ED9A 2DQ4A 5EKUA 4EBFA 3VMFA 4OK6A 1C3EA 3E5HA 1E66A 2PT7A 4KIWA 3DV2A 2JK0A 4PN3A 4TLEA 5LIRA 3STVA 2PV0A 1THMA 3G8CA 1GLNA 3O92A 2ECPA 2I7VA 4GBED 4IQ0A 1RMTA 3T34A 3DCYA 4YPOA 2FPSA 2BEKA 1Z82A 3R0IA 4Q7KA 1T0PA 3B12A 3QUTA 3W2TA 2ZUTA 2Q9BA 3DHWC 3WAGA 2UV8A 1WB9A 5FB3A 4XYBA 3RIEA 2NU7B 4ZT5A 5FTKA 1AQIA 2GR9A 2JFXA 2PYIA 2VJDA 4KKXB 1W8IA 3WZMA 1OW3B 2VAVA 2EIHA 4A82A 4EUNA 3U61B 1RXIA 5GGYA 4C76A 4E7PA 2FSVA 2CK3D 2I4LA 4MLCA 2O9JA 5AW1A 2UVDA 3JRWA 3HHEA 3OY7A 5DW0A 5LB4A 2QPOA 3TLAA 1QOPB 3RSHA 1OXUA 5FWAA 3AOEC 4PQFA 1Z7WA 5DVZA 2JFHA 4P53A 1TC1A 4XR9A 4FMCF 3H5OA 5EZ6B 3KDPA 2JGLA 1PK8A 2VA8A 3PQ3A 4U6QA 4BJ5A 1KNQA 3KZOA 2ES4A 3EIWA 1Q1AA 4GQAA 1P5FA 2OSVA 2YHSA 2ZRBA 3HJRA 1P9RA 1YR6A 3HB7A 1CP2A 3K09A 5SYMA 3EWSA 5U1PA 1UR5A 3ZH2A 3P9NA 3GK3A 5H80A 4KQFA 2O54A 3O4GA 1MJNA 1J9EA 2Q3LA 1J22A 2O2JA 2A9OA 2DBZA 2EX1A 4ZZ0A 1LRJA 4UUPA 3CW2A 1A9XA 1DJOA 1Y1PA 2Y92A 4KUGA 1CZKA 3C41J 2WIBA 4P82A 1S2OA 4PBTA 4CQJA 4DLVA 2FSFA 1QYRA 3K3PA 1PLLA 3GDGA 3NC0C 4WBNA 4YPVA 8ATCA 3R7WB 4QNMA 4XLZA 4KFUA 2QD3A 4DOMA 2P79A 3GU3A 4NP6A 2J6CA 2CVFA 3TSOA 3V8NA 3T3NA 2IH2A 4ZZ1A 1PJ2A 3LUAA 4E46A 1EZ4A 1JHXA 4C22A 2WQ6A 3I61A 3QHQA 3UMJA 5MGNA 1ILEA 3I09A 3NM6B 4ERNA 2XDWA 4ML3A 5KC8A 3M8KA 2R6HA 2ZYRA 1JGTA 1NW7A 1T8YA 3PNYA 1KYVA 4IS2A 3PR1A 1XWIA 2C4UA 2ETXA 3V4PB 1VXOA 2ZU0C 4FSHA 2IYTA 4MV8A 1QIKA 5B3JA 1HE3A 1K66A 3DH0A 3K6JA 1GGMA 3AHIA 1M9NA 3M2TA 4ALKA 5ALJA 4BQQA 4CEJB 2GN1A 3K70C 4ZAZA 3SEZA 2A88A 2YY7A 2HNAA 3L84A 4N0MA 3X0DA 1WXXA 2BM9A 2DBVO 1XJQA 5ALHA 4LCJA 1FZQA 2C7PA 3DD1A 3SS9X 5A4FS 5SZKB 3NTXA 4UOEA 3B20A 2VCYA 1TT5B 4BASA 1J25A 5KYUB 2P4EA 3LK7A 4Q4JA 2JKYA 4UXJA 3VTZA 1HA3A 2C5LA 4LKOA 5SZIA 2C2ZA 3I5UA 1V1RA 2W2VA 4CVNA 2D2XA 3VZPA 2JAPA 3GZNA 1WOMA 3PHCA 3M5PA 1MD9A 5SZJA 4B84A 4D97A 5C8XA 4BNDA 3DZJA 3FPHA 2VJMA 3BCUA 3TD9A 2VYNA 4V0LA 3RSQA 2YV2A 3TRHA 1AGYA 5H83A 2WF5A 1V95A 1ULZA 1FDRA 5BWBA 3K8QA 1JFVA 3WWZA 2WICA 5K0NA 4CUJA 4IO0A 3PFBA 5I7SA 1RKUA 3FMVA 1QVRA 3CB2A 3IIEA 4UD2A 1I4TD 4HCJA 5L4LA 3WQSB 2HNBA 2EAUA 1MW9X 1W0KA 5AD1A 1GPH1 1I1OA 1QF9A 4BNMA 2NLOA 2RGYA 4JSYA 3DL2A 4FEYA 1UJBA 4D7AA 4Z2YA 1TJYA 4X93A 1DQZA 4D56A 2P35A 1H5UA 2WOOA 1QQAA 1FNMA 1WUHS 1U0LA 1X80B 1PJ3A 4F3NA 4H9GA 2P2NA 1JLLA 2GYWA 3ZXXA 1EEHA 3LKZA 2OXFA 2AOTA 4U7GA 4F21A 5CDUA 2B0CA 2ZTLA 4NMMA 4PLHA 5IBPA 3RUEA 4EFNA 2DPMA 5JTTA 5MN4A 2FEPA 3AUSA 5GJCA 2GPTA 2D0IA 2O6HA 4OYYA 4OA5A 1E3DA 1QFZA 4UEKA 2X23A 3H1FA 1HZZC 5BUQA 2WUFA 2BGLA 3ECAA 4LF7B 1K27A 3M3PA 1N6PA 1IDN1 1M8FA 4NZPA 1WUKS 3PLAE 2VJBA 1EMDA 2LVBA 2WVGA 3TDMA 2P3QA 1SG9A 3KAPA 4J1NA 5DOZA 1EVZA 1Z37A 2KI5A 1YCFA 3IC5A 1I0IA 3MCAA 4Q37A 4BGVA 1HPLA 2IYXA 1SVUA 2Q3CA 1A69A 3WMFA 2E48A 1T4CA 4KRXA 3IESA 5DLQC 4ZTZB 4OQFA 5L7YA 4G1EB 2PGDA 4WCFC 3THRA 4UNPA 1I94B 3Q8MA 3L0BA 4CNQA 4RTPA 1T1RA 3I73A 3ETHA 3LK6A 3KJNA 3THWB 4KKVA 5EESA 3S1LA 5TF4A 1XCJA 5JJCA 2OBXA 2V6BA 1MB0A 1H1TA 2CVZA 2Z9CA 1AKRA 3C7AA 3ESYA 1RCTE 4BQIA 1U2GA 3AERA 2PZFA 1L5YA 2ODTX 3MWGA 2E1RA 4A10A 1YIOA 4X92A 3DMYA 4ETNA 1UT5A 3OKPA 3Q3VA 3DTNA 3K6RA 3KSRA 5I9SA 3F6EX 4M0CA 1EZ1A 4P4NA 1V39A 1V8PA 1DIGA 1OFUX 2R4UA 3VDMA 1II8B 1ODSA 5TT1A 1QQ7A 1EA7A 2JFYA 1I1NA 4ND7A 1T0BA 1CU1A 1XRJA 5T57A 1OT3A 2IK8A 1RWKA 4MWZA 1Z4KA 1JU9A 2EJTA 2A0KA 1VL5A 1Y5MA 3DO8A 5IBCA 1EFVA 4EATA 1CR6A 5IT5A 4DRXA 3FPAA 1VSTA 3BJRA 1KZHA 5KCMA 5IHPA 4NCAA 3IBYA 2CUTA 3PEVA 3AU8A 2HHLA 4DG8A 1WSAA 2R6CA 3ZQ4A 3VAZA 3OZ7A 3FR8A 1IZYA 3BVPA 3RSLA 4HL6A 1H2WA 4EI2A 4MA5A 4Q1CA 3QBVA 5CPBA 2JHFA 1IL0A 1ZXBA 2E49A 3AR8A 4GMXA 4IV5A 4Y6RA 3GQBA 3U60B 1O6FA 2ZDHA 3CMCO 4MDEA 1K3FA 3CLUC 4AECA 1OJ7A 4XGKA 3FROA 1M5TA 5JHHB 1O5IA 1RBZA 5KPJA 2IL1A 1IMOA 3UVEA 3F5SA 3EQ9A 4LBYA 4N5MA 2V1XA 3S8EA 3D7LA 3LC7O 4AYXA 4P4TA 2R00C 3L6BA 1GG5A 1PAUA 5DNDA 3TDKA 3F0TA 3ZCTA 1QYDA 4HNRA 3IAAA 5B1YA 5B7PA 1E0DA 3D6MA 1SHKA 1KEEB 4A2WA 3A2MA 3LTNC 4QEKA 5EIFA 1J33A 1BS2A 1K6IA 3L1IA 2GX6A 2FSPA 1ZCJA 1SUSA 2XMZA 4JP1A 5EWLA 5ER6A 3LUBA 3QTBA 3UICA 3OQBA 2YZNA 4PO8A 2X13A 3X1JA 4DDWA 5J23A 1HX7A 2CLMB 2REXB 3KQYA 1TU3A 1NBWB 1IJBA 3TK1A 3B5IA 3C6BA 4ZDIA 4AS1A 4N7RA 3S99A 4C4XA 3G3EA 1CYDA 4BMPB 3BFPA 1RWPA 1Z6YA 3H8VA 1WNTA 2ONJA 1GQYA 2RJ3A 1BNCA 5HFJA 2HA0A 5JZSA 5JYBA 3D54D 1GGHA 4O3FA 1ATIA 1CUIA 4KGXA 3CRW1 4EY7A 1E6EA 2UKDA 1CS0B 3C97A 4EMTA 1N2ZA 3I01A 1QB7A 3BA1A 3OFNA 1GZ6A 4IHKA 5B58T 3TTSA 3GLGB 1ZHHA 5L3QB 4L5AA 3ZUGA 4DCSA 1G8GA 4I50A 1OJLA 3AEKA 1S8FA 1P5HA 5D1NA 5K05A 3ZS9A 1IHOA 5IAKA 3W9YA 3P0RA 4HWKA 5FNZA 4N8DA 1ISFA 2FSGA 1ZGGA 5D5HA 4DUPA 5ISMA 5CFOA 3UG7A 1V35A 4JI8B 3FR7A 2CXPA 3PYLA 4EGQA 1N3LA 1UMCA 2X14A 4YFYA 1ULSA 1X42A 3LKDA 4TS1A 1D2CA 1GKKA 5EGNA 3UHJA 4P8RA 1VGRA 3GUVA 4AQYB 3HVRA 5LXTB 3U4MA 4W5WA 1POWA 3QEKA 3RV4A 2AUTA 4BAUA 2PO5A 2XB6A 2QNIA 1JDTA 4TS9A 3L8YA 3OTGA 3ABQB 3NTQA 2OBMA 2GO7A 2XNKA 3B5EA 1NZFA 4Q3BA 4QJ4A 2GHQA 2UUAB 4TMYA 1SJ9A 2AEJA 4TQAA 2XUGA 2YVKA 4HP8A 3SHOA 1ZXLA 3KQQA 1I7QB 2XRMA 4NJMA 4QOGA 2XYPA 3AUYA 5CUQA 1QRRA 4X6LA 4YRPA 4Z0PA 1LK7A 1Y4UA 5A7FA 4IIUA 1VE7A 4TTVA 1B41A 2CDAA 2F3UA 3SQNA 2IODA 1VM6A 3AM5A 4UAGA 5J5VA 1WBJB 2ZJ7A 4IUBS 3P9KA 2D1QA 3TBFA 3AVVA 3X44A 2JATA 1S5PA 1SUDA 1ARZA 4NH0A 3UAOA 2Q2VA 4XLLA 4ID3A 2UYHA 4CMJA 3OT5A 1Q1QA 3LXUX 1S1CA 1G3QA 1H4SA 4CKCA 2QRNA 4P7FA 3SP1A 3E3OA 3DCIA 3R77A 5JXHA 3H6GA 4PGAA 4F4UA 1PL8A 3CUSA 3EC1A 2I6TA 5EINA 3TUZC 1S4QA 3DOOA 1CXZA 1GEGA 1WZNA 5B4UA 2GXQA 5HJ5A 5HS4A 1ZWKA 1YKFA 2Z3WA 1XFAA 5L7TA 2Y9MB 4BB0A 2JCBA 5I7WA 1FYXA 1YQUA 3A1CA 1NTOA 3CZ5A 3O9MA 1ZH8A 2VLIA 5DNYB 1WABA 1U2GC 1PEDA 3DEJA 4EG4A 1ZBQA 5IKPA 1YHZA 2R62A 1T2NA 3IAHA 5JD3A 2JLUA 2II6A 4L9RA 2WHXA 1YB5A 1GNTA 5JY6A 4ECEA 5AJWA 5B1SA 2O3JA 2ZQ5A 4XFJA 2DUUA 3R7BA 3LOUA 4PLYA 3BE4A 1O96A 1FNSA 3L7NA 1UK7A 5CNKA 4B31A 1PL0A 4J1TC 2PKCA 4ZVMA 2AI1A 4JGBA 4RLSA 3SM9A 1C8BA 1OGYA 2D1TA 2H1RA 3KTFA 3QLUA 2NUAB 5CT8A 2PK3A 2Q6OA 1PS0A 2QVCA 1P3Y1 2K7ZA 5ARBA 4AKHA 4N54A 4JFAA 3W5VA 5C80A 1SAYA 1T1GA 5CA1A 2I8CA 2M6KA 3U13A 5E6SA 4TXHA 1BYUA 5KQSA 4MJLA 3LUDA 1ADJA 4OEHA 5JU6A 3VA7A 2ZUCA 4NSNA 3TGLA 1Y1SA 3OH8A 4LYEA 2KJQA 4ZXFA 3W6ZA 4A36A 3QNUA 5A03A 3RADC 4FR5A 4QUDA 3WJ7A 3K6KA 4XW2A 3RSGA 1BJTA 3B1ZA 4C4AA 1P6QA 4FZVA 4JJAA 4OHPA 1P77A 1II9A 2Q3EA 3SXJA 1EVLA 1XCOA 1E7SA 3Q3IA 3TXXA 2FN4A 3PNMA 1THTA 3W3AH 3KDSE 4KGVA 1VRCA 4TOIA 4IY1A 4CTNA 5FWXA 3W5DA 3JQ8A 2OAP1 1RKXA 3K5HA 1IOLA 3IRUA 4AJ1A 1YQXA 1P80A 3BORA 8GPBA 2CKDA 1T3TA 2QMHA 4O8CA 4B6EA 5BSVA 4B3GA 3L7DA 2IP1A 1NX6A 1N0WA 1YOVA 5LQJA 1N1GA 3GGPA 4IICA 2Y99A 2UYCA 1A3CA 4HDRB 1MF7A 3T3HA 2H9YA 4RGBA 3PKIA 2OY0A 1JHPA 4RLQA 4D96A 4YMHA 2IITA 5BUSA 2PM8A 3DYBA 2C5AA 1YIDA 4DPMA 1RQXA 1TVMA 1XDWA 3ENQA 1V8OA 4V0QA 5EZYF 4RPIA 1PJRA 4UW9A 5ECDA 2EJCA 3IUJA 1PNRA 2DG2A 2UAGA 5G02A 4PC3A 2QTNA 3WJ1A 5A6VA 1WZCA 2Q5OA 3AB7A 2JIPA 3NRJA 1OU0A 2HSGA 3BWYA 1I5RA 3EXEB 2SCUB 4OQZA 3R3ZA 2C3YA 2X6TA 5DEIA 3RM3A 3D3QA 4O29A 1KVQA 5FBVB 2R2GA 5I4CA 5FF9A 1C3OB 3JRNA 3L7OA 4H1HA 1XYVA 4IDNA 3CLKA 5AW8A 5JUWA 1G63A 3DE6X 1SC9A 3EF0A 1A9RA 3WLTA 4U7JA 1W5EA 5DT9A 2AT1A 3K1AB 1HDIA 2F64A 5EFZA 4CMAA 1VL0A 4YDQA 4GC9A 4PY2A 1BHO1 2I99A 3KEOA 4LTDA 1G2PA 1B0PA 3D8BA 2B2CA 2ZW9A 3CH5A 4KVZA 2CJWB 3KB1A 1CZHA 4U02A 2JBAA 2XB8A 3FWHA 4MR7A 2GGSA 2PL5A 1OT5A 4R8SA 1YDWA 2V3CC 1XVLA 1JR3D 2H1FA 4P93A 4CJXA 3JAMA 3FGPA 3T9EA 1ISPA 5BYBA 2BR5A 5GZ1A 4II7A 4NHOA 5DISB 2CD7A 1E6UA 1IJFA 1XJCA 2JD1A 3D8RA 3LDUA 3KTAA 2WJZB 4BAGA 2AN1A 4ERXA 3PZRA 2VDNB 5J2UF 2F90A 4NQZA 2HQOA 4PYIA 3MD0A 1TM4E 5A4MS 2ORED 4AF6A 1QYIA 4GUAA 1HRKA 4R7GA 4N7BA 3FPEA 3EVTA 1A2OA 3RRYA 3UAZA 2AOWA 2DUWA 1YBAA 4NJEA 3N53A 3COZA 5JFGA 1LPMA 1TUEA 3E70C 3R9XA 5TGZA 2HXYA 2QYTA 4PHHA 4X20A 5K0ZA 5EJFA 1C30B 3HCEA 2BFWA 3GRCA 4FK8A 4QATA 2ZQYA 5CGQB 3WBBA 4DT1A 3OUUA 3C5CA 3N07A 4KLRA 4YN3A 4FQ8A 4KQ6A 4YRIA 1KR2A 4KQJA 5DK6A 4G1UC 5A0FA 2DMRA 1ESZA 4NBRA 1JG3A 5CVCA 1P75A 1WQ1R 2R1UA 3CINA 1DC5A 1JIXA 1UL1X 2QZJA 3ZV6A 1YDHA 3HY4A 1G5HA 5AK6A 1I2CA 4RY0A 1I80A 3RT7A 1N6HA 3FPFA 1UBLS 5E7QA 4C0LA 1NNEA 3SIPA 3TIVA 4FFBB 1Y1RA 3A4YA 2EKZA 4E6PA 2GXUA 4C4RA 2EGUA 3BGSA 2VF7A 3OOJA 3PPYA 4OLJA 1RZRD 3N8DA 2XCTB 4AI6A 2V7QD 4L0MA 1B6GA 3P7MA 1XEAA 2BCGY 3FCEA 1PVDA 2Q1TA 2QTMA 2CMKA 3G8BA 3B38A 4K3UA 1W88B 3H8SA 5ALPA 1IN7A 5D85A 3ROEA 4QECA 1DUIA 3E61A 2F7SA 1MJGM 1SQSA 3SG0A 1WU7A 2X4IA 3O9ZA 2JD2A 2NO5A 1Q92A 2BDTA 1H2HA 3P32A 4G0ZA 1KP9A 1GTZA 4RDIA 8ADHA 4QOHA 4WKOA 1X7ZA 5GJBA 2H31A 3NHMA 3RTEA 2NUPB 2HDWA 4JL5A 1NN3A 1JFSA 4LDNA 4ZYWA 1JSLA 3GLKA 4OHRA 4BP3A 1Q7CA 2CL0X 3JQGB 3MWDA 4TKZA 1DC7A 1QVAA 5EAIA 2A35A 2OECA 1RKQA 3I0MA 4V1CI 1YRQA 5DU2A 3C7DB 1F8YA 3BXFA 5G4KB 1IPEA 3FHJA 1AN9A 4G1VA 3R3SA 4D9JA 4D99A 3LLVA 3E7DA 2C00A 3GLIE 4U2CA 2A8YA 4R2HA 4BATA 3W05A 4HSGA 4TUYA 4JX9A 2WPDD 4RXTA 1ZRMA 2PX3A 4RHTA 5KTRA 3ANLA 4E07A 2WM8A 5TQ0B 4QTUB 3GJRA 4A91A 1MVLA 1SQ0A 2MMCA 1X7WA 3U6KA 2WG0A 2O1EA 3AP2A 4ZEOA 5JSFA 5KJ1A 3HMQA 2GT1A 1TAUA 2JIMA 3W5SA 5A62A 3N7AA 5IT0A 2IY7A 2H1IA 1FE8A 1M6VA 3G2OA 1ZFNA 2ZB2A 1CY0A 1TJ4A 1VI6A 1H05A 4CU5A 3H3JA 3MUEA 1SD1A 4YAEA 1ZN9A 4O08A 3T95A 2PWBA 4IX9A 3LI2A 3K9HA 4A8JB 5AW4A 3P0IA 1JDPA 3IAFA 3M83A 1UZUA 2Z2XA 1W34A 3W1WA 1FX1A 3ZIAD 4BO3A 3ZHVA 1OY1A 1V2GA 5CDYA 1XN4A 1NNLA 1V71A 1GV0A 2IEDA 3EXHA 4WEQA 5FO0A 3WK5A 3PGKA 4LDRA 2XNDD 4YJ2B 2B1QA 1NBMA 5KTPA 3K73O 5JJ5A 4I81A 5IDXA 3ND8A 3NIWA 4X1YB 1U3GA 3A3OA 3B6JA 3QW4B 1ZWLA 3O2SB 4IGIA 5TQ2B 3MT8A 2CLSA 5G1OA 2VT7A 3I6ZA 2AFHA 1G8HA 4JLUA 3UC9A 2QU8A 1NDQA 2ODWA 3WLRA 2DR2A 3KQUA 2QW8A 3EDOA 4AS2A 4UFPA 2JAQA 4GSLA 5EVCA 1ZUD1 1RE1A 3G13A 4XB1A 3AIMA 4TZTA 1WF6A 3F78A 1KI3A 5JNRA 4IIHA 1F9EA 1NONA 3HUEA 4MPJA 3VVLA 1K7SN 3AY6A 5HQ3B 1SHLA 1XJ5A 1ISHA 1EP9A 4FPXA 1TTTA 2XQJA 1XLTA 3GELA 3DXYA 4HEHA 1SIOA 3WFIA 2C7QA 1DPFA 2IX9A 2FEKA 3DLHA 2HIGA 2XWPA 2Z5VA 2QUIA 3QX9A 1Y7HA 4JXJA 4EF5A 3QKUA 1YDFA 3BEDA 3QE9Y 2FKAA 4RKFA 3L41A 1PG5A 1Z5NA 3S8MA 1JKJB 2JK1A 2YYZA 3AONB 4KPUA 1WSWA 2VHQA 1CF9A 4MKXA 1IXRC 4GYJA 1JIVA 1MC1A 2AF3C 3AHCA 4F4JA 2X5KO 1ZRNA 4IXDA 4Q4LA 1AUPA 3TPZA 5H9WA 5EHIA 2ZIXA 2ZRLA 3E9CA 4HBZA 3GA0A 1RI3A 5K6AC 4ZAWA 2C4MA 2NU9A 3HZZA 3TX6A 4QGSA 1BS9A 3PGXA 3T1HB 3QOYA 1JSZA 4I55F 1QWSA 4DUGA 3O0TA 1TK2A 4YP6A 3BGOS 5CEEA 3V6LA 1Q83A 2JGMA 4XD7A 3VVBA 1ORDA 3LRPA 4Q0MA 4XR4A 1L7EA 5AKZA 5J2UB 2FFHA 3FYDA 1XVUA 2BBOA 1B43A 3F2IA 4UXHA 2WABA 3G2HA 3UAYA 3QVGA 4A3SA 4DEVA 2BKAA 4XSVA 4BNGA 4DLKA 1UPBA 3MTDA 3IMKA 4BWVA 5KNBD 3QFRA 1EIWA 4F91B 2VQEB 3RC9A 4C4OA 1UEJA 1GOTA 5KOJA 1M2VA 4HDNB 2EOAA 3DXFA 3GT3A 4R2KA 2ZAYA 4WPGA 1K5GA 2ZANA 4US0R 2HSWA 4UHCA 2IY9A 1BROA 2C7OA 4Q1AA 4RYDA 3I2HA 2G8NA 5FBQB 2HRCA 4MYTA 1R64A 2BFEA 1FUUA 1H8EA 1BDBA 2PXCA 1U7ZA 3CN7A 3E6AA 5T4BA 2LKCA 3CUTA 3EGDA 3PFNA 4JOCA 4PONA 3CQ9A 3SCZA 3ZCXA 1Z26A 4FI3C 4N49A 4TRJA 1WTAA 4MJ3A 3RFTA 5DB4A 1WS6A 2WK1A 1KYXA 2WJPA 4KPGA 4RA9A 5DWDA 4OFBA 5EQDA 3UATA 4A5SA 4BB6A 1XZDA 3A11A 3ETGA 4MAAA 5DNAA 3O2QB 3ZGXA 4A0RA 1D09A 4IVQA 4G07A 3UT6A 3TAXA 5JS8A 4PN7A 1U11A 1KXZA 2A5DA 4HAWA 2VDPB 1I1HA 3PIDA 3ZLTA 3ORFA 4TLCA 3EQZA 2H4JA 4PLCA 5BQOA 3IS3A 4RL4A 3YASA 3AKDA 1M7BA 2V7QA 3OPNA 1S3FA 3EEOA 5DCLA 1UBTS 3WYDA 2JCSA 1DUSA 1RM5A 2B4QA 2V7VA 3K9GA 4DC0A 4C7MA 1L5FA 5HIAA 4OY3A 1UAAA 1GAXA 3DAOA 5BYJA 4BFLA 6LDHA 2DECA 2YFHA 2B2XA 5LLSA 5I7OA 2ATCA 3VYWA 4UEJA 3KLOA 2WUWE 1ZM3A 4RJTA 1SEVA 1QHFA 3ELUA 4YCCA 1VKZA 3H9EO 5NLLA 2BFDA 2NAFA 1Z13A 5ALSA 3GGDA 4LZWA 3CGWA 3IX7A 3S0JA 3HJFA 3S1SA 2IHVA 4P80A 1Q12A 1R74A 2E9SA 4I9HA 5BN4B 4EEKA 4WOBA 2YQ5A 5FAXA 1XXHE 1H65A 1RJFA 1E2JA 3JAKA 3PPXA 4ND2A 1SOVA 1XK6A 1K6JA 5TC4A 5LQDA 2FMXA 2CGEA 2WFLB 4MWBA 3KPVA 1MC4A 2KM1A 1HSOA 2W6PA 1CRZA 1M1YE 1P6XA 4JI3B 1CUSA 3QOWA 4I5DA 1E0SA 1NUHA 1YNSA 4MMYB 3C98A 3KJHA 5K3AA 3V9PA 3AJRA 1Z2NX 2VRCD 2YMLA 5CM2Z 5DJ5A 3LZCA 5AI0A 4BC0A 2R8OA 1UF9A 1E5XA 3L7AA 1JSRA 1V16A 5LMCA 3EXHC 1OI4A 2CSUA 4M37A 2JJMA 1O89A 1UBNA 1OE0A 1OSNA 5AVQA 4TWIA 1V8DA 4C7BA 3T3PB 2XAAA 5F3DA 3IKJA 3U7HB 4HDKB 3DVQX 5CB0A 4WDQA 4ESVA 3TZBA 1RBMA 1ENZA 3FDXA 3GRZA 4DAEA 1E4YA 4I1IA 3TW0A 1JQKA 1HEYA 3C2QA 3IEUA 1F20A 4JLVA 3SDSA 3UF0A 4D6PA 3HO1A 1ZC3A 4CI0B 3AHHA 3U3OA 1KFEB 2C5GA 2YWCA 5TF0A 1QU2A 4BNUA 5ANRB 5E95A 5IC5A 3ZQJA 2OM2A 1F06A 1ZQ1A 1MABA 1JTVA 3EEQA 3U3MA 4CKZA 1MO5A 3ZWDA 4C0AC 4U00A 2FX5A 4RIIA 1J1ZA 4MR9A 1V6AA 2OO5A 1YRHA 2A2ZA 2EKBA 3O31A 4PPFA 2OCLA 1XHFA 3RUPA 4YLYA 4LF9B 3NEYA 1OQAA 5H16A 2LV8A 4UQOA 2X3YA 1XL1A 3SAJA 3UCEA 4DBVO