4KXLA

Crystal structure of dnph1 (rcl) with 6-cyclopentyl-amp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
144
structure length
135
Chain Sequence
b'RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVAEAAGGDQFIHEQNLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
publication title N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 53
structure length 135
sequence length 144
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kxlA00
1F8XA 3UQZA 4JEMA 1RCUA 1KZHA 1T35A 4MCJA 4WL0A 4KXNA 3O8LA 3U39A 4I4IA 3PFKA 2F62A 3O8OB 4LJKA 2A0KA 3EHDA 4NPAA 1ZXXA 1WEKA 1S2LA 3F5MA 4A3SA 3O8OA 2F2TA 2F64A 5AJUA 4I36A 4JENA 4HX9A 3IMKA 1S3FA 3HNOA 3SBXA 2Q4OA 5ITSA 3GH1A 2IZ5A 3MAJA 4JELA 3OPYB 3QUAA 2A33A 2NX2A 1WEHA 6PFKA 4KXLA 4I7EA 4U1RA 4OHRA 4PFKA 1MTOA 1S2IA 1F8YA 2KHZA 4FYHA 4P5EA 1PFKA 2PFKA 2Q4DA 2IZ6A 4P5DA 2KLHA 4KXMA 4RH3A 2F67A 2IZ7A 3K2QA 4OHBA 4MEJA 2F48A 2HIGA 4LJRA 4FYIA 4FYKA 2PMBA 3OPYA 3O8NA 3BQ9A 4LJLA 5AJTA 1S2GA 1S2DA 1YDHA
chains in the Genus database with same CATH superfamily
4HS9A 2PUDA 3L01A 4A4DA 1U9CA 1NFFA 3S2EA 1QRTA 4TVSA 1YVPA 1ZA1A 2IW1A 3R8XA 3QVOA 5DBFA 2H1RA 2FW9A 2P78A 1N2EA 1Z3IX 2IXFA 2GEFA 2CSXA 2I78A 4MP3A 4RA9A 4YYZA 1T3GA 3KAPA 2EEPA 2A3RA 3LZDA 2QPOA 1KKUA 1O1YA 4P32A 1TQ4A 2PWBA 2XDWA 4WEQA 1BXRA 2AT1A 2HA6A 3IEXA 4HYTA 3RVSA 3C5CA 2GQ0A 4FJ2A 3KOUA 3P2KA 3V4FA 3PXEA 4QPZA 1AHPA 2R6HA 3GLFA 3HO6A 1S1MA 3U3ZA 2PSFA 1O4VA 1J0XO 2QEQA 2QTCA 1QNLA 4ARIA 2PUJA 1NF2A 1EFPB 1KFKB 1WD5A 1I2ZA 1TF7A 1CHDA 4II3A 5J23A 1G7SA 4AF7A 1NBMA 3OEED 4BDSA 4GP9A 4NNOA 5L45A 1GL6A 4X71A 3RBAA 1SN7A 3R0JA 1E2GA 1D7AA 3HU2A 2OP0A 2OYRA 3ODGA 4RMGA 2ZB2A 4MW4A 1U5CA 3REFA 2HNAA 4DLXA 2ZJFA 1C1HA 1OXXK 3VYSB 2VYCA 2BWJA 1OXTA 3PICA 4LVCA 5FP0A 2IYEA 2CF6A 1TUBA 4RGBA 2G36A 2FW6A 2WDZA 3FTDA 4FFWA 4BUJA 4XLZA 4W5HA 1EP1B 2HIAA 3GJQA 3N07A 1IRXA 5D3ZA 5A3SA 2H1WA 3PC6A 4IAOA 1XI2A 2PX2A 3FB1A 2SICE 1NXSA 3MQ4A 2O0JA 3ZH2A 5U9CA 6GPBA 2R1TB 4CLRB 3K4PA 4Q0MA 5A9SA 1YI0A 2FR0A 2KMLA 2W6JA 3IQFA 4F6RA 3QPDA 2Z3WA 4IQFA 3Q1KA 4YDQA 1GPAA 4PN3A 5EJ8A 3RWBA 4YP5A 1UAGA 4DRZA 3RS7A 3O8BA 1WKVA 1S5PA 1V43A 4FINA 2WINI 4I4TA 1RLMA 2Z2IA 4F3CA 2NYAA 2Q21A 5I8ZA 2BOVA 3QNWA 3GFRA 4EG1A 4IOKA 3TFOA 2A4MA 2C84A 2OHXA 1Y63A 2YIMA 1NYQA 2P62A 4QTTB 2J3KA 4TPKA 1BSVA 5K0GA 1J33A 1Z5UA 4RTLA 3S27A 3N5CA 1NW3A 3IR6A 1ZZEA 3K0FB 3ZIUA 1JP7A 1JT2A 2BTQB 3I01M 5F35A 3N74A 3WGLA 4D4KA 1JG1A 2P5UA 4G0XA 5HUQA 2OENG 1K8YB 5KOYA 1GAEO 3E5HA 4XDGA 3ERCA 1LDYA 4FZJA 4AJ4A 4GUAA 4XIIA 2WIBA 1RPZA 3P32A 4TSFA 5E2IA 2V54A 2GJ8A 4A5OA 4LISA 1BQ4A 1LS1A 1J20A 1PL7A 3A7EA 4LF8B 4V38A 4O8ZA 5TQVA 1K8QA 1MQAA 3KYCB 2XADA 3F3KA 1O5TA 3C5VA 3OE7A 4NCXA 1TW3A 3WMWA 4OIFA 1C1DB 4Q18A 3T1TA 3O38A 2AR9A 3HVKA 5J2UA 1O89A 4HGPA 4X1KB 2ZJBA 2I80A 3ENKA 3FH0A 4MDYA 2QA5A 2RKWA 4OOEA 3F7NA 3SX0A 5B7PA 4CIYA 4O2AB 1XVUA 3GLHA 4RD1A 4YUWA 4CQJA 1WW2A 3ED5A 3RQSA 2CNOA 2VC2B 1C9JA 2NZVG 3FBGA 3VU8A 1G17A 2FX2A 2ZBGA 1EWRA 1TYDE 2DEUA 4NQZA 2HNKA 1NJ1A 3WMEA 1QFSA 3RVRA 1WP4A 4Z4FA 3CNOA 3K2BA 5JBIA 2WSSD 1E3QA 3N8NA 4FYXA 2I3ZA 3QBEA 4ZAGA 1MP0A 5IDYA 4BL5A 3A3YA 2X9QA 4MW5A 4KXNA 2O3TA 3IT3A 3QIAA 2MR5A 4G4JA 4WJKB 4WN9B 3ABRB 4M22A 3MSCA 2XODA 1QK4A 1GNRA 1Y3FE 3WNQA 3T5DA 2XE7A 4EY5A 2WE8A 4ODIA 1TADA 4QL3A 4BO0A 3Q15C 5L51A 1C81A 3MB5A 5B1EA 3F9IA 4XQ0A 2A0KA 1ZM3A 5G0WA 4OLAA 2OMKA 4FFVA 1I7NA 2HB6A 2XGMA 1YVEI 4KK3A 3C87A 3SPXA 1TA0A 3PENA 2AL7A 3VOSA 4G5QA 4KO8A 3PE6A 5DTJA 3O3OB 1T2FA 1JDTA 5C46F 4ZOBA 1ZQ9A 4N3CA 3GJ8A 2UUCB 1K0FA 3PEVA 1GPUA 4FHFA 3REQA 2QPAA 4M9ZA 4K3UA 1MORA 5LNK6 2C8LA 4FR5A 2AFHB 2J09A 3PZBA 3CF2A 3LHKA 1T8RA 2Q1TA 4PINA 4QC2A 4TRJA 3B6IA 4JJ4A 5CLGA 4FGZA 3R7WB 3SC3A 4CPDA 2HJRA 4CWAA 5CDHA 2PKQP 5HIAA 3M3HA 3RT1A 2PBFA 4I19A 2O54A 3HUDA 1LVGA 3G2QA 4IDFA 1AV7A 3PGLA 4CI9A 5A62A 3WIDA 5JQGB 4QM7A 3JQ9A 4MH0R 4KBGA 4KQJA 1CUJA 5TMDA 5H3HA 2D1YA 4PLZA 4EQ6B 1OC2A 2IX9A 1QGYA 2HHJA 2ZTUA 2NUAA 1QDUA 2FVXA 2PSHA 2WF6A 4LVNA 3RFVA 4AMYA 3A1CA 4MXDA 5G4KA 3ZYZA 3DL0A 3OFNA 1UT5A 2RI1A 5JARA 1S2IA 4Q82A 4Q4HB 1HLDA 4R8RA 1WXEA 4BQFA 4JZYA 3ZWPA 4FOLA 5EJ2A 3HZZA 5AW1A 1PG0A 3KIPA 1L8OA 3AUKA 1O6ZA 5EXEA 2ON6A 3CGWA 3R3XA 3RI3A 5A5DA 1QAQA 3D6UA 2VHQA 3EZ9A 1N1GA 3JPWA 3E0QA 3OCVA 1FTSA 3PHCA 4N49A 1GQFA 1J99A 3CNEA 2IGBA 2B34A 3CEJA 2FN9A 5AM0A 2VTDA 2C2WA 3QPCA 4Q1BA 2ZYSA 4I5EA 2BONA 3WIUA 4CGYA 1Q83A 2YWRA 2UU9B 4H1WA 3SDBA 1HY3A 2JLQA 4BZWA 5KWEA 1Z15A 2FPGB 2ZJZA 1K06A 4MEJA 3STYA 3KJZA 4WX2B 4EABA 3LLVA 4M8SA 2CMHA 4EG8A 4O08A 3K2IA 3JQBA 3DM5A 3IC5A 1I3LA 3P45A 4H6WA 3K30A 4TL8A 4R2KA 5AI5A 2YN2A 5HA5A 3RS5A 3WWCA 5IT9A 1E9FA 3CLUC 1XZKA 2GK3A 2GN1A 3G7SA 4Q3EA 1NRXA 1A72A 1RBQA 4BNHA 3AUAA 2E4UA 4W1SA 2PUHA 4C76A 1LPBB 1K6XA 3ZNPA 2AJ8A 1AX9A 2CK3D 5FOTA 2IHVA 1BDJA 2B6HA 4MROA 3RAJA 5ERGB 3NONA 1M8GA 5AXAA 4ZVOA 2CEAA 1MHPA 1VGQA 4PCAA 4UNNA 2HO4A 2I6XA 4EATA 2I65A 3AL3A 4JLJA 2NLOA 4DKXA 1Q16A 3H1FA 1CUGA 3E2IA 1RSZA 4FHGA 4TQGA 5CB4A 5B3JC 3OX2A 5DO9A 3RSQA 1E3WA 1D4OA 1ZRMA 5EMJA 2P4QA 5IXJA 1FFEA 4IBOA 4YQYA 4M0EA 5DEOA 3FMIA 3SKYA 3B1JA 3IXLA 5G0SA 4UEOA 1O94A 3SSAA 4EGCB 3SVTA 2PIAA 2ZBUA 2XWSA 2JD0A 4ZI2A 2GZSA 3GARA 2DX7A 3PFKA 1EUDB 1FUIA 2AF4C 2D06A 2Q9UA 4DZZA 3CKMA 4JUDX 1PV4A 4I1SA 4NCAA 1PD1A 3H3XA 1P2FA 3H5WA 3PDJA 3TX6A 1G2OA 3S40A 2X6RA 1DDOA 2CNNA 3UNXA 4Y2RA 2FPSA 2QD1A 2W37A 3L7CA 4YP6A 3UZUA 4UFPA 4A91A 4DR6B 3HXPA 3SEQA 2QROA 2GR9A 2J9RA 5AXBA 1WM1A 1E2MA 1SMKA 5AKHA 4BBPA 5GIOE 1TZJA 1XGKA 1XP8A 2A0WA 1RQ7A 4CYMA 4BUCA 4RNCA 3TM4A 1NBEA 4C2AA 3ITKA 4CVNA 3WGMA 5GONB 4UREA 5EHZA 4LYFA 1C4KA 3JAMA 1G2PA 2CB9A 1N78A 1XN1A 4MI1A 3HZRA 2O7VA 2OOKA 1VBKA 1FP1D 4AZTA 1TM3E 2W48A 4LAFA 5CITA 4IINA 4JWTA 5KNDH 2G1PA 3H11A 4HYEA 1YS7A 3SNKA 2X0FA 3H5LA 3U4CA 1JTEA 4KLAA 3N8KA 4MR7B 4MWZA 1A97A 1GQOA 3UXMA 4BFUA 2CBGA 3BL8A 3LUBA 3LUCA 2P9FA 3LT1A 2UZ1A 3CISA 4R9NA 2VP2A 4OL0A 1GG9A 1AGRA 3OX3A 4MS4A 4EI8A 2Y92A 2XWJI 3EZXA 3O4GA 2G76A 2GUWA 2H1CA 3LGAA 4WVLA 2Z95A 4ZPJA 1GOTA 3EGDB 4U6QA 4R31A 3EASA 4QU8A 1KKLA 4JBYA 3FSRA 4GX0A 4YCCA 4PM4A 3VJKA 3NBXX 1T5IA 3HP1A 3ZVNA 2INGX 4NBSA 2FQXA 4BN4A 3V32A 5E8JA 2XB6A 3QWHA 4IYJA 5CURA 4D8UA 2WT9A 5FTMA 4ENTA 1IFXA 4LV5B 4RVSA 4UOQA 3QW2A 3CSUA 2PRKA 2YOGA 5EIOA 1ESEA 1ZD3A 1N4DA 4PNPA 1NXOA 1E1QD 1KQ3A 2CVQA 2H1HA 3RTEA 2QTRA 1BVUA 4LDNA 4RFVA 1XJ0A 5AVXA 4M6WB 4H16A 1XAIA 5AK6A 4RF2A 2H85A 3OJXA 4FCWA 4ZAXA 4EB6B 1BX1A 2WYUA 3QXXA 2XZDA 1C29B 1KYIA 4IQ8A 2QNIA 1B6TA 3EB9A 1YVRA 3OPYI 4LYGA 2IY7A 1LWNA 2OXRA 2R8PA 1X7ZB 2NZ8A 3L43A 4FFRA 1TKRA 2FE1A 5AHOA 4U2EA 5G0VA 1M5RA 3FOCA 3FIJA 5LC1A 1KERA 3GJ5A 1JLKA 3PFBA 4Y2UA 1GSAA 2XYQA 3MCWA 4YDSA 4GYYA 1M0EA 1CC1S 1G8PA 3HSKA 4X85A 3GGCA 1PW7A 1ZUIA 3WOVA 1EFKA 1Z0IA 2B2XA 1ES9A 1QHEA 3LRTA 1BVHA 1DGQA 3OKFA 3GPCA 4H77A 3TSWA 2QRKA 3ICWA 1L4UA 2X1VA 1BDBA 2HSWA 4IXNA 3IKJA 3KLMX 2FAXA 3GPLA 3IUNA 1J4AA 2GJKA 2F3RA 4K88A 1S8FA 1T1IA 3B82A 4H7KA 4KQKA 4Q24A 1T4BA 3GRRA 1BGWA 2BY4A 2GD2A 3GROA 5IDWA 4NZZA 4V0RA 2G9QA 2HA2A 3K1JA 4U5QA 5K7SA 4RM3A 3DT9A 3H3FA 4BCCA 4DGQA 1UQUA 3OLVA 4YA6A 4H08A 5ALTA 4ALKA 1RM4A 3OCJA 2W2KB 3PQEA 1TM2A 3PRYA 2I62A 4OQNA 5D84A 4U4AA 4BLVA 4F12A 3H5OA 2P4HX 1JWLA 3TKYA 4DDVA 5IZ4A 2XF2A 4QGAA 2QIOA 2W2OA 1G42A 4LXIA 3K0AA 4ALMA 3R7NA 2AX3A 3AW9A 1QZ3A 3D0QA 3T38A 4FYPA 4I9FA 3D1VA 4Z4QA 2IYFA 1NL3A 2QR2A 5K01A 3HJBA 1EFPA 1EI9A 3C74A 1CQWA 4LJ8A 4LBYA 4BDTA 2ECKA 3VSEA 1Y7HA 4EA7A 1KIMA 1QTRA 4RUKA 1QM5A 4BUZA 3IIKA 4HDNB 2EQ5A 1YJAA 2HCJB 4EGAA 2Y93A 4NESA 4QODA 3R9KA 1VQ1A 5LP6B 3OJ0A 2B1QA 4YJDA 4YP9A 1D2AA 3ORYA 4FFMA 4BIIA 5INTA 2X2FA 3W78A 3NHRA 4ABYA 5DX8A 4G9EA 4F93B 5JJLA 1TJ5A 3E9DA 5KYWA 2CFTA 3HPRA 4E7OA 4NENB 1KI1A 1PEDA 3OIYA 4M1SA 3CWQA 4GE0A 1EZ1A 1B3BA 3SEZA 1EFRD 1NQTA 4LOAA 5CB0A 4HS4A 4YH1A 1NONA 1Q74A 3U5ZB 4BYGA 3AIMA 3D54D 3ID6C 3LUJA 3V8MA 4A2WA 1AK1A 1GZUA 2MSEB 3RO7A 5H80A 4BVLA 3D0OA 4H6VA 1UJ4A 3N2GB 3QI7A 4O5AA 4AICA 1F7VA 2OV3A 4R2HA 4GKVA 4DM4A 2WFLB 3HYTA 3ME5A 5KKAA 1EFTA 4JVMA 1IIRA 1U7PA 1V8OA 1V37A 4FFOA 2JRCA 4WK2B 1T6XA 2P4EA 1TQDA 1KIAA 4W5RA 2JH8A 2JJ1D 4RL6A 4RVOA 4JC5A 1J0AA 4WAUA 4ASUD 4AUMA 5C8VA 2ISCA 1XLWA 2HBYA 5SZJA 1NNEA 4IJMA 1UBKS 3TOSA 1JYEA 1A8IA 4YYEA 3JV7A 1ISJA 2HRDA 4ZT3A 3BK2A 1RJEA 4KVAA 4KXYA 7GPBA 1VBMA 3N0VA 4X8MA 5CAEA 3TGPA 1RXVA 2FNAA 1T1EA 2PBLA 2YWXA 2FOIA 3IOYA 4Q9AA 5D5HA 5IAGA 2ZR0A 4GRDA 4I2VA 3KDAA 4OQQA 3PDCA 1MA0A 4C29A 3IQEA 3W2FA 3IQZA 1QRDA 3ABIA 3G2JA 3L8ZA 5EKUA 3ZZ1A 3Q85A 4QEKA 1WNFA 2OXIA 4LK3A 4WWHA 3DDZX 3L7IA 1G5PA 1E4VA 4Y0AA 4KO1S 5K3OA 4LDJA 1II8B 3Q7RA 3I0NA 4LV6A 2V97A 1L9KA 4GZMA 4XUCA 3PQ4A 4PFQA 1L5FA 2E4VA 2GPWA 2VAPA 4ZI7A 5I6DA 3LX4A 4BB9A 1NKVA 2HCRA 5DYIA 1OBOA 3O92A 3ZD7A 4O2AA 1KQNA 3JTMA 4E33A 2B94A 4K6MA 1K4KA 2FHPA 3HH8A 2BE9A 3GVPA 4KO2S 2XJ9A 1B0ZA 3OM1A 4DGSA 1X1RA 2X5JO 1MCZA 3LLUA 1FXWF 2O1EA 5FLYA 4RTPA 4UPEA 2EZ8A 3UENA 3KXDA 1EG2A 4AJ9A 3RS3A 2REQA 3ZD8A 1QHSA 1FTNA 3H4IA 3NW9A 3RW9A 1E2JA 4HNUA 3MLAA 4QXQA 5LLSA 4PR3A 4EFMA 1RYDA 3D43A 3MAGA 4P86A 1QS0B 3X1YA 5IDXA 3RRXA 5K0BA 5KTOA 1WXHA 4HPJB 3RABA 6YASA 1R0YA 4YCLA 1AK2A 2QMOA 1Z2PX 1SRRA 1PKEA 4RH1A 4QDZA 3WMXA 1EXDA 4YMHA 3EC1A 2VSOA 3W05A 3B2QA 5JT1A 3Q7IA 3GLIE 4D0RA 4IR7A 5DGCA 2OV2A 1RTTA 2AFIE 3SJBA 1ODFA 4MGZR 4DJEC 3EE6A 5ESWA 3B3AA 3L0SA 5BP7A 1PJQA 1Y5MA 3DLHA 1R5NA 2IDZA 2OD7A 2GJAA 3HSSA 4TTJA 4FEYA 4PZZA 3RG2A 1U7DA 1XRSB 3LK7A 4NCHA 5AJUA 1IPFA 2FUG1 5K0ZA 4I36A 4BJ3A 1VSVA 1OI2A 1ORWA 2H9AA 2JGIA 3AOEC 5DB4A 4ZT6A 2O8BB 1Y33E 4ZKDA 5JYCA 2GDJA 1B8OA 3ANTA 2BDTA 2WR8A 4KH0A 3GL9A 1CY7A 2CKMA 5U1PA 3TE6A 4EG5A 2B5VA 4G5GA 5BOSB 4J91A 4XM1A 2EFCB 4JXXA 2C5BA 2W4QA 3ZJUA 1ZFNA 1H1DA 2AFHA 1IZYA 2JIQA 2YWDA 2VJMA 4FILA 4ESOA 4LMAA 2AIRA 1J2UA 1E60A 4K86A 4JQYA 1KP9A 1JAHA 2H9YA 1PJLA 3Q7PA 3DF7A 3ZDXB 2VNJA 1HT0A 1VHWA 1Q7CA 1IN1A 3KVOA 4GQAA 2BHRA 4RESA 1MTOA 3VHXB 4EKNB 1U5BB 3CUKA 2XNSA 1XZDA 2QRJA 4UFNA 4LGYA 5DM1A 4L08A 1YL7A 4YMGA 5COAA 2W83A 3A4VA 1QB7A 1OU4A 1XP5A 2Q4DA 3C5WP 4C06A 1W48A 5JW6A 1JH9A 3T9FA 5C34B 2D5LA 3ZU6A 3FYUA 1ORHA 1UFRA 2EERA 1YS4A 2GRUA 4MWSA 4NBRA 5SYAA 4EFLA 5JWOA 3PNVA 2I34A 3AEQA 2IPNA 4UZEA 3SHOA 3TQHA 2CXPA 5GV7A 3ROZA 4UTPA 2DMRA 2XPCA 4L07A 4N0EA 2WIDA 4PYOA 4ZYXA 5IF9A 5DK4A 3O73A 1OZGA 1EE9A 4XQEA 4PANA 3FDFA 3U31A 3E58A 1Q1GA 3W8FA 4AWXA 2EGGA 3A04A 1R5BA 2Z3ZA 3RS4A 4MVJP 4PGAA 3UJ7A 1N6LA 2WSMA 3H9GA 2ID8A 4OSOA 1SURA 1GNQA 2ATIA 5AK0A 4EUKA 1OFUX 2QX7A 2DWCA 3ICOA 1CDEA 2DWQA 4G97A 1PQ4A 1Y9ZA 4UBKA 4ZVSA 4E14A 1UMCB 2FPGA 1YQ9A 3N87A 1OXBB 16PKA 4I8DA 1DDIA 3FTNA 3NT2A 4QGSA 4EYQA 2VJPA 5A05A 2J6HA 5HIIA 2ZIAA 2BFFA 3FPHA 4E5SA 3DJFA 4TKZA 4U7GA 1M7HA 4DEYA 1M1UA 1E92A 1Q22A 2QSJA 1DXOA 2Y2VA 3GXOA 3H7IA 2Q6TA 3TZQA 1LSUA 3OQNA 5NLLA 3T3MB 1O7JA 3P0RA 1F60A 1W29A 1DELA 3OFJA 4JYAB 5I4CA 1M0TA 1P0IA 1P91A 2H1LA 1HGXA 3G82C 3A6LA 2I2FA 1QP4A 4BGUA 2FG5A 3W3AH 1Y8ZA 2XT0A 2ISSD 2YIJA 2ZE8A 3L0IB 4E6PA 2H2DA 2AJLI 1MC5A 3EF0A 4J7UA 4REMA 5LZ5A 4NFYA 3UGKA 5K8UA 2XA1A 1JEYB 5FWXB 1VLMA 3DJYA 4LCEA 2CHEA 2BR5A 4KQMA 5T4FA 2QQ5A 5KJ1A 3K9FC 5IK2A 3L46A 3MC1A 3K4HA 1T6YA 2JL1A 4AWBA 4C2UA 2ZBRA 3QTLA 1QANA 4OBXA 3K6RA 5EKTA 2GBIA 5JWRA 2IS1A 2NV0A 3FZYA 2ONCA 5IC6A 1UC5B 2OZKA 4B6RA 4Y2SA 1GR0A 2B83A 1GLNA 3V5NA 1UKYA 3G8YA 2NYRA 1CUFA 2DR0A 1ABEA 2GD0A 2A9JA 3ZJTA 1GAJA 2H6EA 5A6VA 4C01A 2DPGA 3KQKA 3IP7A 1RQLA 3CZ4A 2IPMA 1W1UA 1OLOA 4MRMB 3AXSA 2YXLA 4JYPA 4UNIA 1GZHB 4E07A 2VSFA 3AT1A 3W3AA 4RIFA 4C03A 2HSGA 2F1JA 5BURA 4XIGS 3CX4A 1FRFS 3VAZA 2RB4A 4MO9A 3LQ1A 1GQ2A 4F4CA 1RTKA 2PZBA 4PF1A 4WCDA 1IOZA 3QVTA 5SY6A 5CGQB 4U6NA 3K6KA 3I9NA 4OB7A 2XQVA 3LBYA 1E7WA 3DBLA 2DLCX 2EW1A 4XFJA 1IOLA 4BE7B 2YZNA 4A82A 4IW3B 4GMXA 2DGDA 2EAUA 3HO8A 3FM9A 3L1VA 2GCIA 1TMKA 3OPNA 4HRXA 1MO6A 4J7CA 2H48A 3G2PA 3K1AB 4JDPA 4RKEA 1G291 1KAHA 1ZH0A 2DP4E 3OFVA 4PHCA 2O1WA 3U16A 2PH1A 4G1MB 4QFDA 4WHMA 3FAZA 2P9CA 3RF7A 3REGA 4G8CA 3DWEX 2A0YA 3JQ6A 4IQGA 1Y1SA 3S8YA 4UCQA 2ZWIA 4HAOA 5AVQA 2X1LA 3EJWA 4XVRA 4D7AA 1KTVA 4K40A 4YALA 2CN1A 3E3LA 1RT9A 2AQHA 2IGTA 4UMFA 3RVNA 1XNGA 3PPWA 1JQ5A 1AGNA 4ZICA 2FDXA 4DQUA 5LOVF 1HTWA 2WWWA 3KJFA 5EESA 3U49A 4DEVA 4I08A 3IJEB 5HXAA 3OETA 2PUVA 2R9VA 2VRCD 2M6LA 4G0PA 4TV9B 3MBOA 3ZHOA 2EIHA 3FLAA 4X63A 5ADHA 1FJHA 4ZZ1A 3V2UA 1GA6A 2X14A 5GVSA 5KDOA 1EGMB 2R7AA 2PUBA 4FC7A 3G0BA 1WB6A 3JATA 3K9LA 4M6WA 1JAIA 2JGDB 3NTOA 3WLKX 4JI1B 1EH5A 1ZNZA 4G0QA 4N76A 3RROA 3COYA 3DOJA 4BC1A 1Y7TA 4BN0A 4Z49A 3C8MA 3KT3A 1G5FA 1H1LB 4KHZA 4NNJA 3QW4B 2RE8A 1X7ZA 4D4LA 1V8ZA 3I61A 1QRUA 3FHTA 3HKEB 1HFWA 4MK4A 2UDPA 3WHKA 4WFQA 3ER9A 2KWIA 1X1CA 2PGAA 3KKNA 1KJWA 1MH1A 1TQ8A 3LE8A 4R81A 5BV7A 5JAZA 5JMWA 1D1PA 4P4TA 2I3DA 3OOEA 1GSOA 2NU7B 2MSLA 3ROKA 3KWJA 4QX6A 1TTHA 4BMOB 3U7GA 1E3EA 1HYQA 1C0KA 2JLBA 2X77A 2YOHA 1ECCA 3FCSB 1UXJA 1PD0A 3MWJA 3TIGA 3C4QA 1NBWB 2QRUA 5CLFA 2DF8A 3DOFA 3ICVA 4QQRA 1ZGZA 4MCJA 3VPFA 4BB0A 1UBNA 3I9KA 5JCOC 4I3GA 3GMIA 1RVDA 1BTOA 4Q5IA 2Z6QA 4DA8A 2V65A 5M04A 1E5TA 1YMUA 3BERA 1HZZC 1FBTA 1T9GR 4OJYA 4C0AC 2ZBDA 3K6SB 3IAAA 3JZMA 4RTJA 2O2EA 2PA0A 2XYRA 5TGTA 3ZCVA 2OD2A 1N2CB 3OJOA 4IY1A 4O1IA 3N6XA 2LCIA 5BSTA 3RVBA 4DBLE 1SY7A 3DZBA 2CLDX 1LDEA 2FE4A 4V0KA 1QYWA 5BXQC 2AZTA 1PBNA 3K09C 1LZLA 2Q3EA 4J9VA 1FL9A 1R8JA 1WDKA 2JFPA 2X13A 3G68A 4JI5B 7REQA 3ZGZA 4RPJA 2QLLA 2LGJA 2GO7A 3INNA 5CLQA 1HETA 1ZK2A 4XDZA 4F6LA 4KDRA 3IUMA 1LBTA 3TZHA 4YMLA 2F55A 3V7NA 1YI8A 4K05A 5K6AC 2YWEA 5E7JA 4E13A 1E5VA 1VKZA 2F3TA 3OQ6A 5G1PA 3HFRA 4R54A 5JC1A 1Y6RA 3ONFA 4LYEA 3G2OA 1HTTA 4HDNA 3S2YA 2ZREA 1YK0A 3ITEA 2WT4A 2Q46A 4UVDA 4NZNA 3ZDRA 2QRZA 1JEQB 2WJGA 3PNQA 1LBHA 4RA6B 5ITSA 4X24A 4TZ0A 3TL6A 2YJGA 3W6PA 1KMHA 1WTAA 2R84A 3CO0S 5LQUA 1O95A 1UMKA 5JLJA 5MFPA 4WCVA 2BCEA 2H3EA 4A2QA 4J0HA 4EGFA 621PA 1ULSA 1CVRA 3AEUB 3I4CA 3QXJA 2GAIA 4LHYA 4DLTA 3D3WA 1T9CA 2WTNA 3VKGA 1LPOA 5C1BA 2XT9A 3LF1A 2OY0A 5IYZA 1FVFA 3E7DA 2G0TA 2Y1KA 1MX1A 2I7XA 2B21A 4PFKA 4BLUA 1FF9A 4LMBA 3PC8C 1A50B 4K9SA 4MO2A 3RGGA 3VPAA 2VHXA 1Z4PX 4RM2A 3EXG1 3OPVA 1Z8DA 4NYIQ 3Q4GA 5B64A 3GRAA 2WFLA 4TLLB 4F0JA 2J31A 1GEEA 3OLQA 4H7HA 3K0CA 3AI7A 3OX4A 5FB3A 4HGOA 5CXXA 3VZDA 2GBPA 5LD2C 2CL0X 1DBPA 2HHLA 3O82A 3KB8A 2FEAA 5HPYB 4X00A 4C0BA 4AJKA 2F8MA 3GA0A 1PT9A 2VDPB 2HMVA 2WNHA 4NOLA 2NZUG 3L4KA 2MJLA 5HW0A 1BDMA 4ND3A 5A5EA 1SBYA 2I2DA 4U2CA 1H4SA 1GL9B 4X92A 4Y2GA 4OYHA 2E0IA 3JR3A 5IAEA 3UTCA 4W9NA 5AI4A 5B1DA 3GLGE 2B1GA 4ZJZA 1GPNA 2DKNA 3UANA 4BFLA 1JDNA 2Z9BA 1KY3A 3FXAA 2M98A 2QD5A 4G81A 4MR8A 5FL7D 3TM5A 2PL5A 4BE9A 1T3LA 3QLJA 4UCFA 3UJCA 3AR2A 3VPBA 5LVAA 4DABA 3EISA 3ZDDA 1TO2E 4HYYA 2E7ZA 1U04A 4Z99A 2O8NA 1NW9B 3IOMA 4ZA2A 3IMCA 3I76A 1CYDA 4PAWA 1RC0A 2IITA 3DV9A 2PLWA 2FA9A 3NO4A 4EGQA 2FSSA 2IEBA 2XQIA 1I4EB 3HLKA 5CLLA 3L8YA 3GEIA 5IX8A 2GT1A 1Q20A 5AJVB 2EZUA 1E1NA 4BCDA 4D81A 5JAPA 3U80A 2IYUA 3RNLA 2CVHA 2VXCA 1PAUA 3T54A 4CMEC 5K9ZA 1T6ZA 2XH8A 3G7NA 3PR2B 4AJLA 5BRJA 4DB2A 1K8RA 1WMDA 2PLRA 3H18A 3VYVA 1M72A 4MUKA 3KL4A 1EUCB 1QAMA 4Q21A 4UEQA 2FKNA 2I7DA 4EPYA 5TGDA 1I2CA 4C6TB 2AOXA 2J0VA 5JV5A 4X65B 4PSVA 4Y1RA 4H7IA 4K9PA 2ZUVA 5HJ7A 4R51A 5TRTA 2VJBA 1YV9A 5DLPA 3I32A 3FPCA 5JY1A 3EJ6A 3ZI7A 1T8TA 3CURA 4JLOA 2Z8YM 3UGJA 4LZAA 2DH5A 4P5PA 2QMYA 1XCMA 3NEPX 3ONWA 1N2IA 1Z7GA 1OH5A 5E95A 1R5OA 4QRDA 2Y6VA 5KU1A 2PAAA 5EE3A 4MV9A 3SHVA 3VVMA 3DAFA 5K3AA 4ATNA 4J1NA 3KZOA 4N5NA 4UBJA 4B2YA 4GQIA 1M6WA 2BHTA 1SQGA 4CKEA 1RMYA 5HKOA 3FGPA 3FGOA 5AUNB 2JIZA 4W6ZA 1U8CB 1O5IA 2VNAA 2ZRJA 4LWOA 4ROTA 1GDDA 3MVEA 4ZVQA 3DLPX 4EYSA 2PGNA 2MMGA 1U8UA 4QECA 1D0SA 4AC9A 3DDWA 1E7RA 2P2ZA 2QTFA 4GKAA 4FTWA 1WVGA 1E4YA 1YGYA 5BO5A 2ACKA 1P77A 2DJ5A 1EIZA 3I0MA 2FTKE 3L02A 3NXKA 4QYSA 4QZVA 5BOSA 4Q4LA 1GKUB 2NU6A 1YJXA 2HH9A 1NU8A 3A10A 4M9QA 1SXJC 4EYOA 1CX9B 4FBMA 4H1TA 1X86B 4JK3A 5AVRA 4AJPA 1G8HA 2PUWA 3PHLA 4K1LA 3EYWA 1RLTA 3CRVA 3X3HA 2FR8A 2PD6A 2HK8A 2BH2A 3PCXA 2YIVX 2YN4A 1X0VA 3EUFA 4LHSA 4NLLA 2H92A 3UGQA 3GA5A 2KJQA 1XMPA 1E3SA 1I3MA 1I2DA 2YH2A 4MZDA 3TRFA 1NRIA 5ARCA 1RM5A 4QDTA 3UJNA 4XWWA 3GAFA 3U09A 4G6ZA 1KETA 4V0QA 2QTWB 4FGKA 1T5HX 1TK2A 1UP4A 1HV8A 3LG2A 2F43B 2HT6A 3I45A 4M4SA 1E7YA 3H42B 3N9IA 1BS2A 4JC0A 4ZGBA 2JVJA 5KYUB 1M54A 4Z8YA 2NT3A 3E8XA 3TJZA 2O1SA 5BQ5A 2SKDA 3BAFA 3K9BA 2UXBB 4BO9A 2QLFA 2YMQA 3OP1A 1DV2A 1ZINA 3P4UA 4A16A 4C7OB 3IAS1 1N6PA 4PYQA 3ED1A 1OUMA 2ADMA 1SXQA 1EMDA 1OA0A 3QELA 1GADO 4YGXB 4HX5A 1PLKA 1MFZA 3HJUA 1D1TA 1U7TA 4AZ3A 2KI5A 2Y71A 1PFVA 3SMQA 1SUCA 2JGJA 1IDN1 3JU3A 2XMSA 5AKZA 1UBLS 5MGBA 1SVKA 5FWDA 5TARA 1GHTA 3HE3A 1IK6A 5IS2A 2FFJA 2AGVA 3HBNA 3FWPA 1ZMBA 4BNWA 5SY9A 4E12A 4Z0TA 2B3DA 5HZKA 5LZ2A 4BAZA 1JDBC 1PGJA 2AI1A 4YO8A 1ZQ1A 3CFYA 4O33A 1KBOA 1CLUA 3WNVA 4L5YA 4ISBA 3FVWA 3M6IA 3WYBA 2OZEA 3Q10A 4Q16A 1GNSA 2FUG6 2ID4A 4IXTA 2YXDA 1ECGA 3OSZA 2DG2A 5HIKA 1C5KA 4D98A 1W52X 3ZHRA 1O77A 3T7TA 3NFRA 4C0SA 2JPDA 1UFQA 3V1YA 3U44A 2FN3A 3EHDA 4UUOA 3KSRA 4JY7A 2LPMA 2H63A 5KYYB 4ZAFA 3SYRA 3QBDA 1N9GB 1T9BA 2AUNA 1Y4ZA 3EEYA 4UNQA 4MDEA 2H1OA 3NHUA 4QHYA 4C2TA 3BRCA 4ZYTA 3GDWA 4TOIA 3DONA 4UNRA 2CHVA 1SEPA 1LJLA 1Z18A 1GUBA 2E6UX 3IAHA 4R2WA 3SC4A 3DZJA 4BNYA 2Y1LA 2IHTA 4Q1EA 4EAQA 5AK5A 4ZD6A 2CD7A 3QM1A 1WLYA 4CQNA 3B52X 3CN7A 2ODAA 3P9ZA 1EQAA 4OBEA 3AK4A 2IDKA 4AUKA 1OAOC 1L7OA 2RHCA 5FLKA 2W8BB 3ORHA 3S1AB 4MWOA 3E7XA 1QGAA 1T8SA 1MO2A 1ZIDA 2IEYA 2XCOA 4G5FA 5DGTA 2ZYIA 1MJ5A 2R60A 4O2AF 3RS2A 2FPOA 1G5QA 1VKOA 3EFHA 3F98A 2QTBA 4FFBA 4MRMA 4E11A 5EY5B 1GPKA 1OASA 3PV0A 1L0BA 3T3GA 2PH5A 4EY4A 4YAKA 2Y27A 3ZY4A 2G7MC 5BVGB 2QJRA 1K6IA 4N5IX 5HZGA 1D8TA 2ETXA 2H3HA 2ZUUA 5E4JA 1G55A 3NBKA 1HT1E 4UHFA 1ZGBA 4KWEA 3DZCA 4ZOEA 2F3UA 2VDWA 4UMEA 2OFOA 4AMUA 3A36A 1TKCA 1W34A 2YDXA 3WWYA 4B34A 2VDVE 1GA4A 4BO2A 3VVLA 1XOIA 3OIFA 4MRVA 5TMPA 1Z4LA 2REXB 3D8NA 4YC7A 3SG0A 4Q4DA 4NYMR 4DWJA 4URUR 1KZYC 3E15A 2VKTA 4BKPA 4BVFA 4JJIA 2W9XA 2O3RA 4JQZA 4OJKA 4Q02A 1KVRA 1PS0A 4AZSA 4YRLA 1XQWA 2W6PA 5I9SA 1UWKA 1N8KA 4OK5A 4P4GA 1Y6JA 3LV8A 3NXSA 4GEKA 2VEDA 3IJPA 3ZD6A 3UUEA 3U7HB 5KSOA 1LI5A 6AT1A 2II6A 2ZWAA 1FQJA 2IEGA 4PZCA 4IVQA 1SC9A 2QF7A 4OX9B 1OKKA 4MIOA 1L7EA 2DUNA 2TSYB 4NBUA 1OXSC 4FS3A 4RHXA 3BD9A 3BQ9A 2Q27A 3RTGA 3LIIA 2GEJA 4GYKA 4UTNA 5JMOA 1LDGA 1W5TA 4GM1A 4XVHA 4YONB 1HQYE 5FHQA 3JYQA 1FP4A 3T9CA 4ZYYA 1XPOA 2ZS8A 1TUGA 3GZNB 1EESA 5CPFA 1KHHA 2JGDA 3TCKA 3K2EA 2FRDA 4OHKA 5B6PA 1GFIA 2PJDA 5E9WA 2YFYA 4IHJB 2ACVA 1VCMA 3AEXA 3DZKA 2NO4A 5LCXA 1H1LA 5DKFA 5HP4A 5PNTA 4DDTA 5EJ7A 4S0ZA 4ZO6A 3HKEA 3AM3A 3HJGA 3OFSA 3VZCA 1HH4A 2O07A 2EBWA 1D3AA 3PJGA 4D02A 1ZVVA 1GLVA 2IYRA 3GNLA 5JQGF 3UF0A 5IARA 1TOAA 2XTJA 1DO2A 5DFAA 2NZ2A 2QQ0A 3IUEA 2NU7A 4QNMA 5F1PA 5F5NA 1TI7A 1ZLYA 1CJMA 1WMAA 2BFBB 4WPGA 3UJBA 4LRQA 1XROA 3I2YX 1MAUA 3NBZC 4L9RA 4CJXA 1Z38A 2QX9A 3V80A 1FNCA 1P6UA 4RGQA 3DHEA 1CF9A 4FOTA 1XL1A 4COKA 4JIMA 3X1DA 2EJTA 1Q14A 1D03A 3GEDA 3TIVA 4DJFC 1X15A 1XYGA 4NPAA 1R5JA 1S2NA 1UJCA 3NV9A 4BO8A 2ZRFA 2X41A 2X76A 4KIUA 4PLFA 2VTKA 5KX5A 1ILWA 3FCUB 3NZEA 4E22A 1JEAA 1F7UA 3DW1X 3R5HA 1FDIA 3MUEA 1WBDA 4YASA 1CUAA 4XM2A 1GN9A 1R8XA 3UA4A 2D7DA 1ZSNA 4GGPA 5ALYA 5EWLA 4F84A 2PTHA 1ZHOA 1P9OA 2QM8A 5DNCA 1XVIA 1B74A 3K15A 3VKWA 2JI6A 5KYKA 1AS0A 1QCDA 3UB4A 1M2EA 3G9UA 1NDUA 4L02A 2JKVA 3LIPA 1JMVA 4M1TA 3ELBA 5DCYA 2L42A 4ZREA 4H18A 2NMVA 3AFHA 1VLLA 4B84A 3I5MA 1V5EA 3GDGA 2ZUWA 3M2TA 3CVJA 4FGJA 1LF0A 4U1RA 5EUQB 3MCVA 4W9RA 1PR2A 2XYHA 3NP9A 1EFDN 3OTIA 1G3UA 2IOFK 4KMOA 4E5DA 3QSYA 2PANA 4BU0A 1ZK0A 4Q7LA 4KOEC 4BRWA 1WW8A 4I9UA 4KN9S 2P2SA 3AEUA 1YB1A 3LRXA 1DIRA 1IJEA 2YXNA 2F9LA 2QT1A 4UTOA 5IH3A 2V0NA 2H4WA 3GFOA 3NTRA 4J2HA 4KDEA 1EX1A 3WSTA 1I32A 3K0EA 3EMKA 3HQ4O 4V1CA 1GUFA 5B30A 1ND6A 2IZOA 4CKBA 2Q45A 3MT7A 4MGYR 3LUDA 1XQYA 1KPGA 2JKZA 2SKEA 4JDUA 4XX0A 4EHIA 4ZFNA 1VMKA 5J4LA 1T0UA 3STXA 4IIUA 4GEGA 5CD9A 5JFTA 3N75A 1JFFB 3FFAA 1TZ2A 4QFBA 5EHIA 3RTCA 1XA4A 4X7PA 5EQJB 4XPZA 3LUGA 1UKAA 1Y1RA 1JH8A 2EZ4A 1ZOPA 2QM3A 1BIFA 4WE3A 3H5RA 3TR0A 5JHGB 2OG1A 2VAWA 5A7GA 1M2OA 3TEFA 4RZHA 1YGPA 2B4YA 4LQCA 1FE8A 3LPLA 1FDUA 3W4JA 5GONF 3COWA 4O0MA 3DBHB 1G8GA 1T0BA 3KQYA 3ESAA 1JAXA 1Y6QA 4X3OA 1N34B 5DCWA 2GPYA 4KMMA 4NABA 1MFPA 2QL5A 4FBLA 1SPXA 2JCXA 2MMCA 3C3DA 3FUUA 4LGVA 2W0MA 4LYJA 5ERYA 4Q1CA 2DJIA 4FB4A 4YMVA 5DNWA 2DQZA 3TLZA 1RXUA 2RAFA 1CFJA 1Q0LA 4DKJA 4J75A 3HCFA 2DAPA 2J87A 3PI6A 4QXMA 1H85A 1ICIA 2RHMA 3FPFA 5FPTA 4OP3A 1DG3A 3RANA 2B37A 3BD8A 1TMYA 2I7CA 1J2RA 4GL4A 5KHLB 2BBTA 2AN3A 2GEKA 1MRNA 3CN9A 5G3YA 4TMKA 4X8OA 3VO9A 3NHMA 4LJ9A 3AKDA 3AI2A 3FPSA 3JZAA 2NVBA 4B0PA 4DIDA 4RTRA 2V03A 2IELA 4W5QA 2YWJA 4LOLA 1O0CA 1PU2A 2JG3A 1YONA 2GK4A 2QMUA 2BCGY 4B7XA 5F21A 5HM8A 4Y2PA 4OAPA 4JCCA 4PX9A 3LCMA 4AKHA 1CZOA 2HCBA 3WGNA 4OQXA 2ZBFA 1JEJA 3THXB 3B2NA 1PJAA 2FV8A 1F20A 1X7GA 3AWIA 4CMHA 4DC1A 2GN0A 3T5AA 1ZUWA 2O3SA 4AURA 4GX1A 3ZJ4A 1EDBA 5FPKA 2JASA 4MVJG 3M6MD 1LPMA 2OBYA 1O0SA 4IIYA 1N6OA 2YWCA 4EG7A 4RHEA 1QGZA 2DBRA 4WDQA 5AM4A 4C6TA 5BYAA 1XPUA 4JP5A 1KEUA 4OUDB 1C4OA 4Z53A 1THTA 3C3JA 5GWXA 3RARA 1O6GA 1F48A 2JF0A 3G5UA 5FYDA 3DMDA 3TMKA 1FJXA 3A2KA 4B2IA 1ULBA 3C39A 3AJAA 3GRCA 3R5XA 2XWQA 4P8RA 4MULA 1J5PA 1ZX1A 2BN4A 2PBRA 3T94A 5KREA 1H69A 2VBGA 3UWPA 3IPYA 5EP1A 5D5PA 3E7FA 1UK9A 4LTMA 1KMQA 3U3DA 2NVWA 1QYCA 4F9GA 2LUOA 2H9IA 2QYOA 2R79A 3EVNA 3LPCA 1BW9B 1XYVA 4EPXA 1B2RA 4PG8A 4B4DA 4CLOA 2BZGA 4B9EA 3RASA 1UXOA 3HYLA 4KACA 4CDMA 2G5CA 3EZ6A 1M2GA 4TQUS 1WUIS 2W4MA 4IDAA 1Y3DE 4C0XA 4D45A 5CNMA 1Z4KA 3N8DA 1B8UA 5K3BA 2WABA 1P7ZA 1L7RA 4ZO9A 4Z0HO 3KSAC 1MB4A 1Z25A 2W22A 1R9JA 4MPTA 3TZEA 1TVKA 4MB0A 4QUHA 3KYBA 1KZ7B 4IVRA 2HMWA 3ILXA 2C3OA 4L6IA 4GS5A 3DE6X 1E0JA 1ZS9A 2WE7A 4HFMA 2OYSA 4QQKA 1I14A 1VIAA 1Z7EA 4UUMA 3WRWA 3L9WA 3HCOA 4Y6GB 1PFUA 1FYVA 4NZYA 3L2OB 4J0JA 3H86A 3HR4A 1A04A 3QKWA 3EDQA 2X8AA 2WYHA 2EV9A 2EIXA 3UCEA 1O58A 1RFLA 2V7QA 4RU1A 4F2WA 2XCSB 4JBWA 4ZOLB 2FFHA 1GITA 4X61A 3IUPA 1UZUA 3TTWA 1BE0A 1NQ5A 1KJQA 4IWXA 4BP9A 4N3BA 1V0JA 1IOVA 1ZUNB 4AKSA 2UZ3A 1AOXA 2IW3A 4C7MA 2XCLA 5LP6F 1WF6A 3L93A 1UPUA 4QHTA 3R75A 1C7FA 1RU3A 4PAQA 2ZITA 3DZ8A 4N8SA 3I12A 1NXPA 3HL4A 4JEMA 1R0RE 4PQYA 4YJ3A 3UQYS 2PNJA 4AF8A 3GUZA 4D92A 4C7OA 5MN4A 4TMTA 2IJGX 5D2CA 4KG7A 2QRGA 4C4YA 4CF6A 4EW1A 4YRSA 3AXTA 2O2GA 3GVXA 4HCJA 2BKXA 4KO4S 4Y8VA 4Y18A 4LZZA 4GXNA 1U8XX 2VL7A 1G63A 3IRUA 1RACA 3U39A 4JV5B 2VUUA 4TSKA 3AONB 5HKAA 4G5RA 2ZCJA 1XD9A 1WV0A 5CLIA 1YFLA 2LDBA 3A70A 2CDAA 3ZK9A 2VWQA 3H0KA 4CG0A 5DP1A 1VYUA 1YJCA 3ND7A 5DVZA 3R3UA 1ZKMA 3VXKA 1SUDA 1CG6A 1ZC3A 4B3XA 3WWDA 1VXOA 1EBBA 3EDRA 4OQEA 1KEZA 4Q4AB 5IWCA 3RC1A 1NZFA 2RHTA 1P1FA 3PRKE 2PXHA 4RS4A 3WGTA 4UVEA 1GCAA 1NI4B 3G8CA 2ZJAA 3LQ4A 3ZGNA 3VR5D 1YFJA 3SC6A 5EHGA 1JHRA 3BH0A 3R7BA 2X0DA 1SIWA 3B5IA 1NUUA 3HCPA 4KN5A 1YQTA 4OGGA 5CDFE 4GLJA 4BZZA 2BDEA 1VBNA 4GOMD 4H0FA 3EC2A 4BTEA 2VPIA 2QTVA 1JMYA 3HN6A 5A3QA 4MUIA 1DS6A 4HXYA 1ORIA 2NZJA 1T26A 2P0YA 3A0UA 4DCJA 1HE5A 5AO9A 3OPYB 4DLNA 3LXUX 4ZYZA 1A5TA 1ZIYA 2BBSA 1G9SA 4I4CA 4KV9A 2HW8A 1PKXA 2RBEA 3QLTA 3S1AA 3S44A 4J7AA 2Q9AA 4Q47A 1W7AA 5DOVA 5DOZA 4OX9Y 3R0IA 2C2YA 4PRZA 2WKRA 3FHCB 2ZRNA 3GFFA 3HEAA 3NDJA 4TLEA 4ENQA 5A5FA 1U3DA 4FGUA 5AVYA 4HY3A 3F47A 2GO1A 1A5ZA 2BI7A 2JIRA 2V9CA 1TAHA 3ER6A 5AKJA 3RH0A 4B4OA 5CDSA 2P1DA 5CFZA 1Y98A 3Q88A 1ML3A 2Q5JA 3CLHA 4TGLA 3IAS6 4DJAA 1W2HA 1VG8A 5FOSA 1EZ4A 4D9JA 4GKKB 1COWA 2PWZA 1SC3A 4KE6A 4CLEA 1NASA 3CH4B 3JVDA 5IEJA 3SKXA 1SIBE 3E5NA 3B6EA 1PFYA 5LB2A 5F3DA 3UMBA 3SX2A 1CXZA 2QJOA 2YV2A 3MPUA 1R8SA 4F38A 1UFVA 2E89A 5DIFA 4JXZA 2ZLBA 1N5IA 4O2BA 1JFTA 3OZRA 1G21E 1XPJA 2VZLA 4JMLA 3VZPA 4QUAA 3PEUA 3QXHA 2N46A 4M89A 4TUYF 4J16A 2NU8B 4AG3A 1KQPA 2ZB3A 3R2JA 2C61A 4L3OA 5MFZA 3OD1A 1TT5B 4PZLA 5F2KA 1YHNA 1ZWKA 1U0EA 2RMKA 1OWPA 1ADGA 2CFIA 3D8TA 4DCOA 4GE3A 2I4RA 3I5XA 2RD2A 3HDTA 4BNTA 3TW0A 1LBEA 2YL2A 4FONA 1QIKA 5KSPA 4C4SA 3QOFA 1MV5A 1ADCA 3E9MA 1CB7A 1SOWA 3F90A 3GHHA 1C9YA 5C8DA 1TC2A 4MYCA 2X2EA 2B3TA 3D9QX 1YDWA 5F78A 5EE1A 2HFKA 3A4NA 4JEUA 1YOBA 1AB5A 2VF7A 3FPGA 5DTMA 3VM6A 1W6RA 3GZNA 4TV8F 5D00A 3ZWMA 4C0WA 4C22A 1Z34A 1SUEA 1CUHA 3NNNA 1QJ4A 4P38A 3KXPA 3HCEA 4JODA 1AZLA 1KYTA 3U0BA 4YT2A 1PJSA 4QDXA 3OT4A 3PS9A 2WU3A 4PTYA 3CGGA 3VV3A 5BW8A 2FMXA 1RXWA 2DKFA 2A1TR 1X14A 3G89A 3U7QA 4PTZA 1J0DA 2XB2A 1IZ7A 4IIJB 4CKZA 4IFEA 1OGIA 1PDVA 2ODWA 2NPIA 1IWPB 5JXJA 3PNBA 1Y1QA 1J5EB 2QM0A 3NMUF 2B69A 1N8TA 1NVMB 1IVNA 4HUQA 1B8NA 1CV2A 1FMCA 5ALSA 4LZPA 4AN4A 1MJNA 1E2FA 4BWFB 2O06A 4A3SA 3D6NB 3P52A 4R1MA 3T4UA 3WZLA 2FFRA 2ENWA 1WRBA 4LZLA 3ZE2B 1XRJA 1GNVA 4OQDA 1OFIA 4DMRA 4R1SA 3LBFA 1AG9A 1SZPA 1B73A 3WR5A 2AYZA 2PPLA 1WCIB 4I50B 3TIXB 1T1RA 3IMKA 2WUEA 1CWUA 4HMOA 5G1OA 3I05A 3H5NA 1L5OA 2QP4A 2XB8A 1HA3A 3SIRA 4DQKA 1EPUA 4OHWA 4P58A 2QVXX 2EFGA 1YHYA 2MHCA 1YFKA 4U2GA 1DNPA 2DFTA 2FPXA 2VLIA 2HU5A 2OSVA 2WHYA 4FCCA 1R64A 3HP4A 5ENVA 5I3CA 1V48A 1CHNA 4NU6A 3MJTA 3WB2A 2R8OA 2BVNA 2ZGVA 3NHZA 5LKAA 2AMJA 4HH0A 2JI7A 3EZGA 4OYLA 4ER7A 1KEKA 1R9NA 3AF1A 2PZFA 4DV5B 3RIGA 1RWVA 1RZVA 1YBAA 1CDDA 2YBEA 3OUTA 4MQEA 4AM8A 4QLBA 2GAAA 5E38A 3CTMA 2N9UA 2GBFA 1FYEA 1QMPA 3GQBB 3IV6A 3KUDA 3Q41A 4HMPA 3K20A 4NS1A 4JUIA 4RZ3A 5IH7A 1KBZA 1O57A 3W6UA 1ECFA 1TCBA 3ORFA 2FX3A 4JA0A 1QH9A 1Z9BA 2EKLA 2ZYRA 1S3IA 4EFDA 2O8EB 1UR5A 1OWMA 2GF9A 1EQUA 5EXDA 4C3OB 5MDHA 2GAOA 2DBQA 4QBFA 4DY6A 3QUQA 3GWZA 3EG5A 1E8DA 2WMYA 4DJ5X 4ENUA 2JEZA 4BZQA 2CHUA 3T41A 1AKWA 1VHDA 2L82A 1MNAA 3A37A 3AFMA 5FBZA 4LJSA 1RLIA 1E6CA 4ZZ3A 1CPYA 4EHAA 5JIBA 1Z4MA 2AJDA 4JLVA 2XF8A 2Q1WA 1QHHB 2W6JD 3JQAA 1N5KA 2VRWA 3SFZA 3I5UA 1QCZA 1Z6PA 3NORA 3DQZA 1JG6A 3WXMA 3L1UA 1NE2A 2O8DA 3NTQA 3NJRA 3IMGA 1ST2A 3OCWA 5DHRA 4WVFA 1ULTA 1WSAA 3ECSA 4HXEB 4JN6B 4XXHA 3A4IA 5HDBB 3ZCPA 1E8MA 3AFNA 4EA6A 4YQZA 4G0OA 1JHQA 1R0KA 4GKJB 3PWZA 3J81A 4J0QA 3IP8A 1DKUA 3CW9A 4ZOQI 1A88A 1V6SA 3IOBA 3LKVA 3M6LA 2Q3MA 4PHFA 1UBFA 2BRUA 4RDIA 4EFKA 5K99A 1XVLA 5KVCA 3U7FB 4C7BA 3X2EA 5KSYA 5BNWA 3H1GA 5DYWA 3GJSA 2BAGA 1JVNA 2KE5A 1ZGGA 4NCIA 1UPTA 3GJ4A 4CTOA 4G65A 1I9CA 1PWXA 3QA9A 2DPHA 1UBSB 5DM4A 4TSFD 1KFCB 4KIGA 4CDGA 2X0JA 3CUVA 4RIEA 3SQXA 2R00C 1QDLB 2YHBA 3G9XA 3ESDA 2P27A 1DJQA 3PFNA 2VFAA 4DMGA 4N41A 1J06A 5FX2A 3OE7D 1HDCA 1XNRB 3HYCA 2IBSA 4ISCA 4B87A 2HLHA 1ZO8A 1A76A 5JCPA 2G83A 1U0HC 4R8KA 2D62A 1KPHA 4RZSA 4X6LA 3OTHA 4BRSA 4KR6A 1IB0A 4IXWA 1RRFA 3GZJA 4WBNB 5H9VA 1CZLA 4WINA 3U6BA 1N1MA 4XEUA 1DC4A 1Q15A 3KO8A 3WIEA 3FR8A 4MZXA 3UMJA 1GAWA 1ORTA 2JIBA 2LIVA 1LW6E 2PSEA 2ZJOA 3I6IA 4ID9A 3UWDA 3ZDFA 4M76B 4BNMA 5KYXA 1OIVA 4FX2A 1IVYA 3FROA 4D5GA 2JANA 2RGAA 3NHPA 4PYLA 3B9QA 4MVJH 4TV9F 4CG1A 2FP4A 2HIMA 1ZPDA 3FOEC 2RB5A 4JHLA 1GSIA 1JHUA 2QUZA 1N33B 3I6MA 3ZR4B 1UDAA 2RGCA 1YB4A 2GM9A 4UHJA 2WPNA 3CUWA 4W9MC 5DNVA 3IKLA 1GRCA 4X54A 3P0EA 1U94A 1NQWA 2UVQA 3WSWA 5DLQC 4OKNA 5ERXA 5JNRA 2JLWA 2C3UA 5DP2A 1WF3A 4JX8A 1Q0UA 4WESA 5TEWA 1C0PA 2JH3A 2P9EA 1DEAA 3CJTA 1FP7A 3AJEA 3NBYC 3OOYA 4OQYA 4TWBA 3U3RA 3HKBA 5AQ1A 2PUTA 4EH1A 2B5OA 3RJ5A 3K71B 4CM9A 3EPRA 5F2NA 2TS1A 3VR6H 2WU0A 3KJGA 3L6EA 2XBLA 2G9RA 4IGIA 4XIJA 2RH9B 2XUZA 3T5GA 2KX7A 3OT1B 3AMVA 1BW9A 1ONNA 4UC0A 1XCBA 4Z3OA 1Y42X 1W19A 2H7CA 2BT4A 2VOJA 2PFKA 4C0KA 1PV1A 1KJIA 1JA0A 1EK0A 4MVJA 1QP8A 5JSFA 1JSCA 2FVYA 4WOJA 5K2OA 1ZN2A 4HO1X 4V0ME 5JS7A 4X62B 1M7BA 5K8CA 1UK8A 3BREA 4PNZA 2QT0A 2QD2A 4INZA 2QUIA 1QVWA 3GUHA 5BSUA 3OAAA 4WOCA 4P93A 2Q5OA 3HFJA 1GKKA 1KDOA 4EHFA 2PNFA 1NVAA 4KR2A 4OSPA 4DJDC 1ZL0A 1XDZA 1IY8A 1MX3A 1DXYA 3L0YA 4N03A 1JPNA 2ECFA 3D2CA 4INPA 4XAQA 4ZVLA 3THYB 1HEYA 1KEEB 4ALJA 3NI2A 1J49A 1Q0PA 1F3LA 5KTSA 3ROXA 4CIDA 2XNKA 4B4UA 4WN3A 1G64A 3IDFA 2RHHA 5TV2A 2AG8A 3EPPA 3H5VA 1ZI8A 3PTZA 4JVOA 3IP6A 4QXPA 2C2OA 4MJ7A 3RK4A 2XMDA 4L22A 1MZPA 2Z1DA 5H70A 1XU7A 3OLXA 2PYZA 1YJ5A 4LHEA 1RP7A 1RYZA 1R0ZA 1F8XA 2EP7A 3TG2A 3V48A 3GLFE 3OFND 3BSSA 2DKOA 3HB0A 1RYMA 1LFAA 2R8BA 2YY7A 5K4AA 1ZOSA 4IJUA 4KFUA 3SP1A 1SHJA 1X2EA 3F8WA 5HOEA 4BMDA 2AFIB 2COKA 3GLIB 4GMFA 4BMCA 1NBME 1JYFA 1XTSA 1QB8A 4YMIA 4NBKA 4GR4A 1U0SY 3PUHA 3NYRA 4JSTA 3JQQA 3GLQA 4RANA 1JXAA 3O8LA 4I4LA 4PYMA 4WKOA 1G8AA 3FHLA 1M1YA 3GUYA 4MEBA 4RVGA 2ZIUB 5EFOA 5T4BA 2HR1A 4AKGA 3GLKA 3DHYA 3KEFA 4A8HA 3QY0A 4WOBA 1JF8A 3H1BA 4L8LA 2AWNA 4LOJA 3RGWS 2C7VA 3W8NA 5CR9A 4PLGA 2ZAYA 1M74A 2I6FA 2W71A 1K7YA 2R47A 3FI0A 2XQKA 3NHWA 1CD5A 4ND8B 2P40A 4X1OA 3WQRA 5FUQA 5J3JA 2FZ5A 1DJOA 2G7ZA 4JLUA 4YRAA 1S2LA 2OTCA 4P98A 3ET5A 1YR1A 2XTZA 3FNIA 4FZ5A 5AOCA 4ZHQF 4FEAA 5HRUA 4L74A 4H9GA 1YR8A 3QENA 4F8EA 2NNWB 2CNDA 1C1XA 2C97A 3N8HA 5CCXA 3I9FA 4NR0A 4OM7A 5ESRA 1LPNA 4ZVRA 3I1IA 2WYWA 2HJSA 5E3JA 1VCNA 5EIAA 1MLDA 2NTNA 3C98A 2YYZA 3TINA 4EECA 3G9TA 5EIBD 3GRUA 4PZAA 5L95A 3AR6A 3VO8A 3QEKA 1T36B 3ZDCA 3KLBA 5JAQA 4EVIA 2VH5R 1DUIA 1X80B 4Y0NA 3ZNQA 4PRLA 4Y30A 3FVQA 1WXXA 4ZZ2A 4AD8A 1HNNA 1WKCA 2REBA 4PSUA 3PLNA 3AG5A 3LDHA 1SBQA 1II9A 4EF6A 4R1UA 2P3LA 1BXGA 5HJ2A 3ZZNA 1P7VA 2WAXA 3LY5A 4Y6LA 2V4MA 3AHEA 3EW9A 1U3TA 3ZV6A 4IV5A 5DH9A 3AM5A 2XUJA 1Z0FA 4YCJA 1J8YF 5CFPA 4UUQA 1N9KA 2ZAIA 1NY6A 5DISB 4DIMA 5IXSA 4ME6A 1ACLA 2GD6A 3G02A 4R5HA 4UVIA 1U63A 3BB1A 2CJYA 2Q9CA 2IWHA 1OV4A 3SSNA 5SZHB 3VSCA 3DLCA 1E7MA 3E0XA 3I0ZA 3NBUA 2AC2A 3TSZA 2O7SA 3BK7A 2AE1A 4TVBA 2RGDA 3GLHE 5F3WB 3KUXA 3ETJA 1Q0QA 1ZM7A 3K73O 3AH8A 5K45A 1OVGA 2F48A 3O90A 2BZ0A 3KZMA 5DGIA 5DI3A 3ZKAA 4BP8A 4BBZA 3P2MA 4HK4A 1SUWA 1ODSA 1AGYA 4JL5A 4RF4A 1E4EB 2HNBA 4M1MA 3V4RA 4MS3B 1PR3A 4MWBA 3DTVA 1RWPA 1Z7YA 1B16A 1S2DA 1GZ4A 2IOYA 2Y4OA 4KSYA 1K92A 1BWSA 2E55A 4PLCA 4B7CA 4IJWA 3RRFA 4BKMA 7YASA 121PA 4G01B 4LK2A 3F67A 5C8YA 1R4MB 3I62A 3V7UA 2HF2A 3RUIA 3HKCB 2G06A 1TT5A 3DULA 2FGJA 2XE6A 4FQ7A 4KGVA 4RADA 4XGIA 3CX3A 1X9HA 3R9XB 3ABSB 3QBJA 1DMRA 4Z86A 3UC5A 4HMQA 1OH7A 1QX4A 2PWAA 1W94A 3AY7A 4P9NA 3R3HA 1QC5B 4A8TA 1YI1A 3IEMA 4FNOA 1VKNA 2A7QA 3QG5A 4B09A 1AO3A 3DC7A 5KQMA 3DVQX 3S8EA 2F59A 4UULA 5K6RA 3JQFC 4Q9DA 3KFLA 2ZSAA 5ALJA 2C8VA 1YUNA 2OA0A 2VP6A 1HLGA 1I01A 1GGKA 1IEWA 1KAQA 2FSUA 2WD7B 1H2EA 3L05A 1ST3A 1DQPA 1E1YA 4FX5A 1F14A 1POWA 4KUHA 4RAQA 2ETVA 1UBMS 4WZZA 3W7AA 1A3CA 1GUAA 2H1VA 3I09A 4BLOA 1XRLA 4CR8A 5JRDS 2C4VA 3RUAA 3M3PA 3BIFA 1V8FA 3OF2A 3G5LA 3TSAA 3V8BA 3UMMA 1IEQA 4FNAA 2IEAA 2XCUA 3W77A 1N0VC 3AUSA 1PZNA 1W87A 1A2KC 3KVNA 1S89A 5FXMA 3Q3JB 5GV8A 5DN9A 2F64A 2PX5A 3OTWA 1UPXA 4UM7A 4XLTA 1MR3F 3AUUA 1RRGA 1QYRA 1LEHA 1CS0A 1RADA 4MUNA 4RF5A 4UBIA 1AJEA 4MR9A 5F7ZA 5B3JA 3FRJA 5FDFA 1M33A 2O4CA 4QLAA 2DWOA 4ZCLA 1L7DA 3IJRA 4RW0A 5CU7A 5C1OA 4HHEA 3U4MA 3DMPA 3K1YA 4CBVA 1NE7A 4EDFA 5B3KA 3S5JA 2CNKA 3LYLA 2J41A 3FKQA 1XCPA 4N8EA 3Q0IA 3FJYA 4E2WA 1WCIA 3OJFA 4N8DA 1KSGA 5BQ3A 4BQQA 3P71T 2Z1NA 4WZBB 3LKZA 1XZMA 4IUCS 3WYAA 5F98A 3PPYA 3NFYA 1M2VA 3PPVA 2XD9A 2Z5LA 4W99A 1GV0A 1RXYA 1IRIA 4EKGA 4E1BA 1KH2A 4K7JA 4R8SA 5FWYB 5CDUA 1FDSA 3TQIA 3BIOA 1P4GA 2Z6VA 3P26A 4LKOA 1WQ1R 3A1VA 4PGHA 1P1HA 1SCDA 4FYHA 1XJQA 1LVUA 1F2UB 1U8ZA 3PNOA 2XNDA 4H2DA 3TNYA 3KG2A 3OZTA 3DWFA 4G0YA 4ON9A 2I7VA 2ZM6B 2PT9A 2D2XA 1FS6A 3WL3A 4LZNA 1IY0A 1G41A 2UAGA 2FSVC 3GQBA 1DWOA 1NVEA 2EU8A 1F17A 4ZVNA 3W5JA 4ALNA 4BO4A 2PT7A 3TLKA 2PMCA 1FX1A 5F12A 3S29A 4PYJA 1ZGAA 1NU6A 3W2GA 1YQWA 3R4VA 5M2QA 2EKZA 2GYYA 5CDGA 2C5GA 2BYTA 4F2GA 1XDBA 1ZH6A 3EVFA 3OPQA 1VI5A 3P4XA 4TT3A 3OHSX 4XGQA 2M2IA 4XPIB 2WY2D 3T3DA 2YQZA 1D4FA 1Z5OA 4HQKA 4EK9A 3NATA 3V2IA 3E3NA 3K8QA 2J9GA 2V6JA 2RHOA 3KQSA 3QVSA 4DDUA 5BORA 3AEKA 2IQ5A 2RHJA 2YHIB 4D4IA 2C5HA 3D8HA 4G5HA 1I36A 4B44A 1YOVB 1AVTA 1QHHA 2YRFA 4JEIA 1AF7A 5G41A 2IS4A 6CHYA 4B48A 5HZMA 3IKTA 3O3CA 1F6DA 1FQWA 5TQJA 1WTCA 1UJ5A 2Q4EA 1AY0A 1UJ6A 3GIDA 3IPAA 4QYIB 3MUOA 4MRAA 4CDNA 3AR8A 4D9NA 4I1OA 2QL7A 3RSSA 3ZOKA 1OWLA 4FYMA 1ZCZA 4RMJA 2QWXA 3BIWA 3QV2A 4GFDA 3W5BA 3NDIA 1OF1A 2P2LA 3ENQA 3KXIA 3OO1A 4JKOA 2PUEA 3U40A 1DIOB 4OAQA 3B1XA 8OHMA 2OV1A 2J0SA 4JQCA 1B42A 1R6BX 4TWIA 3OQJA 4M1YA 5F73A 3M3DA 1I33A 1AXEA 2GZRA 4D74A 2XDAA 1KHTA 3ZC3A 4J4TA 1T2NA 2OQIA 4LN1A 2CXXA 3PQCA 2K87A 4YUYA 2QE7A 3W5HA 5ALIA 4B81A 1NUTA 2CLKB 3BE6A 4O4IB 1H2FA 1V35A 4IEEA 1JHAA 4CMBA 2XHEA 5IBCA 1G5IA 4DQDA 1FU4A 1U28C 4NK5A 4TTPA 4TKUB 3COVA 1GGEA 2BEVA 3STWA 1O0BA 3HBFA 3ILYA 4JT9A 3QUSA 3VOTA 1UBOS 2CK3A 2JW5A 4LY9A 1DBRA 2ANBA 3AR7A 4XM0A 4D9FA 1P81A 4FE3A 2QSUA 3KTOA 4GR9A 4XARA 2RONA 2X8BA 2WW8A 1LBIA 2GHTA 2GX6A 1ZUHA 2AV6A 4FE4A 2CXUA 3IPLA 2VT2A 2FHSA 2PFGA 2P2DA 3W6ZA 4F4HA 2PO7A 4H7EA 3U48A 1I5EA 2MYNA 4PLPA 5IM4F 2QTLA 3H04A 4EO7A 4QA9A 1BG6A 2ZI7A 1M73E 1J8QA 5IM5A 1E1LA 2WU1A 4UAJA 2N47A 3G0HA 4O6VA 2I22A 1J21A 3A6GA 4BLRA 3ODPA 4DSZA 3VR3D 4XQ9A 4EY7A 2VDNB 4GI7A 4BKOA 3V33A 2PGLA 3TBFA 1CJBA 3OECA 2XUGA 4IHJF 5IKMA 1CZHA 3FZGA 1HQCA 2HU8A 3U4HA 4LC1A 4A0QA 3FTCA 5ITWA 1LLDA 3HWX1 1OYOA 1FK8A 1N2SA 3MB8A 5HF5A 3IAM1 1W8IA 3NRJA 3W06A 1PGOA 4ED9A 1QH8B 4OLJA 3IAUA 4I1RA 4RSMA 2D1QA 4RY2A 5AI9A 1A9PA 2JFBA 2WHXA 2YWGA 3BRWA 1DQRA 4RKRA 3DE1X 4N7MA 4DHWA 3OT1A 5K8IA 2A1TS 5KC8A 5CM9C 1DTEA 3D31A 4J1QA 5CCEA 3MPOA 5L3QB 3EGWA 4OG2A 4C7VA 2UUAB 3ZW7A 5IAAA 4H4DA 4QYMA 4C2BA 5IBPA 2VHVA 4RJTA 1GG5A 4RELA 2AG6A 4NDNE 2HHCA 3MERA 4OQFA 2NSHA 2W4IA 4I4NA 5KU7A 2P77A 5CH5A 3BMOB 2BSAA 5I8WA 5CFRA 4F5EA 3A1DA 1C30A 3LVRE 4JLSA 4RDHA 2G3YA 4LZWA 2BDUA 4JP2A 4URVR 5GIPE 5CMLA 5DHAA 2OXTA 5AMXA 5T5QA 1E9SA 2R5NA 1YE5A 5HF6A 3ZTWA 4MSUA 1KEEA 4IL5A 3BMNB 3N1UA 3EAGA 2ZXEA 4J03A 1B43A 4MHSA 4BXOA 4KQCA 1X7XB 2R87A 4FWBA 3TXYA 3UK6A 3DLIA 1H0HA 1FFXB 2HRZA 3Q7SA 4C5BA 3M1IA 5DASA 1KOLA 3U9LA 1E1QA 2BGMA 4OL9A 1JIKA 3KT8A 1YACA 3T5CA 3FMGA 3L41A 1SCUB 1KO5A 3L04A 4KAXA 3H5AA 4V2UA 5C7YA 4ZDWA 1DC6A 5BR7A 5DBIA 2JJ8A 2E4ZA 3PKJA 3E61A 4DLKA 1E2BA 1D5CA 1RMTA 5T4HA 3GJXC 3K5IA 1O9GA 3QVMA 1E7QA 1IBSA 5LJIA 2PCJA 2QPTA 3GLIA 1M66A 3GJYA 2YR0A 3IBCA 3QQPA 1YS2X 3PFIA 3QVXA 2P5YA 2P8SA 3NP7A 1M6VA 3DAGA 5T6MA 3RT7A 3IE1A 3F71A 4RPCA 4QJIA 3VC7A 2I2WA 5EEHA 4XCQA 5IVHA 2R65A 2RAPA 3E5RA 4GDMA 2JLYA 1Z8HA 4AAYA 5H9WA 1J42A 1FNBA 3HXTA 1M2HA 1V5WA 3U0VA 1MXHA 3UJHA 5DWQA 2C7OA 1FFWA 1OR8A 3E6AA 4Q1VA 2YV1A 3GZ4A 5FUVA 3CEMA 3DQQA 3I9V1 1XKXA 3RJZA 3RYFB 1T9ZA 1DBVO 1JHMA 1HWYA 4F45A 4O4HA 3SMVA 3MJRA 2ZWOA 2YS7A 3O4HA 3N3AC 1OCEA 4MUMA 1SCBA 1QIFA 3BE4A 3COZA 4G5YA 2WICA 5EC8A 1S1CA 4F1KA 3JARB 4H27A 2XOKD 4MYHA 1FVXA 7MHTA 3UY4A 2IE8A 3PHJA 3WLOA 1C3LA 1FNNA 3C5EA 4I3FA 2WSYB 3DTTA 2HTFA 2ORED 4LZOA 4P82A 2ZRIA 4TTRA 5KTYA 4PICA 3ZHTA 5FD8A 4DQVA 1YRYE 2AD5A 4TRRA 1CZNA 4NYMQ 4P4NA 4KE9A 1SNYA 3I2KA 3LSTA 3T1QA 2A5JA 1T36A 5AT1A 1QGUA 1RXCA 2QVBA 4MW9A 5BOVA 3AU9A 3TI7A 5DN6A 4CEIA 3R8CA 5IK2D 1AKUA 2D8AA 1O5OA 4R3WA 2WWXA 1VJ0A 4OHRA 4X3PA 1OJ7A 3CRRA 4A6PA 4RTMA 1DADA 1A9RA 3EG9B 2C5SA 3FF1A 4J3FA 4PRYA 2PS9A 3IHKA 4C87A 4C20A 1RI2A 1T9DA 3FDJA 3LX8A 4P7JA 2R11A 2BI8A 3UHPA 4KQHA 3QJYA 1YNOA 2B7LA 2H11A 4WCFC 1NBIA 4L9SA 4TQAA 5A9TA 3UT6A 2G9VA 4PVCA 1W47A 4EOGA 5AVOA 4X7MA 3DHWC 2ATXA 1IBCA 4HGYA 3AOEA 1OTYA 1H0RA 4E70A 5ICEA 1D6MA 4KPYA 5DCUA 2RFLA 3DP9A 4EZIA 4MKIA 2ZYDA 1QO7A 5FF9A 2QBYA 1W0CA 1KZ9A 2WWGA 5JXIA 3W3AD 4KP7A 5DM70 4HAWA 4DIOA 4AMGA 4RJLA 1H22A 3K0BA 4OYRA 3ZNOA 2Z2KA 1N0UA 3TZCA 3G9ZA 4CN8A 3MTGA 4D26A 1EGQA 4IDOA 1NR7A 4WA8A 1XUOA 3E81A 2W7TA 3DV0B 5ES4B 5HUJA 4L4UA 1VYTA 1CQJA 3PUJA 2R6ZA 2WB2A 5JD5A 3LLCA 4MPJA 5FQOA 1VRCA 1QU2A 2QMQA 1OD6A 1JHDA 4JIGA 1W4CA 1ZMOA 4WNAB 5BSFA 1X6VA 3BFJA 3O2JA 4R6XA 3M70A 2EJVA 1RM0A 2F3PA 1R4MA 3H9BA 1KOGA 3NH9A 2H5LA 2X8JA 4HFRA 4CF5A 1FRNA 1QKJA 3AVXA 4FT2A 1TX4B 3EFOB 1SCAA 3R9WA 2C2ZA 2HOQA 5J5VA 2V0CA 2CGEA 3FYUC 1E62A 10MHA 1Q84A 2G5PA 2WLSA 2PR2A 2O3JA 4P3OA 4FYVA 1QC5A 4JT4A 1C0LA 1N57A 2C4KA 1D6NA 3I9JA 3ZN2A 1V1RB 4U3JB 4NHOA 3A4TA 1I9GA 1SKAA 3AHIA 1LSOA 4FSHA 4IP0A 3ZK8A 2WD7A 3MA0A 3AHCA 1VZ2A 3JD2A 3LY9A 2D4AA 1QOQB 4PLVA 2L0XA 1SEVA 1HYGA 2AJCA 1G8YA 1U2EA 1FXSA 4NV1A 3UV7A 3DA8A 4HF7A 4KYIB 3PKIA 1OFTA 1XU4A 3IVGA 4HZUB 3EZ2A 4DCUA 3D8BA 1P8AA 2I4OA 2XUAA 3GDFA 3ENWA 1NUAA 4OK3A 1S7GA 4RETA 4YNBA 1UBEA 1MG5A 2AFHE 5EMLA 5LYYA 4BPBA 1DLJA 4Z2AA 3FFTA 1E3IA 3EHEA 2NT4A 4ETWA 3MUNA 2BFCA 4M37A 1H65A 2AZ4A 3KUCA 4F72A 1BMQA 1EHYA 1R18A 3FNFA 4Y2XA 1CZUA 4ZOLF 3BDIA 1TPYA 3NYQA 3O84A 4PX5A 5FNVA 1TEZA 5DIZA 5LQDA 1Z3CA 3RUHA 2O2DA 2JEYA 1RP1A 1Z63A 1LX7A 1P61B 5KQSA 1G98A 2C7RA 2RHLA 3WIBA 3NGLA 2R86A 1PGQA 1Y6FA 1Q0HA 1GU0A 1Y9AA 2V7XA 1WEHA 2AI3A 4ZAZA 4CKCA 6PFKA 1N5DA 4J3NA 2R1VB 4RYLA 4XUDA 1XWFA 3WYDA 1VJRA 3TLYA 1EWYA 1Q7RA 2C2XA 3A1WA 3ICQB 4RHFA 1WP9A 3LH5A 4WZBA 3EZYA 3OTQA 2Q7XA 4RJKA 4JUCA 5AIAA 1JR4A 1QYIA 3OKCA 3NVAA 1X1SA 1EX7A 3LYUA 2FEWB 3FCEA 5H83A 4G25A 3SHTA 2FN8A 3TZBA 1P2BA 3OZCA 3S2FA 3HDGA 4GX2A 5IHPA 1EA7A 1U7XA 3MRVA 2B2NA 4LF4B 2NO7A 3BXGA 3RK1A 4MUEA 1F2UA 2O2IA 4FYWA 5EWJB 2IZ7A 3I83A 4EM6A 3A9VA 4F8YA 2X5KO 4MUGA 1M2WA 2JZCA 1IWOA 2NV6A 3DEHA 3MIIA 1TD9A 1GPYA 4POAA 3E3MA 4XDHA 3TLMA 4GMHA 2XGOA 2F17A 1UBUS 1HI9A 1NULA 4RQUA 2IIQA 2GOYA 4YCBA 1TJYA 4BFTA 1SK8A 1T6BY 4DLYA 5JEDA 4I1YA 4CKWB 5JVDA 3AVTA 1D9XA 3HKDA 3CF0A 3DCJA 3IO5A 1O95D 3L1IA 3Q9LA 4OP2A 2VG8A 3EBOA 4U7FA 4U6SA 2XXBA 4A8JC 1SKMA 2AEMA 3R3ZA 3CU5A 5JR3A 3TKAA 1EU1A 1DJPA 1LY1A 2K7ZA 2SECE 3DMGA 4XPIA 3EGCA 5FTWA 3EOZA 3AZQA 3Q8XB 3KXKA 1CF2O 1TIPA 4HB2A 4GX5A 4KIWA 5J5CA 4M9XA 3SC2B 5LIRA 3CO5A 1EIWA 2Y1GA 3CLSD 3WK5A 1MKYA 1XMOB 3UO8B 5ALLA 3RYTC 2YHIA 4DA9A 3HL0A 1IM5A 2DHEA 2KLBA 4K9RA 1AS3A 1YOVA 2ESRA 4KI0A 3TCNA 3IP3A 1ZG3A 3KOXA 3OFKA 4QSHA 4YGYA 4LXYA 4CMAA 5JALA 4P0QB 1U11A 2H2GA 1JUDA 3GUUA 4LRSB 4PYNA 5DX1A 5TSDA 1GV1A 2CLSA 1KYZA 1D2HA 1NRWA 1IDOA 4P3XA 5C3UA 3VC1A 3L8GA 1SVMA 4FDTA 4ZJYA 2ZRPA 2GZ3A 1YR6A 4K9OA 4HATA 5DBEX 5JNLA 5KOJA 2V8OA 1HLPA 1XX6A 4GPTA 2ZR8A 1ESNA 4B7UA 1SU8A 3KQWA 3WB0A 3FVTA 4HT3B 4OKSA 1BHQ1 1D4ZA 1ENYA 2ONZA 3NWBA 4CT0A 3S2ZA 5TC4A 5C81A 1Z2EA 1DUVG 3BGWA 3HCDA 4RTQA 3CVVA 4U9HS 3P2OA 2B5WA 2DSTA 2GNAA 3SYMA 3IVRA 4F91B 2GK6A 4CEHB 5L3VA 3PG5A 4BBAA 1ULHA 4PONA 1JZSA 2FF5A 4DPKA 4QELA 1EDDA 4KQXA 3ZWWA 4B46A 2PLAA 2JGKA 2WJIA 4MIEA 3ZKWA 3AB7A 3FIUA 4KO3S 2Q4TA 3AGPA 4MAMA 4M83A 5BN3B 3EXHC 1J2TA 5EMNA 2H0RA 2PD4A 1E3JA 2P79A 1MO5A 4TKUA 1VHTA 1PT7A 3W2EA 2HMTA 3KKEA 3KKKA 2V7BA 5JCOA 3TVTA 2ZJYA 3TLEA 3V1TC 3ZE8A 4AS2A 4HNVA 4RZUA 4PC2A 1F1JA 3ANYB 2VWGA 5HFNA 3H84A 1Z6YA 4KWCA 1HZZA 4M9UA 1HPLA 2NOAA 7MDHA 2D5IA 3O4VA 1F8FA 4EARA 1UMDB 3EDYA 4YX9A 2RJNA 2ZQYA 2UUPA 4GLFA 4A92A 3A1FA 1YRBA 4I55B 4XTCS 3UV3A 3KOYA 1SULA 2BF7A 1FPMA 2ONKA 3M4JA 4J07A 4WKGA 4BFXA 5I7WA 1UBGA 2QX8A 1A4IA 3BSYA 1TM5E 1V3VA 3K09A 4NPHA 3E9NA 3PNYA 1DHTA 2LNDA 3G2MA 3D2AA 2A9QA 421PA 3CLVA 1YRAA 3ES9A 4K0KB 3SY8A 4DV4B 1XKQA 4QUKA 1XWWA 3QU7A 4JJ8A 3WLQA 4PY2A 2IZZA 3FMVA 3BVPA 2X3YA 4BMVA 4DILA 2R8YA 1AO0A 3RIXA 5K6AA 3LC0A 2PT6A 1SU6A 2ZB7A 1B8PA 1R8QA 1O9BA 3OD5A 4JLAA 4KEAA 3CCBA 4ECEA 3FLEA 2WOOA 4ZO8A 3GFSA 3DVRX 1J9EA 4NU0A 2C1ZA 3T4EA 3ADKA 2NUBA 3DVSX 2C07A 3CSSA 4EG0A 5C9ZA 3MUFA 1KVTA 1QH8A 4IIJF 1QIMA 1DAFA 2D0DA 4RDCA 5J2TB 5H81A 3CRMA 3F4BA 2G70A 1Z5ZA 3PHHA 3PX2A 4TYWA 3PT5A 2JIZD 4MMYB 2V3VA 2DQ4A 4J7XA 4PPQA 1CK4A 4DXHA 4DA4A 3KYDA 1RNLA 2L19A 3TTYA 1OY1A 4Z4GA 5L3QA 4NTZA 1L5MA 2WD8A 1U7ZA 3OH8A 3QYJA 4B82A 4HN4B 3EPHA 1O95C 4DV6B 2JS7A 1SVSA 2JZOA 3S4YA 5FAKA 4IX1A 4PR0A 4NCKA 4KLCA 3PC8A 5YASA 3CG0A 1EK1A 3LX5A 1YSCA 4I50F 3BMOA 4L16A 1UBHS 1PFGA 2GPAA 3IX7A 4RD6A 3SIXA 1BEUB 2JK0A 3D4LA 1DEXA 2B36A 3GEPA 3UYLA 3ZQKA 2GN9A 4LE1A 4B79A 4UUBA 5E7QA 4B7ZA 5HUHA 2R4QA 1T2DA 3CLTD 4MQFB 3B1YA 4HDKB 3IXMA 1MENA 4LBWA 5IN5A 1OYVA 5D87A 2PMFA 4RO0A 1JTFA 3N0TA 1M6EX 4TXHA 4H7JA 1XXHB 3NHLA 5FADA 4L72A 1XQ9A 4GPAA 5LBTA 1N32B 4UDXX 2BFMA 3FNBA 4OV6B 2NO1A 4OHYA 1DPGA 1OA1A 2JJ2A 1J39A 1FFXA 4QFCA 4D25A 1GZ3A 3DKPA 4MW0A 1RAFA 5EVCA 5G3ZA 1W25A 1JFLA 1N9ZA 2NQ8A 1UMBB 3E7PA 4JX9A 4BLTA 4KTTE 2REOA 1PBTA 1Y4UA 5DLDA 5L6MB 1JFSA 5REQA 2ZG6A 2CHGA 2H4FA 3CF4A 4OPMA 3KAJA 3D8UA 1J8VA 4HUTA 1NBAA 5HZHA 2OB2A 4RGVA 3TF5A 2VQ3A 1CF4A 3IAXA 1TD1A 4E5VA 1WXIA 5K6TA 4W9NC 2G63A 2A5YB 5TJHA 3GT3A 1GVNB 3KFXA 3LW7A 3WL4A 1X7WB 4XH9B 2GYVA 4YAIA 3GFPA 2F3QA 4FMCF 3WMFA 2C4NA 4FSDA 5EP4A 3MS4A 2AJBA 4MV4A 3IAM6 1H4QA 3N2KA 5CVVA 4DR2B 3OUZA 4DREA 4BPRA 1JQJC 3RYFA 2ALJA 4ZRNA 1EXNA 2WA2A 4N4AA 5HMMA 3VTZA 2HPVA 3A26A 3G9QA 3UHOA 3V1UA 3P9PA 3DUFA 3ZGVA 4WJZA 1KC3A 1BCSB 1ZESA 5E6SB 2ZRAA 3OCUA 221PA 3S7TA 2BGLA 2Q5IA 3PHIA 3IBFA 5L6LB 3MMSA 3K9HA 4PSAA 1M75A 3CUYA 4NOMA 3O1LA 3P9RA 1QCCA 5JDCA 4BFWA 4O2RA 5C35A 2PCLA 4R1TA 1Z45A 1TF2A 3MEQA 5FFMA 4DRXB 3BRSA 4P4SB 4TZTA 2P41A 1GPLA 3UW3A 5JPCA 1URPA 4BFVA 3WWOA 1JR3A 3VSBA 1I1HA 2IIPA 4UHCA 3QKTA 1WA5A 2JI8A 1T0HB 3WL5A 4GBMA 4RFSB 3V1KA 3D8SA 3K35A 1D0IA 1YR3A 3ZH9B 1VJDA 2DSNA 3HA7A 1JU3A 3C6KA 4U7JA 4ZC8A 2IPXA 5F7OA 3R44A 2IODA 1KDZA 2H31A 1KWGA 1U1CA