4KXNA

Crystal structure of dnph1 (rcl) with kinetine riboside monophosphate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
131
Chain Sequence
RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAGGDQFIHEQNLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
total genus 49
structure length 131
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kxnA00
4OHRA 2F64A 3IMKA 4LJRA 4JENA 4I7EA 4LJLA 1S2IA 4I4IA 3UQZA 4MCJA 4P5EA 3O8OA 2F62A 4I36A 2F67A 3BQ9A 4OHBA 4KXMA 4KXNA 3PFKA 6PFKA 3GH1A 2PMBA 3HNOA 5AJUA 4PFKA 3MAJA 2IZ7A 4JEMA 4LJKA 4A3SA 4HX9A 3O8NA 5ITSA 2HIGA 3QUAA 1T35A 2F48A 1RCUA 2Q4OA 3OPYB 1S3FA 2KHZA 4FYIA 3SBXA 4FYKA 4JELA 3F5MA 4WL0A 1PFKA 1KZHA 4FYHA 2A33A 2A0KA 1WEHA 3O8LA 4MEJA 2PFKA 2Q4DA 2KLHA 1YDHA 2IZ5A 4U1RA 3EHDA 3O8OB 4P5DA 2NX2A 4RH3A 1WEKA 4KXLA 1MTOA 2IZ6A 1S2GA 3K2QA 3OPYA 5AJTA 3U39A 1F8YA 1F8XA 1ZXXA 1S2LA 2F2TA 1S2DA 4NPAA
chains in the Genus database with same CATH superfamily
3HFSA 1ULAA 1ACMA 4NU5A 1FP4B 2ZJYA 3LF2A 3NM5A 1EH5A 2IGTA 2OHOA 4W6QA 1PQYA 5GMOA 4KX3A 3PENA 1BDBA 5ADUS 2BI8A 1W36B 3TTXA 1FLVA 3QVTA 1YTLA 4YIHA 4P32A 4JD5A 1F6BA 3RK1A 2RE8A 2BGIA 4FMCB 3W8EA 4MYTA 5EMKA 2QGFA 1B8OA 4V24A 1OI7A 2VT7A 2BZGA 3HZRA 4KK4A 5JRZA 3COPA 5MFZA 5AUOB 2CMKA 1H5UA 2ZKIA 1F7VA 3I9MA 2ZXFA 3IEMA 1X42A 1IB0A 2HO4A 2QZ4A 4NCXA 4PZPA 2Q0SA 4WLOA 5FL7D 4R9NA 1ZJJA 3N58A 2X5KO 1N92A 4Q19A 5GQSA 3OCWA 3PDIA 1E5QA 1M83A 4DQXA 5FI5A 2HADA 3AP2A 1FUKA 5A6SA 3R7WB 4UQOA 2IZ0A 1Y3IA 1UOQA 2IHNA 4GG1A 1EI9A 3TIGA 3RS0A 4TTJA 3TLEA 5E6UA 3FPCA 4V39A 3M6LA 1V2HE 3A0UA 4IDGA 5DLEA 1GPKA 4DIUA 3BAZA 3D2CA 1Q84A 3MTQA 4M0FA 3WOVA 3ZCXA 5D8DA 3UKDA 3AF6A 3VO8A 2A6PA 4L0QA 2IXFA 3P2IA 3CCCA 3Q4GA 3GDGA 3TMAA 1TVKA 4FMDB 2QRKA 2BH9A 3QWAA 3F9CA 2CFTA 3KR1A 3PQ6A 4QPDA 5KREA 3KQVA 2X41A 1OV4A 1MVOA 3KOOA 4EUHA 1IUKA 3ICPA 1OPRA 3Q2IA 4GKVA 3EY4A 3OJCA 4Q5IA 1CUCA 5IU6A 3REOA 4KVGA 4OP2A 4A36A 1KAGA 4FLEA 3ZQUA 1SQ6A 4TL8A 4ZXPA 3ABRB 4N3NA 1VKRA 1OAOC 4KXUA 3QEOA 4OGWA 4UDOA 2OR3A 2O7VA 3X1MA 3LD9A 1PFUA 4B1FA 1KEEB 2HPHA 3MTBA 4E2YA 3J7AC 3PDIB 4U6SA 5LA6B 1Z7GA 1RKUA 5B36A 4L5YA 4HDRB 1I6KA 3LT2A 1QBKC 2AOTB 2HPAA 2D5AA 4OP1A 5B1HA 2J3MA 5IVDA 3V55A 2AE2A 4QKQA 2OHIA 5KVVA 5K8UA 4HTFB 3ZWXA 4LSMA 4TZ0A 1QF6A 3HUTA 2NO4A 4HEA1 4EY4A 2IPOA 5BOVA 4ZT6A 5BV7A 3H4IA 3HZHA 1IONA 4IXTA 3GW8A 4R16A 4JXXA 1C7EA 1Q3TA 1X9IA 1QGUA 3DCJA 3DVRX 1E20A 2FX5A 5CFRA 2QRHA 2EIXA 1FW8A 4P7JA 13PKA 1Z6QA 3KOWA 4UBOA 4MEJA 5TARA 3L07A 3UZUA 3M5CA 2E4ZA 3N7AA 2BBWA 3GIWA 2WYUA 1RVDA 2D0OB 2LCFA 1T24A 2YWEA 3PCXA 3VV3A 1T29A 1U0FA 2R6HA 3HCBA 4FMPA 3MTGA 4G1UC 4RC9A 4W5NA 4S1OA 4RH3A 3T0GA 1E64A 1M6VB 3E05A 4G1MB 4CQMD 4DQVA 4EGFA 2ZKLA 3TTWA 4DCSA 4JLVA 3GROA 3VAAA 4LDPA 1MGOA 1L3IA 2FU5C 2HN9A 3AZPA 4QG7A 1ZH4A 5F33A 2LCQA 1OVGA 2Q1WA 4FKBA 1EFVB 2J3DA 5CK4A 5A7FA 5K3FA 5DI3A 5I7EA 1QDLB 1VI2A 3FCSB 3MWKA 4OXIA 5THQA 4AWXA 5JANA 4GLFA 2SBTA 3NONA 3W2EA 1TF2A 3KVYA 3WRYC 2AC4A 2L17A 3C70A 3PEUA 3OAAD 4IVRA 1LX7A 5IT4A 2FCAA 2GZAA 4R1TA 4LNUA 2XQIA 3ADPA 3J80A 2ZIVB 4J43A 4WJZA 4F85A 4YAKA 4FQ7A 4C89A 1JHZA 4HDSB 4GGOA 1UM8A 3CWCA 5FR2A 1W36D 3ISTA 4U7TB 4F4UA 1ESCA 1RADA 3DE0X 3HCFA 3RHTA 2RHMA 2EFEB 5JZOA 3A3YA 3OLVA 4IIUA 3S6JA 1OU0A 3JWIA 1OUMA 1PVDA 4QASA 1TCBA 2JIDA 4X7MA 3V33A 1YF3A 5FRDA 2ANBA 3SQDA 5CEJA 3RS9A 4CIBA 1ETUA 3S2IA 4QBFA 3NZEA 4TQAA 3RAJA 3O2JA 10MHA 3AVYA 3W3AA 1TRHA 4IXDA 3CE9A 3F6SA 4RDHA 4EABA 1WETA 7MHTA 3WKAA 3I9NA 2NO7A 2CNNA 3H1TA 3AM3A 4IQ0A 1ZOPA 2BEUA 1AV7A 3MILA 4A23A 2HSEA 4XSVA 5GV7A 5JXIA 1UMDB 2VJAA 1MFZA 5A9SA 1KP2A 3HMKA 2UKDA 1BYIA 4RM2A 1QU2A 3GL9A 3W5SA 1M74A 1CRLA 3LO8A 5AI0A 5KNBH 3AV0B 1OLOA 4CEIA 2AEMA 1COWA 2GO1A 3HKDB 3I28A 5H4HA 5ICGA 1UBHS 2IJGX 4K7JA 1OAKA 4Q1EA 5JNVA 3MTEA 4N5NA 1FDRA 2ZAGA 3M34A 4EG1A 1YH3A 2OMKA 2A92A 4BXOA 1GUBA 2PUDA 4O2AA 1B6GA 1AQNA 3WE7A 2R44A 2B1JA 1E0KA 3PK0A 5T67A 1HSZA 2P4UA 3PPWA 2CK3A 1T9HA 1MN6A 4FOPA 3OT4A 2VZ9A 5CB8A 4F2DA 3H42B 3IODA 2QBYB 4PINA 5FBVB 5DTQA 1KEPA 1RQPA 3PFHA 3PPYA 4OA5A 3UJ9A 4WKPA 4WW0A 4BVFA 4WBNA 3PX7A 1GGJA 3B6JA 2OFOA 4FGZA 1ECBA 3LFUA 5KYNA 3L9WA 2Q4BA 1FNNA 4TKVB 5CNKA 4YROA 3FYSA 5D7NA 1YMQA 3EGWA 3LUJA 2E3JA 5DYNA 3NT4A 3LX4A 5CCDA 3D2LA 1FRFS 2QLTA 2HFKA 3D4NA 1MEJA 2VSFA 2WAAA 1IEQA 2XT0A 3BB3A 3L7DA 3LC1O 4D2IA 1H1DA 1Y3HA 5FUQA 1I13A 1PU2A 1RWWA 5ARBA 3UWDA 1I1HA 1GUDA 2GN2A 2WJJA 3TQQA 1XN1A 3H6GA 5I7VA 2VTBB 2UUAB 1QR6A 3IPRA 2QJRA 2QQFA 1ZVMA 2D2VA 1PR5A 3UWPA 3KEMA 2C8VA 3UHOA 3C3WA 1N77A 3BGVA 1EU1A 2G5CA 2NYVA 5ETJA 5BSTA 1OA0A 3QJGA 3N5KA 1VJTA 1WXEA 4HADA 2O8FB 2DPYA 2XCTB 2WWHA 4ZT4A 5IT5A 1XXLA 1F4PA 2XI4A 3REFA 2OP1A 4P5DA 1CUZA 5F98A 1U2DA 4X95A 1PG0A 3WDMA 1U98A 2YCLA 2ZCUA 3OZWA 4D9CA 1FJHA 1TTQB 2C78A 2W0MA 2WZQA 5LVAA 5FNVB 1XZHA 2GSDA 2ZZMA 5AJYA 2J0EA 4UHHA 4OREX 4PG4A 1MVNA 1RM3A 3H05A 1Z2CA 1KO8A 2DKNA 2ONCA 2QRGA 1P0QA 4MB0A 4P0TA 1U04A 2ZM6B 2R6DA 3K9HA 1APBA 4LE1A 2ZRAA 4IDDA 4RK5A 1SOUA 3DUWA 5J5AA 3VHLB 2NZJA 2PUCA 1E0SA 4QRHA 3PE4A 3ITDA 1BX3A 1WUJS 4Q01A 4Y6LA 3TLYA 4E12A 2FE4A 2Q07A 3I0ZA 1D9XA 2A5GA 3ZDDA 3KQWA 3OQIB 4I1IA 4N3BA 3R7DA 1D5CA 4F6LA 4RS3A 2EKZA 2Z2ZA 3R3WA 1C30B 2I65A 5E9JA 1BJRE 2DSTA 1A5TA 3O47A 4GOJA 5DLQC 4EPVA 3E9DA 4BFZA 4XUGB 4G1BA 4R68A 2VO1A 3AUFA 3WGQA 4CR7A 1A27A 1UJ4A 1YJ5A 2R1ZA 4GMDA 4INZA 2POCA 3M5DA 3NIGB 2HA3A 4G4IA 4NCNA 2YYAA 3BYZA 3CSUA 3FGOA 1PX2A 2IYFA 4HEA6 2HHLA 3V4OA 1H5QA 1O94C 2B2CA 2FN8A 3ZDQA 1FF9A 4D4LA 5C5DA 1X1AA 3NANA 2HLDD 4TVOA 3OURA 2D3WA 3KLMX 5DNAA 1N36B 1RAIA 2BV3A 4YAIA 4JBGA 2LDXA 1KJ8A 4PLTA 1CLEA 4XVUA 1T8TA 3Q87B 4OHMA 2G83A 5DNEA 3TIXB 1RXUA 1EVJA 2IYQA 3MK31 4LWQA 1E60A 2RIPA 3UJ3X 4I55B 4XARA 1VC2A 1ML4A 3SQXA 2PH5A 1VCHA 4UTZA 4ZVVA 1UJ2A 2AYYA 1NWHA 2JBAA 2IH5A 2CNWD 3UF0A 5C2JB 3TSYA 1W52X 2XE6A 1W1UA 3TNFA 2EZ9A 4BWYA 4CM4A 4O4IB 3A6PC 2VAVA 4PHCA 3VNQA 1VE3A 1EBUA 5JBIA 3G79A 4MDYA 4OQFA 1ZJYA 3CN7A 5AYVA 3CFYA 3RV3A 3EXFA 1SXJC 4IYRA 3NHLA 3O0TA 4P1ZA 3CUUA 5E2BA 2ZUWA 3FWPA 3H9GA 5HQJA 2H65A 4G6ZA 1GRCA 1Z0SA 3AVUA 2BCEA 2JHPA 2PXXA 1DTSA 4UVDA 1S5PA 3VR6H 4OFWA 5T5QA 4G24A 4LJ9A 1XCOA 2VHVA 3UEOA 4XYLA 5HF8A 3MVEA 3FDIA 5ENDA 1A8IA 1VYUA 2OV1A 4ISBA 2UZ4A 3UW3A 5DHFA 3VUFA 3HCPA 4MS3A 4AN4A 3MS7A 3ONDA 4OLFA 2HO5A 1MABA 1XG5A 3R3HA 2O5CA 1Z8DA 2RDMA 3JQPA 4UAGA 5CYPA 3K09A 5GTDA 4QLOA 3O3CA 1LQUA 2CLKB 2B4AA 3EE6A 1CUGA 2LWIA 2QM3A 2NYUA 2WKQA 3IHLA 4C5CA 1CJUC 1P7WA 2QZSA 4P4NA 3A2LA 1FSZA 1OLSB 4QYMA 3PT9A 2E1RA 4M53A 1SXJE 4JI6B 3NYIA 5T7BA 1OGJA 1Z5UA 3TE7A 4CBVA 3QUBA 3AI2A 4KQFA 4NPCA 5IT0A 2NU7A 5E3HA 1ZUHA 4L5IA 3QVVA 2D2IA 2QSJA 2XUPA 3TZBA 1BXRB 3VU9A 2BISA 4W5OA 3NVMB 4O2LA 5FTNA 4AMVA 2QUHA 2ZRDA 5IDVA 2PZMA 1OH8A 3ORFA 1VXOA 2FA9A 3K0CC 1CULC 2ZWPA 4OYRA 2D7DA 2H57A 2JGKA 1BGVA 2R1TB 3DQQA 1KS9A 2RHLA 1G5QA 3Q7EA 3ZDBA 4M8IA 1BW9A 1X1DA 3UA3A 2PFGA 4KQCA 1S2DA 2O2JA 3DV9A 1OWPA 2YW2A 2ZE6A 3IKMB 4INOA 1ZUNA 1OFHA 4FJ0A 2DZDA 4RJKA 3PVSA 2FZEA 2HJVA 1BN7A 2H5IA 3K1JA 2JW5A 3DFFA 1QYVA 4S04A 1T8SA 5LQDA 3OIDA 4ZALA 1TZ2A 2X40A 4IWXA 4Q15A 3S1AA 3T9EA 3AM4A 1QJCA 4GSYA 4DCCA 1E2MA 4BQPA 4EA7A 5JS2A 1N6LA 3N1UA 3FKSA 5LOVF 4YHBA 1KQOA 1QTRA 2H2GA 1K8RA 2JH8A 3GLKA 3L1UA 5HIMA 5C35A 1FFCA 2PPLA 4H27A 2VDPB 2XF8A 4JCOA 2CL0X 3V6MA 3VSCA 2II6A 1H4VB 3FVTA 2QTWB 1U3UA 4GKAA 3S2UA 4DVGA 3QTLA 3NBQA 4QEZA 1GGVA 1KZ1A 2XSZD 3IS3A 3CPHA 3MN1A 4L50A 4RV4A 2D62A 4Q24A 1F7UA 1GO2A 5HBGA 5CA1A 2W2QA 4Q4CA 3DB2A 4D0RA 3X1YA 4H0CA 4MGKR 3THRA 1PV2A 2HRZA 3NKLA 3BD7A 5MGNA 1RQNA 4D02A 5GONB 3DTNA 3H9QA 4K9LA 3WGGA 1U6JA 4H3HB 4MUJA 4OI0A 1B8UA 1L5KA 2VJKA 4G0XA 1W5SA 3QKTA 2XBMA 1MIHA 2J9RA 2IDZA 1BJTA 4TQUS 2JJ2D 2J08A 5HTKA 3OM9A 4XYGA 2M32A 4D9KA 1KHTA 2R6JA 1V25A 1NUTA 2PWBA 1EIZA 1LRJA 1GDHA 2GN6A 4M8SA 4TYMA 3UV7A 2PYIA 1SBZA 3A4LA 3R3ZA 5EJAA 4TZ6A 5TT0A 4IPTA 4C30A 1AF4A 5EA2A 1BE0A 3P2KA 4GRAA 2H00A 4OFBA 4ENUA 2BKXA 4PSKA 2BMEA 3UJDA 1FYFA 4KODA 1YQQA 4RV9A 2H1RA 3L0SA 3ROZA 1HXHA 3N0TA 4MPTA 1ABBA 1S2MA 1E63A 3LKVA 3L7YA 3KWMA 3NXKA 1LPMA 4UD6A 1JBQA 3WVNA 3CGGA 3WGKA 3NOOA 4V2UA 2XTMA 2JNWA 2Z58A 3SZMA 5LXTB 4C0HA 1RCUA 4PGHA 1AQLA 2QPOA 2JCYA 4LWPA 4LF4B 3CEHA 4C88A 2BSXA 1YVUA 4BLUA 2W00A 3NBFA 4J16C 4L8GA 3ETLA 3CX6A 2C1EA 2PVPA 3RJ5A 1K8YB 1WX1A 4QLAA 2ZU6A 1CRQA 1F3OA 3EC7A 1TAUA 3K0KA 5C8ZA 1WSWA 1G60A 2P2CA 1NBAA 2GEBA 4MR7B 3DOHA 3QVLA 5JISA 3V9AA 4EELA 1JHPA 2BSQA 2Q3HA 2BGMA 2DQKA 2VT3A 1JWAB 5DO9A 2QXYA 4DLLA 3CUSA 1M1YB 4J29A 4KO2S 4C1BA 1KYTA 5CBPB 1ZONA 3BRWD 1NN1A 3L0ZA 5DSZA 3NHAA 5CJ2A 4D46A 1RYHA 4HRAA 5KSYA 2EP5A 4ZK6A 3D5QA 4F84A 5DPMA 4D26A 2V3CC 2Z6VA 3LE8A 4FEEA 4W8GA 1F0YA 1PR9A 4LECA 4TS3A 5DHUA 3S0JA 5TMPA 5G3YA 4X64B 3QF4B 4US2R 3QA3E 2QJOA 4O3MA 1WVGA 1TXGA 1B14A 3WIVA 1JTEA 1PF7E 1YL6A 2BZSA 1JH8A 3GD5A 2V0CA 3I5UA 4AM8A 1GFWA 3K3PA 2QOEA 5CA0B 4Z2AA 3UK1A 1DCFA 4CMEC 3K5PA 1H42A 1ISGA 4EENA 3WLPA 5CVEA 1OYOA 2P5SA 1II9A 1HV8A 3L7NA 4FONA 3NPAA 5FD8A 2XTNA 1UBFA 2UUPA 2F1IA 4P80A 1MAUA 1EFTA 1KL7A 4R3UC 4JB2A 1NI5A 1LU9A 4BNYA 2OXCA 4MUKA 2WTNA 2GAOA 1GGEA 3BA6A 1IY8A 1EP9A 3SC2A 4LC1A 3AEZA 3GFBA 2C31A 3V8VA 2GF0A 5CG2A 1E4OA 3BK2A 3S68A 2WUFA 3O4RA 4FJ2A 5ITZB 1HYHA 5AOCA 4DMLA 3PLAE 3K96A 3RREA 2RHGB 3OIGA 2VWHA 1NE2A 5HQ3B 4G0MA 4MVJH 4ZGGA 3FVWA 1NN3A 2CBZA 2Q5QA 4B2PA 4B81A 1AUPA 3TGWA 4G9EA 4O2AF 1CNMA 4LRQA 2Q5EA 1JDSA 2Y0PA 2Y1XA 1YS1X 2QT1A 4GQIA 4PZUA 1EDBA 2VSYA 2CLSA 1DUSA 1P31A 2ZYHA 4Q02A 3JZIA 4HI0E 4EFLA 1KNQA 2L82A 1BFKA 1ND6A 4G1FA 2VWQA 3G0GA 4BLWA 2O2CA 3WBJA 4LV8B 3H9BA 3SDBA 3P0IA 1EB8A 5JFOA 1IN6A 2F1RA 5IVIA 3HK2A 2OBNA 5CXSA 3QOWA 5FB3A 1ODTC 4RKQA 4EHNA 2I2XB 5HRAA 4UM5A 3ZHBA 1VKJA 2GZDA 3DBHA 3OQ1A 2I6QA 4KWHA 4YJHB 2FRVA 3KCNA 2XCSB 3NOVA 5DB4A 5EEHA 1EWYA 1FJ2A 4QOFA 5CRIA 1B0AA 2JGIA 5IKXA 3ZVRA 2HK9A 721PA 4LMPA 2JKYA 3DMFA 4RHCA 3OTWA 1THMA 4PCVA 3ZNQA 1TT5A 4V3CA 3TRDA 4ARAA 1SVLA 4AZ3B 1LBIA 3AEXA 1ZM9A 3QKSB 3H86A 4OUKX 3WMRA 1VCOA 3KNZA 3RRFA 4BCCA 2OHHA 4E1VA 1UXIA 5LQJA 3A1TA 2HUNA 2G63A 2X15A 3DMTA 4HQOA 3MRXA 5DKFA 1Y8CA 4P58A 5FPYA 5C80A 1JPNA 4ZQIA 1J6UA 4KFTA 1QH8B 4RSMA 3PPVA 3AUYA 4WUVA 4O29A 3GLQA 1U90A 2PKCA 3E84A 4BVEA 2YWCA 3DMNA 5CT4A 1VMDA 1WZUA 3LUPA 3UM9A 2R48A 2QRMA 3JARA 1XL1A 2OL4A 3Q88A 3PEEA 3U37A 1HZZA 1MV5A 3AFNA 1BVUA 1QLJA 4ARZB 3R5JA 2G08A 3R2JA 3R9KA 4HQFA 1WB9A 1J33A 3TBKA 1JVBA 3NBKA 4BIIA 1E69A 4ND3A 5BPHA 4Z54A 2CWDA 1IY2A 3DKVA 1H2BA 4NZZA 3GUYA 4UPDA 3UB3A 5I01A 1T5DX 5JSQA 1L4GA 3H2IA 3OPMA 1DC4A 1Q77A 5JS8A 1ISFA 1E4YA 2FUEA 5HYVA 3VZPA 3LYUA 4G36A 2N9UA 4N7MA 3P2OA 1FX1A 1Q83A 2DBRA 2QS9A 1MQSA 3EVBA 3LBFA 4OY3A 2GHQA 1JDTA 1ZHFA 5TX7A 3DFIA 1MIOB 4K87A 4DJDC 1XMXA 4G89A 4O2AB 5LQNA 4TSRA 3W04A 4OQLA 1LW7A 1Z2AA 5JAHA 3BMOA 1XNJA 1QWOA 1F0KA 2AR9A 4Y2SA 5K1ZA 5JQWA 3TLBA 5K3FB 4ZWNA 1YUBA 2ZETA 4U7FA 4UTRA 3ESXA 4YJFB 4DHWA 3M82A 3MFQA 3UMJA 1UBSB 3A4NA 4QXPA 1UMDA 1X8JA 2JJ1D 1Q7BA 3DM9B 4J0FA 3HLKA 2H08A 4QELA 1JEEA 1E98A 2JGNA 2FNAA 3MIIA 3JTMA 3G9TA 1TDJA 3HDHA 3UJBA 4CU2A 3UXEA 4E5KA 1SXHA 3LP5A 4ZD6A 2OBXA 1BQ4A 3IAS6 4M0KA 3GRAA 2D00A 4ROTA 4ZARA 3V1TC 4G1EB 3EEIA 3ENKA 4WOCA 3ZV4A 5HQ3A 4MK4A 4D6YA 2QM7A 4C78A 2YV1A 3GD7A 4HS4A 3OX4A 3DSRA 4DJJA 2AXEA 2O2IA 3VC7A 3SSNA 3AM5A 3SJAA 1ZLYA 1RLJA 4CLXA 4CM9A 3HB7A 3DTVD 3R9XB 4EP1A 1O5TA 2PZGA 4LUCA 5HP4A 2ZVPX 3SYMA 1YFJA 5G4KA 1NIJA 1Z62A 4BJHB 4GLJA 3TTVA 1DC3A 1MOZA 2J07A 5BV2P 3HYNA 2VP6A 5KKNB 2O20A 1CV2A 4HD8A 2Q2QA 4R83A 3Q7IA 1P1JA 1DOHA 5JC1A 1U2SA 2I3ZA 2FK8A 4D8YA 4B84A 5BMVA 4BB9A 1D6JA 4ZZ1A 3KTAB 5JPDA 5BPFA 1E3EA 1I51A 2C20A 2KI5A 2GN8A 4A8PA 4PGGA 3ZXYA 4ATNA 3L02A 3QUAA 1IG0A 2QRPA 2J4DA 3TOXA 4K2HA 1GZSA 4ZDJA 3KWJA 2TMYA 2W2XA 3PUYA 4K2AA 2IYAA 2XR1A 4ZYTA 3GJ5A 1ATIA 3E5HA 1SU8A 1PD0A 1UK8A 5J4LA 1VSTA 4CFSA 5JBNA 4WGGA 4F11A 1YJBA 2QKYA 1O5OA 2A9PA 1NI4A 2AWNA 2XB8A 3FWYA 3WYCA 2WTMA 3KBBA 3TWOA 1LLDA 3K7EA 5TIIA 4YK7A 1DVRA 1KSGA 2F8MA 1ZGJA 2WD8A 3NAQA 2HRCA 1N2CB 1CSEE 4D5EA 4LHZA 3B8EA 3GLHA 1GDDA 4MKGA 4TMFA 1NFRA 1P0MA 5CA0F 1SBCA 2JFNA 5BY2A 3WO0A 4FZVA 1QV7A 4BKQA 4H4DA 3D8NA 4PN7A 4P0PB 1X7XA 1DOAA 1JR3A 4IHJF 1YJQA 4TV9F 2Z6QA 2FPSA 2JASA 3G0IA 2YZMA 1CUWA 1VXRA 1XD2A 3L8HA 3L84A 3MCAA 1YO6A 5I9BA 1FTNA 1MBZA 1EK6A 1YDEA 5KOJB 3WA7A 3BL8A 1ZS9A 1ZX1A 3M6MD 4JDUA 3OU7A 5E1BA 1VKHA 4IDQA 1A77A 3G7NA 1G63A 4NVRA 3B82A 3T3IA 2W6NA 4RTOA 2FKAA 2WWFA 4HZGA 5B4VA 2AZ4A 4AX4A 4CMIB 1PL6A 2F9FA 2QP9X 1Z8NA 3U7FB 2VH1A 1DB3A 3WDKA 2X7XA 4WVLA 1WMBA 3ZWWA 1WDMA 4U8GA 3D4BA 1KEUA 5CGQB 4KYUA 2F64A 4KPUB 3KQPA 3RRZA 5GZ6A 4UHFA 1QKKA 3CLSC 3L6BA 4C7MA 5I7WA 1SXQA 3PP8A 3U3OA 1NRWA 1NT2A 1U28C 3DFZA 4GPBA 1SVOA 5DEOA 4CQLB 4E5YA 5IAOA 4G4JA 4QYIB 4BVGA 3ABQB 4YRQA 1WM1A 4KMOA 4LDZA 4TS1A 2UXBB 3UAOA 4HVCA 4UNQA 5G4KB 3OE7A 1EUYA 2JIBA 4PR3A 4ZJZA 2RHHA 3CUKA 4EYOA 3A37A 3A58B 3QK7A 3DEFA 3GGDA 3UGTA 4BVAA 5KYWA 3CKMA 4KXNA 4WHMA 1SC9A 3JWJA 1FFXA 5AI5A 4AJEA 1MO2A 1PIWA 1Y4ZA 3NDPA 5DW0A 2A0XA 3H3JA 4R2WA 2PE5A 4QU0A 2JIMA 1XWIA 3QX8A 3DYBA 3WA6A 2JKZA 2PGLA 1EX7A 2F3PA 1A3CA 3OSZA 1N0HA 3SXUA 3TZHA 1VMIA 4PRKA 5KSZA 5C8YB 1DARA 2OTCA 3E03A 2BELA 2VKTA 5TQ0A 4F9TA 5IJWA 3ICEA 3BEOA 4D4KA 3FNBA 1TUBB 3RIEA 1CF2O 2Y3IA 2FJUA 4TLEA 4AN1A 4IIFA 1E3MA 1JYSA 2BEJA 1SHZA 3AIOA 3HVKA 2I9PA 4R4JA 1CR0A 4MCHA 2P68A 4XAQA 1RPTA 1ZVQA 2B83A 4RV5A 4DMMA 1RU3A 2XMZA 2CXTA 1P81A 3CH6A 4MR8A 3EOAI 4O5OA 4TV8B 1JFTA 4L22A 2E48A 1JL3A 3HY3A 3R0ZA 1WZ2A 4GVLA 3VPFA 4DM3A 5JJCA 5AKJA 1BW9B 3EZXA 2MSWA 1ZK4A 4KQ1A 1V41E 1VG8A 2F3SA 2GWRA 1KAQA 3D6UA 1IXRC 3H6HA 3FETA 2VK4A 4JL8A 4KFSA 3O2QB 4PC1A 5TQ2B 4HKTA 1S6YA 2R1TA 3OSUA 2C5HA 3LUCA 4OI1A 4C4SA 2WJZB 3ZIAD 2R8XA 2E5FA 4PBTA 1DKQA 1XDBA 3DGFC 5MF6A 3F73A 3LZ6A 4FD3A 4ARUA 2Z3ZA 5JROA 1L4KA 1HDRA 2FEOA 1RRVA 2QJFA 2RGGA 4OBEA 5B1DA 5EXDA 2ZRQA 3WLMA 5HZHA 3JVUA 3GZTB 4BTEA 3TECE 3K8YA 5KYYB 3CLRD 4OQXA 5CX1B 2ZSDA 2ZJ2A 5FTLA 4MDHA 1Y8QA 3LIIA 1WLYA 2IPLA 4C43A 5JNTA 3MWJA 3E8SA 1YB7A 1EHYA 1H85A 1D04A 2MSEB 2XUAA 1ZCBA 2WILA 5G0TA 1RXEA 1ZAKA 5K8VA 1FDVA 2D5CA 1BIFA 3Q40A 3B60A 2ONYA 5T57A 1SCBA 1KAHA 3K05A 3M1LA 4S3MA 2HMYB 3WRYA 3T9DA 3STYA 1ZWLA 2A9VA 3QBTA 2HEIA 2JI4A 4HXFB 2E4WA 4EGCB 4AKHA 1OT3A 2PVCA 4I1RA 4BFVA 4OQEA 1H2AS 2KJQA 3FY4A 3L41A 3GP5A 1GNRA 4E51A 5E3JA 5JSYA 1U5BB 3HXTA 4A2WA 4B8YA 2EG9A 2BBSA 4FHGA 2VPZA 1FSFA 4MI1A 3AVQA 2R8RA 4OMDA 3SN6A 2FWNA 3AKCA 4R5HA 2ADFA 4KRFA 1E1RD 1K6IA 3UV6A 1AOXA 4QBTA 3ZDEA 4XDYA 1T9GS 2QD2A 3LWZA 4MQ5A 1AK1A 4EUNA 3AY7A 1UPCA 3GUZA 4O6VA 4CTJA 3EF3A 3VR3A 4EX6A 4CQMB 1OTYA 1TO6A 3IIJA 4M89A 2RAFA 2HBZA 4NBSA 5GAJA 3LVRE 3JW8A 3NG1A 3O92A 5IUJC 3P9CA 2LP4Y 2G5TA 2WIGA 4LZJA 4HBZA 2ZJ7A 4GX5A 1TECE 3UJNA 2ZCVA 4FYJA 1KFKB 4YMWA 1WBJB 1UDXA 3GFPA 3BRWA 1E1QA 3IQZA 4DWJA 3UPUA 3A11A 3N86A 1MPTA 3CZAA 3AR3A 2XSZA 3I1JA 1A7AA 2Y2VA 2WAMA 1IL0A 4MQ6A 3HWX1 4NFLA 2NZVG 1ONSA 4DW8A 3HCOA 1NASA 1KFCB 2ET6A 2J8ZA 4Y6GB 4E94A 4B2YA 3QU7A 3PQEA 3FF4A 3PPIA 3NBUA 2HOQA 2I2FA 4U7GA 3ZIAA 4N18A 2GAIA 4RZSA 3OOYA 1Z6AA 2B36A 2WKSA 1AKMA 1VRCA 5CB4B 1GFIA 2Q21A 1MA0A 3RHFA 4FVTA 5CDFE 2XMDA 3HXQA 2H4YA 5HQTA 3BC1A 4MA5A 1GGFA 1GHTA 2KBFA 3IT2A 3COJA 1JFFB 1KO5A 2UZ3A 4RLSA 3GFTA 3ETEA 1NHWA 2ZIEA 2Q27A 3GT3A 3HXPA 3QLVC 2Z30A 1P45A 2FUG6 2YC4C 3EC1A 3HBNA 5JRDS 2XD9A 1HT2E 1TK3A 3CZPA 2XHEA 3KKOA 2VQ3A 4Q9AA 3DKIA 2JIRA 4RHTA 1ZIPA 4TMXA 1FB5A 4F45A 2PWAA 4CEHB 4IIXA 3LVBA 3TAXA 4UTNA 4PC3A 1AT1A 3U1VA 3LX8A 4PPQA 1ODFA 1V6CA 4XQ9A 4B0PA 3AONB 3ON5A 1QK3A 2H3EA 4JVMA 5DHTA 1WQ3A 2W6CX 4IDNA 1RW4A 4P86A 2MCFA 5HKBA 2WG2A 4L76A 2ZT8A 5A06A 3AVVA 1TK2A 2ZIXA 1C9JA 3S99A 2G1JA 3VM6A 2CB9A 1IQRA 5LQCA 5FTMA 1Q95A 5AXAA 1GPDG 1TJ5A 1DO0A 3ZY5A 2AMLA 3PWSA 2PS9A 4OXKA 4ENTA 4IQ8A 2JJYA 3IDOA 4XX0A 4MRRA 4FINA 2NUAB 2HA7A 2RG1A 1SVIA 3NH9A 3ZWPA 4RABA 3UJPA 5BW8A 5LLTA 2ZJ5A 2QV7A 3FCUB 3HE3A 4FCVA 4ND2A 3ZK8A 3FNQA 3N53A 4KQIA 1SOWA 4AZTA 8ABPA 2C3UA 2J41A 3T52A 3VR4A 4EO7A 1TVEA 4F8JA 3JD4A 5E6RB 4POAA 2B82A 2BFDA 2R65A 4W1PA 4F2HA 1XPUA 4CYMA 2NG1A 1TB4A 4X71A 2OVBA 1Y42X 4DBZA 1NUHA 3KK0A 2G4CA 4GZ3A 2MMCA 3DZBA 3REQB 1Y9DA 2PTGA 3KYIB 3O1LA 4JGIA 1QVRA 4MQEA 5FQNA 1JIVA 4ZCRA 3MOGA 3PGXA 2A0FA 4NH4A 1ISRA 4IMIB 1Z5ZA 2REOA 2R6CA 2V6IA 2WD9A 3TPZA 4XOUA 1YBMA 2INGX 3IEVA 1RPNA 4K26A 4YP1A 2DEUA 3TCXB 2P3QA 3USCS 3ZE7A 3BRSA 5C52B 4K6MA 4BNJA 2G5PA 4ZTZB 4F5YA 1M76A 4GZMA 4D57A 2O0KA 5LMCA 4V0KA 4G5GA 3WY9A 3AR4A 3GAFA 4G37A 2IEYA 2I6TA 2X7HA 3L0DA 3PIRA 4C7BA 4KB5A 4MLCA 3RSZA 4O4HA 3OBBA 3CUEF 1BRMA 5LZ8A 2IE8A 5ELXA 1WNTA 3UMMA 1LRKA 2P9QA 1GSOA 2C97A 5CBKA 1Q74A 5FP0A 2J5XA 3OM8A 1QH1A 2GNOA 2H1SA 3THSA 1U8AA 1FFAA 3IOEA 4E21A 1A95A 1ZHOA 3A2KA 4TV8F 3O84A 3TRFA 1UIRA 2R7AA 1LDGA 3JV7A 4F06A 2O2XA 3QVXA 3DEHA 3NR2A 3VKFA 4UEJA 3VR5H 3O94A 2FK7A 2UYGA 4D79A 4HL6A 3LW7A 4HSGA 2WTAA 4RX1A 2DKOA 3ACDA 3ESCA 2Z83A 4L9SA 2HDNB 2ODBA 2G0TA 2I3DA 1RWKA 3PLNA 4N54A 2XE7A 5F21A 2G7ZA 3LOPA 2BI7A 3ZCVA 2C03A 3PNSA 4FHFA 1X39A 3L6DA 2OESA 1U3FA 3R7NA 2P75A 4MRAA 3VR4D 1YJXA 4EGSA 3GOHA 3O4JA 4BP1A 4MMZB 2HHAA 1CR4A 5LYJB 4NV3A 1C7FA 2FW1A 3O6VA 4JC5A 4PPYA 1O9GA 2G1AA 3ZWOA 4KN9S 3KHTA 2V7EA 1LD3A 4P34A 3SHVA 2GKGA 3BWBA 1XAGA 3BERA 4Q1VA 3RWMB 3S4YA 2DT5A 1PGJA 1H66A 3DE3X 5FOTA 3E8MA 3FJYA 3VZBA 1FP7A 2QAJA 1OFIA 1JDBB 1W6RA 2H0QA 4ZEOA 4HFJA 4M1QA 3CUYA 1VE5A 4YCAA 4M1SA 1T0IA 4F6RB 1V35A 4JUCA 3VO2A 1U0BB 4LZZA 5SZIA 2ID8A 2CW5A 3MQ4A 3WL6A 2ZUBA 4RK6A 1K9VF 3ZH2A 3FZEA 2Z2IA 5KX5A 1D4ZA 1A04A 4X1YB 5CFZA 5T4HA 2HMVA 2ZYVX 1BXZA 1DLJA 4LXUA 1SVMA 2IOFA 5CD1A 2O8BA 1LBEA 3Q6IA 5EYPA 4L15A 1PK9A 2RH9B 1GLGA 4RSHA 3A6HA 4BMNA 3MYRA 3H2ZA 3CG4A 1FMJA 4LY9A 4Q3BA 4BLTA 4DSTA 4TPKA 5CD9A 3FD8A 4R3WA 1HETA 1K8XB 3V00A 4BU0A 4QWMA 2NQTA 3PC2A 4ZVTA 3W6OA 4ARSA 4P53A 2OE2A 4P36A 1D2CA 4YH1A 1P2GA 4LZPA 1PZEA 1K3FA 3H99A 3RRMA 2H5LA 3EVCA 3HXKA 4OXQA 1T15A 1KBZA 2XWBF 4XRRA 2KWIA 2MIIA 5FLXA 4ZV9A 2H5EA 1M2WA 2ZRKA 1MU0A 5KQPA 1N2JA 1NF9A 4YMLA 4A7PA 2Z1MA 3QLUA 1OBCA 2VPPA 1WOMA 3FSRA 1FQKA 2C4MA 2P1ZA 4Y9RA 1OH6A 5K0BA 2EKLA 2QYHA 3KDSE 1E7MA 2C7RA 1V3VA 1JJIA 1F60A 1BOFA 1RTTA 1K6JA 1Z88A 2C88A 3AGPA 2CBXA 2OFWA 1DBIA 1ZNQO 3BMCA 3CLVA 4FNOA 4QTXA 3LQYA 4YCBA 3S7ZA 4G2NA 5LDHA 2P3OA 2QIOA 4CEIB 4WNYA 1PT8A 4TKLA 4RPKA 3ELDA 4H18A 2JDIA 2Q5OA 5FPHA 4JMLA 3KJQA 2VNKA 1OXSC 3V2HA 3LCMA 5B5SA 4GYWA 3N8DA 5HE8A 3E48A 1KR5A 1Q0RA 2X8WA 4FFWA 4L3VA 4I4IA 2NUTA 3WLEA 4BS9A 5HM8A 3LHKA 2L69A 2QDKA 3FMGA 5GY7A 3AFIA 4QULA 5KJ6A 1R5OA 3O82A 3DR3A 3ZUPA 4OP3A 2BGUA 4G23A 4MO2A 2VWGA 2N1MA 1E79A 1EZZA 5HA5A 3P8ZA 9ATCA 2B99A 4N48A 4MZXA 2A1TR 4GHWA 1UL1X 1YI0A 2HDOA 3B2EA 2FLWA 1YZTA 2LZ0A 3WJ2A 1THGA 4RJLA 5MN4A 4WNCA 3TAUA 3GH1A 1NVUQ 2CL5A 1GJRA 1OBFO 1AQYA 2B5WA 2G77B 1CY2A 2RAVA 4B4OA 5KX5F 5FV7A 2HJHA 2I4RA 3BXHA 1RTKA 2H4WA 4C4ZA 1JQBA 1RC8A 5GZ1A 4I5DA 3PQFA 1EUCB 1UPAA 2JI9A 1Q5PA 5EJEA 1E7SA 1GP2A 4Q9HA 4LJKA 1HEYA 3BORA 1EE1A 1GCAA 3EPRA 4WECA 2B8NA 3CJTA 5DGIA 5F2EA 3IQHX 3SX2A 3GVHA 1E3SA 2GYUA 2GBIA 1X77A 1G7TA 1A69A 1R7RA 1GGKA 2GAFA 2QLLA 1U3DA 2HF9A 3AO0B 3E3MA 1DQPA 3IBTA 4J1SA 4GR9A 2CUZA 3ZOKA 4RORA 3CF0A 1AHPA 3BXEA 1T8UA 1AE1A 1R00A 2C3PA 2FZ4A 3GLGA 4O59O 2GH1A 3HCAA 4BZZA 3LY8A 1L8QA 4XSGA 4QQKA 5L4NA 1K8ZB 1ZN2A 5D3MA 3CLHA 3DOOA 3UCFA 1XQXA 1D0SA 1QYIA 4CMJA 2NSLA 1K7EB 1QAOA 2YMPA 3GJZA 2WFZA 4O8CA 4AG3A 3OUTA 1FY2A 3FMVA 4PAOA 3OJLA 1KHHA 5EFOA 4M9XA 4KQMA 3GFGA 1HL3A 4P7BA 2PVSA 4KQ6A 2AOTA 1RYEA 3C3YA 1JKMA 4KQKA 1TVMA 3T1NA 3L79A 1JKJB 3W2FA 5BN3A 2GBPA 4URXR 2IZOA 2PFKA 3W3AD 1V6AA 1CTQA 3ZW8A 3ANNA 1GNPA 1Z16A 3QWBA 4QWWA 3ZNPA 2X8JB 1N7HA 2X58A 4M6WA 1LDYA 1HMYA 3CRZA 2VDKB 3R7SA 5AHOA 3ZY6A 5G2OA 3WLFA 3HYTA 2EDAA 1LF0A 1L7RA 3HKBB 3RQIA 4LJ6A 2Q5JA 3SZLA 3NBAA 2B69A 5K0EA 3KYCB 3S1SA 1ODCA 3LZCA 1WMFA 1E1MA 3QELB 4KV7A 4DPMA 4B3MB 1IHXA 2ZWMA 3EWSA 5TQ2A 4IG4A 1TO2E 1GG2A 3QYAA 2NV0A 3DKRA 3K9LA 3Q3GE 4LHYA 5AKYA 5G0UA 1T8RA 1GKYA 3I6ZA 2A84A 3F3KA 1JA9A 3E2PA 4GU5A 1G20E 3I64A 5K01A 1YQWA 1AQJA 2QG4A 3EVTA 2R4QA 2UYYA 5CXQA 1R50A 1NJFA 5F76A 1TM4E 1QO7A 1PWHA 2IHYA 3DQPA 3GVXA 3RGGA 4BZPA 4BLPA 4BMXA 4K6KA 2IHUA 2Q3FA 1IEXA 3WWYA 4CLHA 4DPKA 4QATA 4MQEB 1L2TA 5F3WB 1K86A 2IXDA 3REQA 2CEAA 2PLFA 3K9FC 1NG9A 1AZLA 3TD6A 3NRBA 3KAQA 3DEYX 1UBUS 4Z5XA 3THXB 3BHMA 3CXRA 2NWQA 1KRHA 2UVPB 4KIGA 4TYYA 4ZQHA 3W9YA 4BKPA 5B4TA 1N5IA 4JXZA 3IPLA 3KKQA 4JJFA 2VLIA 4ZXFA 4AU1A 4AYWA 2P7IA 3B85A 2YV5A 1FDSA 1F8FA 3H9UA 1U80A 3ZGXA 3I32A 3M3HA 1H0SA 4HQLA 4P7GA 4DDMA 5IG2A 1T2FA 2D2EA 3RW9A 3Q72A 3MBOA 2CC2A 1QHHA 1Q57A 1SN7A 3Q8KA 3FHTA 5AJUA 2J9GA 4OHPA 4C21A 2Q46A 5JMPA 3EIWA 4V1CB 4F9FA 2JJ1A 1RSZA 1T9KA 2EERA 2IZ7A 2B6HA 1VE1A 4GX2A 2XBLA 3BH0A 2ADMA 3UQYS 4FBGA 3N0XA 5LU8A 3ELUA 3QV1A 3JQAA 2OQRA 3BD6A 5B30A 5F7OA 1XNHA 2UVQA 2ZRBA 1K3UB 1N2IA 1MNAA 3CJRA 2H06A 1VIYA 2R97A 3IX7A 4LVNA 5DI3B 1M1NB 5U4XA 3TRIA 1WVIA 5CW2A 3MFYA 4YP0A 4CKWA 3RYHA 2EFGA 2QRVA 2QTAA 4PS0A 4E09A 2WB2A 2IH2A 1QG6A 3PNQA 2I6SA 5CB0A 3PD1A 3JZAA 4ZAVA 3M6WA 4E5SA 1N6NA 2H7XA 1WY5A 5DIZA 2OUKA 1RYFA 3LFTA 3ME5A 4HLQB 4J8PA 2LV8A 3IHWA 2OO5A 1TAGA 1JS1X 3JR3A 5E9AA 3SR0A 3UMVA 3V8EA 3V7FA 3OFND 4ZCLA 4IX1A 1HTTA 3DE6X 4FOOA 3C6XA 1OY1A 1F06A 1T1EA 3H1GA 1G8GA 2CMFA 9LDTA 3OEED 2B30A 4Q7LA 4Q9KA 5IASA 1R9NA 1W4LA 3O75A 4IDBA 4CLDA 2H92A 1EP3B 4KXQA 3SM9A 4D92A 4EHLA 2E4UA 1K0UA 4BEVA 3K70D 2WSBA 1B74A 1NSFA 1VFNA 4INJA 3RC7A 4GUDA 1HLFA 4WZBA 2X3UA 3SY8A 3TVYA 4ZVQA 1TJ4A 4XXHA 4YRKA 5LQAA 2OB2A 4GOND 5AW1A 4HDRA 1TYEB 2JK0A 2WTBA 2XWSA 3HB9A 1UJ6A 4FD2A 4Q1DA 4YRIA 4BQNA 1L4LA 4E32A 3IILA 4XE5A 3ZPXA 1FSGA 4HNSA 1XZDA 4X94A 5GIPE 4XB2A 1U8TA 4YR9A 3OLYA 4P08A 3ANYB 2JVIA 2VP0A 4LMBA 4ZO9A 5H81A 4RM3A 1AO3A 4AIIA 2QRUA 2F1HA 2YMMA 4DILA 3IP7A 5J4YA 4R9RA 3BQMB 1PDOA 4ON9A 2OZLA 2VC2B 3LPNA 4DNPA 3VNBA 1B4DA 4CCSA 1NC1A 3M70A 2ORED 4Y7DA 4LRSB 3M3PA 5JI2E 3KUDA 2WM3A 3ZLJA 3DZFA 1DJLA 2VVTA 2WT9A 2AOWA 2WWYA 4MAAA 3SHTA 2RCNA 3W8NA 1G6HA 1G2PA 3JQEA 1BD4A 4J3JA 1W5FA 4EKIA 4K9QA 5KQSA 3V1YA 1AA9A 2FUG1 4Y6SA 3ILSA 2YXLA 3ZDCA 1A8PA 1Z45A 1MT3A 5TGZA 2AC2A 5BSGA 5LP6A 4X65B 1I36A 3GLUA 3LRXA 1CY4A 2WFAA 3MCZA 1ETHA 2XCQA 4FZ3A 3UTDA 2EV9A 3BMQA 2E0IA 3N2KA 5F2OA 3FPJA 5F4BA 3QNWA 2I03A 1UQRA 1UZUA 2D4HA 4ANFA 1BAPA 1NFQA 1RC0A 4MW0A 3DXZA 3AX6A 3EIEA 3IO5A 4QVKA 2C9DA 4RH1A 5BUQA 4AC9A 4PX5A 4YASA 2A1IA 3RUCA 7REQA 2VI5A 2Q3DA 4EHAA 5LSAA 4X7BA 5KYXB 1T3SA 4LWZA 1N1GA 1RWPA 2XDAA 4AFNA 5L3VA 3L8EA 1BS9A 2VJCA 3LV8A 4Y18A 2FSSA 1XYGA 4I4TA 4YCDA 1EUQA 2QN1A 1HA3A 3M5WA 3UYLA 1L4NA 1ADBA 3QOFA 3TL6A 1Z13A 2Q5HA 3MWFA 4MVWA 1KYXA 1E8NA 3HU3A 2OV4A 3I5MA 4MWEA 5LUBA 3DDUA 3RC8A 1GU0A 4XVQA 1N8SA 4JB3A 2PUWA 4FYXA 3JTEA 4MTLA 4DABA 3SSOA 3AT1A 2VDQB 3VYUB 4B5KA 1GU7A 1E9EA 1K8QA 1WE2A 2YHBA 1DX9A 1GN8A 1OD6A 1GYPA 1PX0A 3HXLA 4JCCA 3Q5EA 1CRPA 1GG9A 3SZOA 2HCFA 4NMMA 2WW8A 2BF7A 5A05A 2HNKA 2PT5A 1IXZA 1VPWA 1S0UA 3F8WA 1IHOA 1OU4A 2WFMA 1M1YA 1BC5A 2VQEB 4HGOA 3STWA 3FOCA 5TQ0B 4M0CA 1JQEA 5B57C 4DS3A 1PAUA 3RYCA 1XV5A 2AFHB 1QS0B 4QOEA 3ZHRA 4MUHA 4PG5A 4LK3A 5LQKA 4CKBA 4WZZA 3KEQA 1B1CA 1G8AA 4MKHA 4N12A 1I0LA 2WWIA 4N1AA 2JLCA 4MINA 4XQGA 3IQFA 5CPFA 2ESRA 4R7GA 1SG9A 2C4WA 1Q7RA 2WJAA 1F1JA 2BGKA 3ZI0A 2JFXA 3Q6MA 2P11A 2E5LB 3U44A 5BWLA 2XXBA 3W06A 4X8LA 3M6VA 4HVAA 4IEFB 3DGEC 3DO5A 2C2GA 3I9JA 3O3NB 4Q66C 4NBUA 4TMTA 1VP3A 3KE9A 3BCRA 2E2WA 2I7VA 1RE1A 3VISA 3PIDA 1E6MA 3RJZA 3VC2A 1YUNA 4DLNA 4QOIA 5KYUB 3I62A 3WOHA 4H16A 3SIXA 1HO3A 4OM8A 4LAFA 1QRUA 5EP3A 4ZO8A 4NMXB 5HPYB 4UC0A 2J6CA 4ESVA 1YA8A 4JY7A 4L73A 4D0SA 5DMXA 3I8XA 2RGNA 3Q10A 3I2HA 4NI5A 1W5EA 2WZDA 3L0IB 3UG6A 4C0LA 2F43A 2WF6A 3RUHA 4DA6A 1NV8A 3AW8A 7MDHA 1KS2A 1CUEA 4BB5A 2IUYA 2ZOSA 2BGTA 3ZWAA 1G98A 4D9HA 1ZD2P 1K75A 1JXQA 4QO7A 3FZNA 4L2IB 1V5IA 4Y2UA 3SHFA 1IOVA 3MCTA 3UT6A 1FE8A 1X86B 3GLHE 4QBGB 3U6KA 5DX8A 4JBIA 5DLYA 3SR4A 4EHFA 3OZCA 1X70A 1MO6A 3GEBA 3OM1A 2QXUA 4TT3D 2GPAA 3V4RA 2QP4A 2NAPA 2E85A 3DF9A 3OOWA 1G9SA 3FN4A 5B12A 5K8LA 4GM4A 4QGHA 1GSIA 4GXQA 2C2ZA 5FOSA 5BW6B 3WYAA 2H1HA 3EPKA 4JGBA 2X9QA 5KZMB 4IP0A 4NSNA 4Y2TA 3MS4A 1GPBA 3O73A 4L8WB 3A1UA 5AH0A 2H2FA 1D5WA 3OMLA 3S5JA 5BNTA 4C9BA 3LKZA 2VHEA 4XFDA 3G23A 2HU8A 1P2VA 4KIJA 4LQLA 2R5WA 4UULA 2ECQA 3EN0A 2ZYAA 3PICA 3ND9A 5E7MA 1O58A 4TYPA 5LWQA 4RVFA 2G4LA 5DHQA 4KOEC 1YFZA 4L0DA 1P1HA 1VZ2A 2CDBA 1GADO 3KT3A 3UT5B 1XNQB 1C7RA 1QTIA 1G20A 1YR8A 3RHSA 3A2NA 5JBQA 5FOVA 1KRXA 2OZPA 4DM7A 3KLBA 4KRYA 1FDOA 4B87A 2Z6AA 3ZEIA 4QXRA 3U3XA 3PHLA 4IJUA 4AZSA 1F4VA 3DDWA 5LBUA 1ZL2A 1TMGE 1QX3A 4UDNA 2ZIZA 4PYKA 2J3JA 4WKGA 4EB8A 1JLSA 3T1HB 1QGYA 5HKKD 2WIJA 4ETMA 5KTSA 3ZBPA 3T6KA 3WGJA 4DANA 1QVZA 2VJNA 1U99A 4GF5A 1SOVA 1X3LA 1WHTB 2CF6A 4Z0TA 4DA4A 4LSWA 1MC4A 4DAOA 1P1BA 4OHZA 1J07A 3OPYB 4OMUA 1Y1PA 3WGOA 1Y1TA 1ZEMA 2NYRA 3RVBA 3EGEA 4X1KB 4KITB 1UPBA 4P3XA 2HGZA 3LNCA 3LZDA 4KLZA 1ONBA 4L9WA 3SYTA 1SRRA 1JP7A 2PG3A 2C77A 4R2LA 2CFOA 3O8DA 3P9RA 2G70A 4ITVA 3NM6B 3SIPA 3T5GA 4CIXA 4OJKA 1MZVA 4WA8A 3JQ6A 1TO1E 5ALJA 2A33A 1N6KA 2J0QA 1EM8A 1EGMB 1IEWA 3GHYA 4NF2A 4OU5A 4MQFA 3AEUB 1E9CA 1U9IC 1XA4A 4H7DA 4YA6A 3TLZA 5IJAA 4ZAXA 1G8KA 2B4YA 4PN3A 2VA8A 4G07A 2ZE8A 3WLJA 3ZGVA 2FG6C 5KX5B 4NCJA 1YIOA 4YV1A 1CB7A 3DE7X 1ZJ4A 4I99A 4XPZA 4JU8A 1N3BA 1YVDA 3AETA 5E3IA 1RRCA 4A0HA 3GB9A 3UW1A 5AW8A 1RXCA 3WJ7A 2QMHA 3I0MA 3OOSA 4JQYA 4DYHA 1WUIS 4S2UA 5F64A 5IZCC 4YMVA 2Q1YA 2FTKE 2AOUB 3AF2A 3KKNA 4EW6A 4HS9A 5EPUA 5HKAA 3S28A 3WB1A 1GTZA 1VHTA 2HA4A 4H31A 5IDQA 3JQFA 4D5GA 3BSYA 1Z37A 1JE0A 1X19A 4PX3A 4BQIA 3RANA 2Y27A 3B3AA 5JXHA 3HKCA 1YRWA 2AJDA 4IXMA 2NUPB 4RK4A 5JPIA 3KQUA 1Q6ZA 3IEXA 4JJ7A 1FP1D 1UXGA 2ZI4A 1SFRA 3LC2O 4OSEA 3QFFA 3R9XA 1LH0A 3DHEA 4YRGA 5C81A 2PZKA 3ORHA 8GPBA 3JYPA 1OI3A 1UR5A 5FA5A 3ISJA 2O8NA 3BUSA 1FNBA 1HEIA 3ZE8A 2JD2A 3NHZA 2BE9A 5JCOC 1WS6A 3EZ6A 4ZHSA 2SKEA 1ODJA 1RAGA 1IWOA 5HJ5A 2I76A 3S2SA 1I3LA 2PL5A 4AO8A 2HT6A 4GNRA 2OXFA 2EYUA 2OHGA 4QUKA 4RENA 1JSRA 1CPYA 4DG5A 4YV7A 3I45A 1CFZA 3IR5A 2PZ8A 3OFKA 1KJZA 2AN1A 4GI5A 2IV7A 4BLOA 4M9RA 1VSUA 5KIAA 5DHAA 3WAGA 1F0NA 2G6BA 4D9MA 2UYCA 1KJQA 3KJXA 1T2VA 1M2KA 3DDOA 4KR9A 1DBWA 3T41A 1DIHA 3VGJA 4RTJA 4IRMA 3VNAA 3IAS1 4LZAA 5CX4A 4MGEA 3V6LA 2YYZA 3E5NA 4LX8A 4GMXA 1HNZB 4E5VA 3VJLA 1T36B 4D9JA 2YS7A 3CUTA 2O1WA 2VRWA 2VSOA 4M1TA 4QREA 3RC3A 2PXHA 3FPFA 3ST7A 1A5ZA 2YICA 4XFJA 2WJIA 2CCJA 2D7JA 2OM2A 4ZPJA 4F71A 5CAEA 5MFPA 1QK5A 2PRIA 1GNQA 4FK8A 1MIOA 2KB0A 1E3JA 2W93A 3VDNB 2I8AA 1TM1E 1FOEB 4NJMA 3EVAA 2RK3A 4JHXA 4KR7A 4U4AA 4TLAA 3BSFA 3S44A 3WIOA 3VYTB 3EFHA 4WKCA 1P18A 1I7NA 2DLNA 2ZUUA 4A03A 3H04A 4I1VA 2C92A 1PR4A 1WULS 2C4UA 1BD3A 3OI7A 3NKVA 1A9YA 1J8YF 5DNUA 1QFZA 3BX1A 4H7PA 2AE1A 4BNTA 3BWCA 1SD5A 3FNGA 1ZMBA 4AJHA 4BV9A 3G89A 4N5DA 1CUVA 1E5TA 3QVWA 4QODA 5LJIA 1B1AA 1BVYF 1NVFA 3HY6A 3V7WA 3FNEA 3W8FA 2ZSEA 1GYRA 5FWYA 3DOFA 3ZCSA 3U31A 4HNVA 1IG3A 2DFNA 2XCIA 3DJFA 4MIKA 5E2AA 3T3PB 4QUBA 3ZCUA 5H0IA 1I3OA 4LRWA 1II0A 2HV8A 2HWKA 2PD3A 5A2GA 1Y7HA 3FPHA 1G41A 1YU9A 3BXGA 1GAJA 1DKNA 2EJTA 1RP1A 2WTXA 1GTL1 1J9ZA 4OVKA 4B85A 4A2QA 4YXFA 4YAUA 3U5ZB 4DLZA 3BB4A 4AQDA 1MX9A 3NT5A 1E9DA 5FNZA 3NFYA 3PJGA 3KJNA 5EWMB 1VDMA 4KAFA 1SK9A 4KDRA 3KDPA 3B3QA 3U61B 4AS1A 5IVHA 3LY9A 1TUIA 1Z08A 3BM5A 1GXSB 3JR7A 2QI9F 2XXAA 4QDOA 3PVCA 4OGGA 4RD2A 2E4VA 3U39A 2PQ2A 4GI7A 3I1IA 1M72A 4KMSA 3DP7A 3KDAA 4RJJA 3PKZA 4IX9A 4JQOA 2BFMA 2VHYA 4Y2YA 3RJ9A 1Z6GA 1CIJA 3ROKA 3RLIA 4W82A 2R79A 2HB6A 1M8FA 1PLJA 1YRQA 2ACKA 2OV2A 4WZAE 5HOQA 4MWCA 4HFNA 3E9NA 1Z0DA 3S29A 3NHBA 1L7NA 1SUFA 2XA1A 1ZOLA 4RGYA 1MV8A 4E5DA 1R6DA 2HFJA 5LP6F 1THTA 4GL2A 2W2KA 1QCYA 3A6DA 5K8CA 3WYEA 1FTQA 1XMOB 1JIUA 3D0QA 1WSBA 1ADCA 1AA6A 1KZ9A 1CZUA 1JKXA 2YW9A 3E2MA 1SXJB 1R8YA 2IXAA 2ZJ0A 4H7JA 1N2HA 4QICA 1S2IA 2OQVA 1Q14A 4DV2B 3HJBA 4EI2A 2AXQA 4BO5A 1VHWA 2HEGA 1JW9B 4FFPA 4W5HA 5DX0A 4MCJA 5DZSA 4YQYA 5DM60 2A9OA 1VM6A 5IN5A 1Y9EA 4CT4B 5EWLA 2WUVA 3C5WP 2WICA 5K3SA 1L5NA 4JP3A 4BN0A 4RPHA 2WU3A 3F0TA 3DHVA 3F8SA 1ZJ6A 3OZTA 2OHJA 2CE7A 4Y2RA 3INNA 4KH1A 2I2CA 5BOSB 2FFBA 5JD5A 3UKOA 5KTKA 4ASUD 1TLFA 5I7RA 3SC2B 2YQZA 1Q0HA 4LOLA 1NQOA 2M6SA 1P1CA 2X4IA 3OA2A 4RK1A 4ZEWA 2A9FA 3VMMA 4UFOA 2VDWB 4NESA 3FWNA 3S3TA 4DDKA 5FBWB 5JSUA 2E7ZA 5KJ1A 2V58A 2NSDA 4NYMR 3JWGA 1YB2A 2E82A 5G02A 4CT5A 4JKIA 3GLFA 2VZ8A 4OSOA 3PXCX 1YS9A 2I2BA 3NYQA 3P4XA 1GVNB 1XMSA 4FR2A 4NYIR 1TA9A 3Q41A 1LSOA 4RIEA 3QLVA 3AJAA 4RA6B 2NIPA 2V4MA 4UU7A 1JDPA 3VI4B 1UKEA 3MTJA 1YRLA 1M6HA 1I6MA 3AHEA 3IDFA 4L6IA 2CZQA 1XSEA 3QWFA 4CVNA 6GPBA 2Y1DA 1RQXA 3RFVA 4MUAA 3RKSA 4NBKA 1M2VB 3SLRA 1KTVA 4UE2A 5ICMA 4LF5B 1WU7A 3P0JA 2GRAA 3A2MA 3QVMA 2R87A 2H2DA 4NAUA 1TKCA 3D9QX 3GEMA 2ZYDA 5EWJA 3FUVA 5HZKA 2JLWA 2X6TA 2BMVA 2VIIA 3DG9A 3KFLA 4V1CI 1IJEA 2WHQA 5JSFA 3G5AA 2CK3D 1W87A 4CUKA 3F1KA 1R6TA 5IBPA 3G0DA 3UAZA 3M3DA 2BZ1A 5AQ1A 4UUMA 5M34A 3HBAA 2C94A 5JCXA 1YBFA 5KYXA 4K1LA 1MJHA 4XIIA 2J09A 4QECA 3USZA 4MZDA 2O3RA 4ZZ2A 3WLLA 3IAEA 1FDUA 3FNRA 4EZIA 1G9TA 2XDYA 5HMMA 3WLNA 1AH2A 4NULA 3CWZA 2PGNA 1F17A 2MSDB 1AKUA 1KEEA 1JHXA 1CJSA 1PGNA 1SHKA 2LUOA 3EVGA 3G1WA 1BHQ1 4OYLA 2AF4C 3ANSA 4B35A 1E2GA 2I4NA 2I6UA 5DCYA 2DQSA 2QXTA 3KB2A 2F3RA 4H7IA 4R9VA 3GV0A 4U2DA 1DJQA 3LECA 4RZUA 4XWWA 3C1UA 3OCYA 4XGRA 3VKVA 3L7CA 4M0DA 1NJ1A 5F7JA 4G5HA 2IUSA 2YUTA 2WF9A 4R1QA 1NW7A 5ESRA 1XZFA 4PZZA 1T2EA 1MO4A 2H59A 2PRSA 1ORDA 3GN2A 3NC1C 4ZO4A 3MJ4A 5EE1A 4E15A 4G09A 4F1KA 1CQIB 3QNMA 4EMTA 1Y5LA 2BKVA 3LY7A 2PMWB 2JIOA 3ZQ6A 1BS1A 1M7BA 2CLIB 2DH6A 2N1BA 4UNPA 1B15A 2CFSA 3RAFC 4GMGA 3OIVA 1QGZA 1I10A 5BVHA 2D7CA 3WKEA 4Z99A 3JAWA 4ZI2A 1WB4A 1VYHA 2NZ2A 1VJGA 4BAZA 4KQHA 9ABPA 5HXAA 9GPBA 2I67A 1VIDA 2C3YA 1DX4A 1PS9A 4B76A 4ZYZA 3U1BA 4D6XA 2PL1A 2AI2A 2RK6A 3V80A 3TD2A 2I87A 4QJ4A 3WG9A 4P31A 3S2YA 2QAGC 3EDMA 1F5NA 3K8ZA 4UQPA 3UGKA 5L3SB 3D1VA 3TINA 4KACA 1NA5A 1IXKA 3B5EA 3PFWO 2QMEA 4XWOA 5FHQA 1GD1O 1ZH6A 2Y93A 4B3GA 3G5LA 2OG1A 4J3NA 1O95C 3TIIA 3UMYA 2C2YA 2YC2C 5FPTA 3KQKA 4LHWA 4Q3LA 4Q3OA 3CX3A 4GQBA 4IUYA 4ZRNA 3TW0A 1MJGA 5DU2A 2HU5A 1C50A 1UQUA 4AJNA 4OHCA 2EW2A 1VJCA 3U3ZA 3T7TA 4HX2A 3WLIA 3NYWA 1J0XO 1M3SA 2OBMA 2X0IA 4M3NA 1GZ7A 3A1NA 4K9KA 4JI3B 2DBVO 2VDNB 3FZQA 2HL6A 2RHBA 2QZZA 1JLLA 1EVYA 3K6KA 3VBCA 4OHVA 4HH1A 2JBWA 2M6RA 3UAVA 4YDHB 1H8HD 4FZ5A 1FCJA 4YUYA 4C2AA 2ZB2A 3I01M 1TAQA 1MJFA 4B6OA 2FWRA 3MUOA 3TXYA 5L7TA 3AWDA 2AJCA 2EP8A 3QIAA 5DT9A 1PFGA 3RU2A 2R9VA 3LHSA 4WD3A 1V96A 5DTJA 5G53C 2H7YA 3SLKA 3UWKA 1BDIA 4CTNA 4CCAA 3FW1A 3QLJA 4L3OA 4QTZA 4DR2B 3IHKA 3TTTA 2X0RA 4O2BB 3ADCA 1ESNA 2DBZA 2JLXA 4DQLA 1IN7A 1YZLA 2GFQA 2O2ZA 3C3PA 2PQ0A 1RRPA 3ZKWA 2XZLA 2G1UA 3BDVA 4XUEA 4FT4A 1UIMA 1IJBA 3DUFB 3S2ZA 1G3IA 1O57A 1VIVA 1CY7A 2CHGA 2Z04A 1P2SA 1SUAA 3TLAA 3X1KA 4D41A 5EMMA 1RJWA 2VUSA 2ZB3A 5JLAA 2Q41A 3D64A 1QRTA 1WXHA 2WYHA 3MMPA 2IY7A 4UBLA 2MSLA 3OIFA 5DGHA 5IBQA 3IAUA 5SZJA 1IHPA 3KXDA 3O8QB 3CEMA 5A3RA 1ZKMA 1Z63A 3JS5A 2PU7A 2PGIA 4QXQA 5ARDA 2HYIC 4MRSA 4WY2A 5DNYB 3VR2A 4DRXA 4WGFA 3RDPA 2HA2A 2ZIFA 2HWUA 1YXMA 3LA6A 1D2RA 1XRSB 2BFDB 3BFKA 2VDOB 3G6KA 3QSGA 2IU0A 4AG6A 1VJDA 2JZOA 2YWFA 1EFLA 1UODA 1IQPA 2J59A 1YZFA 1FYDA 3L8MA 2FY8A 1ELOA 1T4BA 4IGIA 2I1QA 4TL7A 4PO8A 2WJWA 1Z3IX 3Q7QA 2GEUA 1XZ8A 1X9HA 2V96A 1LS6A 3B1YA 3FGZA 5IS2A 5ALLA 3JQ7B 3VOTA 2D5LA 1RJFA 5IK2D 2KBEA 5ECWA 5I8ZA 4F4HA 5GZ3A 1A9XA 4FPXA 3C3AA 2BM9A 1G5FA 1HORA 1KI4A 5CXUA 3EJWA 1Z35A 1PW7A 1ZCFA 3K31A 2XYVA 4OUDA 4MI6A 2H16A 5KHLB 3IEKA 1IUNA 1JQDA 3I2JA 1HOXA 1XQ9A 2Q3EA 3ZZ1A 1EVKA 2AV6A 4PO1A 1RBZA 2GLTA 2OM6A 4IJWA 2LD4A 2QTZA 1FMLA 2FFAA 1C2YA 4G0VA 3OCVA 2BGJA 2FUCA 2PGOA 2QYOA 2VNHA 1KIAA 2QU7A 3ILVA 3NI2A 1HGXA 2B6NA 2PBZA 4UDYX 1RWXA 3UK0A 5ISMA 1UEXC 3BMNA 2WB4A 5DHSA 2PLAA 3T7RA 5G1OA 3ZVLA 5JTTA 5B7QA 1PYDA 1LB1B 3OJ0A 2JS7A 4ALJA 3UAYA 3C16C 1RI3A 1UBTS 4KKVA 4BMZA 1FPQA 4DUYB 1Z8FA 4LCEA 3SE0A 1JVNA 1R16A 4FDTA 1NVDA 2VJLA 1YVPA 3S1LA 3IXLA 3TXXA 1S4QA 1P2UA 3FHOA 2WIKA 2OORA 1YU6A 3HFGA 5BWCA 3NETA 1ML3A 2Q3JA 1GZ5A 3DL2A 4AJOA 3QPBA 1JR2A 2BFFA 3GAMA 4REQB 3ZHCA 2EX0A 3OPYI 2GM5A 2A9QA 2O14A 3VNVA 4MTCA 4WADA 1DCTA 1WTCA 5JUWA 4JLMA 1GKUB 3UUWA 1J70A 1RRFA 4IGKA 2X13A 1FFHA 3CZ9A 3EXEB 1QU3A 3Q85A 2I3AA 3SOZA 4JYAB 3EXG2 4C7OB 2BGNA 2VOJA 3MB8A 5M7EA 2DWQA 2ZAMA 2F1OA 2XDQA 3F5SA 4YMTA 4MW9A 2GAAA 4OAOA 3B1ZA 3MT8A 2UAGA 2UXCB 3FTCA 3IDAA 3P19A 1AY0A 3OOHA 1OPXA 3VR5A 3R41A 3E9ZA 4BAGA 4ZOAA 4DR4B 4HSEA 2MINA 3JALA 2GEDA 1S1CA 3H0CA 3HR8A 1AKRA 3D3NA 3VFDA 3L04A 4FE7A 4Y9TA 4JL5A 1SIWA 1GAEO 2VF8A 2WOJA 1UJ5A 3LPAA 2K6GA 5G3ZA 3VOAA 3WL5A 4EMUA 4I4TF 1YQXA 4Q9DA 4W5QA 1XJCA 2RH5A 3P9PA 4WY5A 1PJAA 3QEJA 2AFIE 2A78A 2VPIA 1BKYA 2V5UA 2VKQA 4LOJA 4QPJC 4PFJA 4RPIA 2B9VA 5H82A 3E81A 3ZR4B 4EPWA 1P4JA 1BQ3A 1XTJA 3IAXA 3PHCA 5K4AA 4H2DA 4I2VA 3CY6A 4I46A 1F2UA 3V7YA 1C8KA 2PUAA 3TOVA 2JGRA 3N6XA 1HTBA 4D3YA 2DGDA 4BRZA 4HF7A 3C7CB 1SIOA 2GZRA 1L6IA 1DXYA 2CFIA 1LSUA 1UC4B 1IOWA 4D96A 3N2ZB 1D2AA 3VH2A 4AURA 3Q3JB 2PA0A 2QTVA 4LV5B 2O57A 2I7TA 4OHXA 1BCRB 2QNBA 1VHLA 3ORRA 2I6GA 1Z28A 3Q0EA 4P4GA 1KZ4A 1L5GB 1A9XB 3UPDA 5KYGA 4RULA 4N76A 1G3RA 5TXGA 4UNRA 1ZMOA 2QRQA 3OKPA 5G4LA 3BMCB 3HRKA 3IMKA 2VTEA 1L5RA 1VB3A 4HUQA 3ZHZA 1E32A 1VB5A 3A6GA 3UJCA 2WBLC 2WG1A 1Y33E 5CYFA 4IZ6A 3SICE 2GUGA 4BUCA 3RVDA 1EWVA 3SXUB 4CODB 1ILWA 4M37A 4I08A 5EKSA 3U4AA 2FJPA 3DYIA 2O2EA 4JK3A 5BO5A 2OAGA 4AICA 3VPCA 2H1CA 5A3SA 4MCIA 3AP1A 3U4QB 2DTXA 4GBED 4I3HA 1YI1A 3NEJA 1IQUA 1MRZA 2DBYA 2WT8A 3HUDA 1YOVB 4U7DA 5JHGB 3MJSA 1RCTE 3OPVA 2PWPA 1P2TA 3JQBA 3QKWA 4GL4A 2I5PO 2AZTA 1R5NA 3D1JA 2XNDA 1XE3A 2C4VA 5EHGA 2B3TA 2PMEA 1W35A 3W5HA 4YJFA 4DG8A 1I4TD 1EQ2A 2FSPA 2O19A 1SQSA 5L40A 2V6MA 3NWOA 4GPZA 4LQCA 4MWDA 1R15A 2Z8ZA 2JFHA 1HY3A 1DAGA 1REQB 1YB1A 2EJWA 2YTZA 2CVHA 3GUUA 1H2FA 3HJNA 4G5FA 4D9IA 1V71A 4K9MA 5AW9A 1Q2XA 3TDNA 3FBWA 4OI4A 5FO1A 3AESA 2QN8A 3ONWA 4AUKA 5DBFA 1ZI9A 2ODTX 4BO7A 4D3FA 1UBLS 1WXXA 2XB9A 1ZH8A 3I6QA 3STUA 1T34A 1A88A 1IMOA 5DP2A 3UCXA 5JYDA 3MYYA 1ZQ1A 2O54A 1RKXA 1TU3A 2KPOA 3AU9A 1TM3E 4A27A 1XHEA 4MLPA 3RC1A 3QELA 1EVIA 1ADGA 5KWEA 3P1JA 3LHIA 2D8AA 3ONNA 1GKIA 2D1SA 2OQIA 4HB2A 4W4TA 1KOJA 1QZ3A 2QTFA 3GLFB 4WASA 1P0IA 2YV2A 3WZLA 3OX2A 5DISB 3L0CA 4R8MA 1X14A 3GCXA 2CXPA 2EEPA 2GZHA 2BGWA 2WHPB 2QEQA 4ND4A 3F4KA 3DLAA 3RU7A 4EUFA 4UOEA 5LWHA 3CC8A 2VJPA 4GC9A 4R51A 3LY5A 4ND1A 5DW3A 2QGNA 2UYHA 1DAIA 2FMKA 1JB9A 3UCEA 2E37A 1ZN7A 1E9AA 1EZ1A 2HA5A 3H83A 1RHMA 1KJWA 3HCNA 2Q3BA 3T61A 4EEXA 1E3WB 1T1SA 1KPIA 5EZYB 3UMBA 1JE1A 2PS1A 1XJ0A 3JVDA 1TIBA 4LZLA 4ZC8A 2OZEA 3A6LA 5ALYA 2O50A 4ZGBA 1T2UA 3CLSD 3RFFA 3K4HA 4P2GA 4Q7JB 5FA6A 4PCLA 1O96A 3N0WA 3K0HA 4ETWA 1QDUA 2RBGA 5K0CA 4RPCA 2AJLI 1Z0FA 3GRUA 3CB2A 3DQZA 2FOXA 2OAP1 1ZUD1 4QE3A 4DFDA 2NXEA 3MPUA 4HTAA 3N75A 2Q6KA 2YX1A 3NFRA 4GOOD 1N33B 4NS1A 3LJKA 4H6PA 4NFYA 4TKMA 3S2GA 2GILA 1CHNA 3JQ9C 3K53A 1WF3A 1T3GA 3VDMA 1CJTC 2C9BA 2LPMA 4IJVA 4LXYA 4XCVA 2XEDA 1QIEA 2CMHA 4Q18A 1AUXA 1M75A 1X1CA 3NGXA 2XQGA 4H08A 5KYUA 1OIVA 4KV9A 1D1SA 2OK7A 5K0FA 3MWEA 2XNSA 3IV6A 1GXSA 1YR2A 4Y2JA 1EJ0A 1ZGGA 5JJBA 4F7DA 3GZNA 2VAPA 1RZ3A 1U8XX 2VBCA 4MH0R 4A16A 3IP9A 4LJLA 2FPIB 4RTNA 4KGZA 1KDYA 2ZGVA 5BSMA 4MVJA 1EPUA 1POXA 5A3VA 1IY0A 2J9XB 2QHXA 2VR1A 3AU8A 3B1JA 3LQRA 2VNJA 5BMVF 1K1EA 1V7ZA 1Z2DA 3DF7A 3IUQA 5A7HA 1FU4A 1VFPA 4JODA 6Q21A 1EIWA 1XRMA 3DXFA 2AFRA 3I23A 1ZY2A 2JI7A 1T5OA 4MUEA 4RD0A 4WZBE 1TCAA 3JVIA 4LF8B 4PC6A 3KQQA 3FOAA 2Q2VA 2VF2A 3KUKA 3FCAA 4TSKA 5G0SA 3GFFA 2VJBA 3PKJA 3NMUF 1E3QA 4NBLA 5AKEA 2LE0A 4JZYA 1E2KA 2ZJ8A 3VKUA 4BNDA 1LF5A 3CBQA 2TMGA 3OOJA 4LIPD 4UBMA 1IH8A 3RFXA 1FTSA 1R37A 1BHO1 3FDJA 4D7AA 1YCDA 5K0GA 1FFYA 4HMPA 4ZC1A 1PZFA 4WLFA 1N9ZA 2DHQA 4K3UA 4QGAA 2NLOA 3V46A 1YR6A 1Z74A 4MP6A 1JMKC 2P2YA 2H17A 2IBMA 3RVQA 2ZYWX 2YUIA 3EIXA 3HJHA 1P77A 4IJ6A 2CLLB 4QXAA 3L5OA 1NU6A 4ZAGA 5BYKA 3K2EA 3NWPA 4O0MA 1R9GA 3OLZA 3EOBI 5TDHA 1ZH0A 2X2PA 5DN9A 1CBUA 4ZVNA 2V74B 4KO1S 5IDXA 2YKGA 4NU8X 1LVUA 1Q0ZA 2E49A 5EZQA 1FDWA 1H6DA 3G0CA 1H2ZA 4RMIA 1ISJA 3H1FA 3WP0A 1L5HA 1W94A 3HQ4O 2ISCA 1X94A 2C07A 4NK4A 2RJNA 3I9V1 3QBEA 4EF5A 2BR3A 2JGFA 4OQQA 4AMBA 1WPXA 1Z5NA 3L40A 3MUEA 4N3CA 3T4UA 3G2MA 1J39A 4KXFB 3FPGA 4UUPA 3INGA 5K0LA 4EG7A 5AVXA 4RXUA 5E2IA 2Q3MA 1R2QA 3ZLBA 4BJ1A 3GCWA 4FMDF 1B00A 4OK5A 3GJ4A 1G3UA 3F5MA 4P83A 1QIHA 1QH0A 1XCPA 3SNHA 4CLRB 2PX8A 2OOSA 4B2LA 1DEOA 2FE1A 2V7WA 1ORIA 4Q82A 3GEIA 4OBWA 2AJTA 5J3JA 2G0AA 3OT5A 1T0UA 4J2HA 5HS4A 1XXHB 3TYXA 1D7OA 3TNLA 4QBIA 4O25A 5AKIA 3EDOA 1ZGHA 4JIGA 1T6ZA 4OCZA 5FLEX 3KJZA 3P2MA 2C8JA 2Y9MB 3VHXA 4ISCA 4MVJM 4V03A 5KVQA 2V3VA 1G1AA 5ULLA 3UTCA 5JH7B 4U0KA 4IYJA 4DNFA 1E5VA 1LBQA 4M60A 1WV0A 2AQ8A 3I58A 2NUPA 4ZHQB 2HDWA 1A8UA 5DCWA 4Z4EA 1IVNA 3LDHA 4BLSA 2NNLD 5DRYA 1JJAA 2GFHA 1YHZA 2ZS7A 2CYCA 2YZ7A 1YDMA 2PR7A 3S5UA 3QXXA 1W85B 1UK7A 2HK7A 3EJ6A 4WE3A 3ACCA 3S2FA 1NBMA 1K2VN 4YGYA 4HGZA 4RY8A 1A82A 4XJTA 5ERYA 2G5GX 4IKEA 2CKMA 4DQDA 1N8KA 3FWKA 4P2BA 1AKQA 4C5BA 5C7IO 4BNFA 1J97A 1VIAA 4N0MA 2VHCA 4YMHA 1PSDA 3EOZA 1PZNA 5A02A 3S8YA 3ER9A 3PNVA 1UAAA 4RHFA 3VMFA 4CG0A 1TKBA 1XJQA 2ZJZA 4FT2A 2QU8A 2YIDA 5F2KA 1SVSA 2AQIA 2PCLA 5A5DA 3PPXA 1GZ6A 4MVXA 5E9WA 3K2IA 4YO7A 3GOQA 2PL9A 2FOLA 3LPMA 1MCZA 4RLHA 1TIKA 4JB8A 4XX1A 4P82A 2J9YB 1HL7A 3CONA 3W7BA 3T7EA 4UU8A 5JFTA 3TS1A 3AMVA 2PL3A 3C87A 3BZWA 4RTMA 4QX6A 3AEQB 4BO9A 2RIRA 3FXAA 4K86A 4X85A 3PFGA 4ZVUA 4TZTA 1DBSA 1ID1A 2C1XA 4G3XA 4I8DA 4J75A 4QUAA 2C5SA 1WUYA 1AGYA 2HZBA 1V39A 2V7VA 3N2NA 1FU7A 3G85A 4TV9B 4AI6A 4RHEA 1J99A 1KDTA 1O6ZA 2QLBA 5LKAA 4PYIA 3TEFA 1I7QB 2J1LA 5TPZA 3BJZA 2HA6A 4ZDKA 2GZSA 5JH7F 3V4FA 4LNHA 3A9VA 1PR2A 3DE5X 5AM1A 3GGSA 3RIXA 4MRMA 2R1VB 4XD7D 3E0QA 4KUHA 4I9NA 4Q48A 4ZHQF 5FOWA 1OA1A 5FBLB 3A14A 3WGHA 4NXMB 2ZYIA 1AN9A 3WO1A 3JRXA 4ZCTA 4JYPA 4BDSA 2RJOA 3D8TA 3RBAA 3SYNA 3TIVA 2ECOA 2D1RA 1Z6PA 3HKEB 1QCZA 1U2GA 2B25A 4L3WA 3PNOA 4WK0B 3TJRA 2JFYA 1EVLA 2P2SA 1W30A 3PFIA 3EQZA 4ZI3A 2N42A 1NVWQ 2WHXA 3JQAB 4MGHA 4Q9JA 3UGQA 4C14A 1V16A 2HWYA 1DQSA 1QFMA 3DL7A 3M4ZA 3RVNA 6REQA 2E4XA 4K1XA 3B51X 1S8NA 3M9WA 4JU9A 3ZZUA 3EAFA 3QOYA 3V4VB 3ILYA 3K9WA 4ARBA 2HW8A 2HH9A 2IIPA 2DFLA 2YINC 4MGIR 3HCWA 2D74A 3P9KA 4NIMA 1RJ9B 3IKTA 2Y05A 3SQOA 4B3TB 2H2IA 4PGMA 2HAEA 2WVJA 1R0ZA 3HDTA 3I04M 3M89A 2WQZA 2QN3A 3MINA 4O0LA 5AHXA 5DM4A 3R74A 4TS4A 1AO0A 1R8SA 1SU6A 2A0WA 3LL7A 4MMYB 1EDZA 3QMVA 3RRYA 3WK5A 2PQ6A 2BEVB 4JP8A 2CT8A 1K7YA 2QTRA 3H5NA 3KKEA 5JDCC 2XNDD 2WMNB 4EG0A 1B93A 4BL5A 1ZINA 4M1EA 4X7PA 4BO0A 4GBJA 1V9CA 3AR5A 4KUEA 1CEQA 1YMUA 3DAHA 3MRSA 4X6LA 5CEEA 4C0BA 4UXIA 4GAEA 1W0KA 1TC2A 1WZEA 4NE9A 5CGZA 4ZANA 4ZYVA 3A3OA 1D03A 3BE6A 3BSSA 4LPSA 4OHOA 4RLFA 3NHYA 4FX2A 1PJLA 5KJCA 1RWNA 2HF2A 3PTAA 2OXTA 2Z1DA 3K0AB 4I4LA 2W42A 4PY2A 4B3XA 2YRXA 3ELWA 2FEMA 4QU9A 3GFRA 1TYZA 1FYVA 1L4UA 4L02A 5LXTA 4FN5A 1KYYA 1UCFA 4WN9A 4TRNA 3WGYA 2R7MA 5FWNA 5BT8A 1TMKA 2A7QA 2VSXA 1MJNA 4E88A 1A0OA 1EFVA 3P0HA 2YJ5A 1XF1A 1EXDA 3QSYA 4C0SA 5JS7A 3UBTA 1A9SA 5HJEA 3KSZO 2XNCA 5KEIA 3CVYA 2FPUA 3LC7O 3CYFA 1Q15A 4XDZA 4XM1A 4DLKA 1RHUA 3TRJA 1PQPA 4PXYA 4QXOA 5TB5A 3FOEC 2O3TA 5AICA 4URVR 1I1QB 1L1EA 1JZQA 1SJ9A 3JD0A 1IB6A 2ODQA 2QN9A 4Y2GA 5HDBB 3C8MA 1IN8A 1G291 1ZVVA 2UUOA 3PX3A 3CEJA 4MYDA 4F96A 3CNQS 4QOHA 5IWCA 2C3OA 2WSLA 1PKXA 1QGOA 2GX6A 2ZSJA 3KSMA 2GD1O 5ANRB 1PFYA 3ZBQA 4DDTA 2XWQA 4DC0A 2ERXA 4EBFA 1GRVA 3SD7A 1PSZA 4I6EA 3N2EA 1H94A 1JPVA 3GARA 4PGFA 4YT4A 2IYEA 3H8WA 4V2IA 5J4HA 3I52A 1DDIA 1GQQA 2DFPA 5C46F 3LP8A 4C6SA 5F1KA 1BMQA 1I33A 4RQTA 3RS7A 1LFAA 2XKAA 3RS2A 1PKEA 2FMFA 1GVHA 4A2PA 5AUNB 1RWQA 4A8JA 2DG2A 5BSUA 2EL9A 5AO9A 3D6HA 1U0NA 1UFOA 2VPQA 3N0VA 4IFIA 4B44A 4ER3A 1T5IA 3CSDA 5B6JA 1Q7GA 1EAMA 2ZI5A 4TLBA 4R8RA 3O93A 1MLDA 1E5DA 5EZ6B 1A7KA 3EC2A 2MMGA 1QF9A 2WEKA 1T10A 2QVCA 3HN2A 4HATA 4REQA 4I9GA 4JC4A 2F9LA 4KHPB 2DYKA 3QBJA 1FRNA 4U7WA 3OFJA 3TW8B 2H0RA 3UT5A 1AXRA 1E2LA 4GNKA 3O31A 4Q3CA 2BFCA 1EWRA 3BCUA 3SBDA 5GINE 5KS2A 3IBYA 2SKDA 3Q2OA 4GZ5A 3W05A 2WSIA 3ZX5A 1EVQA 3LPCA 4BNMA 4C3OB 1KO7A 1Y4UA 3DAFA 5LZ2A 3ZS8A 1CR1A 5EZSA 4GPAA 1M2FA 3H9JA 2D06A 3NHJA 4BN4A 2DHEA 2ZRCA 5KYTA 4HDQB 4MDEA 1V5EA 3RYFA 4TRMA 1DGQA 1DPGA 2QD4A 4PCUA 4EBBA 3UANA 2MDTA 1I4DD 2ISSD 1YUMA 2HMSA 3C3EA 2GGSA 4NEQA 1N1DA 2BR5A 1N7JA 1U8UA 1SCDA 5AESA 3UT0A 1XUOA 2RSLA 2WJ3A 4N3AA 3AP3A 1LK5A 4NU0A 4K0KB 2E4YA 4DZZA 2K5UA 1H05A 3IDQA 4KFRA 2AHRA 3LH5A 4RXTA 2OHFA 1Y7TA 2CLFB 4M0UA 4Q9LA 4R2JA 1OREA 3SJUA 3C5HA 4U1RA 5LIRA 2XYQA 5CB6A 2C96A 3O9MA 2G06A 2YFHA 5FLYA 1K6XA 5FYQA 1YQTA 1KY3A 3W79A 1SUWA 3QITA 4KPYA 4DLSA 3VVCA 2VH2A 4WBSA 4YAGA 3PC8A 2WNIA 3VSAA 4BNZA 2JLYA 3QQPA 4G56A 1TQDA 4KGVA 1SO8A 3NKFA 4R2XA 4ZK2A 1I01A 4ZVKA 3TL3A 2QYSA