4KXQA

Structure of nad-dependent protein deacetylase sirtuin-1 (closed state, 1.85 a)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
b'HMRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4kxqA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kxqA01
1PT9A 1S5PA 2IHVA 4ZZIA 4BVHA 1OVMA 3GLUA 1PVDA 4MZXA 4QELA 2Q28A 4C7BA 5K3SA 4UTRA 5EJ7A 1O96B 3JR3A 1UPBA 2VJYA 2NXWA 4JT8A 1J8FA 4IAOA 4BVFA 5K6TA 4UUBA 4GP9A 4V1CI 1OZFA 2IHUA 3LQ1A 2FN3A 1V5EA 1T9AA 2EZ9A 2H2GA 2Q5LA 1XLTC 2VBIA 1UPCA 2OORC 4JU9A 5K6RA 1MA3A 2H2HA 2BRUC 4UTVA 2Q5QA 4RMIA 1ZPDA 4G1CA 4RJKA 4FEEA 1OZHA 3FSJX 4BUZA 4GM1A 4K9KA 2OD7A 1Y9DA 3PKJA 4UTNA 3PKIA 4UTZA 5IMSA 1Q17A 1HZZC 4L3OA 2Q27A 4FEGA 1Q6ZA 2OO5C 1YI0A 4IF6A 4RJJA 2JLCA 1POXA 3HWWA 2EZ4A 4IG9A 1YBHA 4BVGA 1D4OA 4JUCA 2EZTA 4MPJA 1O97D 2Q5OA 1EFPA 1PNOA 4F4UA 1DJLA 4HD8A 4I5IA 4UUAA 2VK8A 2JI7A 3U31A 2VK4A 2VK1A 3D4BA 2WVGA 1U2GC 2W93A 4MQ5A 1N0HA 3GLRA 2Q29A 1PYDA 4JUFA 1YHZA 1M2KA 1SZDA 5D7NA 4KXQA 2DJIA 3F6EX 4Y6LA 1M2NA 4R8MA 1M2HA 3E9YA 5FYQA 4D5EA 2QQGA 2H4FA 3PDHA 3ZGVA 1U2DC 2JI9A 4K9NA 2AG1A 2Q5JA 2FR8C 4Y6OA 1YC5A 5EJ9A 4MPPA 4JD5A 2FWNA 4HDAA 5BWNA 1E3TA 4ZP1A 2VBFA 5DGDA 4BV2A 3CLRD 2JI6A 2UZ1A 4BV3A 3RIYA 3CLTD 5DEIA 1PTJC 3IAEA 5BWLA 2PGOA 4QPZA 1YC2A 1YHYA 3EY9A 2B4YA 2PGNA 1YI1A 2H2DA 4L2IA 4KPUA 4GG1A 4K9QA 3ZG6A 2C31A 4JU8A 2JI8A 4X3PA 4COKA 4TWJA 1T9DA 4F56A 5DGTA 3RIGA 2NYRA 4JSRA 1M2JA 4JT9A 3ZGOA 1S7GA 2UZ1B 5K2OA 3CLSD 4RMGA 4FVTA 4K9OA 5EJ8A 3CLUD 1M2GA 2A1UA 2X7JA 5MFZA 4O8ZA 4X3OA 1POWA 4K9LA 4TWIA 3GLTA 1JSCA 4GM0A 5EJ5A 1YNOA 2OD2A 1NM5C 1ICIA 4BN4A 2AG0A 2IHTA 5MFPA 2H59A 1Z8NA 2H2FA 5MGNA 1UPAA 5FEMA 4RMHA 4V1CA 1U31A 2H2IA 4BVEA 2JLAA 4BVBA 4JUDX 5EJMA 4FZ3A 2JIBA 4GPEA 4MPRA 4Y6QA 2PANA 3F6BX 4BN5A 2WVHA 5EJ6A 4Q9DA 4K9PA 3U3DA 1V5GA 3JWPA 2EZUA 1YTLA 3FLMA 2A1TR 2WVAA 5MF6A 1PNQA 1T9CA 2V3WA 3K35A 4JUBA 1PO7A 3CF4G 1V5FA 3EA4A 3EYAA 2H4JA 4V1CB 1BFDA 3HWX1 1OZGA 4QQ8A 1PI3A 3GLSA 1QPBA 4J1TC 2EZ8A 4KGDA 4J16C 4K9MA 2OD9A 2VBGA 2H4HA 3D81A 4RMJA 3D7KA 1EFVA 4JUAA 2FRDC 2HJHA 4C78A 3OE1A 4D5GA 4GM4A 2QQFA 2FSVC 4UU7A 3IAFA 1MCZA 1T9BA 1SZCA 1Q14A 1U28C 5EJAA 1Q1AA 4RJIA 3FZNA 4UTXA 4UU8A 5BWOA 5EJ4A 5AHKA
chains in the Genus database with same CATH superfamily
4G2TA 2IYLD 1VJ0A 4JJAA 4ZRNA 4EFMA 1Z36A 1PQPA 3RABA 1TCBA 2INGX 3IQXA 5CXSA 3IVMA 1LRKA 3H5AA 3HUDA 5AKHA 5E4YA 1UFOA 1TVCA 2GJ9A 4IVQA 2X9NA 3D4LA 5CW1A 4B3RB 3WYDA 4BFWA 1RLOA 2RCYA 4QBKA 4TTIA 2CCGA 2ZAYA 3HA5A 5GGYA 4EX6A 2Q28A 3EYWA 5EI5A 1R9GA 5AXCA 5SICE 3UV3A 3TRIA 2JFOA 4J6EA 4XX0B 1M6NA 3L5KA 1SU7A 4FX5A 5F78A 4NS4A 4QXPA 4JQCA 2C98A 2FUCA 3DAFA 1FP7A 3HI6A 1MC1A 1VZ2A 3OOJA 4TRRA 3FKJA 1YZTA 4Z4FA 3OPXA 1AOXA 1IATA 3I76A 3R2JA 2QVBA 3H13A 4J43A 8ADHA 1L7AA 1UADA 4IAOA 4BVFA 1V95A 3ZU4A 4CEHA 1DKOA 1N8NA 3DO5A 1C3OB 3AHDA 3PD7A 4NJMB 3EEQA 2ZJ8A 3GROA 4LYFA 1X74A 4CQMA 5HK8A 1PYOA 3C5WP 3P97A 1XELA 1E59A 3IVAA 5ICFA 4AX4A 1RHQA 3GEMA 3VU9A 3LU1A 3RVKA 1WPXA 1L7EA 2P69A 3A05A 2UAGA 3MTGA 2DPMA 2V4UA 3QA9A 4GVPA 5LZ8A 1X8LA 5DB4A 5AJUA 4DMRA 1SD2A 4M9XA 4ETWA 1X1EA 3K0FB 4NEGA 5B6JA 5GJCA 3CNQS 3TLEA 1GKIA 4DJDC 4ND8A 1FP4A 4DADA 1ESEA 1SKAA 4KBYA 1BE1A 3FSGA 1GR0A 2XRZA 3FCAA 1NBOA 5C3UA 3RTEA 2O1SA 5REQB 5AVZA 2JDID 1PSWA 4P0TA 2ENWA 4NTZA 3SJBA 3WVNA 3C6QA 2WQ7A 4B3BA 3G2IA 3RVPA 1T8WA 2YC2C 3GJ3A 1CLUA 2HMSA 1M8KA 5G0WA 4B4DA 4UATA 2WKQA 1G8HA 1MA3A 3T9CA 2EP5A 3GZ4A 1R0BA 1L7QA 3HVHA 1SD5A 4C22A 3EX7C 4HLDA 4K40A 1JPNA 2ATVA 2HQ1A 3I01M 3OY2A 4HX2A 2C9MA 1ZPDA 1YD7A 5CM2Z 4PG4A 2AQKA 1R27A 2Y0BA 1L1QA 1G98A 1U7WA 4CKBA 1D03A 5KYXA 4ZVPA 2EJCA 4RDHA 5ES3A 1VG0B 4L51A 1ULHA 4CU2A 3FMVA 2AI2A 3D7MA 1T1JA 3T0GA 3QV2A 1OFHA 3K6KA 5JH7B 1PKEA 3QU5A 3ZY2A 4Z4EA 3C3XA 4OI2A 2Q07A 3GG2A 4HRXA 5EQJB 2YN4A 4HX5A 5TF0A 1TT7A 5EFZA 2G77B 1E3DA 1THGA 1MV8A 2MMGA 2QDXA 3KDPA 4UBOA 2NUPB 2Z08A 3ZHZA 3NV7A 3KTAA 2NPFA 1TW2A 1K7XB 1U3FA 3R74A 3LW8A 2IOHA 3LPAA 1QGDA 2GQ0A 1EVYA 2COKA 2OV1A 3D7NA 3IQIX 1QM5A 4YRPA 5B6IA 5U4QA 2X86A 1T0IA 2EP7A 4GWLA 1NVTA 4W9NA 4PQYA 1NF3A 4FEGA 3ZGNA 3HXMA 1WV1A 2EFHB 3BHIA 3GRZA 4LHYA 1EX7A 5BOSA 3PFCA 4NK5A 3UOAB 5DM60 4I55F 3VR4D 3DKIA 3ZE0B 4IDOA 1FXWF 2YXNA 3LDUA 2I03A 1QF6A 4LGVA 3U4AA 4FNAA 4IRUB 2D54A 2O05A 4KR2A 2XCIA 1L4UA 2EHJA 4N9WA 4H9GA 3AEKB 1MAVA 3LVFO 3S5UA 2G8LA 2Q7OE 4JUCA 3A6KA 2X4GA 4PO1A 3I9FA 2ZCJA 4B32A 1SR8A 2IXAA 3EEIA 2JJ1A 3JQ7B 3E48A 5KHLB 4HFNA 4UXIA 3UOGA 3MAJA 4XYLA 4LZLA 1D1QA 1O8BA 3GUYA 3X1MA 4EHLA 1CEQA 3WRYA 2B9EA 4FNMA 1XJWA 4O4LF 1PFYA 3ZXIA 2G1KA 2JGAA 1DQZA 3AFOA 4CFSA 1TEVA 3ZOZA 4RIFA 4LYAA 4PIMA 2XPCA 1YDFA 3TUIC 1XU4A 2CUZA 4Q4JB 1CUJA 2DH6A 2YZGA 3IIKA 3MPOA 3P9SA 4KE8A 2RGEA 4OQMA 4OB6A 1U5CA 3LBFA 2UZ4A 2H00A 5HUQA 4L16A 5AM3A 5B1YA 4E4RA 5K0EA 1CY4A 2GM9A 4ZQHA 2AW5A 3FDZA 2QZ4A 2Y1CA 5JI3E 3CURA 2P6NA 1XEWX 5G53C 5IYZA 2JFBA 3OF2A 2XTJA 3AUAA 1WY7A 3T54A 4LXTA 1IXSB 3FMIA 3SHVA 4ALNA 2ORYA 5ADVA 4LVUA 1GV1A 4BNLA 2IHBA 1E79A 2WVJA 3H5IA 5L9AA 4FB5A 1YQDA 2QD4A 4MVJF 3U3OA 4YMVA 1TEZA 1Z4NA 5K0FA 3MHTA 3ZGYA 4BX0A 4OI0A 4OL0A 5AKLA 4IJUA 1CHDA 5EJEA 1RBMA 3UMSA 4HNAA 1SKYE 4UASA 3QMMA 2Q3HA 4LK2A 4L9AA 2ZWOA 3A58B 2D74A 2E2WA 2QLLA 3AFNA 4FN5A 3D2LA 4BJ1A 1G2IA 2KBEA 2YDXA 5AI0A 3AKCA 5EEGA 3GVIA 4JC8A 2C9DA 3D4NA 1V5WA 1SQ6A 3DL2A 4CLXA 3A4MA 3EIUA 1JMVA 4PVDA 1U1EA 2FU5C 4A9AA 1VE3A 4DDWA 4W63A 1BXRB 1W36B 1TD9A 2IH5A 3OEHA 5ANRB 3ZYCA 3P2YA 1IY2A 1NZFA 1REQA 4KWCA 4HH0A 1TQ8A 3WK6A 5BYBA 2HIMA 2PJZA 1X7ZA 2ZBRA 2FUG6 4BP8A 2NU9B 3IDZA 1MTOA 4QO7A 2RJ3A 2A86A 4ZV4A 6ABPA 3GT3A 1SWVA 4ZP1A 1EVQA 1YCHA 1WXDA 1XDZA 2F00A 3EAGA 3OMLA 4RNDB 1K2WA 3UCXA 5IJAA 1X6VA 3OI7A 5CVDA 5F5XA 4EI2A 5K0GA 4DSUA 2HL6A 3KKOA 2NAPA 2H51A 1WDWB 2P2GA 4P84A 2QLFA 4N18A 4R2XA 4N3NA 1ISFA 1XLTA 4UD6A 1EI9A 2V1UA 3WLNA 2CXSA 2VOEA 4Q4CA 4OB8A 3FUXA 3G1UA 1K8RA 1J0AA 4O5OA 5CX1B 4C30A 4JI3B 5K20A 4ZT3A 1HKUA 2XZTA 4MDEA 3ZVMA 1H2HA 1TLTA 4ZTZB 3KZ1E 1VLMA 4CCYB 1GNRA 1HEIA 1NMEA 4FMDB 1U7OA 3NBMA 4B73A 2G67A 4KYVA 1G42A 2HFJA 1FDWA 2FI1A 4DMKA 1YHYA 1K6EA 1Y9EA 3H7IA 2XUGA 1KFCB 2NX2A 3MD9A 3HXOA 4GPIB 1EG7A 3NBXX 3NOVA 3SC4A 1DAIA 3PE6A 4TMTA 2H2DA 1KJWA 3CV3A 4KEAA 1ZK2A 2LCFA 4I4TB 5HS6A 5FBVB 3VDMA 5M7EA 3U7HB 4PO3X 1LNSA 2A35A 3SSMA 4NCBA 2RGBA 3P2EA 4EG6A 3QLEA 3DHEA 4YEDA 1JE0A 5IUKC 1DOAA 2ONKA 1HL3A 2XVYA 2V7GA 4JI4B 4YY3B 3UVEA 2FSPA 2V6IA 2CFTA 2CVFA 2R7NA 4ZT6A 3CMMA 2VAMA 4UMFA 1IU9A 2QAGC 1JHOA 1ID1A 2CZCA 2Z98A 4JLDA 4EITA 5L7YA 5HOQA 2I3ZA 2I7XA 1A5TA 2ZR0A 5G40A 4HX9A 1YGPA 4MS1A 1S7GA 2XCLA 4MDYA 1QHNA 3Q2KA 4H1UA 2HQRA 4L78A 5EIHA 1N78A 4URXR 3DZJA 1N9ZA 4ALJA 4ETNA 3H87A 1JFRA 2COEA 2L69A 1EUYA 3EJ6A 1LFAA 2D62A 4ND2A 3OMWA 5C18A 1WTCA 1OH5A 1FPMA 2G0AA 3H2GA 5BY2A 3K5PA 3QHPA 4KYTA 1KE1A 5FOVA 3E84A 4R7ZA 4ZGWA 1RMTA 4ARUA 1QFZA 5E3JA 3KKEA 3AEQB 1JWAB 5ALQA 5IXJA 1UXJA 3QI7A 1PWEA 2I87A 1T5TA 5FHRA 1SUEA 2GERA 1VCIA 1S8OA 2NYUA 2GZSA 3N8NA 4EHBA 2X76A 4WAUA 2CHUA 3ROXA 2JJYA 4MUHA 2AR0A 4DAOA 3I73A 5I7FA 4Q4AA 4I46A 3HWRA 1FBNA 4XSVA 4TSKA 3MMXA 4CDNA 2QPTA 4LRWA 4ZZ2A 2XHZA 2O48X 3HHEA 1YZFA 1M1UA 1Q12A 3BGVA 3N0XA 4B9AA 5I8PA 2FSFA 4ECEA 2I91A 2W43A 3VR0A 2QPOA 2C8LA 1KARA 3F74A 3KX2A 3NTQA 2X6RA 1AKNA 1Q77A 2HGZA 2Q62A 2QMZA 3DB1A 3GLKA 4AF6A 1T9ZA 1UKCA 2DSNA 4N03A 1H23A 1F7UA 4E6PA 1KQFA 2XVXA 3SVTA 1EXVA 4P7BA 1QP0A 1TZJA 2X6QA 3MCVA 4GZ5A 4NK4A 4OHKA 3VNRA 4BC1A 5BQ5A 4O02B 1P4AA 2G0TA 4O3FA 1O77A 2Q5HA 3OLCX 5AM5A 4ZYZA 2FVYA 1E2GA 2F6RA 3A6FA 1VIAA 1OX4A 2YDYA 1U2DA 2FP4A 2HJ9A 1R9NA 1JQJC 2I7VA 2VJAA 3I64A 5JCXA 1X1CA 3CLUC 2FR8A 3TLYA 5DLQC 2EATA 3DT8A 4YJ2F 1H8ED 3B89A 1A0OA 4TTSA 4JYZA 1HA3A 3DC2A 4IL5A 4YRQA 4EWLA 3ENNA 4KK4A 3LE8A 3TN7A 4C1NA 2C7PA 5D1NA 5DSTA 4QVGA 4TUYB 4RVUA 5KS2A 2PXHA 4DV0B 4DPKA 4H7EA 1EBBA 3RRBA 4X60A 1SZJG 4L6CA 3V33A 2W2MA 4P93A 1HDEA 2XKKA 3OJLA 1AV7A 2OL4A 3W78A 1IY1A 2XSZD 1S2IA 4PHTA 4AL4A 4MYHA 1KH1A 2EEZA 2Z2ZA 3VDRA 3WADA 4BJ6A 1Q0TA 4P0QB 2FRVA 2JGKA 3EZYA 3QFCA 3UMJA 1KF0A 1NUHA 3H3JA 4AY5A 1U3UA 2CYBA 3ZE9A 4IIJA 4FKBA 1II8B 3W7VA 1FX1A 1T9CA 1T8PA 3CX7A 3QUQA 3MINA 3MVEA 2DT8A 2H08A 2O2YA 2QTTA 3K35A 3N2YA 3QVUA 4I7EA 4JVLA 3UHJA 1C9EA 3RC7A 2HMVA 2DWUA 3CBGA 4R05A 1GTMA 2PEYA 1B0PA 2JAOA 1LBEA 2WIBA 3HVRA 1RBYA 4I50F 5EKSA 1ZLXA 3I9LA 3QUCA 2BSQA 4IDGA 2P4EA 3TLGA 3AVPA 3L0BA 4EVQA 2REBA 1U8UA 4BFVA 3MMSA 4HDMB 3CE9A 1TXGA 4UXHA 1FL9A 4FQ8A 5FPHA 4N49A 3TGWA 2RD2A 1B7GO 2UVQA 2ZIGA 3GFRA 1IN5A 4CYMA 1RKUA 1Y6FA 4KQEA 2H2AA 4BTVA 3WGZA 5AR1A 1QZTA 5KKCA 3B1FA 1EHIA 1VFNA 4TT3D 5I48A 4PO9A 1GUZA 2SCUB 4RVFA 5JAOA 2LV8A 1UBSB 2W6OA 2QR5A 4KXVA 1ZOOA 1WMSA 3NGMA 1NG1A 2ZT7A 4RGVA 2NQ8A 4POOA 4V0SA 2WTUA 2MINA 3FE2A 4AS1A 1K6JA 3HV2A 4AIIA 2ILTA 1WW2A 4IFEA 2Y0PA 1OX5A 1QTIA 2C9BA 3LX6A 3RYIA 3E7DA 5KWEA 1D0IA 4QM7A 3WV5A 1DWQA 3DCJA 3RW9A 2QY9A 4OXQA 4F4HA 4K28A 4C0JA 2IL1A 4NBWA 2XF2A 1GQYA 3RLIA 3U0BA 2H9YA 3S1LA 2VF4X 4MQFA 3HMQA 2MSNA 3T5GA 3ZGLA 1N5DA 1T2FA 3KPJA 4JAVC 5EWLA 4TMWA 1VJGA 3CNEA 5AVKA 3D8BA 3TQTA 2QP3A 1ENZA 1XDGA 4QT0A 4ZA2A 2R6GA 5D6NA 5DI3A 1XTKA 4BRZA 2ISQA 1FFDA 4B4UA 7REQA 1YMQA 4MUFA 2NP6A 8AT1A 3C7CB 3IJ5A 4B84A 1CE8A 2H0RA 1UM9A 2IXGA 2YKGA 3U19A 4A0QA 5K99A 3CW9A 4ONEA 1QGAA 4GC5A 3ZDCA 1SC9A 4P53A 2Q7DA 2FFJA 3ROGA 3WWYA 3GLFE 4KDCA 1CJVC 1NQTA 1J56A 5TT1A 4EY3A 1TQ6A 2XNDA 4FZVA 3OT5A 4LV8B 3ETNA 4L8YA 2G7MC 2IYUA 1ZK1A 1R4MB 3EVDA 3PEWA 3L7MA 2A1IA 2JIDA 3PDWA 2AJBA 4KIFA 4MUBA 4TMFA 4YP1A 4H0FA 5B7PA 3M4YA 4G0MA 5BRNA 4LDNA 3Q6MA 5HQ3B 1VC2A 4JV5B 2BI4A 4Q00A 5AVWA 4BVHA 1J0BA 1VMDA 1PGOA 5GONA 3S6JA 5IG2A 4M0MA 1H6AA 1TYZA 3PQDA 5DM70 1ZA2A 3RVBA 1HOTA 1KR5A 1LBIA 1XRLA 1Z88A 3MWKA 3W1VA 5IN5A 2BTQA 2HCRA 3NHMA 5A7HA 1WG8A 4QU5A 4J03A 1X7XA 2W2VA 2RG1A 2FZWA 3C45A 3JZFA 4NBVA 4X6YA 3SKXA 1P7YA 5EJ7A 1ZN7A 3OT4A 3TVDA 1MQSA 4CKWB 1SCDA 3JR3A 1VPLA 1WZIA 2QR3A 1C2YA 2ZJ5A 3V1YA 5I3CA 1VOTA 4Q3OA 4TL7A 3ZPXA 1T6BY 1QTNA 1RAGA 1G5HA 3KFXA 5D5PA 3RI3A 2FZ4A 4CG2A 4L07A 1DGQA 4RPJA 1FRFS 2P9GA 3RWOA 1A2QA 2D1QA 1SD1A 4IX9A 4XDZA 3VFDA 3QFTA 3GGCA 3HH8A 3PQ8A 4Q4HB 4A73A 4A15A 3HFGA 2O19A 1ST3A 3B1YA 4IO1A 5A6SB 4JB2A 4JB3A 1TUBB 3V2GA 4EJSC 1W0KD 4BBPA 2LTAA 4GX5A 2J0UB 3A3OA 2DTXA 1P8AA 4IMRA 4MLPA 3RUHA 2R7LA 2JH8A 1OLXA 1WVIA 5CVUA 4RZXA 3C16C 2PRJA 2WYHA 1FJHA 1I01A 3CEAA 2NG1A 5CIYA 2IDMA 1W5BA 4R84A 1O2DA 4B6OA 3BCHA 1VRWA 5ALHA 4W5NA 3ZHSA 1HDGO 2WT4A 4EKYA 3D2BA 4URVR 1LS1A 4J9VA 4R0MA 4NONA 1XNJA 1SXGA 3RGWS 4B4VA 3ESXA 1CY0A 4G0VA 5LZ5A 2E18A 2GK3A 3MOIA 2NPOA 1BN7A 2CMDA 2ETVA 3NDIA 4JEUA 4RTSA 1FMJA 1YAJA 3KFVA 4M8KA 2Y1DA 2ODAA 2PMBA 4P4NA 3GY0A 1ZMOA 2EW2A 4I5EA 3S29A 3TW8A 1AA9A 1NQAO 4HQRA 1YZNA 2G1PA 2J45A 3DDSA 5CD1A 3V4PB 2WNHA 1TPYA 2ZWAA 2H11A 3K4PA 3L7OA 3OZRA 1UJMA 1X7YA 2CE2X 1ANKA 3DTVB 1TF2A 4J0FA 2C1XA 4DWWA 2BC9A 2IIQA 4CUZA 4OQQA 4MJ7A 4N5IX 4ON9A 1UM8A 2WAMA 1U0NA 1OJ7A 5IAEA 2VWQA 2FYTA 4B6JA 5JAPA 2J9YB 2P9JA 1L7NA 5TX7A 1F0NA 4QXAA 3KEGA 4ZI7F 1SH7A 1WHSA 3V2IA 1QANA 3G23A 4FGJA 2FJPA 5K0TA 2QYSA 3I5MA 5LLSA 5KKNB 4JC4A 2O54A 4Q66C 4BMPB 3HP1A 4BUJA 3ED5A 5K3AA 3U49A 3EIHA 3IKLA 2X40A 1I7SB 3AY7A 3A4YA 1HYHA 2EZ4A 3K8OE 1W49A 1ZD8A 1CX9B 2J3IA 4RY0A 4UREA 3RU7A 3THYA 1DAEA 2I6TA 3SAJA 1JIUA 3LT1A 5KNBH 3GVCA 4RTNA 1P77A 4Q5IA 4UQLA 1D2NA 3U5TA 1SC6A 1BFUA 3AK4A 4TVBA 2V98A 1NJ5A 1VRCA 2PTHA 1I4LD 3G59A 1HETA 4ACAA 4NJEB 3V2HA 2HWUA 4BWVA 4ZALA 5B1IA 1JEEA 1BQEA 1CUAA 4AJIA 4BECA 2VYND 1EFPA 2AZTA 2OXEA 4IXMA 4FC7A 5B1EA 5EIOA 1SKQA 2ASEA 4JGBA 4EFKA 5E6SA 3K9NA 3ZJVA 1ZIOA 1A5SB 5DLEA 3PZBA 1BOFA 2VK4A 1ML4A 2JFYA 2BE9A 3KKZA 2QW1A 1N5JA 4L0MA 2R7AA 1KI1A 1FFXA 1M67A 4NBLA 1NLMA 2IP4A 5DH9A 3BSYA 2Y4NA 3JWEA 1KAHA 5HS4A 1U28A 4ASUD 4B74A 4IGKA 4HFJA 1LBHA 3I2JA 2JBHA 2EKLA 5F1YA 5AW3A 3GLRA 5BNIA 4BGIA 5F23A 1P31A 4BMDA 1E6UA 1NOKA 1Z5UA 2WTAA 1QU3A 3E4DA 2OE2A 2W4QA 2JLUA 3KKMA 1SVNA 4UW9A 4KVAA 4XPIB 2Z1DA 3O26A 3GNQA 4DR7B 1KDRA 1EVIA 1VI6A 2WF7A 3K0CA 5DGXA 4EA6A 4F2DA 4Q9AA 3IJRA 3IAM6 3AUTA 4ZOBA 1QK5A 4LQDA 4WK4B 5H83A 3LV8A 5BV0A 3FB1A 3ICWA 1RRKA 3NOQA 3L6OO 2OZEA 4QREA 5BO5A 4DSOA 3K31A 5JSFA 1EZZA 3G5TA 3JZAA 2ZRAA 1G8JA 3GDHA 4ZTBA 1Y8RB 4GKKB 3Q5DA 3ESBA 1P4GA 1HQDA 2IXBA 1TEXA 2D2EA 3TZBA 5K7SA 3CONA 4YRSA 2B3DA 3L0ZA 4QXMA 5K0ZA 2XMDA 2YZMA 3OM8A 4LVCA 4O2AB 1ZIDA 5AYVA 4X93A 4RDIA 3VSAA 5SYAA 2JIPA 4M1OA 4EYKA 4XWWA 1CS0B 1NSYA 1PFKA 2GN4A 3OPMA 1D1PA 4WXYB 5KHOC 1P39A 2VT2A 3G8BA 1ARZA 1NQ5A 1JG7A 1WY5A 1PR0A 3O8QB 1R74A 2GI4A 2VAXA 1R3DA 2WUVA 4H77A 4IHAA 5DNVA 2EKBA 5DV9A 3GEDA 4ZARA 5C9ZA 9LDBA 5KNCH 2ERXA 3O9VA 2ZYWX 3OJCA 4IYJA 3TOSA 4V0ME 4WTOA 1JXOA 3W2TA 3OZXA 1BMQA 1GZ6A 2ZJ2A 5H1YA 4CM6A 4PNEA 5I7SA 3DWGA 4XIJA 3PGLA 1CEEA 1K0UA 1WA5A 3W2IA 5EUMA 1VSBA 4U2BA 5A5DA 5CH8A 1DJPA 1SOWA 2ONJA 4OGKA 3Q1KA 1UH5A 4QUJA 2X9LA 1BH2A 1L5NA 3NDBB 2JFWA 2VT7A 4UJ5A 5K0CA 4DUZB 1ZGJA 3SYKA 2LR0A 1Q0QA 2EIXA 2X3YA 1KYZA 3A9TA 3WKEA 1CIVA 4EHHA 4CM9A 3ANSA 3MB8A 2XWSA 3A9UA 1IK6A 5DISB 1BHQ1 4JC0A 4YK7A 3AZQA 2BIFA 1MB9A 2C5EA 3D2AA 4A0RA 4G5RA 2IBTA 3LUAA 3P20A 1TQ4A 3F3SA 2DPLA 2IY8A 2QRJA 3ANNA 5ES4B 1OLUA 1V9SA 1EK0A 2R86A 2HIGA 1W4LA 2FMFA 2MT9A 1DO0A 4CG1A 3H9BA 3JQ6A 3TTWA 3U60B 2B21A 1J5PA 1Q2XA 2PYIA 2IH4A 3LI2A 2PRSA 1NW6A 2VP6A 5FR2A 3BN3A 3N75A 3W5SA 1U0OC 4H7IA 5JYEA 5IM5A 3RYFA 3DOFA 3WHKA 3SP1A 4NXMB 4HQFA 3H99A 3ZE8A 3A26A 1V26A 4CCWA 5GVRA 2CK3D 4JJ6A 4FMCF 1D2AA 1W85A 4MYDA 3A36A 4RW0A 2Z6VA 1BHSA 4ZOLB 1U6KA 1BEEA 2VRCD 2E4XA 4MS3A 1XBTA 3U3ZA 4BGVA 4Z6KA 1GXSA 2GPSA 2HDOA 3ECAA 3SFZA 3QWHA 3IOMA 2FN9A 4HZUB 1RQ7A 4PFSA 5JSHA 1IBSA 3HE3A 1B0AA 3FH0A 2ZE7A 1XYVA 3JQ8B 4DLPA 1J2YA 3ZDBA 4MR8A 2QXUA 1X0XA 1QIMA 2FN4A 2YWEA 3EW9A 2J30A 4RSHA 1IJKA 4UHEA 1WCIA 4EQZA 4YRBA 1F7VA 1Q0SA 2YIDA 2XKAA 3QQPA 3RVMA 1XZFA 1UBLS 2Y93A 3CZ5A 5IZCA 4F06A 3F5SA 5BQXA 3UAOA 3DTTA 4NBTA 3Q40A 5FNVF 3O8NA 2WNIA 1BGWA 1CC1S 1BN6A 3PUVA 4D57A 1GZUA 1UXOA 3WXMA 4BTEA 1GUYA 1Y0BA 2K4MA 2WHQA 4HEQA 3GLGB 4FOPA 3JRXA 2EBHX 1QR2A 1RC8A 3ZLVA 4XZ3A 4MVYA 4N5HX 2P68A 3VKGA 4L0DA 1B43A 3KFLA 1AKUA 5CDGA 2XX3A 2PFKA 1V8ZA 2PGIA 3TBHA 3UYKA 4HUTA 3TXXA 4Q4LA 3D4OA 4K9OA 3QMWA 2GBIA 4MEBA 4UBKA 2J9FB 2WTEA 1LV7A 1N7GA 3HKCA 4IQFA 2QYTA 4LDJA 1L4YA 5AQ1A 4D81A 1S8AA 2YZ2A 2BM0A 1YO6A 2ZSKA 3ZWXA 4EB0A 5KWIA 4F6RB 1VYVA 4A6DA 3P5BA 4M7RA 4I66A 3UH1A 1ZMXA 1LW7A 2A67A 1G60A 3C6ZA 2PO7A 1KSJA 4IDBA 1LTQA 2GKGA 5HRCA 2ZAMA 2IS2A 1HSOA 5F9FA 3TPCA 1DKUA 3TSAA 1JSCA 2FSHA 1ADYA 3RARA 3V8MA 1KIAA 2HA4A 4DR4B 1Z6PA 1YT5A 4LY6A 1FTSA 4OHXA 3NHPA 1HDZA 1W0CA 2H0QA 3AJ8A 1GDDA 3TAXA 1NR5A 4C3ZA 4KB5A 4R2MA 2JEOA 1WUJS 1ZAYA 3DCNA 3QOXA 5CFZA 3MWYW 1HV8A 2GJ4A 3P71T 3PUXA 3KJIA 1E18A 3NEPX 3OD5A 4NU0A 2JNWA 2OY0A 4QFBA 2OUIA 5LP6B 5DT9A 5HFNA 1Z8HA 3L6BA 2OV8A 1G3QA 2QLMA 3EAQA 1O6CA 1KK3A 2CHFA 3PUYA 1X9HA 1U0HC 1GGVA 2O7VA 3E9ZA 4PX2A 4HEJA 4RK4A 3U80A 2PX4A 3DEZA 3GZJA 3AEUB 4PSCA 4I1YA 3U9LA 5L4SA 4B3SB 4OVKA 2CB0A 1IMOA 3QWAA 2QROA 3K09A 2UZIR 4HADA 4PQGA 1AF4A 4WUVA 2JCVA 4YLEA 3TZKA 3VU8A 3AHIA 1FFWA 3AHCA 3IMKA 2I65A 3LOUA 2FFHA 2ZRBA 1JKJA 4FXOA 1YFLA 3D54D 2Z4TA 3NRBA 2GA9A 1Y3BE 3CISA 5C4MA 3AJEA 5C8YF 2DETA 3QE0A 3ABRB 4CKYA 4OHOA 1KS2A 5KMGB 3NZEA 4R1PA 2QM3A 1PL8A 4D44A 3JAMA 1CEYA 3WLMA 4REOA 4JT4A 1QGED 4DWVA 1FLDA 2E4WA 4IHJB 2HJVA 2QTVA 3BJIC 4DCTA 2DCMA 2Q46A 4J7AA 4QTUB 1LX7A 4M89A 1IIBA 4QUGA 1MB3A 2ZJ1A 3TQFA 1GGEA 3DGEC 3E9NA 4WXPA 1CQPA 1TK3A 4JLJA 4GKJB 3WMFA 3KT3A 1PS9A 1EK2A 1EUDB 1AKWA 3CX8A 3EAFA 2B82A 5K51A 4PYQA 4D99A 3AJRA 1P74A 2AE1A 2A6PA 3MCAA 1W4CA 4OOFA 3MS2A 4WPGA 3PFIA 4A8JB 3NOOA 3ZDAA 4DQ0A 5KBYA 3MN1A 2QIPA 1XMSA 4K9DA 4EW1A 4MP8A 5CP8A 2NT3A 4B47A 5K45A 1K89A 1EK1A 1JHDA 4E2YA 2FPPA 5BORA 2JFGA 1WW3A 1AK9A 2XCSB 2VQSA 1XQXA 4RZSA 4CV2A 4HH3C 3GMSA 2QENA 2YJ5A 1ZR2A 1GQ2A 2WAXA 4LJ9A 1VJ5A 5TJ9A 3AVYA 4LHZA 2UZ0A 3SXUB 2XNJA 3EF0A 2P9TA 3ES9A 2EKQA 3OX4A 1R7RA 4V1CB 1PR1A 2W6JA 4NH0A 4W7HA 2B2CA 1JR6A 2AQHA 3PYLA 4HXYA 4AJEA 1IAVA 5KTOA 1Y8QA 1N92A 2P9EA 2XXBA 3BIOA 3F6PA 2ACWA 5KO2A 1J7JA 1XEWY 3H9QA 4IH4A 2P9YA 5CMLA 5HIMA 4H1TA 3PNMA 3ZNPA 4ZYVA 1I94B 4JNCA 3V7UA 3V8NA 4LJKA 1D4AA 4RKYA 2DHCA 5B2EA 1NX9A 1TM2A 2ZYVX 2FZGA 3PSHA 5FL7A 2BGNA 2BFCB 3T7EA 3I12A 4AWAA 2QVGA 5CFRA 5L6LB 1IHPA 5KTTA 1IXKA 2B8NA 1JS1X 3GGJA 3M6MD 4JQOA 4MARA 2BBTA 4ODIA 2XUFA 2MYTA 1MTZA 2Y0EA 1V11B 3EXFB 2MTBA 4AY4A 5KJCA 4CV0A 4MHTA 4KTTE 2ZRLA 1XTRA 3REQA 4C4RA 2BYTA 1EFVA 3THSA 5FYDA 4M98A 3HXQA 3KT6A 3EZNA 1UBHS 3QW2A 5CXXA 4ZRDA 3RREA 4P4UA 1TKBA 3EC7A 4OYRA 4GOXA 1OLSB 3ZHRA 1J24A 3U26A 4E7PA 5DBIA 1KSGA 2G4LA 5L51A 2DH5A 1OWNA 3JAWA 3LYLA 2IA5A 3PEEA 3FWHA 3TECE 4GM4A 2XZLA 1NF8A 4NYIQ 1H85A 3UHAA 4JJGA 4QOEA 1FA9A 2H85A 4KMSA 4UU7A 3SXJA 1KI8A 3E5NA 3PHLA 1L4KA 4H3HB 4ZU3A 4IRXA 5FP0A 1IPHA 1T9BA 4C0QC 5BYKA 1JDBC 2LE0A 1C7RA 4YJHB 2F48A 4OTZA 3RRZA 3WHPA 5CB6A 3G2KA 3JZIA 3KV3O 3DOIA 4EA7A 3IBYA 1LDBA 2WJGA 3G2LA 1T5BA 2CV2A 1XZGA 4A0GA 1WXXA 4RJIA 3V1MA 3CNOA 4TLAA 4UTXA 1Z6GA 2VDMB 1ZUNB 5H16A 1YZQA 3EZLA 3VGJA 1QO9A 3ZLTA 1MJFA 1NIPA 1NNEA 4XM2A 5ALOA 3RDPA 4NWIA 2ERYA 1KGDA 2R1ZA 3HY4A 2EYQA 2OXRA 2PKYX 3HYNA 4OGWA 5HPYB 1QWOA 2XY4A 5J2TB 3GDWA 1KYWA 1NVVR 1E1RA 1BRMA 3DYBA 1S5PA 3GI1A 4D9KA 2IE0A 3CHYA 3TWOA 4WBSA 5KX5F 3JW8A 3GAAA 1NULA 4RSGA 3SZ3A 4UNRA 1D6JA 1GQRA 2G5PA 2VYCA 4F7WA 1OREA 2JVIA 5KYUA 5AVRA 1NXWA 4DA0A 5B53A 2PUFA 5LJIA 1ZMRA 1ORIA 4BLWA 4G84A 3AT1A 4D4IA 4MYTA 4ZEWA 5C32A 2DJ5A 4KRGA 4MHOA 1BXKA 4FS8A 1TA4A 3R6WA 4CHTA 1O96B 2P2LA 2DR3A 2JIMA 2VPXA 1ONSA 1NVGA 2UKDA 5EMMA 5KYWB 2A4MA 4B17A 5JR3A 4JEMA 4MGHA 4QEZA 1AQIA 1K2VN 1X1BA 1T3TA 3IEUA 5EE1A 4TZ0A 2RH9B 3PRYA 5DYNA 5HIJA 1W7AA 4BBJA 3S55A 4HWSA 3QXXA 3NW9A 4FHFA 4QUBA 3EWSA 3LMKA 5DJ5A 3D8TA 5TPWA 2Q50A 2XB6A 5ICEA 3SEFA 1IUNA 3EZXA 5F1PA 5DIZA 5AKEA 5JMTA 3OZFA 4YRMA 1AKEA 4R5MA 2WKSA 2G9VA 5CW2A 1P2FA 2ZRKA 1W2GA 3NVMB 5GJBA 2G4CA 3SG0A 3OHPA 1E8MA 2WAAA 2HPZA 2J3JA 2ZU6A 4PZCA 4TVSA 4DRXA 3VC2A 1JXQA 1XJQA 3PFBA 5JG7A 1P1IA 1G0NA 3AF6A 5HKOA 2VDWA 1IWBB 5AW2A 2FN7A 3ZWYA 2QVZX 3QLTA 1UPCA 3MOGA 1KZ6A 1Z0FA 4AYXA 5KOJA 3D3EA 4YROA 5AJXA 4MQEA 5L4NA 2PVPA 1M5TA 2JD0A 3IUSA 4G6ZA 4ND1A 2B1GA 4J94A 3BWXA 3T7KA 1GGJA 3VYVA 1I33A 1JR3D 1S7CA 4IV5A 2XB9A 4B3XA 2YHIA 2BMVA 2I8LA 2VHWA 3JARA 1MJ5A 4DFDA 4YQFA 5IDQA 5J2UB 2H7XA 2DPHA 1B6GA 4HB2A 3PBKA 3ZIDA 5HIAA 1BVRA 2FXVA 3IXMA 1NKTA 5E8JA 1COWA 4V2IA 4KXUA 4KAAA 2OR3A 2JGEA 3PWKA 4IXDA 2W2KA 1BRTA 4RA9A 2ZI4A 4KSCA 1A9QA 1CF2O 1P0QA 4PYIA 3ZBTA 5JPIA 4MUMA 4BQFA 3FOWA 3FNEA 1QDUA 2AEMA 3W5HA 4F2HA 5G1PA 2QGZA 3E15A 5F9HA 2ZSDA 3C0KA 1A4RA 4GYWA 1KKMA 3TYXA 1U7TA 4B83A 4UTNA 1NBME 4BO1A 1YZGA 1MPTA 2EDAA 3HBJA 3KYDA 5BNFA 1XQWA 4D9FA 1P2GA 2G8NA 3BXPA 4UCWA 5DHQA 4WBNB 1Y9JA 3U16A 4B4WA 2FK7A 1G8AA 1BKDR 1JE1A 4U02A 4G9GA 3LZDA 5FCDA 5B3JC 4NXNB 4ANFA 4B81A 1RWVA 4R3WA 2OO5C 3L0PA 1RHUA 2ZBDA 2QVYX 5EZQA 3NUZA 4NCNA 1F4LA 2D0DA 2JZNA 4FYPA 3ZX4A 1AZTA 4LXIA 5EIXA 3QEBZ 3K1AB 2BR3A 2WYOA 1JKIA 3MXTA 1YJBA 3P0HA 4AY3A 2KPOA 1BJRE 1RLMA 4S2EA 4YJ3A 2F3RA 2OCXA 5A2GA 1SELA 5B7QA 2A9OA 2YQZA 1H2AS 3S28A 4IV0A 3G02A 3CN7A 1CRPA 1NE7A 1ZR4A 1Z12A 4NZOA 1KO4A 3JASB 4UUAA 4PN3A 1O95A 3JQRA 3ZCPA 3H1AA 1PGPA 3VC7A 4FSHA 1Z47A 2WA2A 4FGKA 2MSDB 2WYUA 4GICA 4M9QA 5HDBB 3PEYA 1MC5A 4B45A 4CL2A 4KGVA 4JS0A 2M6LA 3B9QA 4QD3A 3PIDA 4K8OA 4WZBB 3TTVA 3DAYA 1CVLA 2K87A 1TUGA 2QJWA 4MQ5A 4XFKA 1D2CA 5TY0A 5HJEA 2Q4OA 1AGPA 1XA0A 5I7RA 2ZYTX 4TMYA 1XEFA 3FYUA 3IFSA 2K2QB 2V5UA 5SZHB 4RUKA 2R7MA 4TXJA 2CFOA 2VQDA 3P9CA 2HLNA 4NE9A 3DLBA 3B8EA 3OIUA 3UENA 2CSXA 1W8IA 5H8WA 1RWBA 1T4MA 1LH0A 2OHIA 4EW6A 1S1CA 4R5HA 2XZDA 1M0WA 5FFNA 5SYMA 3VOBA 1GEEA 1WHTB 5AVTA 4UBIA 3BWMA 2FUEA 3CR7A 4WZAA 2XT9A 2IQ5A 3AW8A 3W7AA 4AYWA 3R20A 3WK9A 1HYBA 4TYQA 4X94A 2WLTA 1AQNA 2Y1OA 3OIFA 3DDZX 3DFFA 5L4LA 4NU8X 3OPQA 1XCGB 1G9XA 4OXXA 1B76A 2XF8A 4KDFA 2XDAA 5TARA 3PENA 5G1NA 3REOA 4F4CA 2TMGA 1FJGB 1TJ3A 2YWDA 3KU1A 1KEKA 3SF8A 1TAGA 3H1BA 4Z49A 1PBTA 3JV7A 4HFRA 3BC1A 1DOHA 1KO1A 3VOTA 1F5NA 4FTWA 1C7IA 4BWYA 2MSWA 1QP4A 4CN8A 4JB8A 4N8DA 1EWRA 3KELA 5ECYA 5IJ9B 2I6SA 3U17A 2RGNA 5BURA 3B38A 4TKLA 1F6DA 5ARDA 2C94A 3KS9A 4NENB 3ZCRA 2DBYA 4ZCIA 2C2BA 2C5FA 5ED4A 1HE4A 3JQPA 4QWMA 1ZN8A 3KL4A 3PHGA 3B6IA 4A03A 4IJWA 1J99A 3DAHA 4KXXA 1MW9X 4HAVA 3SS9X 4HDKA 4Y9UA 4PO8A 1B8PA 3C70A 4OUKX 4QU8A 3D31A 3W4IA 4OJNA 1FYXA 3O74A 2IHZA 4M0UA 4BKOA 5K0JA 4JQYA 1GYRA 2AOVA 3GPBA 1IHYA 4DIKA 5ER6A 3M6IA 3RSZA 1GRQA 3KVYA 4P3NA 2TECE 4L5JA 1I7DA 3I42A 3JSXA 1OH7A 1OX6A 2BGGA 2XA2A 4K0KB 1GL3A 2G9ZA 5CVCA 1L5HA 1BS2A 4EYSA 3ZIUA 1R9MA 2DFPA 1MABA 3CZAA 1S3GA 1V96A 3ZVNA 1SQSA 3U4CA 4U63A 3L4JA 3UMMA 4FI3C 1EA7A 2YFYA 4NAVA 1W5AA 4CODB 3Q3GE 4GH5A 2HJSA 2XMZA 3T95A 1CPYA 1Z0DA 3EXEB 2PGOA 3E9EA 1CJBA 2HPHA 2BRUA 2OAGA 4GQBA 2JFPA 2FOLA 3K9FC 1PS8A 1WEHA 4W6ZA 1XXLA 3DHYA 5FTWA 3ET4A 2FSIA 4OI1A 3VR5H 3SDZA 3SIXA 1JKMA 2VYFA 3Q6IA 3PQ7A 4I55A 4J0QA 2WF8A 3IMCA 1Q2UA 3OSZA 3PQEA 3WRWA 1I2CA 2PGNA 1EM8B 1XWWA 1N2EA 1Q5PA 16PKA 3DTNA 4NIMA 5U4XA 5P8WA 3GLIB 2TSYB 1Z22A 2C2MA 4L2IA 3LDAA 3QLVC 1ND6A 1RKXA 2PZKA 3DOOA 3LGAA 3TLXA 1G5FA 1DIAA 2YRXA 1XJ0A 2DG2A 2E1PA 1SQGA 4WXEA 1RW4A 2ZRHA 3LJKA 4KIWA 1C4XA 1NUUA 4RD2A 3VHXB 3QX3A 3ANMA 4ETMA 2R00C 1Z83A 5FUQA 1FFEA 2ZBQA 3LCMA 2CHGA 4JEIA 3AKZA 4O4LA 3K4HA 2NM0A 1USUA 3UO8B 3RFVA 2D00A 3I34X 4KPYA 3BD7A 4JSRA 4JLMA 4JZKA 4RXMA 3NIFB 2ENUA 3FCEA 4NYMR 1XWIA 1IZYA 3TQQA 5IUJC 1JFTA 1WXHA 2BJWA 4XVRA 1QS0A 3RSQA 4JT9A 5IF3A 3L1UA 2IPMA 3BMOB 4UNIA 3KQSA 4HRYA 1RMYA 2Q6TA 4PSDA 3CH5A 1T9GS 1DT5A 3NAGA 1TFRA 3VNVA 1LPNA 1G21E 3I8OA 4P34A 3V32A 1U1CA 5FR1A 5G3ZA 5ED0A 3WNCA 1CB0A 3J7AC 4HI0E 1V39A 4U8GA 1CSEE 3RRFA 3RRXA 2J3LA 3T5CA 1EWQA 1L4EA 2IF2A 1YZVA 5I9SA 2REOA 3I4LA 5A71A 2WE7A 4PRLA 1YJ8A 1L4FA 2ZQYA 4HWOA 1M2OA 2CBGA 3AJ9A 4ND4A 4MQ4A 2AFHB 3WGUA 3TGPA 5KNBA 4Z3OA 4ABTA 3WLQA 1GD1O 1DDGA 1E63A 3BMNB 3GJ7A 5J5AA 1Z3IX 2W90A 3LLMA 5LXTF 4U1RA 1XMQB 3N28A 1C3JA 3S2SA 4CMAA 4O8ZA 1O9GA 2JBAB 2JA2A 3TMAA 4LJYA 1M9NA 3IAXA 3NC0C 2AF4C 3FSGD 4EAAA 3T3OA 1PZHA 1B2RA 3H0CA 4MVXA 5LLTA 5DMHA 4DR2B 4CR7A 5LKRA 4NQZA 1LDEA 2YC4C 4BJ3A 3F5QA 1CS4C 2VKTA 2W2LA 5TGZA 5LM3A 4UUNA 5GZ6A 4CF6A 1SOVA 1PT7A 1RT9A 2VJMA 4P3YA 4P83A 3V7NA 1HURA 5JC8A 3L7AA 2I1VB 2V8OA 3E53A 2B7BA 4INOA 3U4QB 3LDHA 1O7JA 3DXFA 4V2UA 1GAEO 5DEOA 4CQJA 3BGSA 2JAXA 5JTUA 1Z2DA 5LPNA 1S2DA 1JW9B 2H2IA 4JB0A 2PLRA 3EGXA 4WESB 2EKDA 5KYTA 4JUDX 5H81A 1TUEA 4UEKA 3BSFA 2ECKA 5EIBC 3E5MA 5KDOA 1N8SA 4LNUA 5BV1A 3UV7A 3TVTA 4EZBA 1WVGA 4MGYR 1BU8A 4Y2JA 2WWXA 5HHTA 2FG7C 1WBJB 3QJ5A 2WVHA 1A9XA 4GC9A 2BLLA 4PX5A 4AICA 5KOHB 1O94A 3TB6A 1FSFA 2WI8A 2ZYHA 1Z6XA 3HNPA 2XBLA 1VSQA 1IYZA 1DFGA 2M6RA 2QW8A 3HXTA 4Q1AA 2P2SA 2FE1A 3ID6C 3TFQA 3U39A 1Q0ZA 3IMFA 3AHJA 2NOAA 3NUQA 3OWOA 2R2AA 3BDVA 2WJPA 3L0YA 3RS2A 4CF7A 3ADDA 2H65A 1YTLA 3INGA 1DEXA 3HJBA 1ZY2A 3EDCA 1TJNA 1SUDA 3ZQKA 1EJ0A 1CQWA 3RVSA 4INPA 1DX9A 4JIMA 5FIUA 3TLZA 5KNCA 1DRJA 2D3WA 2A1TR 5E8RA 5FORA 1E1MA 1DDIA 2DR0A 1TGVA 2PL1A 3LOPA 3NCTA 3ER8A 2O4CA 3IQHX 5HF9A 3K2EA 4ARSA 1YIAA 2G9QA 4O2LA 5ALIA 4D9GA 3GFVA 1PJTA 3KOMA 4ARVA 3FVQA 4ER5A 3I6MA 4WFIA 1GNTA 2DUUA 4OP3A 2IWHA 5HJ2A 1VXOA 1XDSA 2VZ0A 1A9PA 3L6EA 4CT5A 2XYRA 4RV9A 2YVAA 1T13A 3BMCA 3UWOA 1PNTA 1J06A 4QUDA 1LWNA 4XDYA 2VTBB 2Q7XA 2C0QA 5DX1A 1BDHA 5SZJA 3HNRA 1O58A 1FDIA 1T1SA 1RE1A 3AVOA 4EPRA 1YR7A 4D8TA 3N2GB 1TO1E 3ZXSA 2EJVA 3JYQA 3DAGA 4W82A 1GPYA 3OE4A 1X14A 5AKIA 1V3TA 3L1JA 1Y7IA 3TRJA 2MYNA 1M2FA 4I9GA 3WOHA 3ELWA 1N2HA 1NYLA 3IDFA 4BLVA 2PV0A 2DGDA 3D7SA 4MI1A 1QPBA 2I8AA 3D59A 1P91A 3MIZA 4B0PA 3FNBA 3MWEB 1P9NA 2P79A 4LJRA 4JBIA 4UQOA 5LVAA 1MBZA 2YIVX 5HM6A 3ZE7A 3GO4A 1E79D 3PYMA 4I5FA 2PGAA 2C5BA 1O4WA 2PT9A 2OD9A 2WYVA 1SVOA 5KYYA 4GEGA 4POAA 1GPH1 2XBUA 3FUUA 4NFHA 3FFBA 3RUCA 2ZPAA 4U2CA 1LB1B 3U40A 3WWEA 3OEEA 4MW9A 1E6WA 2GCGA 4Q3KA 4DUYB 5K2MA 3CUKA 4PLWA 4TVOA 4UFNA 3I5YA 1GPUA 1YCFA 2O2EA 3DDWA 5A7GA 3DL7A 1E2NA 1F2UA 1UKAA 1KSHA 3L7KA 4X6UA 1K06A 4RQUA 3F73A 4DDKA 4L8WB 4WOJA 3U3XA 4GPZA 1FFAA 4R0VA 5TS3A 3WS7A 1E94E 3I83A 5CYGA 1XEXB 1O5OA 3RRNA 3F9CA 4K88A 2FX2A 5DLYA 5HE8A 1A2KC 1U81A 1H65A 1IEQA 1PDVA 2P6MA 2OEPA 3KRTA 3M9XA 4RADA 2QM0A 4JJ4A 2FDCA 1K98A 3OEHD 2UYCA 3EVEA 2WFLB 1RLUA 3PC4A 3R5FA 5LP6F 1WR8A 2CUKA 5DK6A 2C00A 1ZEJA 1KY4A 1EMDA 3UFXB 1SBTA 4FHGA 4RCZA 2D5LA 2IYAA 3UXEA 3HO1A 2PMEA 1UT6A 3JSAA 5DHFA 3MD0A 4Y1GA 3PQ4A 4BWGA 2CUNA 2ZRIA 4CPDA 1RJGA 2JW5A 1UJBA 4PR0A 3Q10A 4PAOA 1EA5A 3G8AA 1BHJA 2JFXA 5BWOA 1LPBB 3AHHA 3K7EA 3LDGA 3BD8A 3MTEA 4IY1A 5EVJA 3T3GA 1L8OA 3WOVA 4C06A 2SICE 3WHLA 1PT6A 3CUWA 2PS9A 2ZBUA 1X80A 2FUG1 3DE6X 4FYIA 4I1OA 4R1NA 3T8YA 4PZ9A 4P4TA 4KQ6A 3AF4A 1CY7A 5ESWA 1A5AB 3RFXA 1JR2A 1KMMA 1EQUA 1EWYA 4HNQA 2HF8A 4BNFA 4QAJA 1DDOA 2BFWA 2FPGB 4IM7A 1RP7A 4AXXA 2VT6A 5BV2P 3OWXA 2CEAA 2O1WA 3QPBA 3MSXA 3B9PA 4HQ0A 1TLLA 1V2GA 2VPPA 4PS0A 2CFCA 4OLJA 2W8BB 1VBMA 4CF5A 4OD0A 1NWCA 3CR8A 4PGAA 721PA 2FMIA 3K73O 4OPMA 3FZEA 1CNEA 1EJ6A 1PFUA 4DCJA 3QFRA 1VCHA 2D0PB 2ZUCA 3I62A 1NVMB 2VXCA 2F67A 3A1NA 5ALJA 3ZXYA 4DL9A 4RTJA 4I4NA 3EGDA 2R5FA 2C4MA 1PJLA 1ZUIA 2ZS7A 4UZFA 3WSWA 4N7MA 4D4LA 3ZV4A 1BWSA 3T9EA 4UUBA 4ZMSA 1C1DA 2HWYA 1NKVA 2RAUA 4YPFA 3USZA 4CRWB 2Q8NA 1PIWA 2VAWA 1SIWA 1QONA 1ONNA 5JT1A 4ILEA 2H57A 4JVSB 2P90A 4XW2A 5BWMA 3LQ1A 4EIWA 2B1IA 3PE3A 5IKMA 1I4TD 2XQIA 3KQUA 4I1VA 5KTMA 1Z7BA 3V4SA 2O0MA 2WZQA 2HREA 4MR9A 3WYNA 3H0EA 4B7AA 5DHUA 3M4ZA 2PL5A 1ZBQA 2EZ9A 1D0SA 3OQNA 3NTVA 3P4XA 2HA5A 3AW9A 4I50A 5J58A 1W1IA 3MJFA 3TO5A 4WECA 1AMUA 1BX1A 3VO8A 5E4JA 5AVVA 2YQ4A 3CZRA 3TTSA 2YUTA 5FA8A 3P2JA 3MUEA 5EKTA 4Z0TA 5A04A 4KFUA 3HYLA 3TLCA 5JXHA 3EVBA 1R4NB 1RC1A 2OORC 2V5AA 3CINA 2Q6OA 3OUTA 4KIUA 5DYIA 5K4AA 3KOOA 3BJMA 1P4RA 4DSZA 2WMYA 3CX3A 1RYMA 2J08A 3JYOA 1GLNA 3Q41A 1QG4A 3JVUA 4O1IA 1YZYA 3T3DA 4DAEA 1OFIA 4BLRA 3EHDA 3GMDA 5KUTA 4W9RA 3I3SR 2OORA 3R3YA 4JJIA 3NM5A 4BRWA 2H4ZA 1KIMA 2P6PA 3FYDA 5EWMA 3EFOA 1JEOA 5CTJA 2QUAA 4EKIA 2ATCA 3SXPA 2G36A 1TQDA 3KQMA 1PFQA 3IKMB 3BCSA 2R1VA 3NIBA 2G06A 3NYRA 1PZGA 3DEKA 5K8UA 4XR9A 3TR0A 4FQ5A 4NZPA 4DYDA 1AJEA 4DXHA 1L7MA 2O8CB 2B8JA 4PZZA 2LPMA 2YNMA 1E58A 3ZCXA 2BDTA 3NWPA 4LOAA 3MFQA 4KQIA 4YAWA 4CEHB 4OKSA 2C2KA 5KSPA 5CDUA 4EO7A 3PKIA 5JDIA 3PQ5A 2GN1A 4JJKA 4MB6A 4CQMB 2DWOA 1DVRA 3W8NA 4U6QA 3FJYA 3ZHVA 5A4AA 1A4UA 3DMGA 1QFJA 4GYYA 1NDQA 1ZH4A 4NVRA 4P38A 3VU9B 4R7GA 3DVRX 5LBTA 1YASA 3PGA1 1VL2A 4MLZA 4YRIA 5K4GA 1CERA 4R9VA 1JZTA 3PT9A 2W2OA 5B2ZA 3SX0A 1KI7A 3AF5A 4BXOB 2XYQA 3R5SA 4XTCS 4ND8B 3V4VB 1TAHA 2VEDA 1MENA 1LDMA 3HCRA 1FP2A 4GKBA 3VVCA 4MKXA 1YK0A 1E2UA 3I1IA 3INRA 4MWZA 4AWXA 4H7KA 4Z9XA 5IVKA 1ZVVA 1JT2A 2X6TA 1M6VA 3C6MA 1CYEA 3N2LA 2F43A 2FF5A 4PPGA 2PXCA 5CB8A 1ILWA 3MWLA 4JBNA 3VI3B 4F4UA 1B74A 2AN1A 1F6WA 3FKQA 1G291 3HKDA 3K8ZA 2P8JA 3KNZA 1SOUA 1U0BB 3AIKA 4ESEA 4PGGA 3HN2A 3NM4A 1FVHA 1RZUA 4KKXB 3NAMA 4LY3A 5FBQB 1WETA 3IV7A 2HIHA 2D13A 2NO4A 1E6KA 1E5TA 3AUFA 4Q9NA 4QOFA 3T5MA 1P2VA 4U7FA 3DEIA 5TDHA 4AFNA 4MW0A 4CKBB 3CZCA 5KYXB 1ILEA 2AEFA 3JATB 3PC3A 2J0SA 4CGYA 3K16A 3N2ZB 1N0HA 3RBZA 3FUWA 5BSEA 4C4SA 5FUBA 1UPFA 2Z3WA 3RUIA 1QU2A 5A7FA 4UOEA 2BT4A 2AJTA 1G7CA 1PJRA 3GJSA 5BP7A 4QJ5A 1FOEB 3ELBA 3KTAB 3R5XA 4R69A 2SNIE 4R41A 3WL5A 5KVAA 3E3NA 2FGJA 1TQ2A 2PR7A 1HMYA 3KXPA 4Z1MA 1DE0A 1T1RA 1WO8A 4QOIA 1CJSA 1V1MA 4IIHA 2QQ0A 4F45A 4UZEA 1BCRA 2GFQA 3LBAA 2ZYRA 4EPXA 4JJEA 1XD2A 2YMQA 3OZIA 4FIDA 2NU6B 3I9V1 5T5QA 4BPRA 5BOSB 1LX6A 1P1BA 4TS9A 3W6PA 2ZGVA 1DC7A 2Z3VA 4FFNA 3W7BA 1YR2A 3ZK8A 1X8KA 2WIGA 3T7IA 3EDQA 4YJFA 5K9ZA 1P3Y1 3IQGX 1W87A 4Q7EA 5LMNB 3ZLJA 4LYYA 2X9QA 1H22A 2J5QA 1U02A 4O4JF 1RCTE 2X0IA 4TWZA 3RVLA 3WGTA 2JIOA 3LCCA 1IWPB 3W5DA 2ZEJA 4TM8A 1IRIA 3IKJA 5K3OA 3L4BA 4Q03A 3R9KA 3N05A 1MT3A 3G1TA 5JVDB 1L4BA 3E3LA 5CUQA 1ZAKA 2WF6A 1DZIA 1E69A 2ZYAA 3HUEA 4K26A 1JWBB 3BK7A 2OO3A 3H1PA 3EVCA 3IT2A 3L93A 1NQVA 3Q88A 4O08A 1PT8A 1ECLA 1DQYA 2OV2A 1K92A 2AJDA 1MO5A 2JVJA 4ID3A 4M38A 3PXGA 2EFDB 3ABQB 3G82C 3KXIA 2H9AA 4OIFA 2FK8A 1P6XA 3TRFA 4YV7A 3T0FA 2B6NA 2FWPA 1U9YA 1ZISA 2QZSA 4UNSA 4ZXPA 4JI5B 3BILA 1SG6A 2J5XA 3TIFA 3COVA 1R12A 2AQ8A 1CEXA 3FDZB 3BGIA 3GWZA 3Q5GA 4QXQA 3U9TA 1I1QB 4TN5A 2YWHA 4QVIA 2GASA 4UAVA 3L7NA 1STOA 2X22A 4XWKA 5AKJA 3WIUA 2AZDA 4LGCA 3LHKA 2XD4A 1WXGA 2X8AA 3AP1A 1DHTA 4G1UC 3DLHA 1BS9A 4R7TA 2XCTB 2ZUWA 4YT5A 3IEVA 1LNZA 2I22A 3DW1X 2W48A 3M5DA 4FYJA 4OAQA 4B4KA 5FAKA 3OLXA 4ZI7A 3QYJA 4UKDA 4HNAB 1ULBA 4ZPJA 5LDGA 1U3VA 1HE2A 1MJGA 1D0VA 1H1TA 1E6EA 1N2GA 2EWVA 1GCOA 3D3NA 3T9BA 4KYIB 4NNOA 3PI7A 1NZDA 4ZMRA 1TNDA 1OAAA 1QR6A 1TKRA 1LK7A 2XNDD 1WP9A 1O6GA 4JXZA 1ULAA 5BVHA 3B3FA 1PBNA 4U00A 1NYQA 1XP5A 2F4NA 3ROQA 1OTHA 4CMIA 5C5IA 3S5JA 3TOXA 4F04A 2O2GA 4YRNA 1SCUA 3EZ9A 4UULA 4BE9A 2C31A 1GA4A 1REQB 1SBIA 1T15A 2GSDA 3AC0A 1ODTC 2C4NA 3EVAA 3LY8A 1GZ7A 1OU4A 4FBGA 4AECA 4D82A 2ZR7A 5KTKA 2Q6LA 4YCAA 1X7ZB 2GARA 1EU1A 3QQ5A 1TW3A 4RIEA 3JYPA 2II6A 4D0RA 4FIZA 4RE5A 4YXWA 4Q3DA 5JMPA 3WBBA 4R54A 4ND6A 2ZZMA 2Q3JA 4GWKA 5IS2A 2EJWA 1PZMA 4G85A 2ZDHA 5THQA 3V3KA 1Z15A 3RJTA 1E1LA 3ITKA 1I2ZA 3ILXA 1XF9A 3THXB 2JCSA 3ZEIA 3CLTC 4X97A 3CLSD 3OQ1A 5CXUA 3TI7A 4JGGA 5CA0F 3GLFA 1JWLA 1XYGA 1MGPA 3TS1A 4OHCA 4MGIR 4M0DA 2AKYA 3I9OA 3JWIA 2Y2UA 2N46A 3AYXB 2PKQO 1JIJA 4Y30A 4DREA 2QVCA 3GRPA 4XWYA 1YDWA 1K7CA 1CUWA 2OMEA 2JS7A 3A7EA 3UBMA 4D8XA 5ALYA 4WKOA 2CLLB 2WJJA 3E3OA 3L1KA 2UZAA 4II3A 4A5OA 1JX6A 5CDFE 1HG1A 1GVNB 1TECE 1R3UA 4LFBB 2H07A 4ZT7A 5MFZA 3NUGA 5ILOA 2C58A 3DZDA 1ZGBA 3FUVA 4IZHA 5A4KA 5JS7A 1GTL1 1SAYA 4W7SA 2HMYB 4FEAA 4PXSA 4RK6A 2ZTLA 3C87A 3ZZ1A 2HUNA 3JQBC 3RRMA 1KQOA 4YI3A 2P2YA 3MT0A 1RR6A 1E3IA 1XTZA 4YIHA 3SIWA 2PN1A 3PCRB 1JR3E 4F4DA 3SFVA 5IMBA 4Z3DA 3WQHA 2E9SA 3IBCA 4JYPA 4BKUA 3AM1A 2XB2A 3GFFA 2AG0A 2HBRA 1QHIA 1HBJA 3O6VA 4FD3A 3VOSA 5LMUB 4K46A 4KLRA 4BNMA 2A9PA 2C1ZA 2HEIA 2IYRA 4R2JA 3TSZA 2P6OA 3UK1A 1UPAA 3UGJA 3BZBA 3L05A 4QZVA 4AJOA 1QG2A 1GPJA 1XDDA 2Q4DA 3JQFA 2EYUA 2HXSA 1CUYA 3LIPA 4F9TA 1PX2A 1U31A 1YVDA 3S2FA 2ZSAA 3K9BA 3TR6A 3HR8A 5IXYA 2C8VA 4I81A 5TEWA 1V3UA 4GWGA 4MCAA 3BL8A 3UAVA 2Y71A 2VSNA 4XUCA 1S3FA 5TVGA 3LXRA 4AJ2A 1GLGA 3PFFA 5FLKA 3ZZNA 2O8BA 3INYA 4TROA 4AKSA 2I7CA 4IJ5A 4JL5A 4S0XA 3I0NA 3DE2X 2HMUA 2PKWA 2QAGB 3DBLA 5EAIA 3W2HA 4YUXA 2C9YA 3CM0A 3E9QA 1AXEA 1E96A 3EY4A 1JG6A 1PHPA 3M9LA 4WQMA 3K5HA 4ZYLA 4PNHA 3RT7A 3T4XA 2YXLA 3ZU3A 3IAAA 3KUXA 1KGSA 1SPBS 1PG0A 4AMBA 4KRYA 1TAUA 5T6BA 2OV4A 3FZGA 2CFRA 2YIJA 4TTJA 3VH4A 5ICSA 4BEBA 2LWIA 3CCFA 5FBLB 3TKLA 4LGMA 3KOZA 4HHEA 4NABA 3S8EA 2G07A 5KPJA 5K8VA 3GF4A 4MINA 5AUPB 1SHTX 1SKBA 4WINA 1KXJA 3ZCUA 4N6GA 4JJ7A 2H5JA 4Q4AB 3KB1A 4L8GA 1K6IA 4RQAA 3QRWA 3ZWMA 3ETDA 4B3CA 4DDVA 4ZDIA 1R5BA 1JRLA 1K68A 4KQWA 4YECA 2VC2B 3T9DA 3CKLA 1N5KA 2RHCA 2EHDA 1C9JA 2DQZA 5E1BA 4FBMA 1L4NA 5GV8A 3VYWA 4BCCA 5FUMA 3CRZA 4MKFA 4AURA 4PNPA 5EN4A 1ZD3A 4WA8A 1Q6YA 2GJKA 3F4LA 3U13A 4DZTA 4ZOQI 1MV5A 5FEUA 2A33A 1HT0A 2BJHA 2JFQA 4YRGA 5EJGA 2BDEA 1G6Q1 1IHDA 4LQLA 1B8UA 1JL3A 4CFYA 1JZSA 3F8WA 1DKQA 3O83A 3EYAA 3QTTA 1BFDA 5JPCA 1XGKA 1PUJA 3PU6A 1Q22A 2QRQA 4FWBA 4K03A 5CT5A 3VR6D 3ZD6A 4Z3KA 3FTEA 1MOZA 2Z43A 3GJTA 3GHHA 3JZMA 4LZNA 1GG8A 1L5QA 3TJZA 3WTBA 5T4HA 4QGHA 5AT1A 5FNVA 1OX4B 1WSBA 4WCDA 2ADFA 2FP4B 3FI0A 4CW7A 4ZQGA 2HMTA 2CMFA 3Q1LA 3EFBA 1BE6A 5EZ6B 4U6NA 2E37A 2HO5A 1GHTA 2VZ8A 4KSYA 1Y5IA 2VWPA 4KJXA 3CNNA 3W3AH 1L4LA 2C2OA 3WGJA 2O8DA 4DLRA 3VR5A 5AVYA 2OA0A 1M8PA 3EW7A 5FPSA 4C3UA 3QIAA 2B37A 1GGHA 2BE7A 2B8TA 1KK1A 2YWFA 3TIIA 4UHCA 4EYEA 3H1FA 4GRAA 3D81A 2P1ZA 3W3ZB 4B7XA 5KTNA 4KNYA 3R0QA 5IANA 5TLSA 4LXYA 2NYAA 3H2BA 3JRNA 1MAUA 3TM4A 2GDZA 1A1SA 3F47A 3SC2A 1E7MA 1GCGA 1O57A 4KQKA 5F33A 2D7JA 2HJHA 1EDZA 3E2IA 4PAQA 2Y66A 3W0LB 2EG5A 3RHSA 2FUKA 1E20A 3PUJA 2VQ3A 2CXTA 4E33A 4A8PA 2WWIA 1D7AA 2WSYB 3VHRA 2C5SA 1W36C 4QGFA 2BMDA 4IIJB 3U4MA 3AHEA 4UARA 3FOFC 2QUBA 2HQOA 2QMUA 4KMRA 4UVGA 3MINB 4WFQA 2BD0A 4C5CA 4ZI2A 5C8XA 2XXAA 1UF9A 2GPWA 3KEOA 3VU1A 1TM7E 3AESA 4UM5A 3O93A 3J81A 1EUCA 1GL9B 1QX4A 3R3ZA 2BZGA 2P4UA 4X54A 4WKGA 2Q41A 3WIDA 1WVMA 4UMEA 1G4UR 3LLUA 4MQUA 4D96A 3EG9A 3CLHA 2Z8ZA 3TLGB 1Y89A 1RLIA 3KE8A 2EX0A 3IUMA 1T5DX 4CM9D 4G37A 1K8YB 1SBQA 3ICVA 3QYFA 4UU8A 2CJWA 2ZLBA 3DD5A 4AIRA 3HB0A 1KY5A 1OHHA 1YOVB 1VYTA 2PT5A 2R8XA 2WWHA 3TFWA 1GGMA 5EJ4A 4TQGA 3F7NA 3SHFA 3VAZA 2OGUA 2C5HA 3RTAA 5DK4A 1CRQA 1MR3F 3A9RA 3TI9A 2R5WA 3TD9A 3FPHA 1XZBA 4GBMA 1EG2A 2CWDA 2OCDA 1W75A 1FK8A 3OPYA 4D3FA 1JFSA 2PRIA 1RKVA 3KLPX 1COZA 1YRYE 4JMPA 5C8YA 3T6KA 1B23P 3K94A 1KRWA 5AJYA 4OJQA 4A2WA 2O52A 3DVSX 1JU9A 5TRTA 4MLDA 2GAJA 2MINB 4P4SA 4XDHA 1UMBA 2H54A 2R6R1 3NQ41 2WG2A 4V0MA 2P27A 5TGTA 3RYIB 4HQLA 5LYJF 2PVCA 1JGTA 3GU3A 4DQKA 3LPMA 4B7UA 1Q3HA 3W05A 4AF7A 3ZV6A 2NZJA 1Y7LA 1WD5A 3TJMA 4FOTA 5KIAA 3Q8MA 3P19A 3OA2A 3K3PA 1EXWA 3BA1A 4GE0A 4MQFB 1MX5A 1ZD2P 5CVVA 3OU6A 2Y1GA 3CJRA 2DE0X 5EWLB 3RR2A 4INJA 2AJ8A 4BFLA 1XDBA 4QQKA 5DW3A 3BCRA 4KIJA 2E4YA 3STXA 1NMXA 4RBNA 5DI3B 4RACA 1OI4A 2E6KA 2ZE5A 4PYMA 4ZWNA 3BMQA 3OZCA 2JKVA 7REQB 1C0LA 1M1NA 4WVLA 3VPDA 8ATCA 4KBGA 4H35A 1MA0A 1UM9B 1MIOA 2V65A 3UKJA 4ZMBA 5FI1B 1OI7A 4AQYB 4YRRA 3ZYZA 2ZVQX 2QUHA 4RE6A 4XX1A 4D6XA 5DHSA 3WICA 4L57A 4BVAA 4OB7A 2C92A 1HYGA 2BKVA 2JC3A 3OIDA 4GIBA 1GY8A 4EI7A 6NULA 2QYHA 5A4IS 5ISMA 1QE0A 3DLPX 1UXHA 1Y3FE 1AKVA 2EGGA 4MWOA 5B57C 5BSGA 2YJ3A 1C7FA 4A0HA 4TWAA 1XPUA 4Q12A 1EM6A 2YRFA 4RPGA 3ZTWA 5IT5A 1YVPA 1GU1A 2CXOA 3ZWDA 5F73A 1UK6A 3PL5A 4WVFA 4DJ5X 4DJFC 2DF8A 3ZVLA 2VTDA 2SBTA 5GONB 1QH0A 3LNTA 4OIMA 2HNAA 5I7EA 1KI6A 3PDUA 4KH0A 4TLMB 1W44A 1CJKC 5KYNA 3KSRA 1N5MA 3EDRA 4O4HF 4DLYA 3RTDA 1UAAA 1E5VA 1ATIA 1RWPA 1ZVKA 2VF2A 1PFGA 2E1RA 2WTXA 2XCQA 3LLCA 3WJ1A 4CV1A 2ZAOA 2H92A 1R10A 2JGMA 4IDNA 3ZHQA 4CTNA 5ADHA 4FNOA 3LTNC 5HMLA 1QIKA 2XYGA 1Q0UA 2NSLA 3NS7A 3IP1A 1K4KA 1DWUA 4IWXA 3WMWA 4E30A 1HFEL 3G89A 2GB4A 1T2UA 4WN3A 5AM1A 2QUJA 4Q1BA 1M76A 1J2JA 3SKVA 2GS9A 2OGWA 2ADOA 3VZRA 4HTAA 3MCUA 3KHSA 4ZCSA 2O3TA 5JRZA 3KSAC 1TLFA 4UTZA 2O3UA 5CG2A 4JI2B 3VPCA 5CDYA 4CI0B 2EEPA 5LQKA 3O73A 2FW8A 1UXIA 1Z13A 3UJ9A 4BO3A 3RV3A 1QF9A 1RJ9A 2Q27A 1GAXA 3FKSD 2W0MA 4I36A 4LXUA 1YI0A 2AUMA 1GPLA 1JEQB 1EVLA 1N2IA 2JK0A 3Q8XB 4IQGA 5TMEA 4YVFA 4F7DA 2OCIA 4V39A 5LA6A 5DNCA 1KEPA 2O2JA 4QAQA 3BXEA 5DXAA 1X1AA 3D7LA 5CRIA 4ER0A 5KINB 3Q8KA 1UBRS 2X19A 1VI2A 4L27A 3JCZA 3AKDA 4A82A 4GMGA 2A92A 1OLXB 2D1SA 4LSZA 4O1HA 5L3VA 3LA8A 5M34A 2PQ2A 3GYGA 1GRVA 2F64A 2HEGA 2OBLA 1NBAA 3KG2A 2NVBA 3L5OA 4XE5A 1DIBA 5U9CA 1IL0A 2H6EA 1NN3A 2V0NA 5CT6A 4C5BA 5B3LA 2X23A 3IUYA 2AVNA 2P8SA 1G2PA 3BXXA 3MELA 3O94A 4LJ8A 2ZUTA 4TSFA 5KX5A 2O2DA 2PJRA 1CF9A 2DLCX 3OEWA 5F2NA 1U80A 1OE0A 4KAFA 3KAQA 1GCIA 4LMPA 4F46A 2I2BA 1TYCA 4QODA 3TW8B 5K09A 4CI9A 4CZ2A 2NZVG 1G3IA 3VO2A 2FZKA 1ND5A 1R66A 1Y34E 1J20A 1WXFA 2JFNA 3FVTA 2PWBA 4MVJI 4GECA 3ZUGA 1X7YB 4NCKA 4D3DA 1WMDA 2CMGA 3BREA 3VBEA 4TLEA 2O3SA 1A7KA 1E3QA 2WB4A 3H5WA 4BZQA 4C4TA 3L9WA 1CIPA 3B5IA 1FNBA 3FTQA 1OMOA 4XEUA 4MV4A 4LBVA 3CRW1 4C2TA 5KU7A 3PQ3A 3C1TA 4KODA 2QTGA 4NH4A 1Y1LA 3EUAA 1QFSA 3W6OA 2VHJA 3IEXA 5C34B 1Q0PA 3C3JA 2W6JD 3HL4A 2I66A 2H16A 3QKRA 5IVIA 2PTGA 3VDXA 4OYLA 5HBRA 4B1FA 5BUQA 2IW1A 3ESAA 1PN3A 2FG6C 3WZMA 5JDCC 5JXJA 1XKQA 2FPOA 2Q1UA 2AZMA 2J32A 2NSYA 1GTG1 2OT3B 1JFLA 5J4HA 1RIIA 2QMHA 3BH7A 1WUHS 2A78A 3GT7A 4LTMA 1VE1A 3OP1A 3TL6A 1E9FA 4QM6A 2V7UA 1KZHA 4BWFB 1NI3A 5HZGA 1J49A 4G4JA 1PQUA 1RQGA 4M1SA 1EFPB 2YR0A 2PUDA 3KR0A 1RI2A 1IQ0A 5E6SB 2O7SA 3I1FA 2ZYIA 3LUCA 1FP6A 3G17A 4O4IA 3SQXA 2QRHA 3HYSA 3IUEA 2ZM5A 1E9RA 1XRRA 2CLIB 1FFXB 4N8EA 1V4VA 3H2JA 4OU4A 1KMIY 3DDUA 3OU7A 4PHFA 4YDHB 1FRQA 4BO8A 1SVLA 1AUOA 1VECA 3ENKA 4G97A 2WKPA 2XQFA 4LWZA 5EZYF 1Y1PA 4YIKA 4JBLA 1XA4A 1FQOA 1D09A 3F78A 3BE5A 3KBOA 1U0SY 2BY4A 3I2YX 3QFHA 5NULA 3RFTA 2UZ1A 2YFKA 2YJZA 2E87A 1BW9B 4MVWA 1NVDA 1IC6A 1OF1A 4TTPA 5AXBA 4BE4A 1OW3B 2FWBA 4IO0A 5DN9A 4TKVA 3R7BA 5CFLA 3T52A 1DELA 1NR1A 1UBKS 3DLIA 3EBOA 5AVOA 3DVLA 1V43A 1J9GA 1XQ1A 2ZKIA 1NVXQ 3QFFA 4R81A 4U7PB 1V35A 5T4FA 2F7SA 1ZN2A 1O6BA 3DE3X 3E8SA 4BO0A 2Z8XA 1Y1KE 4XM1A 2ZRGA 2HA0A 4R1MA 3W77A 3ZHUA 4BQOA 2FW0A 2XB8A 3CCBA 5C1DA 5L40A 4TYPA 1KZYC 1SIOA 5ILQA 1HQYE 4IHKA 4QWWA 1Y6QA 4R71A 3W1EA 4D97A 3KPYA 1QHSA 1Z62A 4E3ZA 1PK7A 3AUJB 2R48A 4EDHA 5CJ2A 1FB5A 1QFXA 2QP4A 1YQTA 4TQUS 2R6AA 4UBLA 3CTMA 2XQKA 4LI0A 3WMGA 1H2BA 1XTUA 4Y6GB 3I53A 3VYRB 3UK0A 3LPDA 3VSBA 2Q6IA 4LMRA 4GG1A 4RK5A 1DFHA 3O8OA 2ZREA 1E1RD 1L9KA 1CFZA 1MG5A 3QBDA 3BIXA 1E3EA 4RABA 5DGCA 3ZY5A 4D8UA 2O2HA 1E3WA 1I3MA 1NOJA 1OXVA 3ANYB 3ECCA 3Q7TA 5CK4A 4COKA 4ZQBA 1H4TA 1UXKA 4RHUA 1U8YA 1V3VA 1XLVA 3OQIA 4G5FA 3B85A 3FWPA 3GUUA 4G8CA 2MIIA 2P4SA 1AS2A 3UT0A 5TMPA 1XTBA 1N33B 4UE3S 4DV2B 1VMAA 2EV9A 4NFLA 1RC0A 4M6WA 4MW7A 4C7OB 3IB6A 1U2ZA 1FP1D 4E21A 3VX3A 1K6XA 1XL1A 3GCZA 4HL6A 4A2QA 2O2ZA 4B3IA 3Q5EA 1XVIA 4HVCA 1I3LA 1ZCBA 1UT5A 1G66A 3QPUA 4I1SA 3C3PA 4XIIA 5CB4F 5JD5A 1QH8A 2R0QC 1ESDA 1JJBA 1V2HE 4GYJA 4OFBA 1OLUB 4MQMA 3OCZA 2NUBA 2I54A 3B48A 1LSSA 2PEZA 3R44A 3UUGA 2AKAB 3SJUA 3NC1C 3AQ4A 1AHPA 2OUKA 1Y4AE 1UK7A 1GAJA 2Z9BA 5C53B 3ACCA 2HOQA 3WGGA 1W581 1ZK4A 2ZJYA 3U9SA 2QTRA 5AW5A 2RC5A 3G2QA 1QORA 4JLSA 4AP9A 4E70A 3KHTA 3RYFB 1JA9A 3G9TA 1H0RA 2ZRDA 4DF3A 2ECPA 2J5KA 1D2GA 1OAOC 3UAYA 3AKYA 3QXHA 2G70A 3EVGA 3RPEA 4DIDA 3QEOA 5SZKB 5FDFA 2RG7A 1W85B 4U2DA 4URHA 2NP7A 3FPCA 5ALPA 3CUEF 1P2TA 2AN4A 3F3YA 5J4VA 1XMXA 3IT0A 3LC2O 4MS3B 4BY9E 4HO1X 1NUQA 1GXSB 1JU4A 1OAOA 3WA7A 2IUFA 4QQNA 1RRVA 4EECA 4KE6A 4P9NA 2ZBEA 4BNWA 2XE7A 4RLFA 4AMYA 3HO6A 2ZSJA 4P3PA 3F9IA 1QPGA 1EWKA 1OA0A 1S02A 1DTWA 1FVFA 1OQAA 2WRZA 3FWNA 4I5GA 1WCIB 4R98A 4TXNA 5GMOA 3J81k 5E2IA 1XLUA 2PS0A 4E2ZA 4JYBA 5IJZA 2H31A 3NYQA 3WHIA 1ABEA 4PSVA 4XFJA 4ZVTA 1AN9A 1COWD 1ES9A 2C7GA 2HZ7A 1MO4A 1TB4A 4F93B 1DV2A 1Q91A 1T0JB 4GPEA 4UU0A 5FTLA 2XUZA 4DZZA 5DYTA 1NTOA 4YONB 1E64A 5KEIA 2PANA 5ERYA 3RYCB 4DR6B 2BFEA 2YHUA 4Q93A 3E5RA 3K9LA 1CDOA 1RHKA 3QX7A 5IYZF 4XWOA 3NHFA 3QVXA 4RK1A 4AZ0A 1I2MA 4JI6B 5IAAA 5J1SB 4WDRA 1YFJA 4C2AA 3HJAA 5IARA 3BVPA 2WU3A 3QIVA 4RAQA 1K8XB 3IS3A 3HKCB 1V5GA 2C9OA 3HCEA 2VDQB 4IF4A 3WWDA 3X2FA 1EFLA 3LG2A 4O0MA 3ZDYB 4DNXA 2AUTA 5BN3B 2H5IA 1JN0A 3PICA 4I2VA 1SK9A 2OHFA 1XRSB 2I78A 2XH8A 2Y6VA 3M6VA 4GI5A 4OQYA 4WNIA 1WDKA 3KPWA 2PLAA 3L4EA 4KLCA 3AETA 2DYKA 3VTFA 1V1JA 2CXRA 2JCYA 5CNMA 4BLTA 3BB4A 3QFSA 4OU5A 1U3WA 4W6QA 1DKRA 3KL2A 3FBTA 4KW7A 3A9VA 4QFMA 4YPVA 5K8LA 1F8YA 1PAUA 4HMOA 4GMDA 4K9RA 3S8MA 4X7BA 2ST1A 4REQA 4D45A 3BE8A 1N3BA 1WV0A 4IZIA 4GOLD 2AOXA 2OBYA 3BM5A 2PSSA 1H3NA 4B87A 1O95D 1D5WA 2F8LA 3Q2OA 3WTCA 1T5IA 5JC1A 4FXPA 4EI8A 3FDFA 2B35A 4QBIA 4R68A 3OQPA 1CIJA 1NBMA 4JOCA 4MUJA 3GJRA 1EQ2A 4W99A 1GSAA 4BNJA 1NFRA 3HWX1 5CAEA 1M8FA 4RVCA 2X1VA 3NWJA 4ZO9A 3FR7A 1U63A 2B78A 5AJVB 4NMXB 2H7CA 1Q3TA 3K2IA 3WP1B 2FR0A 3EMKA 2FNAA 4Z9BA 2HR1A 2AMLA 1VSUA 1MH9A 5CJPA 1GTVA 2NYVA 1WKCA 2OKGA 4DLXA 3WB2A 3ZWAA 2XRYA 6ADHA 4PCLA 1KFEB 1JKJB 1FRVA 1OTYA 1IB0A 1QBKC 2F9LA 3ROTA 3STYA 3X1KA 2J9GA 4BB0A 3OO1A 3SZOA 3GEHA 4KTVE 4U9IS 2FMKA 2MCFA 5BMVB 4DDMA 5IKEA 1LLDA 4NMMA 2G17A 1L5SA 1GILA 4MRNA 1ZX1A 1PKXA 3TJRA 3DZCA 3ZCQA 1OYWA 2YY5A 4P36A 1ICEA 2B25A 3EFHA 1KJ8A 4LV6A 4UM8B 1H8EA 2QTVB 2FEMA 4MRSA 3A4NA 4G0YA 2X4DA 1LKZA 4BX8A 2JBWA 2ZJAA 3JQGB 4KWIA 3ONEA 3LXXA 1M7BA 5YASA 5C46F 1USWA 4IG4A 1KOFA 5LXTA 3M4NA 1LK5A 2XKJE 3AR9A 3FFXA 4CVNA 2HCJB 3SWWA 1VP3A 1KOLA 1GSOA 5LU9A 4J76A 2C97A 1UP4A 3NTOA 3OLVA 2FF7A 2PU7A 2RDMA 3QE4A 3PIIA 1PP4A 1OI3A 1E1QA 1X1QA 3GQVA 2JD2A 4DQDA 3RC8A 2BKAA 2FPPB 4R1UA 1UOQA 5A9SA 1ZQ1A 3GVPA 3H42B 4EF4A 2PUGA 3R5KA 5EYPA 2HA7A 3T4PA 1V4NA 4DBVO 4Y6PA 2YZKA 3KYCA 1ETHA 4WMLA 1EEXB 5D5HA 2ZUSA 5FPPA 1OXKB 1TEHA 4AJ4A 5CFNA 3CWZA 2J07A 1NG9A 3DO8A 4BKPA 5HNKA 3B6KA 3C43A 1G1MA 3MRVA 1PFWA 4E0BA 4QJBA 2NZWA 1Y8QB 2AMYA 3NPAA 5FQOA 4B6GA 5F1OA 1M73E 1R2QA 2IZ0A 2Z83A 4MMZB 4N3BA 2OQVA 3T3PB 3HK2A 1CP2A 2GX6A 2CXUA 4PBRA 5JE8A 1UXGA 2H5LA 3B2NA 5FWNA 1Y6ZA 2GGSA 2L82A 5LQMA 3GFPA 1UWCA 4D9MA 1D6SA 3CR3C 3N74A 3OOYA 1OD6A 4FT2A 3U0VA 2A8YA 1MJGM 4YS6A 2Z1NA 4E03A 1V41E 4NBNA 1ID8A 3L7BA 3MPUA 1WKBA 1EGVB 3EFEA 4LCJA 3ZUPA 3KJNA 4II2A 3SQLA 3RF6A 2X15A 2SKCA 1N1GA 3KJQA 2R8ZA 3O4GA 5HCNA 4RF3A 3CVVA 2OQRA 4N47A 1FUKA 4FFBA 3UMVA 3L1VA 1DINA 3OJFA 2DP4E 1Y37A 3JD4A 3KKNA 1AHNA 3B7GA 1P18A 4LY9A 4MRAA 1BSVA 2DQYA 2VDRB 2CZQA 3WLLA 2LD4A 2WDZA 4TL9A 1NQWA 3RSOA 4PM4A 1FLVA 2BCEA 1Y1TA 6PFKA 1ONBA 2REXB 5E6RA 3NH6A 3GJXC 1G20E 1KDTA 3T4EA