4KXQA

Structure of nad-dependent protein deacetylase sirtuin-1 (closed state, 1.85 a)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
HMRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacetylase sirtuin-1
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4kxqA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kxqA01
4BVGA 2IHVA 3PKJA 4ZP1A 3GLRA 1O97D 1YC5A 2Q5JA 4JUAA 3FZNA 1SZDA 5EJ7A 4I5IA 3E9YA 1NM5C 4HD8A 3LQ1A 3GLUA 3EA4A 2H4FA 4JT8A 2FR8C 2FSVC 1M2HA 2B4YA 2PANA 1YHYA 4RMJA 5MFZA 4TWIA 1Q14A 1T9AA 2DJIA 2JIBA 2UZ1B 2X7JA 2OO5C 3HWWA 4K9MA 3U31A 2Q5OA 4RJKA 3U3DA 3EY9A 4UTZA 4HDAA 3FSJX 4K9KA 1Q1AA 1SZCA 4JU8A 4JT9A 2HJHA 1V5GA 2AG0A 2EZ9A 4X3OA 4K9NA 2NXWA 1BFDA 4F56A 2JLCA 4UUAA 4GPEA 4TWJA 2IHUA 4BVEA 1V5EA 2VBGA 3CLRD 1U2GC 4L3OA 4KPUA 2H2IA 5BWNA 2WVGA 4J1TC 5EJ6A 2FWNA 3CF4G 2FRDC 3CLTD 3IAFA 1PI3A 3IAEA 1POWA 1N0HA 1U2DC 1XLTC 4J16C 4K9OA 5IMSA 4K9LA 2JI6A 5EJ8A 1EFPA 4IG9A 1E3TA 5BWLA 1S7GA 4K9QA 2FN3A 5EJAA 5MGNA 2JI9A 2QQFA 2H59A 4BVFA 1T9CA 4JD5A 1YC2A 5EJ4A 2A1TR 3D81A 4UTXA 3RIGA 1V5FA 3FLMA 5BWOA 1T9DA 4FEEA 4MPPA 2BRUC 3JWPA 4FZ3A 1U28C 1M2GA 2H2DA 1PO7A 1POXA 2VBFA 1PT9A 4RMHA 3F6EX 4D5GA 4GG1A 4MPJA 4RJIA 4MPRA 3OE1A 1M2JA 1DJLA 1YHZA 2Q29A 3CLUD 2V3WA 1ZPDA 2PGNA 4JUBA 2A1UA 3D4BA 2VK4A 5K6TA 4Y6OA 5EJ5A 4JSRA 4UTVA 2IHTA 1D4OA 2JI8A 3D7KA 2EZ4A 3PDHA 4ZZIA 4BV2A 1Q6ZA 4MZXA 1YI0A 1YNOA 2VJYA 2Q5LA 3EYAA 1Z8NA 4KXQA 4O8ZA 4IAOA 1O96B 1M2KA 2EZUA 1OZHA 2VK8A 3K35A 2OD9A 2JI7A 1QPBA 4MQ5A 5K3SA 4JUFA 1PTJC 5MFPA 2EZTA 5K6RA 4BV3A 4V1CI 4GP9A 4D5EA 2EZ8A 1UPAA 2C31A 3ZGVA 2WVHA 1YTLA 4GM4A 1MA3A 2H2FA 4IF6A 2OD2A 5EJ9A 4V1CA 4RMIA 3HWX1 3PKIA 1OZFA 3ZGOA 1MCZA 4GM1A 4Q9DA 4BVBA 5DEIA 4C78A 4FVTA 3JR3A 3RIYA 1YBHA 1M2NA 2Q5QA 4FEGA 4X3PA 5FYQA 4BVHA 4QELA 2H4HA 2Q27A 5K2OA 4QPZA 3GLTA 1EFVA 5FEMA 1JSCA 2H2GA 4KGDA 1UPCA 1S5PA 4Y6LA 4Y6QA 4JU9A 5D7NA 5DGDA 4UU7A 4UTNA 5DGTA 4R8MA 1OVMA 1T9BA 4UTRA 1UPBA 1ICIA 2QQGA 2H4JA 1PNQA 4RMGA 2OORC 4RJJA 3ZG6A 5MF6A 4BN5A 1YI1A 2NYRA 3GLSA 2AG1A 1HZZC 4F4UA 1OZGA 2UZ1A 3CLSD 4C7BA 4QQ8A 4COKA 4L2IA 5AHKA 2OD7A 2Q28A 1PNOA 2PGOA 4GM0A 4V1CB 2VK1A 2H2HA 4JUCA 4UUBA 1PYDA 1U31A 2JLAA 2VBIA 2W93A 4G1CA 1Y9DA 3F6BX 4JUDX 5EJMA 4UU8A 4BUZA 4BN4A 1PVDA 4K9PA 1J8FA 1Q17A 2WVAA
chains in the Genus database with same CATH superfamily
3W8FA 3C5VA 3AGPA 4PCVA 5LNK1 1FLNA 3BWCA 4QBIA 2ZVPX 3STXA 4QULA 1EDZA 1IHOA 4X7PA 4YLGA 4DVJA 4U2EA 1XE3A 4JR1A 2MSEB 1KU0A 1TEHA 5EIOA 1ACJA 3F96A 2A0XA 3WQSB 2ZREA 3UXHA 1KGDA 5KUTA 5IT9A 1GY8A 4HKTA 1YQXA 4IDCA 4YO7A 3C7TA 4DF3A 1F7VA 4ASUD 1V26A 2I4NA 4FYHA 3RD5A 5L3ZA 2W58A 3BQNB 4LRWA 2OYRA 4QDOA 1EX7A 3KL4A 4HNAA 5KYYB 5IWAB 5IYZF 1J9EA 3PI7A 3L18A 4FOLA 2G7MC 1POWA 4NTZA 4YQEA 5EQFA 1A8PA 3FCUB 3UANA 3C3MA 4ZV9A 5TNXA 4WDRA 2VDWA 2J6HA 4W8GA 3WLHA 3IR6A 4ADSG 3ND9A 1AKEA 2CEKA 3QA3E 1YR8A 3TVDA 2CXSA 4BEJA 1VLJA 4FNGA 2CCJA 3JYLA 1D8TA 3GL9A 3U49A 2Q0SA 4PXSA 4COKA 5JQGB 1AVTA 1NU6A 3FZYA 1UBNA 4DBVO 1COWA 5IVKA 1GTVA 1QS0A 4EATA 1LH0A 1IJKA 4YUAA 3OT1B 1V5WA 3IIJA 1VL0A 4J6FA 4C6TA 3KZ1E 4M8NE 4MQUA 5T4HA 3HSYA 3TTUA 5FADA 1MAAA 4TROA 1KU6A 2OOSA 3CUSA 3PFGA 1YL7A 3VHRA 4A92A 2ZE8A 3S1LA 3UA3A 4OJYA 2NT4A 2W0SA 3C3YA 3KKKA 3JAKB 3L3BA 2EJUA 4H60A 4OQQA 1G4HA 3IT2A 3WXMA 1JEJA 3B1KA 4UHBA 3SIXA 4RVSA 1GSOA 3SFTA 1O96B 4LA4A 1O6CA 5J9FA 1XCJA 2C07A 1R5OA 2VF2A 3A1NA 5EKDA 4R71A 4ASUA 1S3FA 1TT5B 4V1CI 3D6HA 1J9GA 2P0AA 3M8KA 4BASA 4DGQA 5AQEA 1ZDMA 1UOOA 2Y68A 1GPH1 1RWBA 3B8HA 1E79D 2BMWA 3DB2A 3DOFA 3H9UA 2OV4A 3L7CA 3AF6A 1PBNA 2AA3A 2H7XA 3RS3A 2W2LA 3VR3A 4BU1A 5BRJA 3RIYA 4HRXA 5IH3A 5IASA 1ZLYA 1D2NA 1CUXA 2P41A 3N7AA 1QV7A 1BMDA 1AXRA 3DQQA 3JQAD 3MMSA 1XJ5A 4G5HA 3KSAC 1M74A 3DMTA 4LNAA 3TXYA 1FFBA 3NDRA 1WOMA 2JCGA 3ANYB 4MRMA 1KDVA 5DHTA 2HMTA 3HVJA 2VF7A 4HQFA 2DFNA 4OHXA 2C2WA 5HIIA 5EHIA 5KOHA 3QYAA 1EWYA 4AN1A 4OMDA 1JDSA 4H7EA 4KRYA 1IM2A 2DB3A 1ZL2A 2DQZA 1L7EA 3E9DA 3PSHA 1YZTA 4V1CB 3L6DA 2XLCA 3HN2A 5FUWA 4YRTA 1JG2A 2Q6VA 3TKAA 1Z38A 4RY0A 4XVCA 1MIOA 4JYPA 3QXJA 4BN4A 1OBFO 2R6CA 2ILVA 2XBLA 4B47A 4EQ6A 3I61A 1Z5OA 1KPGA 1LU9A 2CDAA 2HA3A 3MLAA 4CFYA 1Z5UA 2OFXA 4Y98A 4JLMA 2VP9A 1QOQB 3UT5A 1YQ9A 4ZAGA 4C22A 5HHTA 1RI3A 4XSVA 2NO6A 4KN9S 4KQ1A 2J0QA 4Q9AA 4AMUA 2E4AA 1S8FA 1LV7A 5IULC 3G17A 1Z15A 4QVIA 1DBPA 1IZ0A 4CT0A 4P5PA 4WI1A 3WZMA 2QX7A 1D2AA 2VHUA 4V24A 3SAJA 3BQ9A 4Z9XA 4YRAA 3H1EA 5D3KA 1LBEA 3QVKA 2GERA 4GBJA 4BGUA 5KJ6A 4M9ZA 3AVXA 3IESA 5KC8A 1KK2A 3FNIA 4EJFA 5IZCC 4HB3A 5I6DA 1U0OC 3I9FA 2YHAA 4I2VA 3BGVA 1JMVA 4J29A 4JVLA 1PTKA 1JLLA 5KCZA 2OR3A 2G08A 3KE8A 3ANNA 3EYWA 4LCBA 2IKQA 3GJ0A 3QJYA 5BN3A 2OP0A 4YUZA 2GK7A 3DPIA 3T7CA 3WHKA 4FGWA 2BY4A 2IYFA 4NICA 4R9RA 1UT5A 2ATVA 2Z8ZA 3DWEX 4HDKA 3HA7A 4MPPA 4BRWA 4RTQA 1OXUA 1T34A 4C04A 2XOKA 4AJHA 3U4MA 1LBSA 1TM3E 4OQFA 1W85A 2Q49A 3I0MA 5TMPA 4XAQA 3WWPA 2QN3A 3H9EO 1Q7RA 3N86A 4DG9A 4ENPA 1J2EA 3OIVA 4FLMA 2YRXA 4KWHA 3H9CA 4GP7A 4TMWA 4HDMA 4IDBA 4W5WA 4ALNA 1B4DA 1DUIA 2ZBGA 1BHQ1 2ZUVA 4RC9A 3B48A 4GAEA 4LGVA 2DGDA 4LOIA 4WA8A 5KYUB 3BXXA 2ZBFA 4INJA 4BKMA 2FFQA 1QZTA 3JATA 4F12A 4MVJF 1QGUA 4UAVA 2PD6A 4B0PA 4W5QA 1UM9A 2WG1A 2YJ6A 3GG2A 1FLDA 4B6EA 1Z82A 5T3UA 4DMRA 2G8NA 1WUHS 3HR7A 3FTCA 1QPZA 1UPFA 1R00A 1J5PA 1FUEA 3HA3A 4LQ4A 5AJVB 4LECA 2WUEA 3UM9A 4EHNA 2AZXA 1MV5A 2XGGA 3F6PA 4N7MA 1YS7A 4J4TA 4OB8A 4D4IA 4KIFA 1BJKA 3VYUB 5EQDA 1GUBA 5DEIA 2R5NA 2XOKD 3I83A 2QSZA 5AI6A 4XE5A 2OE2A 4PVDA 4Q19A 5DV9A 4F85A 4OHYA 3LUJA 4QXQA 4C7MA 4LDZA 1C9MA 4JP2A 2GN0A 1VIAA 1RKBA 2PYZA 4UNNA 3WC4A 2I62A 2R97A 3KJQA 3OY7A 4X7MA 5TPZD 2EFDB 3BGOS 4Q3BA 5KYXA 2IRWA 5IBQA 3AHDA 1G8HA 3VR5A 4L78A 4RIEA 2WDZA 3TBKA 2OTCA 4L5YA 2DP4E 3KUCA 1RRCA 2G6TA 3M9LA 4O4HA 4OJTA 1M7HA 2OAGA 4N8SA 4OP3A 3IIEA 1QHNA 2J7KA 2BM1A 4FSHA 1N4AA 4Z4FA 1RHJA 3MCUA 3MAJA 3CLVA 2P0YA 3LP5A 1OFTA 1CT9A 1G3IA 2I2DA 3HCNA 4MV3A 4WW0A 1RM0A 3RTCA 5CDHA 5IF3A 4M1ZA 2JIOA 4MJXA 3E3LA 3ZHTA 2H65A 4DLLA 4OF4A 1CY4A 2VYQA 5IVPA 3UBTA 2GN6A 3O3MB 2JHAA 1KI4A 1M2WA 1CP3A 1JB9A 1CNFA 3RIXA 4BO2A 3WDKA 2QTMA 2NV2B 4Z9BA 2Y1LA 3BCRA 3O75A 2VCEA 4CMJA 1ZZGA 2F43A 4MEAA 4QEZA 5G0WA 4P4NA 2C2KA 3KQPA 1M9NA 4UHEA 3CEMA 5LZ4A 4Z51A 4EKIA 2AR0A 4YYEA 1CR6A 1Q14A 4LYGA 4JODA 4GWKA 3U3DA 4MRVA 1ZHFA 3VDNB 2AMFA 3MNFA 4KAJA 4WBNF 3UAGA 2FR1A 5JXHA 1QHHB 3ICEA 2FX2A 4GR5A 1E99A 1R74A 4N0EA 3L6CA 1U2GC 4KGZA 4TTAA 5AKYA 4EI7A 3IX7A 3BAFA 3QQPA 5AMXA 3ZWKA 3REGA 2ONKA 5UKDA 4MGIR 3N2YA 1UXHA 2JANA 4HPJB 2EFHB 1PS8A 2J85A 3JQ9A 2VH1A 1DXYA 1O95A 3C8HA 5C52B 1DLIA 2RG1A 3W5BA 1J0AA 3EQ6A 3GW8A 1RR6A 2CN1A 2V54A 4P0TA 1E64A 5ELLA 1K4MA 1FVHA 1E0JA 2W2LD 3FVQA 3QBVA 1L5KA 3GIWA 4KOAA 3O0TA 1NNLA 4L02A 4CYMA 3H5IA 3AG5A 2VF8A 1CHNA 2IV3A 1XDZA 3JTMA 1E9SA 4B7AA 5AIBA 1OYOA 3TD2A 4FYJA 1X3LA 3ADPA 3DMFA 3N2LA 3D6JA 5DYWA 3VDXA 3ZDDA 1D0SA 5EGSA 1K5PA 4ANFA 4MQLA 2G4CA 1XDGA 4XB6B 1LLDA 2CB9A 2CNLA 4RNDB 1D2CA 4Y9DA 3WLQA 4HNVA 4M9SA 4ZCRA 2G9QA 1U8XX 3U62A 1PBTA 5BPHA 3OVMA 3FPKA 4FJ0A 4PRZA 3TDNA 3PNMA 3TF5A 5A2QA 1MIOB 2VWHA 4FGUA 4OMFG 5JZBA 2H5JA 4FC6A 4BDTA 3IVMA 5JADA 4BFZA 1JYFA 1YZNA 1ZL0A 1XZNA 5B57C 3WR5A 2QQ5A 4FZ5A 5LQRA 4A0HA 2PZJA 1YMVA 1CXZA 2QI9C 3KM0A 5AKLA 5KYXB 4N7JA 3ANLA 5F2OA 4CRWB 5B4VA 5DX1A 3IJPA 3EG9B 1CS0A 3I3OA 4M0UA 3E58A 4PGAA 2R8XA 1OV6A 1E3JA 3PUHA 4LYHA 1T9ZA 3NX4A 4D4HA 3R7NA 3H2KA 2IZ6A 5DX0A 4R0NA 1ID1A 2P11A 5JJKA 2JDID 5DGDA 1R0ZA 2WMNB 3IUYA 1B6SA 1EJ2A 1NVBA 2XTMA 1OI2A 1HM5A 2IWRA 3B82A 5B3JC 5FAKA 1T8SA 2WABA 2X0RA 1SKQA 3OPXA 2W6CX 2BN4A 3WNBA 4BUJA 1Z2PX 3RODA 4EA7A 1AUXA 4I6EA 4BN5A 4QARA 3B3AA 1RQLA 4F4UA 4Q01A 4XWWA 2PA0A 2FA9A 3GFFA 2GCOA 2Y0EA 1NG1A 1TE2A 3R4VA 2W5UA 1DKNA 1FFCA 4MB6A 2PMEA 4EJSC 3L8DA 1JSZA 5IT0A 4S05A 4CIYA 1RT9A 4MVYA 2ZJ4A 4OFZA 4UDYX 1RACA 4D79A 1W94A 3EUAA 3KLMX 2O8FA 2DJ5A 3HYCA 4D0NA 3U56A 4MQBA 4DCGA 1B76A 2ERCA 3GP5A 4GKBA 4MLPA 4RK1A 5HIKA 4CIVA 3JQBA 3VBEA 4PFKA 1W85B 4PAWA 4M2LA 5M3BA 4ZMRA 1H9CA 4B3FX 5CB8A 2OENG 1O9GA 1T0IA 3HUEA 3S40A 1NBME 1K63A 2FOXA 2MINA 3KWJA 3P2OA 5ALSA 1Y81A 1ZICA 4EVRA 5CG1A 4PGHA 1EWRA 5BSRA 3GPBA 1BE8A 4MTCA 4OP2A 4KMOA 4AVYA 1NIPA 1MJGM 3ME5A 3PQ6A 5FXMA 1Z62A 1L0BA 1EFPB 4A6DA 3GUCA 4BDSA 5BORA 4RFSB 4LGYA 4GOMD 3KHUA 4ZWNA 2C97A 3PT5A 1C9EA 1ZJJA 2I54A 1BIFA 1QH1A 2PZAA 3EMKA 1ZMTA 5CT9A 5E9JA 2MR5A 3LLVA 2CFOA 3FZQA 2DM6A 5EZYB 5DRTA 4U02A 2YN0A 3U40A 3PNLA 4LXXA 3WGMA 3WKAA 3GCXA 5LLSA 2JLZA 4S1VA 3LV8A 4J0KA 4KQ2A 3ZJ5A 2YZ7A 1AB5A 1VPVA 1FFGA 2BT4A 4TL7A 4FP9A 2ZETA 3TKLA 4HYQA 2ZSKA 3K70D 2H54A 5ALEA 4Z8XA 1FXUA 3WLMA 2D8AA 2FRVA 1Y8RB 1PVOA 3OURA 4LQDA 4IUCS 2B8EA 1JEAA 4X93A 4DCOA 2M1ZA 4LXHA 3QI7A 3KHSA 8ATCA 2TMYA 5JROA 1ZUHA 2PL1A 3I6YA 4RM2A 1EFTA 3KXDA 4OQZA 4JXXA 5AXDA 4XQEA 4ND4A 3LFHA 3TQHA 5BVHB 1KAQA 4N65A 3WDMA 1QF6A 3CLRC 1H4QA 2I99A 2KSQA 4V0QA 1SC9A 1IE3A 4C5CA 3Q7RA 4WJKB 2FPSA 5EXEA 1NBMD 1VLMA 3Q8LA 2X3UA 2PWYA 1YL6A 2IWHA 5JH7F 4DAOA 1Y4DE 4IMPA 4Q4DA 2C92A 2IL1A 3AR4A 4U0JA 1BROA 4GWLA 4B83A 4YJGB 2B2XA 2EWVA 1O7JA 2WKWA 3BSSA 1AIPA 3DP9A 3W7BA 3WVNA 3VZQA 1UKAA 4LJRA 3B13B 4QG7A 1WR8A 1GVHA 2Q3JA 3UWOA 4RZUA 3N8NA 4XIFA 5JYBA 4B2PA 3CBGA 3RM3A 5KZMB 3SE7A 1KO5A 3LQFA 5B53A 4CIAA 4LFBB 4V38A 3X1XA 4ZI7F 2F2TA 3KJEA 3NDJA 4PV7A 4G2NA 2I4RA 2P78A 1OVMA 4K0RA 4EDFA 1KMHA 4EHFA 4LXTA 1R6VA 4Q00A 3BB1A 5B7NA 2A86A 1YI1A 2BGLA 3O7MA 3L9WA 4D4GA 1SH7A 4OQEA 2PV7A 2YNMA 3PBKA 5AHKA 2XF2A 3L7LA 4P3KA 4PLTA 3GEBA 4OHKA 3U44A 3V7FA 4P5DA 5ARBA 3RHSA 3VAZA 4E22A 3TRDA 1LSSA 4IIUA 2FWPA 2QRUA 2BFMA 2HHAA 4LTNA 3KJZA 4RA6B 2QX9A 3U4QA 5AVXA 3GXOA 1LWNA 4FIZA 1N75A 1K7CA 4IQ8A 2CXNA 4WEQA 5GOZA 4MV8A 1E69A 2FFRA 4HLUC 5F78A 4EGAA 2C4MA 4I9FA 4EP1A 3PWKA 5HJ5A 3NFYA 2DH5A 4HTFB 2B37A 4I1RA 3E22B 1EHYA 4R7TA 1S2NA 3MWFA 3M6XA 1GFIA 3IB6A 3A3KA 1OFUA 5H80A 2GKGA 4D8VA 2FY8A 2P2CA 3AWDA 1L5LA 5EIAA 4RIGA 1E1CB 2F64A 1QFZA 1THGA 3HY4A 4N0DA 5FUQA 5I48A 2QP4A 1UCFA 2Q07A 2I7TA 5KOHB 4KPUA 4L57A 1PR6A 1ECJA 5BT9A 3IPLA 1G6HA 4PC6A 1O94D 2ETXA 1P75A 3GJTA 1ESEA 3MA0A 3RWOA 3P0RA 4UOEA 1RZVA 1XK6A 2JA2A 3IAUA 3MGGA 3HR8A 3ESRA 4EX7A 5EHQA 3QF4B 3A1EA 2HEGA 3V1LA 2V6IA 1M7GA 4PZ9A 2QRLA 4JOSA 2NUPB 4B3XA 1VI2A 4L95C 4D74A 2J3IA 4YAEA 2IYYA 2DEUA 2HSZA 5B37A 4EHKA 1KJQA 2GM4A 1R8XA 2D1TA 1RZ3A 2JEOA 4JH0A 1O6ZA 5C8YF 2IYVA 1DAMA 4RJIA 2A9QA 2C8VA 2D06A 5J2TF 4EYOA 4ITRC 1J8VA 3R4CA 4JUBA 2J67A 1DUVG 2SECE 1P4RA 3OZFA 4GMXA 4RA9A 1N5IA 4DBZA 4GQBA 3JQFC 1JSLA 4G23A 1FMJA 1G4AE 1R0WA 4B79A 1OH8A 2FFBA 5TEWA 2XITA 4TSFD 4LJ4A 4NNJA 3HXOA 1SUPA 1QH0A 2Q5LA 1UMBA 3BEOA 5A06A 1DIBA 3K35A 2PT6A 2GVZC 2K6GA 4UBIA 3L8CA 1USVA 1GRRA 2O20A 3HB4X 5CCDA 3OQOA 4JB0A 3CZRA 2E4ZA 3TQFA 3FBGA 1VJRA 4M22A 1YFKA 5KPJA 1CB7A 2J4FA 4X7BA 3W5AA 3E7XA 2VN8A 2JZCA 1EGHA 3MJ4A 4S04A 2QF7A 2OXTA 3ZTWA 4G2TA 1Y7IA 4CV2A 4L4SA 3T1HB 3HWX1 3JWHA 1ZBQA 4OJQA 3SPXA 3L7BA 2PBZA 1MG5A 2APJA 1DRUA 2IIPA 2ZJ6A 3GJ6A 3Q72A 4LI3X 4ATNA 4CETA 3A10A 1B93A 4H7DA 3KVRA 1R5BA 2B82A 3HRKA 4H1WA 5TGTA 3BJMA 4A36A 2Z0MA 3PXEA 2KS6A 1GZSA 3EDMA 1QOZA 1JVNA 4YRMA 5IX8A 2OZVA 2R8EA 2VAMA 3WE7A 1L5NA 4QGGA 1TZKA 1N4DA 3R7WA 4F46A 4H4DA 1GGFA 5FA8A 5HPYB 4JYCA 1NRIA 4QD3A 2IS4A 5CT8A 5CA1A 3R5FA 1LC3A 2B7BA 4QASA 3P27A 2XVXA 3IUPA 5T64A 2V6GA 4BY9E 2GNOA 2I2FA 3IRVA 3DR3A 3OZSA 2NAPA 1I9GA 4RH1A 5BNWA 7ADHA 3P9QA 4QM7A 1H05A 1FEZA 2GCNA 2WFLB 1KA9H 2XWSA 4O63O 4OAOA 1JEDA 1IDOA 4DR2B 2H0AA 1V95A 2JI4A 4M1OA 4Q1AA 4FGSA 5B1HA 3PCTA 4ND7A 2EQAA 5JJIA 5BSFA 2XTAA 5LLDA 4AJ4A 2B8TA 1S2MA 1DINA 3FNQA 3MOSA 5CCBA 1BOOA 4DZZA 2FR8C 2J09A 3NH9A 4HMPA 4MMXB 1M8PA 3ZI7A 2VJKA 3STVA 4WASA 2IVFA 1G5IA 1L4GA 2C4VA 2ZT6A 3ABIA 2IBMA 5JR3A 4C2TA 3DCJA 5CEJA 2ADOA 3Q98A 2PT5A 4MGZR 2X23A 1M1XB 5CRIA 1MN6A 1E1RD 3TR5A 3ZXIA 2G09A 1QVVA 5JMTA 3LGSA 3EQ2A 3GRVA 2P6NA 1VGQA 4U3JA 3QX8A 5BP7A 3A1TA 4BLSA 3ZLUA 5EYPA 3VVLA 3UXEA 4G0XA 1JJAA 1KDRA 1RJ9A 1SVLA 4MW1A 4N6OA 4R1QA 3SF0A 5A4FS 2QG4A 3QEBZ 4FFMA 1JT9A 1Q83A 1WU8A 2D5IA 5F3DA 4JK3A 2F8MA 4JGBA 4RPLA 1ISRA 2AOTA 4MS1A 3ZHYA 3ITDA 1NNSA 3BBPA 3OECA 1CR2A 1DC3A 2CVQA 2ECPA 2GKOA 1RWPA 3E82A 2FKNA 1E3MA 1M2GA 1Q7CA 1TCVA 2ANBA 3K96A 5TJHA 4BNJA 2IZZA 3HCRA 2ILTA 4CV3A 1XDUA 1G17A 3K8YA 4D3XA 4E11A 5C2JB 1DKPA 1WUIS 4TVSA 4WBSA 1SVSA 1DDIA 4B4KA 4RTMA 1HLGA 2IXFA 3FWNA 2BTEA 4GKAA 5I5GA 4JLBA 2J32A 3VSAA 3A05A 5BV2P 2WBLC 2X8JB 4X1YA 5IKOA 1EX9A 4XRRA 1IH8A 2H31A 5EE0A 2BFBB 5FO0A 1ISHA 4BAUA 1UADA 2FPLA 1ORVA 3QVLA 4O2AB 1QFSA 3QVWA 1W35A 1U9ZA 3S99A 3HV0A 1OX4A 3U7IA 2NO9A 3HTXA 1II8A 1O58A 4PSVA 4Q9HA 5D51S 2XZDA 5AK4A 1XRPA 5A0TA 3T99A 1EGAA 1I80A 2WG0A 2Y1DA 1WXQA 4PCLA 4Z0HO 4B44A 2QRPA 2XYPA 4DQLA 3I6IA 3PVZA 5JSZA 5FTLA 3W8NA 1KFCB 4LMAA 4PFSA 1CUAA 5BURA 1ZHHA 1M1UA 3DYBA 4WOCA 2YHBA 1HURA 3QPUA 4R9SA 3Q2IA 2QMQA 2ZJFA 2G04A 3GPDG 1KGSA 3GH1A 4RMGA 4DCTA 2EQ5A 2WJVA 1D2RA 5KTMA 4OYYA 3B5EA 4I19A 4RYLA 4DA7A 1M2VB 4YPFA 2WFMA 2YJ3A 3ROMA 3TZLA 3WMFA 4BNIA 1FUKA 4Y2YA 2EDCA 3W4KA 1Z7BA 2Q4TA 2JVJA 3RBAA 3DW3X 1WS6A 3LX5A 3VYWA 5DNCA 3TJZA 3PA6A 4UU8A 3UJDA 2HJ9A 3RUPA 2WA1A 5C53B 4L4RA 4QNNA 2JBWA 1YULA 3D6TB 5C31A 3LFTA 3L6EA 3QH4A 2IV2X 4FNMA 5CVCA 2YRWA 3KOXA 2ZUUA 5KHLB 4XLLA 1ZN7A 5L4NA 1L1QA 3EZFA 1NM5C 2B1GA 1WWKA 1JXAA 3T06B 4FQ7A 3A36A 1NONA 2O2EA 1DXQA 4H7PA 1E4VA 3GJZA 1EE1A 5NULA 5A9SA 4HUTA 3D6UA 4CL3A 4MIEA 3M4YA 4IDAA 4CDGA 4G1BA 4PPQA 4CM4A 1OLOA 3K6JA 4Y6RA 1VA4A 1FYFA 2AFRA 3FUWA 2HBQA 3SQMA 2PX2A 1BAPA 4BAGA 1N0UA 3G2OA 4RIHA 3W3AH 1BDMA 4ONEA 1DMSA 1JPVA 5DFAA 4E3ZA 4JYAB 3DO8A 1U2GA 2JIRA 2IHUA 3UFBA 4ILKA 5GQSA 4Y18A 2JGIA 4E1VA 1MB3A 5JQGA 1L7QA 3EHEA 3L0OA 3R9IA 3AF3A 5B7GA 4HB4A 5I8ZA 4A1OA 5G53C 1YB4A 3ZX4A 4IHJF 5L53A 1HLPA 2RIRA 2LCQA 1D1SA 4NOMA 3K0FA 2QAGA 1S7GA 2YVQA 3O8QA 3ESCA 4MKIA 4N54A 2ZIWB 2LWIA 3TRKA 2JLVA 1IWOA 4HAXA 3MQ4A 4LRYA 3L0ZA 3AM4A 2EHJA 2PUFA 3U1BA 4BB5A 1J2UA 2Y1GA 1GIAA 1YO6A 2NN3C 3T4PA 4ARSA 1Z36A 1Z2OX 2DZDA 1JXOA 2DULA 3DS8A 1T9KA 5DM4A 5BQFA 5DTQA 3ZWCA 4BZXA 1CZNA 1OJLA 4RETA 1H8EA 5LFAA 2I7VA 2Y8EA 4E5UA 3K9QO 1FFEA 1MRZA 1A8QA 2D5AA 3N5KA 4FOTA 2HZBA 1ZJ5A 1KE2A 2GLTA 4DLZA 2YX1A 2NYVA 3H8VA 2GPJA 3R7FA 1F06A 3OZAA 3T4EA 4R1OA 4O4IF 4ILEA 3ZV7A 4DHWA 4PYMA 4C7KA 1GTG1 4UAUA 1AGPA 2FF7A 3RYIB 5CDFE 1ATIA 2XCRB 2YWRA 1OIVA 5CVUA 4CGYA 3S1AB 5EHZA 1KAHA 2EZTA 2JLBA 4KL8S 3ZWMA 2HK7A 1T4BA 3DCIA 4QAJA 5EI5A 1N6HA 1VE1A 2H2FA 4IL5A 4J2HA 2FDRA 4TRMA 1VBKA 3ND8A 3QYPA 3Q0IA 4FS8A 4GM1A 1YHNA 2IY7A 5TY0A 4DCSA 2C0PA 1ND6A 5JQGF 3BZBA 3MTBA 2JCXA 3N0RA 8MHTA 1KEUA 3FUVA 2C61A 2ZYAA 3O4HA 4KR7A 1VG8A 3QKWA 3V8NA 1JALA 3UV3A 5JZMA 1CJVC 5DMXA 2GZ3A 5CNKA 4Y6LA 4Y6QA 3R6DA 4GYKA 2WZQA 5E7IA 1XZEA 4ZTBA 2VOEA 3PXAA 4Y9UA 2XMZA 5F1OA 5A1TA 3W3AA 2O4CA 4KQWA 1GJRA 1EVZA 1G8PA 4KO3S 5ADHA 3BMCA 5ECGC 2SICE 3O94A 4BNMA 1JEYB 3ZD7A 1SHLA 3MBKA 1Y5RA 4WCVA 3SZGA 4L5CA 5G1OA 1OU0A 4YWJA 5A71A 3IV6A 3WLOA 4BC0A 3GLIE 3NAZA 4MIYA 1CQZA 4ACAA 2R1TA 1JFLA 4UQPA 4WKBA 5B58T 2PLAA 4FJ1A 4ZQBA 2QX6A 5HVNA 1ISIA 1I2AA 1HR0B 1U81A 4B40A 1X19A 2YHIB 4FUQA 4KVGA 3TW6A 3A1WA 4QTXA 3PIDA 1JFRA 1J8FA 2WTNA 2Y92A 3DC2A 1PGNA 2R7AA 3P2IA 4WLEA 4PLYA 4R54A 4WLUA 1ZIXA 2XWJI 3NGMA 1VRCA 3PE3A 3DWGA 4C7VA 5GZ1A 1U2RA 5FJJA 4AY6A 4YCMA 4QYWA 4B4DA 4UE6A 5IK2D 1ZX1A 1QKIA 1ETHA 3GLHB 4JI3B 1IL0A 2OHGA 3UC5A 3COJA 3MS7A 1NTOA 2RB5A 3OQBA 3SXUB 3UAVA 2PGAA 3I39X 4ZICA 4WIAA 3KT6A 3PXGA 2EX0A 1UFOA 2PS1A 3KEFA 3FKSD 4BMNA 4KWIA 2GI4A 5BNZA 1VPLA 1WTCA 2XQIA 1BXGB 3W5DA 1QANA 3Q12A 4U6QA 4HFMA 2BFBA 1EAMA 1M0TA 1RPJA 2HA0A 2P5YA 2ST1A 3FWYA 3L0DA 3ORYA 5FQNA 5SV2A 3RUAA 3U9SA 4E13A 3GARA 3BBLA 1B8NA 2C0CA 3H4IA 3KCNA 3Q3CA 1KVQA 2IODA 4HWSA 4BTLA 2UVQA 5F51A 5D3MB 4XDYA 4OFWA 1P74A 2D5LA 4IBOA 1G8MA 5FFNA 5IJXA 4G9EA 1MRSA 2PO5A 5LQSA 3SQLA 5TIIA 3OCZA 5EP3A 4QTZA 3VA7A 4LDJA 5BYBA 2X1MA 2ZQYA 3ELBA 5ALNA 3UWMA 2EC5A 2Q46A 3AC0A 4QUAA 1JAHA 2YN4A 1KK1A 1PX0A 3DH0A 4IIDA 4XYLA 1SK9A 1X14A 4YIHA 1ZH4A 1PFUA 4HDRB 4ZYXA 2VYNA 4G26A 3PHHA 1D4ZA 4HLCA 5CB4A 1G1MA 2OQRA 3REOA 1R27A 1DAGA 4ZT4A 4BRUA 1N8NA 1QVAA 1UKYA 4D56A 3DBRB 4HWRA 3VH1A 2P75A 2B4KA 2MMCA 4OM8A 4EPYA 5M2QA 1KJYA 1TZCA 4CUJA 2UYHA 3OJ0A 3P19A 4G8CA 4S2EA 1KTIA 2ZTLA 4G24A 4XLTA 5E6SB 3B9PA 4BE9A 2Z5LA 4B31A 2P3LA 1TD1A 3PGXA 2W00A 4RF2A 3D5EA 5B1SA 4X84A 1EVYA 3HO6A 1ZNXA 5K3SA 3LPDA 1PTJC 3WLAA 5K3EA 3SBXA 4BECA 3WB2A 3ILSA 2AG5A 1JYSA 3C1OA 2WIFA 4D57A 1QIIA 3OZVA 3A4LA 4ENRA 3A9SA 2AE2A 4R5MA 1U8YA 4NIMA 4M1TA 1AHHA 4I55A 4YRIA 4AKHA 1NAIA 1E3WA 4BMPB 2JLRA 3PS9A 1LSOA 3R40A 3PX3A 4NS4A 4M8IA 4F3YA 1W19A 3BGWA 4NBUA 1RM4A 4O2BF 3WGUA 1Y37A 3ZV5A 4BQQA 4TRJA 2H4XA 4X00A 4KZKA 3RIHA 2D1YA 2P27A 1Y3HA 4UNIA 2ENWA 3PGLA 3SX2A 4CKBA 2VSQA 1ICIA 1XXHA 5FI1B 3O03A 2OORC 4QOHA 5LLTA 3D3WA 3NBYC 4FFLA 2WM3A 1TAHA 4U2BA 3KOYA 2QLNA 3TLZA 3VO9A 2LR0A 3NS7A 5JALA 1JHMA 1N57A 3BMXA 3FHCB 1JG1A 5ED0A 4UPEA 3UJ8A 3UMBA 5HKKD 2NZYA 2I22A 1PYGA 3L4BA 1B1AA 4FI3F 4Z99A 4EARA 4DDVA 4ZOQI 1YRYE 5KNDD 1Z6GA 3ZXXA 2JGLA 4CKYA 2WMYA 2QL5A 3OOHA 3ND5A 3QX7A 4J7CA 2WY2D 1ES9A 2WVAA 5HGJA 1G16A 3AU9A 3PA8A 1NN5A 3AEUB 3ORSA 3THOA 5CHEA 5JAMA 3HM9A 5BSVA 1KZ6A 4RZ2A 2AHOA 3U7RA 3OZCA 3PWTA 1ZQ9A 5A6SB 4UEWA 3HN6A 4DARA 1WXXA 5DTIA 3LDGA 2W6MA 3CF2A 1A9RA 4RKFA 5C4GB 4EYKA 5J58A 3WGIA 4GUDA 3SC4A 3P71T 4HGRA 4L08A 4RTRA 4A27A 1IMOA 1NHGA 5DN9A 3KQHA 1Z47A 1FBTA 2C9ZA 3OI7A 1JSRA 2M6KA 1AQNA 2Y2VA 3WI7A 1Z4PX 2DTDA 1MW8X 2GAAA 3OT1A 4LC1A 3H5RA 1MAHA 2P9GA 1X2BA 3TIGA 2Y0DA 2J7PA 1WDWB 1K9VF 4OX9B 1XWFA 1L5WA 1NBEA 2UDPA 1NP6A 1LS1A 4A7PA 3HKDA 4JDUA 2VTKA 1Y8QA 3CX8A 4TM7A 5AW3A 4B3TB 4Q6WA 1QRRA 4OQXA 5JISA 1ODSA 4YCDA 4A8JC 3CISA 1EDDA 5REQA 2ONZA 2FW8A 4PG5A 2PMWB 1E2GA 2UYYA 4FIDA 5FUBA 5FUYA 5AJHA 3RVBA 1JAXA 2VNAA 1X7XB 3ZK8A 2EVWX 2ZEJA 3CLSC 1AA9A 3EVTA 4E46A 1LI7A 2WYOA 3NEJA 5KTYA 2EJVA 4TZ6A 1J23A 1NXSA 3D0OA 3LGXA 4FMPA 5E8RA 4DWVA 3MINA 3PQ4A 4QUBA 5JNSA 2HO5A 3RASA 4ZPJA 3ZCXA 3S2UA 2O0KA 1Y82A 3H5LA 1YS9A 1D3AA 4C3ZA 3OPQA 2NU6B 2P7HA 1FXSA 2HSDA 4G5FA 4M0EA 2C84A 3KIPA 4JX9A 1GN9A 4Q1CA 1UMCA 5LP6F 2YZNA 3NV7A 3HA5A 3G9TA 3NHYA 1DU4A 2NP6A 1QR2A 1NRJB 2KE5A 1R9JA 5ITVA 3B2NA 2HNBA 3IQFA 2QUBA 3NEPX 1QKJA 5T4FA 1KH3A 5KNBD 1Q3HA 1ISPA 3E3AA 3RK4A 4EA8A 1FDOA 5THKA 3U1TA 4HS4A 3M3PA 4RY2A 1Y1TA 5FWNA 1OT3A 4RQUA 3AM5A 3KPJA 4HPXB 4OQDA 3EA0A 3H9BA 2ECFA 5AM4A 4BMDA 5KX5A 1WMSA 4PS1A 3ZVLA 3U61B 1M1YA 2O3RA 4HX2A 4HNUA 3PVSA 5ER9A 4DC1A 3ISTA 1VFPA 2HHJA 2W4IA 3X1ZA 1V5IA 1HI9A 1X1DA 2C20A 3DFMA 4WUVA 3EAGA 5ALDA 1ZJ4A 1O9BA 3JV7A 2GCGA 5FWDA 2R8BA 4OHUA 3AXSA 3HHPA 2WWGA 3CJRA 3KQUA 1MXFA 3IMEA 1C0EA 1FFSA 3JQ8B 4QXOA 2REQA 4EZIA 4QDKA 1IY9A 5ALKA 2VSFA 4JL8A 4JKYA 1QP0A 3GMSA 4ZVMA 1R37A 1U2TA 1JNYA 3MMZA 1XA3A 2NYAA 3R75A 5IJ0B 1XQYA 2EKPA 4W1RA 2QRQA 3M3HA 3GJ4A 3M5CA 4ETWA 2UZ1A 2YC4C 4EFKA 4D96A 2IBSA 1TC1A 2QUZA 2W0MA 1A7UA 1XJQA 4M1MA 2O8NA 5JS7A 4IR7A 1TECE 5AXAA 3ZWYA 2RB4A 4WBXC 1VLZA 1C3EA 1P1FA 1XGKA 3C8UA 3AMVA 6LDHA 1YKSA 3NPMA 1H65A 3UK2A 1YFJA 4CL2A 3BTOA 3DV2A 4HUQB 2O06A 4GX0A 5KNCH 3ER9A 2BR5A 3VU3A 2V9PA 3GLRA 4RKWA 1ZW1A 1KWGA 4HDRA 1VIDA 2QN6A 4CQMA 4Q4AA 1ONNA 4HNSA 4MR7B 4O29A 1Z0UA 1KC3A 1BC5A 1JHDA 2Y76A 3KUDA 4MUIA 3LQ1A 3OU7A 4ZO6A 3SZLA 4AUEA 3VKFA 4KITB 5JANA 1KFJB 1UFRA 4RD3A 2ZJ7A 3W2FA 1XQ6A 3PLNA 4V0NA 8ABPA 1PSWA 4E2XA 4UZFA 2B83A 3BMOA 3QU4A 3O8DA 4QU5A 4FYWA 1SCJA 2FLKA 2P77A 4JL5A 5JSQA 1NBAA 1PLLA 3LKBA 5DSXA 3F4BA 3DTVB 4E2FA 3ZCUA 5CA0A 1ADGA 1DO2A 4CR6A 3AIOA 1ZUD1 3G6WA 3FPFA 1DG1G 1MUUA 1N8KA 1WSBA 2FWNA 5IABA 2CV0A 1NFQA 1E5VA 1Z8FA 2R62A 3IL2A 1EZ1A 4DT1A 2UYGA 3PFNA 5EJMA 1V6CA 4UJ5A 2BM8A 3EODA 1T0UA 4FYVA 4JB2A 5DVZA 4CKBB 2E4VA 2WUGA 4EHBA 4D9IA 1QGUB 1T10A 2J87A 3RIGA 4X1KA 2A94A 3NNNA 1F1BA 3X3HA 2G77B 4ENWA 1OZ0A 3ZWQA 1EX6A 3AVPA 3X2EA 3LSTA 1YJBA 4Q6BA 1EG2A 3Q7QA 4FLFA 5AVJA 1L6IA 3C85A 4GZ6A 4LHZA 5BN4B 3U3OA 4EY6A 4YAJA 5L3SB 2AJDA 4JIGA 4D9CA 4YP7A 4W63A 4MYHA 4BUCA 3DBHB 3FROA 4C08A 4B4VA 2ZSIA 3IMKA 4H16A 4EZBA 3NWOA 3RADC 1YNOA 3DE1X 5GP1A 5TS2A 3TEJA 3KAQA 4O8ZA 2Q2OA 1T2VA 1O0SA 3O90A 4TOIA 1L8LA 1E1DA 4LZWA 2FXIA 1THTA 2VNJA 1FSGA 3N3AC 3CUUA 4CUZA 3T7RA 3L7MA 3AJDA 4GM4A 2B2CA 2BE7A 1MX1A 2PH3A 5JVDB 3QTBA 2PRJA 1Z08A 3SLRA 1CIJA 3WL6A 1PG2A 1R4ZA 4Q9DA 4E07A 1WKBA 3HNOA 3HLKA 5DK6A 1RTTA 4ZRDA 2DWUA 3EPJA 3OBBA 1I7DA 3T15A 3WB0A 2XAAA 2GEVA 2GHTA 3B9QA 3RIMA 3EGDA 4HADA 3HDHA 2EWWA 4UASA 4CT5A 2GAOA 1II9A 1MC5A 3I5AA 3NG1A 1XHFA 3FRIA 1FL9A 4P0PB 3NT2A 2H1CA 2ZQ5A 3OJOA 5FA6A 5CAEB 4F4JA 4OFXA 3IJ5A 1LF0A 2AZ4A 3IIKA 3OX3A 4AURA 5GIPE 4RD1A 5GONF 4GMDA 5AVVA 2MYPA 2GUGA 1Y6QA 1K6JA 4AUKA 5L7YA 2I29A 3JYHA 2H06A 4GEGA 4DHEA 5HUJA 1N7GA 4I9UA 5IBCA 2CL5A 5JCOC 4NV3A 4WEOA 3WL7A 1XMIA 1K0FA 3G5UA 1ZSVA 1DAEA 4KHPB 4EYSA 3OEEA 2G0TA 2XGJA 2D00A 4B33A 3WGHA 1CY6A 1T4MA 5DHFA 1QPGA 3OLQA 1VA5A 3SEQA 1RPZA 4ERXA 1HDXA 4ZARA 5JZSA 3AUAA 1SN7A 4D4KA 2WSSD 3HWWA 4CTNA 1SCIA 2RGUA 1L5RA 2Q5OA 2IE0A 3T3IA 2G76A 1QHXA 4JQSA 2FW6A 2OC4A 3S68A 3GFQA 4JT9A 4TXMA 2XB9A 3LDAA 1GQFA 1V7CA 4HQLA 4K9NA 3OIGA 4MCIA 5TV2A 2FZGA 3DWFA 5GV8A 4AZVA 4DDHA 2GYWA 4WMLA 3FPCA 3PHIA 4X1KB 3Q5DA 1SU6A 2W2NA 3MT0A 3VC3A 1XEAA 3AQ4A 3L8GA 3AX6A 1ZONA 3EGOA 1EHCA 3W9SA 1GT6A 2Q3DA 3DO5A 4K26A 5E8JA 4MWBA 5CTAA 3PQDA 3NP9A 3C6BA 5CPBA 1AB6A 1ZCZA 4GE3A 4E5NA 5FNVF 3U6KA 1IATA 1XF1A 2I33A 2IJGX 2LKCA 3O9VA 5F4ZA 5DU2A 4H7HA 4B81A 1GFWA 4ZEMA 2PGXA 1LDEA 2ZRBA 4TX1A 2EX4A 5H16A 3WZ2A 3NVKI 3R41A 2PZEA 1GUDA 4GI3A 1YZQA 1SU8A 3PUIA 1I5RA 1KYYA 3NOXA 3GYGA 2PVSA 3BPSA 3VC1A 3ZUPA 1ZMXA 1U9YA 1ISFA 2LCIA 1I3LA 3OE4A 5K0SA 1Q0ZA 1CTQA 1XVUA 4GC5A 4FT4A 2JFBA 3OCXA 2G80A 2AI2A 1DZ3A 4LZAA 5CVJA 2XRZA 1NW3A 1AO3A 1E9DA 4L5JA 5K0BA 1OH5A 4C0BA 3HSKA 4Q4AB 5IG2A 3TZHA 1CY1A 1T1IA 1YE5A 2VJYA 5EY5B 3T9CA 3K6KA 2Z4RA 3Q8KA 4P3PA 2RGEA 1QQ5A 4JB8A 4ALMA 1FX1A 3MWJA 4A2QA 1ABFA 2F1RA 1QYVA 3T9DA 4EHJA 1QHIA 4L4ZA 1TK2A 2IZ1A 3MF4A 1TMKA 3GFBA 1VLHA 4ER3A 4AQYB 1KRHA 3AL0C 4S0ZA 2WA2A 1Z45A 4PBTA 4MLZA 3SYMA 3PEEA 1F20A 1Q44A 3IP3A 3ZGVA 3GLVA 3TDKA 3TZBA 4CHTA 4PLVA 4RACA 1ZD8A 1DV2A 2RC6A 2H0RA 2ONYA 2ZAGA 2PQ6A 3KVNA 2QTFA 4RMIA 4IQFA 4XGNA 4DIEA 2P90A 4MPDA 1EA5A 1WXDA 3GOQA 3LYLA 4Q66C 4H1VA 1EXMA 1O54A 2D54A 1PYOA 1V0JA 4L75A 4NNPA 2FEWB 4FNAA 4K9RA 3SDBA 1ILEA 5G3YA 1BXRA 1J5XA 2UUCB 1XQ9A 4ZXFA 2LXNA 3DKPA 3IERA 4F4DA 3O6VA 4H3VA 1XMXA 5L51A 1F60A 1X77A 2HWXA 3MILA 2I03A 3IAHA 3WGLA 3P9IA 1PN3A 5ERXA 1Q0UA 2ZIXB 3NHPA 4KQFA 4LE1A 3H86A 4BO5A 1PGOA 1KAMA 3LPNA 2F1HA 1PFWA 1OC2A 1M6NA 1DXOA 1P17A 4KUHA 2ZYVX 3PCXA 5EZSA 1GTJ1 1EINA 2RBKA 4M6WB 1IEXA 2J5BA 4MTLA 1NVWQ 3SJBA 4N76A 1VRWA 2AL7A 1MOSA 5A5VA 2ET6A 2H07A 2VTBB 2FQ1A 3BERA 2GBGA 1L8OA 1M6WA 3NBAA 4P2GA 1TUBA 1M0WA 3BE6A 3NANA 4HR7A 5DLQC 4H0NA 4ZDKA 4PZUA 4UUMA 1EU1A 3RVJA 1V6SA 5EWMB 3TRJA 1UFKA 5L6LB 4X85A 2TSYB 3CRRA 3E8MA 3JVIA 2EATA 3KYCB 4Q0MA 2Q3CA 3SQDA 3U7QB 3UWSA 1SQFA 3VMFA 2XUDA 2CZCA 1VJ5A 2DT5A 1G5QA 3QLEA 3KJHA 1N8TA 3LIPA 4BZQA 4R1TA 2VHZA 2VWQA 3LQQA 2E4XA 3N0TA 2WWVD 5L3VA 4HLUA 2JA1A 2VSOA 1U2EA 4AJIA 3LLMA 5A0FA 4YUVA 5IEBA 3UYLA 4DQUA 1K3TA 4I1OA 4N7RA 4BEVA 4KPYA 3BTUA 3FYUC 4KKVA 4FFPA 1R88A 3AFIA 5GPBA 4QJ4A 2ZSUA 3RFXA 2CHFA 4IXDA 4BNUA 5KSZA 4CKEA 1Y8ZA 5BWLA 4W5HA 1GA6A 4IDQA 4JXJA 5BOSA 4EG5A 1G8YA 2FPIA 1GU7A 1DMRA 3FD8A 1NXPA 1QIKA 4YJ3F 1GV0A 3A04A 3RFCA 4DANA 1AGRA 1FDTA 1YRBA 1AO0A 5LXTF 1KQNA 2QN7A 2WSMA 4E31A 3LLUA 2QJFA 4AN0A 2FZWA 4HATA 1P1BA 4GG1A 1H1DA 2YCBA 4NENB 1HTTA 2O8BA 3K9FC 1AUVA 5GVSA 1VJTA 3I42A 2MCFA 4D8XA 1QRAA 2X3YA 4FGLA 2B1JA 1MLDA 5D3QA 2X0FA 2I9KA 4A6PA 2W22A 3VVBA 1RW4A 4TTTS 1E0DA 2V45A 4BV2A 4AECA 2R6FA 4AJEA 1MMFB 2PXCA 3W05A 2J45A 1K8QA 5KTNA 5LKAA 3GRZA 4D4LA 1E1QD 3D6MA 1USIA 2W2KA 5HBGA 3UBMA 2ZI6A 2A0FA 2J46A 4LJLA 2GEBA 2X3FA 2VH5R 1RWKA 4URYR 3AT1A 2DTXA 4LZOA 4EPTA 3FJ1A 3A1VA 5SZIA 1HZZA 1ZMOA 1K5DA 3K31A 4PQEA 2Q4BA 4O02B 3IEKA 3ADKA 2Q0XA 3NP7A 2XUZA 1SCUB 2BEKA 1MENA 2B6HA 2ZT5A 3G2IA 4IQGA 2OCBA 2PZBA 3KTFA 1XZBA 3UB4A 4C4AA 5EJ9A 3A58B 4HRYA 2HF2A 4ZPXA 1SG6A 5E9QA 3W5CA 2V96A 3GELA 5EWJA 2WU8A 2IS1A 3MXOA 1SB8A 3IRUA 1IEVA 4LYAA 3I8SA 1RLIA 3HZZA 4P86A 3CPHA 3P0FA 3WGGA 1YA4A 1S5PA 4AY5A 3IAS1 3LX6A 2JD0A 1JLRA 3A3NA 3OTIA 3DD5A 4BP8A 1DKLA 2Q4DA 4O4LA 1SBHA 5HQJA 4P36A 1BE1A 1R0XA 2BLNA 4ZD6A 3ZUGA 2YOFA 3DZHA 2YJZA 1EUZA 3PNBA 4R9VA 3VISA 4C2AA 5IKXA 4KXLA 3THWA 4IH1A 3VBCA 2FSSA 1KDZA 1EXDA 2FUEA 5DWDA 1UMCB 4M88A 5DM1A 1APBA 4QQNA 4HNTA 3X1YA 3R09A 1NXWA 3U7JA 4CCWA 4REQA 4F72A 4RPHA 1EK6A 1OR8A 5HQ3A 4QUKA 1GU0A 1XRQA 3F6BX 4GYJA 4JC0A 2ZXUA 1JPUA 4D02A 1BN7A 2AZTA 1NF2A 1WIWA 4AMZA 5LP6B 1I3OA 4L2IB 4ZT2A 4WN9A 3VR0A 4LRQA 1RBMA 4EL0A 2OQ2A 1E5DA 2MU1A 3OQHA 3NR2A 5ETJA 1G21E 1ZWKA 4QA9A 2XUJA 3H2IA 4MDFA 1ZCFA 4FE4A 4J4HA 3GIDA 5T3YA 2R4UA 3EEBA 2FCRA 4YN3A 4BQPA 1RE1A 2OK8A 3KTDA 1CP2A 4QYXA 1A88A 3HH8A 2SCUB 3VAYA 2V0GA 1JAIA 4WZAB 1L5QA 4UM9B 1X0VA 2BMVA 4TKMA 4FN4A 3RQIA 3PZBA 1GA1A 2CLKB 1TJNA 1CJUC 2YFKA 2G71A 3AL2A 3PUZA 3RT7A 1GRQA 4D9MA 5AW7A 4DMFA 2BFEA 1AZLA 1WHTB 4FOSA 1PR5A 1CS0B 1ZK1A 3T4XA 3T3DA 3GV0A 2CD9A 4BZWA 3CJTA 3I76A 2XE4A 2C5GA 5AM1A 3M83A 4NR0A 1XCGB 2X8WA 4TQUS 2ABWA 3C39A 4FDTA 1JLMA 4AO6A 4C6TB 1RLTA 2JJ1D 5K2MA 4UTPA 1DHTA 1WY5A 4B8YA 2DWCA 2H52A 2JKYA 5K3FB 2QPAA 1GZHB 1GPDG 4HFRA 5BWOA 4ZOLB 3PTLA 4WADA 3L7NA 2I3GA 5J63A 3U80A 4D2IA 5CYGA 1POXA 4J0FA 2D3TA 1ESNA 3G13A 3N87A 3KZMA 1IRIA 2WWIA 2XTJA 1W5EA 3CTPA 3GUYA 1N2SA 5FLXA 3QVTA 5KYGA 1UC4B 1J8YF 1IVYA 2OZEA 1Z0ZA 3ZHCA 1IHXA 1SRQA 2QQEA 4C29A 2OM6A 2NTEA 2TECE 4G09A 2ZUBA 2GZDA 2CVOA 1USGA 4FFNA 1OU4A 2VA9A 4HVTA 5EWMA 3AZOA 1T6ZA 3ND7A 4RBNA 3CCFA 1JQEA 4NG5A 3SHFA 5JVDF 2D62A 2NGRA 1KIMA 2AH5A 2X6RA 3B5IA 5EEGA 1DXHA 5MN5A 3R20A 2FSHA 1SHZA 3D0KA 4TKZA 2CT8A 3TFOA 4M3NA 4ZN6A 3TQCA 4DRXA 4OV6B 3GLGA 5L3RA 1VHWA 3HO8A 4O2LA 1JFFB 3AJAA 3RS0A 1M1NA 1NJ1A 5DI3B 3USZA 1FSFA 4QPDA 3BMCB 1PD1A 2VEOA 3UJ3X 2WP8J 4IVRA 1WW3A 4QELA 1PW5A 1J70A 4MCAA 1RPNA 2IS6A 2II6A 2OGSA 3AHIA 3NHZA 4MVJD 1Z7YA 3L1KA 3D6AA 1J1UA 2FEXA 4IMRA 3ZCSA 5IKMA 4RHTA 1K2VN 3TTSA 5I7HA 821PA 2MMGA 4B17A 3H83A 4M89A 5DYGA 1E89A 2DFDA 5FNVA 2AEMA 5KOYA 2Z9BA 3IP5A 3KFVA 4IIJF 1M8JA 1A8UA 1DJPA 2IXEA 4A0FA 4MAAA 1DFHA 2FHSA 1OT5A 4F96A 5AVYA 1OFUX 1KDTA 2H2AA 3COZA 3HRIA 2BMEA 3L1VA 3ENKA 3MT8A 5JS2A 3VDRA 3HCWA 3J81A 2IE8A 2PKWA 2SKEA 3AIIA 4EELA 4E32A 5A7GA 2WP0A 2DECA 2HSJA 3NC0C 5HIJA 1MTZA 2RCYA 3RH0A 1STOA 1TW3A 2QG9A 4FZRA 4XYGA 5H4HA 1ZGAA 4ZVLA 3UAYA 2AN1A 1G38A 1TYZA 3CUEF 3TD9A 2BKEA 1JT2A 4JN6B 2XXJA 1YU9A 4PYQA 3W5IA 4GVXA 3F90A 2C2OA 3QP9A 5TGZA 1O77A 4YR9A 3CKMA 3WY9A 4F92B 3O2NA 2A14A 3W3ZB 2HMSA 1BVHA 3UGTA 2RHWA 3OKAA 4JROA 1KMIY 2PEZA 1GA4A 5I7VA 2Z9CA 1IZ9A 4DC0A 2WC1A 2R8YA 3CEHA 3OX1A 3B6EA 4HRVA 3V8EA 5AW0A 3KB1A 1Y3IA 3HDYA 4ZYUA 3WV5A 3BKXA 2SBTA 3ETCA 4JHXA 5LM3A 2FDCA 4ZVSA 2ZIEA 3LPLA 3MWLA 1H2YA 1LCIA 1NY6A 2X42A 3RPEA 9GPBA 1VJCA 4DV1B 3OA0A 3PDIB 3T9EA 2OBMA 1FUIA 4Q16A 2C59A 3DMGA 3PD1A 3KO8A 5FUXA 2BFFA 2ODPA 3L4SO 2I4TA 4HEQA 3WYGA 4D6PA 2GUWA 2HREA 2DPYA 4IHQA 1JDBC 1H2RS 5JAHA 1PS9A 3GVXA 4ZVVA 3TIFA 2VR1A 3KQOA 2OHFA 1ONBA 2OSVA 3E0XA 2HRDA 3BD7A 5DLYA 2P4QA 3N2EA 1UPUA 4LBWA 4M55A 1SPBS 1X7ZA 2ZYTX 4DMHA 5FBVB 4DJTA 4XB1A 4FZ3A 2JHCA 3OPYI 4EJ0A 3W6NA 2PCLA 4R2IA 1XELA 1ONPA 4E5KA 5T4BA 4F0JA 2LGJA 3BL8A 1VSUA 3G9QA 3QELB 4A4DA 4KQEA 4QDTA 2UUBB 3G9XA 5AKXA 3DLIA 3WLEA 3CR7A 3T7KA 1GAXA 4JLUA 5F76A 1XDBA 5D8DA 3HJNA 3UCXA 2FP4B 2JDIA 3G1WA 3R1IA 4AZ3B 4E15A 4MDYA 5K7SA 2QTRA 2ZBUA 1GRCA 4G37A 2IW3A 4WKNA 1U6KA 4W5OA 3I9KA 4F04A 3VJMA 5JHHB 5TDHA 3HZOA 2XY4A 4LQLA 2C7VA 3AINA 3W4JA 1ADJA 3THXA 1Q50A 3OT5A 3OUUA 5C1OA 2YXLA 4ER6A 2QTGA 4DCJA 2ZJBA 1JKIA 2SHKA 5H59A 5B5SA 1IBCA 3B6KA 3JD4A 3C3DA 4R0MA 1WB4A 3CXRA 2C96A 1SXQA 1UFQA 3KJIA 3R7WB 2PUAA 1P9WA 1JXQA 1RYHA 1D7AA 3BWMA 3W1VA 2LDBA 1YB6A 1RKUA 1GR0A 1LVGA 1I2BA 1QLHA 1SBCA 2V55B 2XVYA 3F6RA 3RRNA 1JG3A 1GGKA 4KVAA 5FPKA 1K97A 5GY7A 1PSDA 2VDPB 3HU1A 4MKXA 3CR3C 5A04A 3HYTA 2GOYA 1E94E 4Y0NA 4YBRA 3VR6D 1M3SA 3O1LA 3QSGA 4EO9A 2ZYDA 2WPDA 4JUIA 1VHJA 4X97A 5L7WA 2J0VA 4FSDA 1XZLA 3AUUA 1TQHA 3KOOA 2MYTA 4HN9A 1Y3FE 4NSNA 3TLCA 2BFCA 5ILQA 2FPRA 1SBZA 1I5OA 4YJHB 1YE3A 4L8YA 4PZLA 2OO7A 3SQOA 2P5SA 3GXBA 2A9RA 4JLSA 3LUBA 4US2R 3KETA 3WTBA 3RAEC 1CIPA 2CDCA 2QZSA 3BEDA 1THZA 5G41A 5JDCA 4C7OB 4V39A 2I87A 3T3EA 1C2TA 3A1UA 3V97A 3L4BC 2IK8A 1QGED 2P9HA 2ZYSA 4DA8A 2AYYA 1HG1A 2J3HA 3SHVA 2BGMA 1JIXA 2OCPA 4MUYA 3ZY2A 4F7DA 5JJ5A 1FDVA 3A26A 3FAKA 3B36A 2X0KA 1YJCA 4Y1RB 4DIKA 3R0IA 4CM8B 1NAHA 3D8UA 1VP3A 3MM4A 3A11A 3KNZA 4CV0A 2VJAA 2EBWA 3EH1A 2VP2A 4AB1A 4ALLA 1MC1A 3KT3A 3PNSA 5JZ9A 4DWJA 1GPKA 1YS2X 4QFBA 3KQQA 2BEVA 3QPVA 4N82A 3HJBA 1B3RA 2Z3WA 3G2LA 3R5TA 2R6DA 2N46A 2VQ3A 4J7AA 1ID8A 2C2GA 3ICPA 1NKTA 1IJEA 1DRWA 1HFWA 4CNBA 3IPXA 3A6DA 1UOQA 3TMKA 3ZHUA 3HBFA 1KI1A 2CY0A 1WDMA 2JFQA 2NADA 1NQOA 2Y1FA 3CA8A 3OIUA 4G5SA 1F51E 5DNAA 5LYYA 3V8RA 5C32A 3C24A 4A2WA 4KDFA 1BEEA 1DL5A 3H6HA 1AX9A 2XYQA 1Y5IA 2ARKA 1UC8A 3R3UA 4J03A 2RONA 4KQ6A 2W4QA 4HN2A 3DUFA 5E38A 3CU5A 1W36C 1CW2B 1U2DC 2HIHA 4GSYA 4K3VA 3V2GA 3EAQA 1NBMA 1HBJA 1I2ZA 3PJDA 1WV0A 2Q6KA 2ZU0C 3TYXA 3UXMA 5KJCA 2C83A 2W6JA 3WBJA 4EVQA 4PC1A 1NSYA 1IG0A 3ZCRA 2O3JA 3QNWA 2DXIA 2GJ8A 3EXFA 1OFIA 1NLFA 3K9HA 4H6VA 3T7TA 4MP8A 5IM4A 1RQ2A 1F8FA 4QOJA 4CMHA 1W75A 2YXPX 4XASA 1JDBB 3HVIA 3L1HA 2HA2A 1H6BA 3QIAA 2VDKB 3HR4A 3CSDA 3PR3A 4RZSA 1LPBB 1TIKA 2ORYA 3PFHA 4YMLA 1BHSA 3QY9A 3UHJA 1HE3A 4ENSA 3AESA 1U8ZA 2PJRA 2C29D 5G40A 2ZKIA 1KO4A 2V1UA 1IPFA 2WJ3A 3C3BA 4HZGA 3L5OA 4OL0A 3GT3A 2QQ0A 1WULS 2ETVA 4LUCA 2BOVA 2Q45A 2Q8NA 1XDDA 1BE0A 2CFCA 1F8XA 3GEMA 4Z0NA 3A6PC 1N1GA 1Q7GA 4CF7A 1AXEA 2AC4A 3QNUA 2VK2A 5IVDA 2NVWA 2OBXA 3LZ6A 2XW6A 2WSLA 3QVOA 1NUSA 4Q7JB 4Z3DA 1NW8A 3K8QA 3R24A 5G4KA 3GT0A 1R3UA 2J9YB 4QBTA 3UJCA 3VX4A 3BHJA 1C30B 4MUBA 3QVVA 4JP1A 4Q3CA 3VZDA 4MIKA 4XA8A 4NONA 2VI5A 4YJHA 1XAJA 5JSFA 3OFVA 4OI2A 1AQYA 3LL4A 5EYPB 1HYGA 2J33A 4L16A 2PWPA 3A6EA 2CYCA 5AO9A 1CULC 221PA 2BDTA 4RK5A 4V0KA 3WLFA 4D9NA 2E4UA 3KFLA 4RULA 3VYRB 4HT3B 4CEJA 5EWLA 3Q3GE 5BOVA 4U2CA 4NU5A 3TB4A 3EDYA 2O8FB 2DHQA 5KWVA 1QDEA 4S1OA 4L85A 4NFYA 1HZZC 1G9SA 1DBVO 3RS2A 2QN2A 3E1KA 3E9MA 2RC5A 3AJ8A 3F67A 3GJ3A 3H75A 3L6OO 2Q28A 4O8CA 5G0VA 2W2KB 1AURA 1XI2A 1QNLA 1ULTA 3PC7A 4LMRA 1LQUA 1Y63A 2BTOA 1VFNA 2VBIA 3LWBA 3G68A 1CZRA 2EW8A 2OVBA 2IYEA 2X8AA 3OQPA 4HK4A 4LJ9A 4NMMA 4UM5A 3GUHA 1SEVA 1U3WA 1W30A 1VB3A 3NIDB 1GNTA 5LPNA 1FJXA 4EMUA 4BTEA 1LQ2A 4RJ2A 4JI5B 3I09A 4UXJA 3TOVA 3VSDA 2QBYA 3C74A 2X76A 1M1YE 1ZN2A 4LTMA 1DAPA 2P8SA 2XX3A 3MFYA 2XUGA 5IARA 7MHTA 4F38A 3ACDA 4WLNA 3QLJA 1YK0A 4P82A 5DP1A 5AOVA 1NRXA 3AGQA 3DUFB 3MC1A 1I8TA 1DC4A 1Z0JA 1JHPA 3IPAA 4YASA 2V7WA 4BQSA 3E8SA 2GO7A 1G20E 3A6LA 1HFJA 3M89A 5TQ2B 1CUVA 2YZKA 5C81A 1FP4A 3LFUA 4LAFA 2VBGA 3FSGA 1VDZA 1AY0A 4JZYA 4JLVA 1XU7A 3M6WA 3FLBA 3D5QA 4WFQA 5FA5A 1BS1A 4AKEA 4DV0B 3UWPA 1QH8B 2A3NA 1J06A 2GPSA 4LS3A 5DDIP 1QLWA 1TM5E 3LXMA 3FW1A 3RYHA 3TLXA 5KNDH 2ZJ0A 3OOYA 4QUJA 4F21A 2XYRA 3VGJA 2CZGA 4X1IB 1JSXA 3RS4A 1U3CA 1T35A 5DCUA 3JATB 1E2HA 3L7KA 5C8VA 4URFA 3PQEA 4IXNA 3OKCA 3Q8XB 1QU3A 3ZLTA 2HF8A 3QKUA 4J49A 4QOGA 2E4WA 1EVLA 2XSZA 1QCCA 4P4GA 5HGXA 1RXIA 2P5TB 3L06A 1TU0A 1SZJG 2JB9A 1TZJA 4ZU6X 3PGVA 1FZQA 2GSDA 2XT9A 4AP6A 3GRUA 1RXVA 2CFRA 4TLAA 3FX2A 5E9WA 3KLOA 1Q57A 5DIZA 1OMOA 2G63A 4HDNA 2YUTA 4BP3A 3PXBA 4MEJA 5TGDA 5TVKA 1NRWA 2R85A 3FSEA 3PQCA 4HN4B 5KKAA 3CLKA 5HRCA 3U37A 4D3ZA 5BWCA 4KE8A 1Z29A 4G56A 4TTPA 2AFHE 2BFEB 1P0FA 1YDMA 3GB9A 2WMDA 2JK1A 4Y2XA 4YP6A 2DUJA 3WIOA 4BQIA 4YT4A 2B3TA 2GN1A 4C0KA 4UKDA 3OFKA 3QEMB 1XTPA 4DLVA 3BXGA 3T94A 1V4BA 3AP2A 1JKMA 5BR7A 4J94A 1GGEA 4LF4B 3NOVA 6GPBA 2ERYA 1UBCA 3F78A 5B6JA 1CUEA 2Z57A 2PUDA 3LDHA 5BMVA 5DSZA 1TYBE 2A92A 4LJ8A 1O4VA 1K68A 3FZEA 2H92A 4UUNA 2E0IA 4YJ3A 5IJAA 1AZSC 2DETA 3KR1A 4DCCA 2YN2A 4D46A 3WKBA 1GPWB 1M33A 2QR3A 3DE6X 4IIHA 1DEKA 4BE7B 2V7GA 3JQQA 4H17A 7GPBA 3QA9A 4MP3A 3AQIA 3IOMA 3BWVA 3L02A 2WF8A 3VU1A 2D7DA 2XDWA 2H16A 3BB3A 1U0BB 4U00A 1TYAE 1PJ8A 1KBOA 3DLPX 4JBHA 1E1NA 1V8DA 4BNGA 4D0SA 1SBYA 3C0KA 3CNEA 4DDMA 3VTAA 1PNOA 3PUXA 4UM7A 5FI0B 1RWOA 1X8XA 3PX2A 3PC8C 1C9YA 2F43B 5ALPA 5DASA 5H1YA 1ITZA 1QYDA 3KK0A 1Y9DA 3PFFA 4I7EA 2WFAA 2HQSA 5M29A 4DC9A 2GYUA 1Z28A 3OZUA 2OV1A 1I4LD 2CC2A 4IJMA 3L0BA 4O4IB 7AT1A 4OH1A 2Q5JA 4Q3DA 4KXUA 4J7UA 3GOHA 3MYYA 5CX1B 4NFHA 2H3EA 3B6JA 2JCBA 1PJSA 4IIGA 5DI3A 1ULSA 1H8HD 3HKCA 4KPFC 2RGNA 4ICIA 3CNQS 4LZNA 1U0LA 4F9TA 5A5FA 4QPPA 3VRHA 3NDPA 3L82B 2ZRJA 2M9MA 2FOLA 3EXG2 3OH8A 5DHAA 1C3OA 3QYJA 4LYDA 4Y2TA 3MLBA 5H3HA 1EUCA 1KFKB 4M0DA 3CJQA 3KR0A 1N5LA 3NAMA 2NVBA 1YZVA 2CF6A 4GPEA 4CM9A 1QG2A 4TV8F 1RDFA 4NDAA 4RCZA 3RSQA 4GL2A 5LMUB 1QIFA 2P65A 3WWZA 3TTVA 1NW6A 3SS9X 1ZM9A 3CCCA 2V03A 1M2FA 1USWA 2VDJA 2YWHA 4ZEOA 3C4JA 2QYTA 5IVHA 2HTFA 1W44A 5K0FA 1W8DA 4IFBA 4A3SA 3IQEA 1C7FA 1NUUA 3LY5A 3VOTA 2XMPA 1C8LA 5DM0A 4KRXA 4RKYA 3K0CA 1KI6B 1ECPA 2FSIA 1JTFA 2AUTA 2CHEA 3ZQKA 5HBRA 2ORIA 1TT7A 3PQ5A 2XHEA 3D7RA 3R9XB 1N0VC 1TK9A 3NO4A 2XCTB 4A8JB 1UFVA 1AKQA 4AZWA 5CFQA 2A1TS 2P5UA 2O19A 3LHIA 1RWXA 2ZPUA 3EDOA 3FDIA 1I4OA 1S2GA 2X6QA 1EGVB 3O4IA 2YQZA 4OBWA 1XAHA 1EFVB 4IM7A 4BJ6A 3PICA 3W5VA 3KQLA 3RS5A 2LNDA 3L0PA 4F2HA 3K4HA 3FPLA 3ZKAA 2NM0A 2QRGA 3MERA 2PKRA 3LT1A 4Y2JA 3KWMA 4P81A 3C6ZA 3BXHA 4X8HA 2C7OA 1UT6A 1E2LA 3BYZA 4DUGD 4Q03A 3AB7A 1KSHA 2VO1A 3E03A 3NHSA 4LVCA 3EZGA 4KRFA 2RAPA 4IX9A 3NHAA 1GNSA 3ISVA 3OICA 5FT9A 4FT2A 1G8KA 3DG9A 4HXYA 4XVQA 3BK2A 1BWRA 1H2FA 1IQ0A 1C7QA 2QXTA 3A4VA 3LYHA 5CFZA 3GH3A 1R4NB 3CR8A 3SBDA 1XN4A 1YIDA 5EUMA 2HXSA 4OKSA 2P35A 3BHIA 3RV3A 2JCSA 4Q7EA 1KJIA 1UC5B 4MKRA 3T38A 1YUNA 1PLKA 5BRAA 4CIBA 1NF8A 2IYZA 4DLWA 3LXUX 3TAHA 1NI4A 1H9BA 4PSCA 4KSYA 4OY3A 3NUQA 1OH6A 1UDAA 3LUGA 1WAMA 1OAOA 1QFMA 3GA0A 3QM1A 4Q82A 4I4TA 4RIIA 4AZTA 5HRUA 5FPSA 4BEBA 4HXGA 3TUJC 3L07A 2F9FA 5JIBA 2BUCA 4FKMA 1Q2UA 2FI1A 3DONA 2JGDA 3KR9A 4O1MA 1HWYA 4IIBA 1X86B 3ADOA 3MTEA 3PF9A 3TH5A 1TCCA 4JP3A 4LJSA 3ZDQA 4CDMA 2VP0A 1UK6A 3JASA 4RK4A 3UAWA 3ZOKA 1JHXA 2BD0A 3JYQA 4EY8A 2IHVA 3KOZA 1OBOA 3NDBB 1UQRA 1FP7A 2D2XA 4E94A 1L7OA 2GM9A 2IU6A 3QE3A 4PC3A 5D5QA 5E6SA 5A5GA 2J6CA 1XCMA 4RD0A 2ZPTX 4BTVA 1O08A 1VIYA 3MTGA 1GFSA 2GF2A 1XUOA 4GFDA 1PEAA 3OUZA 4G0NA 3MGKA 1ODKA 4KG7A 4OLJA 1DFIA 2BTQA 4I8XA 1GR1A 3TQTA 2WD7A 4DMMA 1Q1BA 2FPIB 4X3OA 4OSEA 3BXEA 4URHA 4PNHA 5BSTA 5CH3A 2FWMX 3UAOA 1DX9A 2CL0X 4TLMB 3R0ZA 1D7OA 1U11A 5CEEA 5KNLA 4KR3A 3C15C 2ZRDA 3HB7A 1P2UA 4JWKA 1FQWA 2E85A 3W6OA 4UNQA 3KKLA 1RXEA 3BFJA 4MXDA 1DRVA 1BJRE 4I1UA 3W04A 3CT4A 2VJLA 1H5QA 3CPJB 4ZCTA 1X2EA 2BGTA 2XRMA 3CVJA 3ZY6A 5ICEA 4C87A 2QM7A 4FFBB 4UU0A 1BE6A 1L6RA 2GKSA 3C3KA 2F3SA 4W5JA 5FO1A 2BZSA 2VJNA 1F6WA 3SC2A 1SO8A 3CYFA 1A9YA 1ECCA 1Z07A 1ZITA 3B1WA 1U7UA 4OBEA 4IFEA 3F6YA 4CL8A 1QS0B 5EERA 4POOA 3TSWA 3TZKA 4X24A 2O2HA 1RHKA 3GFVA 4EK9A 1NN3A 3TI7A 3ABRB 2QLBA 4YJGA 3I01A 4JT2A 2B5WA 5EMHA 1KORA 5GINE 4TQAA 1OX4B 1SUDA 5CPFA 5TQ0A 2F90A 4D9FA 1BWSA 2D0IA 4QRHA 1L4KA 2YZ2A 1L4NA 3DE0X 3MTIA 2PH1A 1I0ZA 3F7MA 1MKYA 3E2IA 2DAPA 3OCVA 4JSTA 4NF2A 5BR1A 2DHEA 4C76A 3DBRA 2ZVQX 4OXXA 4G4IA 1KSFX 5K9ZA 3U7GA 1R9GA 4K6FA 3G1TA 2EZ8A 1LDMA 1VQ1A 5BW5A 5EZQA 4DIBA 3SIRA 1WSWA 2PXAA 4C1NA 4ZAFA 1G55A 5BW6B 2P6PA 1OLSB 1C3LA 2Y1KA 4FSXA 1CUIA 4BNLA 4I50B 5DGIA 4FEGA 2POQX 1PKXA 3QVGB 5DWVA 2RGGA 5JAIA 4YA6A 1B14A 2B34A 3QUSA 4ML3A 5LKRA 1EYZA 3A28A 3PPWA 4FN5A 3DTNA 4QHTA 3HKEB 1XL1A 4XJSA 5BV8A 2XDAA 4MRRA 2QIOA 3RU3A 5MHTA 2OZPA 4LHXA 3O4RA 3VVCA 3VU0A 1ENYA 4LDAA 1B0ZA 4ZJPA 6ABPA 1H5UA 4HZUA 1VMAA 1DP4A 2C3OA 3PUYA 3KQMA 1J20A 2FWAA 1C8VB 3HBJA 3VO8A 4CMAA 4HQOA 3ZIUA 3JALB 2PVCA 1J0XO 3W3AD 3SXUA 3HK2A 1RC1A 1RYYA 3ZDRA 2N1MA 4D42A 4DYDA 3JW8A 2H11A 4K9PA 4RWEA 1WB5A 1V8ZA 1YONA 5IJ9A 3TOZA 3BMNB 3QEOA 1KEVA 2W2VA 1IZ8A 2M98A 1YR1A 3NZEA 1DX4A 1Z2NX 4OA5A 4TZKA 5FP0A 5BV1A 1Z5PA 3K4QA 4CLRA 1RXUA 1YNSA 4L72A 5AHXA 3WRWA 3FGNA 1NVAA 1Z2EA 1B43A 2C9DA 1M2HA 2VYND 3F4LA 3JWGA 5LIRA 5KX5F 1E3LA 1R9NA 3RSFA 1P6UA 4NU8X 2FTKE 2J3KA 2NUPA 5C80A 1W36D 3CURA 4OIFA 5CGQB 3EF0A 1IU9A 1IWPB 2MSLA 4QU9A 3RJ9A 3ZGNA 4B6GA 1SK8A 4XX0A 3F5MA 2UUOA 3M7IA 1Q1ZA 3K4PA 1X80A 2WI8A 4CBVA 4FQ5A 4LJKA 1UQTA 4YP9A 1GZDA 2WWTA 2XJ9A 2RH9B 3G2NA 5JAOA 1V7QA 1EDEA 3CLTD 1AH2A 3N3BC 5C5IA 2VHEA 4MYRA 2HLNA 1SC1A 1DHRA 4YNBA 3UYKA 1SKYB 1HTWA 2IFTA 2VDWB 1T8UA 4DXAA 1U3DA 4PFJA 2YC2C 3L1JA 1SQGA 2BISA 4IZHA 2R9VA 2IUSA 1FRQA 1UOPA 3SZOA 4NZZA 4GRIA 4G4SO 1GEEA 2YMPA 4HNAB 4R7ZA 3VSEA 2FW1A 2QMEA 2ZAOA 1MOPA 4WXEA 1KEPA 3K1YA 5CYOA 3AOEA 1SBQA 2HADA 3NT5A 5TARA 3WIUA 2BSAA 1IY1A 1VPTA 2A5YB 1TK3A 4RV9A 4XZ3A 5AI4A 1Z2CA 3B1FA 3T5TA 2R6R1 1E2BA 1N6IA 2W43A 3VR6A 4GW3A 1OWLA 1XZJA 3B1XA 4I0WB 4KQIA 4LWQA 4NECA 4LRXA 1I3CA 5FOVA 4BQOA 3UJ9A 2AEJA 4MUMA 2VNSA 3NOQA 5A7FA 1UKEA 1Y6JA 3R3HA 4G5YA 1ISMA 5DHRA 2I76A 3IE1A 3SBEA 3B20A 3TINA 3H9GA 1OI7A 1F6DA 3BH0A 3OTQA 1W8IA 2CLFB 2QM8A 2IOHA 4XFKA 3X44A 1N6PA 1U0NA 2DY0A 1XLTA 2JLSA 3FFXA 1ULUA 1WVGA 2YYSA 2ZZKA 4LOHA 1PFQA 1K0UA 3RSHA 5K3OA 2J9GA 3WBBA 4FCVA 2GMWA 3AVYA 3KLNA 4BVBA 1GNLA 2VKTA 1KJWA 2ZJ8A 3SKVA 1DWOA 1RFGE 2DHRA 3KKEA 3PUWA 5E0KB 3L84A 5J2TA 2FMUA 1R3DA 3LECA 1KKMA 2YQ4A 3OZ7A 4ITUA 4K6OA 2FG7C 2IV7A 3RUFA 1T8WA 2HWYA 5ALWA 4RVGA 4B3RB 3JQPA 1N9GB 1HOXA 1BRTA 5AKIA 1RQNA 3H8JA 4HAVA 2GZ1A 1Z7EA 1BQ3A 4B71A 1HNZB 3VI4B 4MVJG 3BOSA 2D5CA 4TN1A 1AKWA 1E6KA 2DBRA 4BS9A 4NCAA 3VDQA 1ZK0A 2VL7A 2J6IA 2BZ0A 2L0XA 3VPCA 4RHXA 3UHFA 5ALIA 1AS2A 4DV4B 4LQCA 3X1MA 2XUAA 4PYKA 1QCDA 2X2EA 1RWWA 1E7SA 2F1JA 4Z3OA 1YUMA 4DNXA 2V7PA 1Y48E 5FIUA 4X8LA 1ZMBA 3SC3A 3UCFA 1EP3B 3VZRA 1LDBA 5GJBA 3TLGA 2IUUA 1CQJB 1CWUA 4GKJB 4P4UA 4UCFA 5EJIA 3SX0A 3AKYA 2C2YA 1HEYA 1UJ2A 3JRXA 1GD1O 4OB6A 4KE6A 5JCOA 4L0MA 5JRJA 3DOEA 3CINA 4QRIA 1UBHS 3NETA 2WJPA 1JFVA 4R4JA 3U31A 2EJTA 4ROTA 3RJMA 5KYYA 1CUJA 2ZRMA 3BG5A 5FOWA 4JBXA 3TAUA 2WOOA 4M60A 4RGQA 2IHJA 5DULA 4FMDB 1HRKA 1KZGB 1V4NA 3GAAA 4J4BA 2C0QA 2O8VA 4IJVA 1IN5A 1SHTX 1T1JA 3EPRA 4H35A 4YO8A 2WD9A 5JNVA 2O8CA 3EB9A 3HL0A 1CS4C 1T43A 5CT6A 1BGWA 2QRHA 4R68A 5K01A 1D5WA 3LK7A 3O4FA 1KYQA 4L9SA 5CA0B 5KKCA 2PSSA 4B2IA 2FN3A 4KEAA 4LJ5A 1LVUA 4ZEVA 3U7FB 2BGIA 3GNLA 2MINB 1WMDA 2P3OA 1K7XB 1RADA 1FQJA 4FFOA 2YXDA 1YBAA 4C4OA 1YK1A 3G6KA 3VHQA 2ZANA 3RRZA 3WJAA 4S1TA 2E6KA 2O50A 4ZOEA 1PIWA 2AFIE 1AZTA 3BXPA 3QZUA 4DW8A 3ANSA 2R8ZA 3H3JA 4NBKA 5K0NA 1USKA 3ZHVA 3K8OE 1J0DA 3LCUA 3LCVB 4K81B 3WGYA 1AQJA 2O7VA 3PFIA 1GUZA 5T41A 2HA7A 4G8DA 4ZHSA 3FOZA 1PHPA 3ST7A 1KVSA 1J7JA 1Q0PA 2W6IA 3G89A 3GFTA 5A9TA 1VIVA 4TUYF 4AF8A 3A14A 4REMA 4M7WA 5AM0A 1JJBA 1EPUA 4KTVE 3THXB 1SB9A 2GPAA 3S5UA 1I1HA 4YUWA 1OZHA 2YZGA 4NPHA 1A7AA 4I6GA 2AWNA 3GI1A 621PA 1VL2A 2X5KO 5AKGA 2PUTA 3WK4A 2JC3A 2JGNA 1JDNA 5AK0A 2QY9A 4EAAA 2VSYA 1YMQA 4UDOA 4MS4A 3UOAB 5K8UA 1Z25A 2DLCX 3V4PB 5H4GA 1ZD9A 3MB8A 3Q11A 1XKLA 2PFKA 2QIPA 2OLKA 1Z06A 1RE0A 3MUNA 4MA0A 4EHLA 4PHGA 3NKVA 2TS1A 3I30X 1XCOA 2QN9A 3IYLW 3RF6A 4BVHA 2Q2NA 3HCOA 5TS3A 5TPWB 3JWJA 1NP7A 4M49A 4OQYA 4PIPA 3TSCA 3SI7A 1JQ3A 2H9AA 2J3JA 5D84A 4F3NA 4PONA 3DDWA 3KZXA 2GEKA 3T34A 1JE0A 5HTKA 4Y2VA 5JJCA 5CYFA 3P5BA 4HS9A 2PL3A 1ADFA 2KX7A 3MTJA 1PD0A 4CODB 3RLFA 4UDXX 1QFXA 721PA 1HZJA 1T3HA 1Z68A 3VO1A 3WK6A 2RK6A 1JEEA 5DHQA 4OHMA 5IANA 4KQGA 4Y3UA 4V2IA 1EJBA 3TGWA 4DQDA 1S2DA 4MPTA 4IQ4A 1DVRA 2M32A 4RLSA 2CBZA 1RSZA 1CCWA 1F3LA 1KNQA 1ML3A 2IDMA 4WJZA 5AVTA 1ZC4A 1VCOA 4HXFB 4NKRA 2Q9UA 5I8PA 3ED1A 1WXEA 5D7BA 2MSKA 3VPFA 4EGCB 3VMMA 2QWXA 1C29B 4FFSA 4R9UC 4WZ6A 3KR2A 3UJPA 3VR4D 1XZCA 2XE6A 2GAIA 3TI9A 3ZV6A 2WJGA 4QZVA 1E92A 3HKDB 1RMYA 1LDYA 3ODPA 2A78A 1YUBA 2LBPA 3CMCO 4HRAA 4DSNA 4G07A 4F11A 2NXWA 4P35A 1NYLA 1MJ5A 3Q6NA 3B7PA 2UUAB 2D2VA 1UT8A 1DWQA 4YJFB 2JLWA 1U02A 4JZKA 4AJ1A 5IWCA 1QGOA 1WZNA 3OIDA 1XLTC 3C43A 4K86A 3LDUA 4FFDA 4MWTA 5HE9A 4DR5B 3ICVA 2CLDX 4P58A 1R0SA 4RLQA 2PXXA 1W1WA 5JO0A 1WZCA 1U80A 2LPMA 3NC4A 4WXYB 4LX8A 4KYIB 3RUEA 3D81A 4TYQA 3CH7A 4PICA 1TM1E 3BFPA 4G81A 5DTMA 4JFRA 4CEHA 4KIUA 3ZWPA 3G1UA 1A1SA 2O59A 3DF7A 4PW0A 3I23A 2QY6A 1O6BA 3LUHA 2NVUA 2B20A 3RROA 4JI8B 3MUFA 3UOWA 2QT0A 1ZM3A 1LI4A 2VAWA 2QP9X 1NM5A 1VP9A 2IZ7A 2V3WA 1Y33E 2VXCA 5I9SA 1MXHA 2IF2A 1ONSA 3F49S 4HNGA 3A31A 3PJEA 4V03A 1A69A 2ZWMA 3V80A 3JARB 4GWGA 5B36A 1DG9A 1XZMA 1GPAA 1C1HA 4MV0A 2FK8A 1Q6ZA 2C9BA 2MTBA 5F23A 4WFJA 1C9DB 5T4EA 5SZHB 3V1MA 1EJ6A 3C97A 3QFHA 1QRUA 1J56A 2QNRA 3OOJA 4GZ3A 5F2EA 3LT4A 2CZQA 3IEIA 3ONNA 1TTTA 4DR4B 1G6OA 2CWWA 1CR1A 1BD3A 2VRCA 4CKWA 1K86A 3NM5A 3VPBA 3TDMA 1FMLA 1EFHA</