4KXQA

Structure of nad-dependent protein deacetylase sirtuin-1 (closed state, 1.85 a)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
HMRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-1
publication title Structural and Functional Analysis of Human SIRT1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4kxqA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kxqA01
2OD9A 2W93A 4UUBA 3FSJX 1Q14A 4UTNA 5MF6A 1ICIA 3U31A 4V1CI 2PGOA 2JIBA 4BUZA 3OE1A 2H2HA 4GP9A 4J1TC 1MA3A 1YC2A 1DJLA 4TWIA 1PVDA 3D7KA 5MFZA 3F6EX 1MCZA 3FZNA 4IF6A 5EJ8A 1M2KA 2EZTA 1Q17A 2BRUC 1UPCA 2OD2A 1SZDA 2EZ4A 4K9NA 5FYQA 1E3TA 4Y6OA 2PANA 5D7NA 4RMGA 1HZZC 2AG1A 2JLAA 1ZPDA 4Y6QA 4TWJA 1YNOA 2EZ9A 2OD7A 3IAFA 1S5PA 4I5IA 4JUFA 4C7BA 2FR8C 2B4YA 1Y9DA 3ZGVA 2Q28A 3FLMA 4JU9A 4JUAA 4QELA 4IG9A 5BWLA 2JI7A 4UU8A 4O8ZA 4JUDX 5K2OA 4FVTA 2Q27A 4BVFA 1M2HA 4HD8A 2VBFA 4BV2A 3ZG6A 1T9BA 1M2JA 4ZZIA 2Q5JA 2VK1A 1U28C 4FEEA 5MFPA 1YHZA 2VK4A 5EJ4A 3ZGOA 4KXQA 4IAOA 3GLTA 2FN3A 2NXWA 1POXA 4COKA 1PO7A 4D5EA 5EJMA 1U2DC 3F6BX 3CLUD 5BWOA 2C31A 4F56A 3GLRA 1PTJC 4MZXA 2H2GA 4Y6LA 4D5GA 1PT9A 5K6RA 1N0HA 4X3PA 5IMSA 2Q5QA 2Q29A 4BVHA 1Q6ZA 2H4FA 2IHVA 1QPBA 4V1CB 2PGNA 4BVBA 4MPRA 4GM1A 4G1CA 3PKIA 1PNOA 4Q9DA 4K9KA 4BN4A 3IAEA 2A1UA 1O96B 2H59A 4L3OA 1EFPA 5BWNA 5K6TA 4QPZA 2JI8A 2JI9A 4BV3A 2WVAA 4K9QA 4MPJA 4FEGA 4FZ3A 1T9CA 1EFVA 2NYRA 1JSCA 1YI1A 4JD5A 4K9PA 1YTLA 2H2FA 5MGNA 1OZFA 1Q1AA 3D81A 1U31A 3D4BA 1T9DA 3PKJA 4KPUA 4UTZA 4GPEA 3CF4G 4R8MA 1YI0A 5EJ9A 1SZCA 4JT9A 4ZP1A 4K9LA 4GM0A 4J16C 2QQFA 4JUBA 4HDAA 4F4UA 4RMHA 1YBHA 4KGDA 2UZ1B 2VK8A 5DGTA 2A1TR 1S7GA 1U2GC 2VJYA 4K9MA 2H4HA 3EA4A 4RMJA 3HWWA 2QQGA 2EZUA 1OZHA 5DGDA 4L2IA 3RIGA 1M2GA 1UPAA 4UU7A 3E9YA 2FWNA 4V1CA 3JWPA 5FEMA 1V5EA 1YHYA 4BN5A 4BVGA 2JLCA 3CLRD 4JSRA 1T9AA 2H2IA 1M2NA 4JUCA 5EJAA 2AG0A 4QQ8A 3CLSD 3U3DA 1POWA 3GLSA 4JT8A 4X3OA 1NM5C 5EJ7A 1BFDA 4MQ5A 3LQ1A 3K35A 2WVHA 4C78A 3PDHA 2VBIA 4MPPA 1XLTC 4JU8A 2OO5C 3RIYA 4RJIA 2JI6A 2V3WA 5AHKA 2IHTA 1PI3A 5EJ5A 1PNQA 2OORC 1D4OA 4GM4A 1OVMA 2H2DA 3JR3A 1V5FA 5DEIA 4UTVA 2UZ1A 3EYAA 4GG1A 2DJIA 2FSVC 3EY9A 5EJ6A 1OZGA 4K9OA 5K3SA 2VBGA 1V5GA 3HWX1 1UPBA 1Z8NA 2Q5LA 2H4JA 1PYDA 2WVGA 3CLTD 3GLUA 1YC5A 4RJKA 4UTRA 2HJHA 4RMIA 1O97D 4RJJA 2FRDC 2EZ8A 2Q5OA 4BVEA 4UUAA 2X7JA 2IHUA 4UTXA 1J8FA
chains in the Genus database with same CATH superfamily
2EKPA 4U2DA 2GYUA 1G8YA 3AFOA 3CNQS 1G8GA 2P9EA 9ABPA 4NXMB 2CF6A 4FZJA 4TLLB 5HKLA 4Q3CA 3VPSA 2RGNA 1H66A 2CLOB 3D7NA 2MYTA 1FNNA 1E59A 1PT6A 3RK0A 4EGCB 3AZOA 1OFHA 2P6OA 1DQYA 3C43A 3T15A 4RCVA 1X7GA 2Q0QA 4I08A 3FWPA 3WOVA 2VHZA 4JLWA 4CWAA 2OLKA 3A8TA 1CEYA 2ZSUA 4BFSA 2Q2OA 1G3MA 2Q50A 3P96A 4JVMA 2HDHA 4ZCQA 4NZYA 1P4SA 2VA9A 3FNEA 3GWZA 4WTOA 4KREA 3QP9A 3URMA 3HB9A 4NYJR 1D0VA 1QO7A 1USGA 1RRVA 2F7SA 1O97C 3UJ3X 1FQOA 3CNNA 3FI0A 1OXMA 2Y4NA 5AK0A 3UM9A 3E9RA 2OCDA 1TAGA 4KN6A 3NNDA 1TUGA 1E2LA 3RANA 2Y67A 1R2QA 4DA6A 5DTJA 5JWRA 1TZCA 4HS9A 3VV2A 1NZJA 1P72A 2BEWB 2Y66A 4MQMA 2O0LA 3RSCA 4PC3A 1IM8A 3SS8A 2P9TA 1E63A 1GRQA 5KNDA 1W1WA 4KSYA 4QG7A 4NCAA 3EDYA 4CLOB 1SZDA 2CV2A 4AO8A 1XCMA 2LIPA 1A27A 3C87A 2I2AA 5E3HA 1Y1QA 3NOQA 2PU7A 3MQ2A 3OIFA 1RRGA 1XTPA 5A3QA 2PSSA 3G3EA 1W94A 4JJKA 2P9HA 1C3VA 4OP3A 4DCTA 5LJLA 2NVOA 5KPJA 2UUCB 3OPXA 2J3LA 2EJCA 3DCIA 4FHCA 3WYCA 4DMGA 1XZFA 2P1DA 5FWXB 2EW8A 3RC2A 4O8CA 1O5OA 4O3FA 1CQIB 2R8YA 3DE6X 2B2XA 4N4AA 1AKUA 3EVZA 5CH3A 4A0RA 4ES6A 3R5TA 1KJIA 1ZO8A 3EIHA 3GEBA 4RPKA 5KJEA 1UDWA 4WY2A 4NDZA 1XZDA 2WIBA 2GBPA 4ZC8A 4DSTA 1JEJA 3AB3A 3OJWA 3C7TA 4OVKA 2G5PA 5EZQA 4CL3A 1ADYA 5TQ0B 2Q6LA 4I4TB 4KEAA 4ND8A 1WZEA 4ZICA 1QG2A 3TRDA 1RQNA 2CFTA 3B2QA 3GD7A 5L6MB 3UGKA 4A4DA 1WRBA 5FUYA 1HMYA 2B82A 5IBRA 1EZ4A 3GLFE 4RABA 4U7TB 1ZOIA 1W2HA 3C8HA 3L9XA 3SAJA 3OCXA 1P4JA 1XD8A 5AI0A 4TSFA 1G9XA 3KAQA 4YMSA 2YS6A 3B36A 3DLHA 1FFCA 5AJHA 1TM1E 5IUNC 2IF0A 2BI7A 4RVGA 3K71B 4Y98A 3HDTA 1CEXA 1XU7A 2GBLC 2X15A 2AW5A 3BICA 3DAYA 1E2FA 4L5BA 4JK3A 4PBRA 5KZMB 4PYIA 1F14A 3WJ2A 1P3Y1 1UBEA 3BHMA 3EXIA 4JB0A 3G2PA 1WPGA 1Y4SA 1DKNA 1I4EB 1QMPA 3V2GA 2JA2A 3LOPA 1VLQA 2HL6A 3DS8A 3PICA 4HR7A 4ZPJA 1ZGHA 3UMYA 2PV0A 3BMCB 7YASA 4EI8A 2VI5A 2H1OA 2O50A 1ZUIA 3SZMA 1XNQB 4IZIA 1Z8DA 1NW5A 1Y1TA 4W4TA 4LXIA 5AVJA 3DTYA 5H9VA 3FZQA 4PC2A 2OGUA 4S0ZA 3VC3A 2O8BB 2RGEA 2ZYWX 3NIDB 4HN9A 3G79A 1YB7A 1Q0TA 3QF4B 4PGAA 1CFJA 4BVFA 2VLIA 4DC1A 2EW1A 4OQZA 1RBYA 4FHZA 4HPXB 1O8BA 4DIOA 2WAAA 1GKIA 3VOSA 5CLHA 1XROA 4HQOA 4MX8A 1XU4A 3LDHA 2YY6A 4L5JA 2W22A 1NUQA 1JHPA 1XEWY 2TECE 3D6JA 1E6CA 2D59A 2GN0A 3I6ZA 4MWGA 1N4AA 4CV0A 4ZI5A 2V6MA 2WR8A 1NBIA 3D4IA 4RX1A 4XVRA 5H1YA 2AXQA 2W2MA 4ZRNA 1ZBQA 3ZU6A 2F1KA 2B4KA 4CLEA 1J0AA 3O0TA 4O3MA 3LIIA 4IFBA 4FYMA 4LFBB 4Z3OA 2W6IA 4M7WA 5CEFA 1A2QA 5P8WA 1Y7TA 3D8UA 3PITA 3NTRA 2EF0A 3O92A 4PQRA 2OAQ1 2BEWA 2MMGA 1VGVA 1HKUA 5EEGA 1GNTA 2YJNA 1KTIA 5A9SB 3MILA 4KU4A 3GUYA 1MIHA 3DV0B 4DS3A 4CLOA 1W9MA 4G89A 1V4BA 3H1TA 4I3FA 3LY8A 1E0JA 2H48A 4H7IA 3TZ6A 1BU8A 4YJFB 4Q7QA 3TNJA 5A03A 1OF1A 1RWMA 3A6EA 1W4ZA 3WSVA 1IU9A 3WDKA 1G42A 2BPOA 1XG5A 2JGAA 2Q3DA 2FU5C 1CWUA 5FWXA 1JFLA 4QUGA 2G06A 1A2OA 1UADA 2JFNA 3M82A 4NFYA 4D5GA 2WD7B 1PEAA 3G2OA 1CQIA 4XLTA 4MVJF 4AP6A 5IMSA 3F78A 4A2WA 5CUQA 1NF8A 2Q29A 3E27A 2ZVDA 1SH7A 3CO5A 4UXHA 2VR1A 2J09A 4Q1BA 1GD1O 1KTVA 3BA6A 3QBJA 5HUQA 4BJ3A 2EX4A 2CVHA 1GQOA 1SKQA 4HDRB 1N0UA 3M4JA 4YRGA 1GNRA 1XQ6A 3NGXA 4ENTA 1ZQ9A 3D0QA 5IVDA 5TQ0A 3CY6A 3RGGA 4P92A 4I4TA 2UUPA 1UZNA 3QPCA 2EKBA 3ODGA 4D0NA 2TS1A 5D5PA 5FUXA 1UXHA 4E6PA 1WSDA 1XCBA 1J2UA 4I99A 2DE0X 2AKYA 1RXYA 2C5FA 2PAFA 3U9TA 5BO5A 1Z5GA 3R9KA 1K3UB 3I72A 1XXLA 2G07A 2YHIB 4BVJA 1KQNA 3GP5A 1WQ3A 2AEMA 4BKRA 5C8YB 5LOVA 4PLCA 1E62A 3KOWA 2FPLA 5AM4A 3S2IA 1IWPB 3CCCA 4DVJA 4CEHB 4GBGA 3HCNA 3IESA 5CYPA 4HH4A 5H02A 2QYSA 2VWGA 2ZVJA 1TMGE 1XU9A 3D2CA 1K8RA 3ONNA 2BWJA 4MPJA 3ZQUA 5HOEA 3GCXA 3IFSA 1H94A 1R9MA 5CPFA 2LVBA 5AXCA 3HVUA 2V6BA 5IJ0A 3UOAB 4P32A 2C3YA 2D06A 2G71A 3EXHC 3TG8A 3BMCA 5GJBA 3H4MA 1FBTA 5EJFA 3B1WA 3HPRA 1EZZA 2HGSA 4IUCS 1PFKA 4WT7A 4J75A 2ANCA 3VX3A 4AY6A 2X2PA 3ZCXA 4H1HA 1U3TA 4NBUA 1C81A 3FPFA 1X7WB 3GRYA 4EO4A 7GPBA 4XASA 4ETWA 3I6MA 4I1SA 2XUZA 2IQ5A 2JAPA 2VT2A 2R79A 3KT3A 2VZ0A 3QF4A 4L1KA 4UFNA 3HO6A 1IB0A 4L6AA 4GKVA 5BSFA 2VHJA 4G0YA 3D4BA 2B7LA 3FCSB 1JPNA 3H9EO 4L0QA 5DYIA 4YT5A 3K3PA 1T2EA 3SZUA 4LF5B 1QIFA 3RVLA 3GX1A 3N53A 2AXEA 4PQGA 1CR0A 2ID9A 3CF4G 2IYRA 3CLHA 3VPGA 4B4VA 4B7UA 2QUIA 3GRAA 1R9JA 3HGQA 5GV7A 4OI1A 3FOBA 1U0RA 3KALA 5C7OO 1BCSB 1YI0A 4JX9A 2Q8QA 3AP1A 1IPFA 4BEBA 9ATCA 4MS1B 3BRCA 1KF0A 2B0CA 4NONA 5LA6F 2QL7A 2XTNA 4UEKA 1CRQA 3PLRA 4PWYA 5I7EA 2HU8A 3HVIA 4YB8A 2JAUA 2J45A 3L0BA 3QI7A 4J29A 2A9QA 1J9ZA 1MLDA 4C0HA 5IZ4A 3Q4GA 1ZSYA 2WG1A 2ZTVA 3E7XA 3ZIDA 3WAJA 3TB6A 1RXCA 3PWTA 1ZJ4A 2A86A 3BL6A 4JT4A 5A9SA 2Z4RA 1WW8A 2J08A 3PZBA 1XE3A 3DV0A 1W5EA 2X2FA 3NBQA 3A1WA 3MGBA 2A0UA 1J70A 4R8LA 3P4YA 1FSZA 2E4WA 2ZUVA 5FQOA 3HWWA 1LI5A 4B31A 2V5UA 2DPHA 5LQDA 2X77A 5A1JA 5HZMA 2X4LA 3A9WA 5MN4A 4HDKB 1W73A 4UU1A 5CT8A 4GD3Q 1QP8A 1OZHA 4GF5A 4Y1GA 1VRWA 3T4UA 4QODA 4AIIA 2BM8A 1M2GA 2PK3A 1R0RE 1WDWB 3VUEA 2PKXA 4MZDA 4Q24A 1IB6A 1EWKA 1V3TA 5LBTA 2LNDA 3KYDB 2A9KA 2H3EA 3VU8A 5HF5A 1KMQA 1LZLA 4KSBA 1WMFA 1NE2A 4A8HA 4ALLA 2I4RA 4IIYA 3R8CA 1IRIA 4B47A 4BFYA 4FQ5A 3VC1A 4HDRA 1CJMA 1PWZA 3GU3A 3K9HA 1P91A 1P3JA 1BDIA 5JPCA 2C7VA 3SC4A 4YJ3B 4GZ3A 1B73A 1YHYA 5K0BA 2PR7A 2CXUA 4LTNA 3PX7A 3U3XA 2ZR8A 3ZHSA 2OCLA 5AWFC 3EGXB 1T8SA 1UKYA 1KVTA 4YGXB 5IS2A 1SCNE 2XYVA 2Z6AA 2A1TS 2ODWA 4QYTA 2YHIA 2OHOA 3H8JA 4IIFA 5KMGB 1YWGO 3SXUB 2PSDA 2O8VA 5F33A 2Q3FA 4ZDKA 5C8YA 1AMUA 4MUIA 3AF1A 3RT9A 3V4SA 4W6ZA 3NTVA 3SK0A 1G5TA 1D9ZA 2I71A 3D6VA 3LVBA 3HR8A 2EQAA 4CEHA 1QYCA 4DA9A 2AIRA 4B6RA 2ZPTX 3EXHA 2O5RA 1GPKA 3C6MA 2JJ2D 5LIRA 4C1NA 3ZU5A 1DS6A 1OAOC 1ZH8A 2BEKA 4MB6A 5CYGA 3DZFA 4QRIA 2Y05A 3T5MA 1CSEE 4M86A 3VR0A 4BBAA 3IA2A 3OKPA 5DN6D 1XK6A 3BL5A 3CUKA 3TGPA 4IF4A 3CFYA 1X8XA 3VAZA 4EHNA 4LRTB 2YNMD 1Q20A 1XLTC 3E61A 3JVVA 1C7ZA 4JU8A 4RYLA 4U7DA 1WP4A 2G1JA 4KQFA 4TSKA 3LT1A 1X7WA 3LZCA 1GN9A 4A0HA 2Z8ZA 2BW0A 2MWMA 3RS7A 2OO5C 1IUKA 4O2RA 1UK8A 1WSBA 4U2GA 1U3VA 3Q3GE 3Q7TA 2AFHB 1VKJA 1U9IC 4AXXA 4JB8A 3L18A 1J56A 1GUFA 2Q9CA 1ENPA 3FRHA 4UHKA 4YCLA 3EWAA 1EWYA 3NW9A 2YX1A 3PFNA 5FIUA 5E7MA 1E6MA 1BCSA 1DAIA 1ZC4A 1N6PA 4MRPA 3E05A 3MGGA 3GUHA 1JLMA 2PGAA 4MS1A 3ISJA 3ZTWA 2R8XA 2H2DA 2XJ4A 3L6OO 2PGDA 5EQDA 5K0NA 2PTGA 5FTJA 3UT0A 2GKOA 3K0FB 5F2OA 1D7AA 3M4NA 4UBNA 1Y63A 3S28A 1Y3FE 5FV4A 1TO6A 2W6NA 3OZAA 4XM0A 3PUJA 1XSEA 2VP3A 3MMXA 3L82B 3TB4A 1I3NA 1ETHA 5JCPA 3S2GA 2Y0DA 3D8TA 4KIFA 4BTLA 1HZJA 4JN6B 5IBPA 2HHJA 3SSOA 1KK0A 1RPZA 4ZYXA 3ZNQA 3E3AA 1T2UA 2QLLA 4O29A 1O6ZA 4DV3B 3T41A 2O5VA 3FLBA 4MUEA 2GD6A 1P17A 4PO8A 5FTMA 5SICE 1SGWA 2RC6A 3JCZA 3DZGA 4HPJB 4HDKA 1N6RA 4IUYA 2BAGA 4WIAA 4B3SB 2G25A 5D3MA 4BX2A 5MN6A 4JLJA 3S2YA 3U62A 3FSGD 3N1UA 3WK5A 3ZWOA 1OE0A 4AF7A 5HUHA 1CUJA 2XOKD 3B3JA 4C0SA 2CLKB 3AZPA 4GGMX 1OV4A 3KYDA 3C3EA 3VKUA 4US1R 1QZUA 1KR2A 2BFNA 2GYYA 5F2KA 5TMBA 4HCJA 2OBMA 2VNJA 1TUEA 3ZXIA 3SIRA 3LFHA 5LVAA 4ZVKA 3ES9A 1E2PA 3P0EA 4L8FA 4MKFA 3A3YA 1MU0A 2BM1A 2NIPA 2WIGA 3QFHA 2HPAA 4YJ3A 2BN4A 4OXNA 2KQUA 2W6CX 3V8EA 2X40A 2BGWA 4JP5A 1QFYA 2WV7A 3WLAA 4ND5A 2JJYA 2CHUA 3O9VA 3EGXA 4HLQB 1WWKA 3DPIA 2BP7B 4BNVA 4YX9A 2AOXA 2PDAA 1A98A 5I7FA 5KMGA 2ZR7A 3LF1A 1M5TA 4DBVO 4UOZA 2PX6A 5AM0A 1TEZA 1UC8A 4PPNA 3OOYA 4EYSA 3CB2A 2X7JA 4GGOA 2ADOA 3FXAA 4F3RA 2IZ7A 2HYIC 1LPOA 3EDMA 3GIWA 8MHTA 1XLTA 1MGOA 1IWOA 4RGYA 1UH5A 1A1VA 1J8FA 1F2UB 2O6LA 4A92A 3U56A 3AKEA 1U7PA 4IHJB 4L02A 4RM3A 4ZAZA 3TNYA 5BYKA 2V98A 3HJTA 3KIPA 3IQFA 4IOLA 3AJ9A 3DL0A 1M34B 1CZKA 1OWMA 3KC2A 4CBVA 4L6CA 4JYAB 2VC2B 1FDSA 1QR2A 3NOXA 1N6LA 1U9IA 1F4VA 1XNJA 1YGPA 3ND9A 3CLTC 1Z34A 4KN9S 3SN6A 3R9XB 1QG6A 4MQEB 1XRPA 2XMZA 4U5QA 3DGFC 3ZNOA 3ZCUA 1RE0A 2ZRIA 1U6KA 1YQUA 3MTDA 1CUEA 5BSUA 2DLCX 3LZ6A 1YK1A 1JX6A 2J5BA 2R47A 2EFDB 3LY7A 3M9WA 3R0QA 4P4NA 1H6AA 2AFHA 4NX2A 4TWIA 1R0ZA 1SC1A 3T5DA 4ZCIA 5HHTA 1I94B 2A5LA 4R98A 4NU5A 5KHLB 4KHPB 1PJBA 1JDJA 3DOUA 2EFJA 4WBXC 3VSCA 4XIIA 1T0JB 5HRCA 3DMPA 4W5NA 2DECA 3F5MA 1A4XA 4FYYA 3P5BA 1OZ0A 4HATA 1K88A 3S44A 4CIAA 3PFCA 4CM5A 5F98A 1FDTA 3L92A 4S35A 1W35A 2W48A 3ESZA 1G3UA 3STHA 2QMHA 2J33A 2OHIA 2HB6A 3IGFA 3LVQE 3K0FA 2I9KA 1A9YA 4PQYA 2IYTA 3TW8B 4OUDB 2BRUC 4LCJA 2E89A 4IKOA 3PGXA 1QH1B 4NHOA 5JWHA 1GV0A 3K9BA 2VXOA 3E53A 2EZ4A 4JA2A 2PBRA 1C7JA 2E49A 3N5KA 2WFLA 3ZZMA 4D9MA 3EISA 4URWR 1MMFB 1RC0A 1TGYA 3R6DA 4HB2A 1TMOA 3IQIX 4JQZA 5I9NA 2K6GA 4ESHA 1NQXA 4MVJH 1DC8A 1D1TA 2PXXA 2GPBA 1ZESA 4REMA 4NPHA 3UWDA 3CISA 4Y67A 2Q4EA 4KDCA 1VL2A 5F23A 1LV7A 3WQBA 4B6OA 1TK3A 3R7WB 2WWYA 1U04A 1VJRA 2FSSA 2VF5X 2QBYB 1NR7A 3ICCA 4X20B 4NL4H 4RMGA 1YFJA 3UJBA 2QUZA 1EB9A 2DFVA 3QPUA 1OTYA 1JHRA 4IV8A 3CE6A 1T9HA 1YQDA 3AF0A 1X0XA 3B3QA 3I2JA 2F2TA 4OIMA 4YAEA 3W6OA 3AC0A 3ICPA 1D2NA 2ZWIA 3WQHA 4YR7A 3Q8LA 1AKRA 3K1JA 5AOCA 4BRWA 3V2IA 4Y9RA 5JBIA 3WQRA 5JASA 3HLKA 3HJNA 3MIIA 1K66A 1UKAA 4KFUA 3U40A 2QTNA 4AF8A 3HXQA 3AU8A 2HK6A 2RHOA 3IAFA 4INZA 1BW9B 4RETA 5FA6A 4FW8A 4UULA 5CFZA 4KG7A 2FN8A 3CNLA 4L57A 1LPAB 2F3TA 2P0AA 1U9JA 2CVPA 4IIHA 1TUBB 3OIDA 3G8YA 3ZDZB 1KZGB 1QR6A 2AYYA 2BP7A 3CTPA 4JLMA 3ND5A 1JG4A 2RHWA 4OOFA 1A76A 3VR6A 1RYEA 4FYJA 2PKEA 4WADA 2XH8A 4UM7A 2H54A 2PFGA 4UUNA 1DG3A 1ZK3A 1AE1A 3MMZA 1GDDA 1PEDA 1QHYA 3ZWQA 2IIBA 4OSPA 4UAUA 1OHHA 1QGAA 1CR2A 1PV4A 4ITRC 5AKKA 4KPFC 1FRNA 3VI4B 4ZYWA 1ZWKA 3MAAC 3QJYA 4X8OA 4JJFA 3TGLA 2J4CA 3FMOB 4TTVA 4IG9A 5KJ1A 2OKCA 2HTEA 1Y5MA 2QW8A 4BNIA 2F1HA 4JHXA 1W1UA 2WNHA 2HYDA 4PTYA 4XDZA 4E4RA 5LQKA 2QTRA 2H08A 1HR0B 1EG7A 2RHRA 1CYEA 1F2UA 3C4QA 3A05A 4Y7DA 4IHJA 1YMQA 4TWZA 3LPLA 1NXQA 4RWEA 5AD1A 1P9OA 3WGKA 3DUFB 3QKUA 4RVCA 4QYSA 1WV0A 3EVDA 5DCLA 5JAZA 3O91A 4Z9YA 1H93A 2AOUA 4BNLA 1EM6A 2GZ3A 3BH7A 4KKVA 1LNQA 1UBRS 2VJPA 4O08A 4OLJA 2QTBA 1SG6A 4R9UC 5G3YA 5JT1A 4B2LA 3HU2A 3OHSX 3TZLA 4S1WA 2R84A 1NVWQ 1XMVA 3LLVA 3MAGA 4FDLA 2UZAA 3DZJA 2BFEB 2PV7A 4JI2B 3VSBA 3V4FA 3AINA 3NV9A 3V32A 4AQYB 4KWHA 4NOKA 5ILQA 3AIKA 5AMXA 4ZN6A 1QRDA 1TYDE 1E79A 1SNYA 3PEEA 3LXMA 1FPQA 2DSTA 1SU6A 1K08A 1Z4QA 2FVXA 2MCFA 4ZGWA 4RZSA 5AVOA 3VPBA 4DIEA 3GBPA 2BRUA 3S6JA 5IU6A 1E3DA 3RUDA 1HT3A 4W8OA 4AFNA 5IDWA 4RTMA 1P29A 3IXMA 3OWOA 1N92A 2C98A 3GF4A 3DE4X 3IKVA 4BMVA 3TIIA 2NXWA 4KWIA 2OYSA 3AUXA 4NBWA 3TW8A 1ZD5A 1K4MA 4OUDA 3V7WA 5J5VA 3VNVA 1QH1A 4ZC1A 5D3KA 1K8XB 2YHUA 3OSZA 1I3CA 1XDZA 3PEFA 3V8PA 1RPTA 2BZSA 1ISSA 3UWOA 3PHCA 3MBKA 1H23A 3EGIA 2RK6A 3ETHA 1HYQA 5LQCA 5BMVF 1YBVA 3GT0A 1D2CA 1OA0A 1W0CA 4DCGA 3HP7A 4L2IB 3RFVA 4BNZA 2FVYA 1XWIA 2BBOA 5K6RA 4W1PA 4K9SA 4PWZA 2XW6A 3R7WA 2V54A 1F9EA 4AKSA 2WTNA 2O1EA 4UEJA 2QBYA 2HSEA 4A16A 1I7LA 3ZWXA 4DC9A 2V7UA 4H9GA 1ZQ1A 2NPOA 2H4FA 2I8LA 4WFIA 3G2MA 3OPNA 1D6SA 2HEGA 3OQJA 3HDGA 2IWHA 2PUBA 4Z4IA 3V00A 4RTLA 1KJJA 2C92A 2PGJA 3RIHA 4MP6A 4QREA 4WUTA 5GTDA 1RQ2A 3DAGA 4W1RA 1PBTA 5KYUA 1QTRA 3A6FA 1K6EA 3IRUA 4GM1A 3ROEA 1C9EA 2GKGA 4DIUA 5I7RA 2G0AA 1JE1A 4LHWA 1WW3A 4UBOA 4LJYA 4X84A 4C22A 4Z3KA 4X6YA 4K9KA 1Z25A 4O1HA 3W3AD 2HSJA 3SEZA 1Q83A 3KU1A 4G67A 4CN9A 4N01A 1KC1A 1OV6A 2I8CA 5KJCA 1X8LA 2VLBA 1T9ZA 1NURA 1TUBA 1MO5A 1T0HB 4E5DA 5JJKA 3ZHVA 2V9PA 2H59A 2MOKA 4U9HS 4JXJA 1PZNA 1VCNA 3GRFA 5JQGA 5TEVA 2FSFA 2HK8A 3EUFA 2N46A 3VYUB 1C4KA 2XBMA 3I1IA 1HL3A 1RS0A 3IIIA 3A37A 1C7FA 3HUEA 1QGED 4AMBA 4UDXX 5B58C 4JC0A 3E7PA 4CTKA 2PRJA 3SOZA 5G0WA 5M29A 3HC7A 2QF7A 2FJ0A 4EAQA 3GJ5A 1E3MA 1KFEB 2J7PD 3GR6A 4KI0A 4ALKA 5LXTB 3L7LA 4HNQA 1KH2A 2COKA 5EIHA 4EA7A 3IKTA 3VTFA 3CZAA 1DO2A 2NZWA 2QVBA 3Q9NA 2GDJA 2RHHA 3R9WA 2FEAA 4KPYA 4LBWA 5K9ZA 3A4LA 4AD8A 1T3TA 2WQ6A 3OLZA 3PF9A 1WU8A 1TYCA 1GFIA 1ZNQO 3TZBA 1P1HA 3E35A 1NDHA 3VR4A 4P08A 1FF9A 1HT0A 2FUG6 4GDMA 1A8HA 4GKJB 1ULZA 1JH8A 4YAUA 1JUDA 2BFEA 3JYPA 4XQGA 3WYBA 1X1EA 1CJVC 1KETA 1GR0A 1SZCA 3UJHA 1TA4A 1RRKA 2CUZA 2RI6A 3OD1A 4JENA 3AEZA 3HSKA 4IS2A 4LOIA 4RADA 3GRPA 4N65A 2O9JA 2OAGA 1L1QA 2Q2QA 3LFTA 3SVTA 3AHIA 3AP3A 4G9GA 5SZKB 2A9JA 2LPMA 5B1SA 4CF7A 2Z5LA 5HW0A 4F4UA 4BNDA 4D4MA 1YBHA 1RCFA 2ZI3A 2FOLA 3MTEA 3IELA 1K4YA 1HDEA 4L3WA 5DTRA 3RREA 4TTSA 1JTFA 3BVPA 4LC1A 5COQA 1HDCA 5LQMA 1Y89A 1Q21A 2IE0A 1ABBA 4K26A 5FB3A 3NH9A 3NWJA 4LDRA 4P22A 1TLLA 2G72A 2NUTB 3SDBA 4PTZA 2J85A 4E08A 2IYXA 3THWB 1S2IA 1UKCA 3OJLA 4MYHA 3G17A 4Z0PA 1CLEA 1GCUA 2KHZA 4ZOLB 4B1FA 3FWZA 5IKMA 3TDNA 3O1LA 4DCMA 4KN8A 1TC1A 1GZ5A 1R4ZA 3QU4A 1IXYA 2PSJA 3VVMA 5A04A 2EJVA 1FS4A 1N8KA 2R751 1EX1A 4L2IA 5AKJA 1JKXA 4WH0A 5KOHB 4B9AA 2WF8A 3BRWD 2AJBA 3K5WA 4NCHA 4JBIA 4NMWA 1SWVA 3NIFB 5F12A 3BWYA 3UK1A 4C07A 2P30A 2ZGVA 3OFND 2AI1A 3AVQA 3QUTA 4RIFA 3FUUA 1P2TA 2P9BA 5LA6B 2FWNA 2HMUA 2QP4A 3MYRA 1SCKA 3SM9A 4WASA 2Q1UA 1NUAA 2REQB 5J2UB 1FMTA 1Z5PA 2VJKA 2VHEA 2GD0A 3WO0A 4EI9A 2FWBA 3F47A 1LGYA 2BLNA 5I9SA 5BQ3A 1TVKB 3EUEA 2YJ4A 4C05A 3KWFA 1HDXA 3TD2A 3CLRD 3ELYA 3SE7A 3OT4A 4MV7A 1A9PA 3FFWA 4AB1A 1A96A 3EGCA 4Q3BA 5C3UA 2FSGA 4EOGA 1KQFA 2OBNA 5D2CA 1QKKA 1UOOA 1YL6A 1YUBA 5EJAA 5CA1B 1EP9A 4TMZA 3MJSA 2R7NA 2VK2A 4TLMB 2CUTA 4ZEVA 2WHQA 3PX3A 4B44A 1NZDA 3FHJA 2X0NA 1IZ9A 1Q74A 3CTMA 3GVXA 4FNGA 1POWA 2BZ0A 4HH1A 3H17A 5FBQB 5A9RA 4JT8A 1ENYA 5EP3A 1T0BA 2C83A 1JFFB 5L53A 1F8UA 2XAUA 3C5WP 2I66A 4GH5A 4UREA 1YMVA 4Z53A 2J3DA 5DHAA 5LZ2A 2Z9CA 2WVHA 4DEXA 1W19A 4WESB 2BFOA 2FQWA 2ZTLA 4EENA 3QBTA 5IH7A 3Q8XB 1L4KA 2X4DA 5BWMA 2J9GA 3RT1A 5A5VA 1E3IA 3E9CA 1GG8A 1AN9A 1WKCA 4OSOA 4U0KA 3TMYA 4GI3A 4QXRA 5CB4F 1ULAA 1Y8RB 3BHIA 1A8PA 1IUOA 4IJ6A 4L8LA 3O4HA 4KE6A 4MPPA 5EXXA 1CQZA 3QA9A 3UYKA 5LXTA 1OB2A 5FUQA 4OYYA 5ED0A 3RDPA 1XTQA 4QX6A 1R74A 3CA8A 3IO5A 1LSOA 2YYZA 1VG8A 3PD1A 5K8CA 2XE4A 2ESRA 2PNFA 2GYVA 3ZZ1A 1FW8A 4TS9A 1J23A 2RK3A 1RZUA 2ZRPA 2ZYGA 4BCBA 3J7TA 3U39A 2GX6A 2B5VA 2VQSA 421PA 3ZWMA 5JADA 1PNQA 1GG2A 3LHKA 2HAEA 4TL7A 1QIKA 2R5FA 2ST1A 3DH0A 4MWEA 3STUA 5JYBA 3FWYA 1EAMA 1OH5A 1U8AA 5K3AA 4CHGA 5FBWB 4EYEA 5CDYA 4LE2A 4AY5A 1N75A 1S89A 2NZYA 4H4CA 4B3TB 1EK2A 4DIKA 1Z0ZA 4GR5A 2HIGA 3M6LA 2FWMX 1V5FA 2DR3A 5DEIA 4KMMA 1RJWA 3K4PA 2H1WA 3ABQB 2VJLA 1DEOA 3DKVA 1ZCJA 2FEKA 3L0SA 3QMWA 3S2EA 3UHOA 4BBZA 4IW3B 4LXYA 4BB0A 4DCVA 5LYJF 4LXXA 5KQMA 1N2XA 2G1AA 2IUEA 1H3NA 3PR3A 4KFRA 2NZUG 1XP8A 1PDOA 4DWJA 3OOEA 1GPMA 4J1QA 1DG9A 2NUTA 3THWA 3OSUA 4IXNA 3AGQA 1LF0A 2SCUB 1J07A 1CUBA 1XPUA 1MZVA 4EJFA 2XQFA 2I3GA 2FN7A 2QLJA 2R5WA 4PPYA 4ZOLA 3D9QX 5B1YA 3DHEA 2QXYA 3NHPA 1KFCB 4KR2A 2ZYVX 3VZQA 1PZMA 5IXYA 2PD6A 5KOHA 4UVDA 4MS4B 5DM70 2QZJA 2QI9F 2QN8A 1JDPA 2QV0A 3GHYA 4GOJA 1ZD9A 4TYPA 2EX0A 3R9IA 3TOZA 1U1EA 1D4ZA 1F2VA 2BKXA 2QN3A 4RY0A 5IEJA 4L95C 4NFHA 4ER0A 2IVZA 5LA6A 3SQDA 4KVFA 1Q0QA 4BNMA 1FB5A 1SB8A 1U1CA 2D7DA 1E5DA 1W581 3MTJA 1VIVA 1KJZA 2P41A 1N9KA 1P0QA 2REQA 2GUWA 4MWZA 3RWMB 2I78A 4QJ5A 5FOQA 1XL1A 4KH0A 4KLNA 5G0UA 3BN3A 3FJOA 1S2MA 1VKOA 4V0QA 1TVKA 3EEOA 1E5LA 1CY1A 4LDNA 1L5WA 2C42A 4KX3A 4MKHA 3HYCA 2BGUA 3UK7A 2NZVG 4B45A 1V1MB 2ZUCA 3HB4X 3N8DA 1Y33E 1CS0B 2QTAA 1H6DA 4UBKA 3OC6A 2YFQA 4HJRA 4TTIA 3GEPA 4MRMB 1WVGA 1VCOA 2EX1A 2F90A 1HE1C 2EWVA 2MU1A 2RHDA 2XUHA 3I34X 3K0BA 2G4CA 1MOSA 4W63A 4L85A 4OL0A 4I9UA 5CA1A 721PA 5JAMA 4EJ0A 5KYKA 1FXWF 2RARA 1RHRA 2P4EA 1F6DA 1T3ZA 2EU8A 3DVSX 1ZUHA 4CJXA 2C94A 4BVEA 4XB2A 3A0UA 1SBZA 5B12A 1MHPA 2EJUA 5B6IA 3H65A 5LLSA 1H6BA 2AJLI 2BCJQ 4B09A 4HGYA 3Q9SA 3UC5A 1U7UA 1NJ5A 1VLMA 4WESA 3ZVLA 1HT2E 1V2GA 1ZR2A 1ZI8A 1BKDR 3AEUB 3NDIA 3TYXA 1MVOA 2IP2A 5K0TA 1YE3A 4HTFB 2PPVA 4BNKA 3IUQA 1MEEA 3KQWA 3RU7A 2C5SA 1P7VA 1Y8RA 3TS1A 1YCHA 2H1VA 1P33A 2SKCA 3CH7A 5G4KB 3H0CA 4N5MA 4WZBB 2BONA 1Q14A 3DFUA 3LY5A 4AJEA 5KQGA 4B46A 4IWXA 2UYGA 2PGOA 1LUAA 3ESQA 3NHMA 3QFCA 4MARA 2HFJA 1XK7A 5EP1A 2R4QA 5EXPA 4QE3A 2WJYA 3TSCA 2PFSA 2WG0A 3BXXA 3CF0A 2OG1A 1VZ3A 3TI9A 4QBFA 4YRCA 3N8KA 3RSZA 2OGSA 3H97A 4WUVA 3T3HA 3VTZA 1HZZA 1R0LA 4AROA 5FOUA 1OGYA 1AZWA 4MHSA 3MD0A 4EI2A 5C52B 1GNLA 3HCRA 4Q9HA 2JJMA 1EU1A 1RP7A 2JS7A 1Z39A 3EGEA 3RIMA 4UDNA 2QM8A 4XB1A 4KRFA 1KYZA 1GNQA 4M9ZA 3V8NA 2HQBA 3F9CA 2Q4OA 2NO1A 1E3EA 1YS7A 3EG9B 3JQ8B 2H2WA 3G8AA 3W2IA 1C3JA 4J76A 2JJ8A 3FH0A 4N7RA 1T3SA 3K1YA 3B3AA 3PEVA 4ICIA 4UQLA 5LOVB 3B8EA 5CLFA 3FCOA 2NAPA 3KSRA 4F6CA 4XGRA 4D82A 4DMCA 4FONA 1WHTB 1U7XA 5KDOA 3QU2A 2XCTB 3TINA 1LS1A 1VMAA 1TZJA 3LDAA 4KFTA 5JXJA 3IUJA 3SLKA 2SCUA 4AUNA 5KQPA 3U48A 3WIDA 3EMKA 4QJBA 3HU3A 1EVZA 4ACBA 5BW8A 1XZNA 1ORDA 5JNRA 1NUUA 3KQYA 1HLPA 4HAWA 3ZOKA 2IYEA 1RWOA 3HPQA 2R8PA 4DTCA 4CF6A 3IDQA 5HBGA 4WCDA 1MVLA 1QIDA 1II8B 2A2ZA 2XR1A 4KJZA 4MS4A 4BWVA 4DG5A 4DW8A 1L2TA 1RYFA 5KNCH 1AVTA 4KYVA 2H4WA 3DXXA 1YZLA 5SY6A 3RS0A 3EJWA 3RUIA 3PNLA 2VHWA 4FOSA 1R9NA 1EJ6A 1RI5A 2G0TA 2HH9A 2JC3A 1TKCA 1SIWA 2AUTA 4JR1A 5CCDA 3TDMA 4ZI7F 3RSGA 2RAUA 1B3RA 3UQYS 1LQ2A 3CUSA 2L42A 5GOTA 2VUHB 2OXIA 2P9QA 4L4ZA 3ZI0A 3WK6A 1VGRA 1SWWA 1C1DB 4DADA 3MMPA 5T67A 4DCSA 3LE8A 4RZXA 3B60A 1DX4A 5EUMA 1ESEA 1SD1A 3HJHA 2QG6A 1YAJA 3EWSA 1V1MA 3ICVA 4KO4S 5DI3A 2JZOA 1CS0A 4WE3A 5DNWA 2OBFA 5EC8A 2OE2A 3TECE 3OPMA 1ACLA 1TLTA 4MRMA 3Q2IA 4PZ0A 1A0OA 3OT5A 4IDCA 4NESA 3T54A 2EF1A 1GNVA 4C7BA 4F71A 2HZ7A 3IB6A 3JU3A 2CFIA 4UBIA 2ZDGA 3RYCB 1EFKA 1MOQA 4HNAB 5B2FA 1UJBA 1WJGA 2HQOA 2WZBA 3ON5A 4Q3LA 4BIMA 3QKIA 3WGIA 3FDIA 3H11B 2ECPA 4G1MB 2ZK7A 1UMBB 1P3DA 3WVNA 5EERA 1UQTA 5GY7A 3ABOB 2APJA 2GOYA 2I33A 3BPSA 4UMVA 3C98A 4YI3A 4R68A 1M6VB 1AKYA 1TVMA 5F9FA 2FWJA 2HR1A 1A1SA 3AEUA 2D4AA 3FA2A 5EZYA 5JAQA 1OXSC 3HYTA 4PYLA 3SE0A 4HTFA 3TVTA 3FN4A 4DV6B 4DJ5X 4JOSA 5BSGA 1MTZA 2HXGA 4NU0A 4ZHQA 1UFOA 4D9NA 1XDBA 2XDAA 4KRXA 4P4TA 3DMGA 5G4KA 1FDRA 4B43A 4WZBA 2AFIB 3JASB 3O31A 3AHHA 2OXTA 4OI0A 1I7DA 5CT5A 3HHPA 5A7FA 1VG9B 2OL4A 2B69A 3SF0A 1T9BA 2FW9A 4D97A 1SUWA 2PCJA 1NP6A 1WXGA 2AV6A 3ZBUA 4C5AA 1SU7A 1G3RA 2YTZA 4GW3A 4F97A 5HRAA 1DBWA 2I4TA 3HYLA 4DZTA 1SC4A 1TT7A 1NJ6A 3WGYA 2HWUA 2IC5A 5BNIA 1U28C 4TQ9A 3R7AA 5ARCA 3Q88A 5MFPA 2QYTA 4NABA 4DR1B 2IEZA 3JRXA 3CM0A 2HJGA 2R1TB 2GD2A 1E32A 3DMRA 1FTNA 4IAOA 3FUXA 1D8TA 3JVDA 2HO5A 2Z8XA 2YC4C 5CLIA 5C8ZA 2E5LB 1BJTA 3EG9A 2AT1A 3JQ8A 4G5SA 3JZDA 4L9SA 4PIMA 4PRYA 4PVCA 1RBMA 5DBIA 4COKA 4TXNA 3KO8A 1L6RA 1YS4A 3M6WA 1VHJA 1TJ4A 2QZZA 3ZZTA 2I6TA 3QVLA 5C7IO 5K0ZA 4G5YA 5DULA 4A2PA 3O8QA 4WERA 4W1SA 5BWOA 3CRRA 4QJ3A 2CDCA 2B5WA 2W4QA 2YV5A 3CUVA 1NXSA 1WHTA 3OO0A 4FGUA 2PZGA 1N1EA 5K7SA 5IKEA 3G7SA 3E1GA 2I7TA 2HCFA 3FTCA 3IXQA 4QQKA 3ZWWA 5C5DA 1TNDA 4BCDA 1Y1LA 3WZ2A 1AGPA 3U4IA 3ST7A 3VO1A 1C3EA 1XXHE 5TXGA 2DHRA 3AESA 4L6IA 5JNUA 2IT1A 2EP7A 2QPOA 3AMVA 3ETEA 5IX8A 1YZFA 5DK6A 1P2UA 5CFNA 4J0KA 1II8A 3R9XA 2XRZA 1NLYA 2RHCA 3I6QA 3WADA 4YRIA 1P7YA 2C8JA 2PGNA 3CPEA 3UHFA 4ECAA 4K9DA 2HSGA 2Q1XA 4P4GA 2XUPA 3KOOA 5E4FA 4YV0A 4ZI2A 2ZS9A 1L7XA 4J3JA 4KR9A 4AS3A 4QPNA 1CXZA 2C2GA 5HUJA 4M8KA 4P2BA 1OH7A 1CJSA 2D62A 2HJRA 5FA8A 2PWAA 3H13A 5K3FB 2CK3D 1F4LA 3HN7A 4LZNA 2GN4A 2PS0A 2WTAA 1GVHA 3QE4A 4GOXA 3F5QA 1DAEA 3VZPA 3I58A 1UBKS 1C1DA 2C2BA 3F6PA 3DO5A 2C9OA 4Q6BA 4EITA 5BMOA 1U4NA 4DV1B 1IHOA 3ZI4A 1MV5A 4KMSA 5G4LA 4ZKEA 4JLOA 2K5UA 1X74A 2Q5IA 5ESRA 1YB6A 2X0IA 1D3AA 1MRNA 1JQDA 3CURA 3QFFA 5CM9C 2GM5A 3OHMA 7ABPA 1E2BA 1FRQA 5M04A 3EHDA 1R3DA 2FZ5A 4LZPA 5BWNA 2YICA 4OQQA 4F0JA 1HDOA 1UZMA 4GRIA 1W36B 1E9FA 2V7EA 4HNAA 1UP7A 2IELA 3OM8A 3AV3A 4QM7A 3H11A 3T7IA 2I7VA 2P35A 2O4UX 3BOSA 1UMBA 3TCNA 4CODB 4DSUA 1GPUA 5AUOB 3U5ZB 3CUEF 4KVGA 4NS1A 3SBDA 4BTVA 2CLHB 1LVGA 1YI1A 1M6VA 3VMMA 3TQQA 3V7YA 3JYQA 3HBFA 3IURA 3DYVA 3R3SA 4HDOB 4K9PA 2I6QA 3RC7A 2RE8A 3L0PA 3OIVA 4KGVA 2WT4A 3L43A 1S1MA 1C1YA 1Z2OX 3C8UA 3DEKA 1USUA 5IEBA 3T7DA 3LVRE 4MRNA 4EJSC 4IFEA 4ZREA 3BH6A 3GEEA 1A3CA 3A6HA 3EVFA 4PN7A 1DGQA 4FEAA 4M0PA 1OU0A 3WHKA 2AFIA 3JASA 1HRDA 5CXUA 4ZIRB 2GPSA 1YE8A 3FAKA 5EE0A 2Z83A 1U28A 4I6GA 4YAKA 4UTZA 2XCUA 2VHXA 3LC0A 3AUAA 4MVJG 1IN4A 1X86B 1YD7A 2EYQA 2J46A 1SVIA 2Y1CA 2FOIA 4FFWA 5E4YA 4AF6A 4G5RA 5KCZA 2ZSHA 1IULA 2AFRA 5ALGA 4UNNA 1U6IA 3NJ8A 4OU5A 5FUWA 5EKUA 4YUYA 2BH9A 1UWCA 3WHIA 2UYQA 2QD2A 2VDQB 4LZAA 1O4VA 3F3SA 4JJ7A 4EJMA 3KB8A 3MUNA 4J16C 3IT2A 1JR3A 1XCPA 3BWEA 1J39A 1QGUB 2R1TA 2QDKA 1XC7A 3KQHA 3LHSA 3O3OB 4IYRA 3GLGE 1PV2A 3GCGA 5DNYB 1DDGA 3CR7A 5JAIA 2R62A 2P5TB 4AJ4A 4RENA 2Z4SA 5AVXA 1G5QA 3MYYA 3K92A 4S2UA 1TK2A 3RG8A 4KQ9A 4M1KA 4ENPA 4BMOB 4HLDA 1Y9ZA 2JJ1D 2YYSA 3A4MA 4R2IA 2GZDA 3DEFA 4IQFA 3ZV6A 4CV3A 1P2FA 1H9CA 1S8NA 5AVWA 4GQIA 1T4DA 1B8VA 3BGWA 4Q7EA 4C4AA 5BYAA 4RMNA 1SKBA 3KSMA 1QCCA 3SOPA 4E70A 3GLKA 3I4FA 3OLQA 1E18A 4HXGA 5BYJA 1NVBA 3NRCA 4KXYA 2IHJA 4WZAE 4HWTA 1V2HE 3BB3A 2PD4A 4CM7A 3V4ZA 3WP1B 1HDZA 5JS1A 1L4MA 4WCFB 2HA0A 1VGQA 3S55A 2D1SA 5T6BA 2H5IA 1LKZA 1WVIA 1FUKA 1YQEA 2R65A 3IMGA 4EH1A 2PL5A 3KB6A 2ZUTA 1AGXA 1Q0LA 3NNNA 5K3FA 3KUKA 1JG3A 1CUZA 2ZWMA 4DGSA 4PNEA 4WCFC 2HO4A 4RESA 3SQLA 3RSHA 3S7TA 1DAMA 4FLEA 2HA6A 4FOLA 1W76A 2BDEA 3AFMA 3GZNB 1OC4A 4RFVA 3BWVA 4W7SA 5T4HA 3OECA 3UUGA 1FA9A 3GEHA 4F96A 4R8SA 2RAFA 3P4UA 2DUUA 4MMZB 4RY9A 3TTUA 4EB6B 4MVWA 2CSXA 2X9QA 1QWSA 1G8AA 1GPJA 1DAFA 4BNUA 4YV1A 3EC1A 4LOHA 3TUJC 3VKWA 1VJTA 1XTKA 3KYCB 2G9RA 4GEKA 1NM5C 4GUAA 3BHNA 1DRUA 3M1IA 4R2WA 1PJAA 1N2IA 1YRQA 2P67A 4MQ5A 1XCJA 3NHBA 3E8MA 3KZ1E 2Z6VA 3A14A 4OJQA 3LQ1A 1PJZA 4C5BA 1AU9A 5LUBA 3WGUA 3GGDA 3ZE1B 1REQB 3TCKA 4F5ZA 4EHLA 1Y34E 4MSUA 1NLZA 4WK6A 5CJ2A 1NQUA 2PUAA 3GFVA 3KJZA 1G20B 4PTLA 3HFSA 2BKAA 2UAGA 2V8BA 4H31A 2I6SA 3CMMA 2OCBA 1IEXA 2ERYA 3MRVA 4J9UE 3TFWA 5LCXA 1KAGA 2IF2A 1XGKA 3MOSA 1D6JA 2IS1A 4GOND 4DDMA 4F3TA 2BSXA 4QQFA 3B9QA 1CF9A 1M1YE 1WIWA 3IV6A 2I3DA 4XAQA 1XMJA 3BE6A 1L4EA 1HDGO 1O94D 1XRQA 4Z86A 4Z4EA 3SC6A 3JZIA 4BKUA 5AH0A 4EJ6A 1TA0A 1I10A 1Z0KA 1J8VA 1V71A 1EGVB 5EWMB 2PXCA 4ZIRA 3N6RA 1PAUA 2R4UA 2R7LA 3FNRA 2CL6X 1IG3A 2FE1A 2ZBRA 1KRHA 3GA7A 4J16A 3DVAB 3A58B 4P9NA 1PFGA 4LG1A 2BFPA 2Q8PA 1XD2B 2D3TA 2B9EA 1G8FA 2MR5A 2X5NA 3E18A 1RHJA 4F5EA 4ESOA 3ONVA 4M2LA 4TMYA 4OBBA 1YVPA 1DXOA 5JDCA 4PX2A 4LMBA 3THSA 3GNLA 3DEZA 3OZFA 3AOEA 3C41J 4P5PA 4R7ZA 2IDZA 5JSQA 3DV2A 4BPBA 4UD2A 3GVPA 2XDYA 2Q3CA 3L1JA 3WGZA 4NV3A 3RWOA 2J3MA 4IIJB 1MGPA 4WOPA 2XGJA 3P27A 2QW0X 3AF6A 2UUAB 2QK4A 3DMFA 4U8HA 2W2LA 3SQWA 1UFVA 1WKBA 2GCIA 2Q3EA 3VO9A 4ROSA 1YGYA 3FUTA 1JVNA 3G5LA 3L04A 4QUIA 5BYBA 3STTA 1JEEA 3VKGA 3UT5B 2CNBA 5E9AA 1N7GA 1OTXA 4LGYA 2FPSA 4QYXA 5ALRA 1IJKA 1G7TA 4ZVUA 4BJ5A 2RJNA 1L7MA 3HWX1 1UPBA 1FFEA 1DHRA 1PG0A 1XJ5A 3N8NA 5JS2A 2FMIA 3CT4A 2Z9BA 5HMLA 3ZCVA 5KPDA 4OHUA 4DMHA 4OXXA 1UDCA 1BJKA 1I7NA 3UW1A 1UT6A 3L1UA 3GJZA 1W0JA 2WKQA 3T52A 3C1OA 3H2HA 3T95A 2R96A 4N49A 3I9NA 3VH2A 2JIPA 4WCFA 1SB9A 3R4CA 4XYGA 4RF5A 3J81A 4S12A 4TKZA 2SKEA 2ID8A 4YLGA 5LYJB 1VI2A 2JLUA 4G8JA 1QGYA 2REOA 3GV0A 3ZV4A 4AO6A 4R3NA 2QNBA 3GZ4A 2IYUA 5IFKA 3O8CA 4DBLC 1CQWA 3DZCA 1CETA 3OD5A 4N03A 3TL2A 1YJCA 1B8OA 1H8EA 2OV2A 2Q07A 4PCUA 3G13A 4DNPA 4KR7A 4B79A 2QZSA 1ZYUA 2H4XA 1YBMA 3HDVA 5THQA 1YC5A 4A8JC 4LRQA 1NM5A 3GZNA 4UVHA 2WG2A 1ZN8A 4RJKA 3BXFA 2VPWA 5H81A 4NR0A 4DYVA 4BJ1A 4H18A 4IOKA 4OA8A 4XCQA 4RMIA 4MW7A 3SZRA 5FL7A 3OEEA 3GRKA 3IEMA 1SVWA 4MYRA 1ESZA 4BZXA 1C8KA 1TDJA 5TS2A 3KYCA 1ZM3A 4FKBA 1CVRA 4RPCA 3PSAA 3PPWA 3R0JA 3ZJYA 5LBUA 4AL4A 5LD2B 2X0FA 2H17A 3P2YA 1IWBB 2IIQA 4B7XA 1WB9A 3MA0A 2D6FA 2WFMA 3USCS 1EVJA 1WOYA 1Z38A 3D1LA 1YE5A 1C0IA 1REQA 5I9BA 2UYCA 3ACDA 3TPZA 5SZIA 2IBMA 3ZXXA 2ETXA 2AFVA 4CKXA 1G8HA 5J4YA 2AQIA 2PMBA 5JCXA 1BX0A 1G20A 3K05A 5JY1A 1VFPA 3EIQA 4YYEA 5HWSA 1P0FA 2QVZX 3PC2A 4H1TA 1XN4A 3LYUA 3QWFA 1NXXA 3IVXA 3PL1A 5JSFA 3R5SA 3PIIA 3DMYA 4XQEA 4BO9A 3FYDA 4IL5A 2AK3A 3T9BA 5KAPA 3UJCA 1XDDA 3TZHA 1SUCA 1ZMRA 3DLTA 3OE1A 1ZH2A 2NP7A 2BJHA 3H2ZA 3I4CA 5LQSA 1BE6A 3HNOA 3H2SA 2YFHA 3DBLA 3GN2A 2ZATA 4BOYA 2MYNA 2BFCB 2VSXA 3ENKA 4BU0A 4CLXA 3DVAA 1QQAA 4GRDA 1QZXA 4FBGA 1Q95A 2X3FA 1XD2A 1PGNA 2JFGA 3K70C 3E7DA 5ALHA 1TE2A 4KV9A 3A9CA 1V8DA 1G5PA 1OWNA 5BT9A 1MB0A 3TVYA 4FILA 3ZI7A 1J5XA 1PL7A 1UBFA 5IDYA 3K0SA 1ZFNA 4NEQA 5JTTA 2UZ3A 4GP6A 3CWQA 2W2PA 2VPIA 5ESDA 3COSA 2J4DA 4P3NA 1WDMA 1EBBA 3H7IA 2H85A 3RVDA 3QXSA 2H7CA 4IIJA 2WHXA 4UMEA 1Y1PA 1GAJA 2ISQA 3EXG1 2YZGA 5DGHA 4ZVMA 1W7AA 5LMUB 2Q46A 2P7HA 1NNUA 3EDOA 4N1AA 1VSTA 5BSKA 4I6JA 1AQYA 4GR9A 2MINB 3CWCA 1YIAA 2FV8A 2VZ8A 4EG7A 3FMIA 5ICSA 1HQYE 3GFPA 4FI3F 2A84A 2Q5HA 2YXNA 2ZTMA 3LCVB 3UCFA 3ASYA 1RP1A 1DIBA 1CDOA 3NCTA 1N9GB 1VTKA 4MUJA 1K8ZB 1TI7A 2F00A 2A57A 3UZUA 1OBHA 1TFRA 3TSYA 1G4AE 5KINB 2H0AA 3L4JA 2XXAA 4CIYA 4HEA1 4JNCA 3S2ZA 3AXSA 4NZNA 1IJEA 1KU6A 3MCTA 2AC2A 2P2YA 2IZ6A 3MGKA 1CBUA 2JLAA 4ERNA 3SJUA 4LDZA 1ZPDA 2I6GA 3VOBA 2OB1A 3EXAA 2J3HA 3PKZA 4QBGB 2XD4A 5KB3A 1H4SA 1XBTA 3OZTA 2R6HA 4LKOA 1MEJA 1F2DA 1XJQA 2FUNB 3B78A 3H4VA 5LYJA 3DKRA 1OJLA 2JIOA 2QV7A 3GDHA 2EQBA 3RS3A 4JL6A 3B1XA 3QPBA 1XCGB 3VOAA 4ZVPA 4N5LA 4K0KB 2JGRA 3KEGA 4GXRA 2DTDA 3UB3A 1B0ZA 3NX4A 3E3MA 1V7CA 5EIFA 1HNZB 4FT4A 3P0JA 4DSOA 5HRUA 3P94A 1TQ2A 2MYUA 3TVDA 2DHDA 4C2BA 3I2IA 4YP1A 1JAHA 4MH0R 4X1IB 3UXEA 2WWXA 2Q28A 3RG2A 4JP3A 5K4AA 4QELA 1NBAA 4FFSA 3CVXA 5T8KC 4F8YA 4B40A 3QTBA 1L4HA 1IOWA 4LZJA 3SKYA 1Z0FA 4K8OA 4CDMA 4F91B 1ONBA 3ZEAA 3AHGA 3T3IA 4CKCB 3I0MA 1ZLYA 2PM8A 2P0EA 2GFHA 3VKFA 5F2NA 4MW5A 1J49A 5ELMA 3T7EA 4NNOA 1U4OA 1C29B 4US0R 1UDXA 2VRCD 4TV9F 4Y2YA 4BQFA 4EGSA 4NMMA 1F3OA 1TZKA 3ZH2A 1TM5E 1M5RA 1UM8A 2PMCA 1JG1A 1JSRA 2Z0MA 4HRVA 1SXJE 1JHQA 1MDBA 1JSZA 4NCXA 3DE7X 3I9OA 4TTTS 5F1OA 1JHVA 3L8ZA 4RWZA 4HD8A 1KQOA 4UCFA 1PR6A 4NZ9A 1DTSA 1E6EA 4X62B 3OAAA 1V9SA 4L9RA 4FGZA 3OFKA 5E8JA 5A3RA 3WK7A 1XWFA 3F74A 5BXYA 3G0OA 1NXWA 2VJAA 1UT8A 1AA6A 4KOEC 3RO7A 4LXUA 4TTJA 2BUCA 4U7PB 4ZRDA 2BFCA 2RBEA 4YMUA 2WSYB 5E2BA 2BSQA 2PH7A 4AECA 3O8NA 2IBSA 1NXVA 1Y0BA 3P32A 4QWMA 1BH2A 5EJ4A 4GVPA 1BX3A 4F9GA 3BJEA 1HG0A 3V1UA 1EVYA 2DPMA 4UPEA 3KZCA 3PXDA 2O1SA 1NMEA 4LE1A 2GA8A 4MR8B 4KQ1A 3RF6A 4D8VA 4DPMA 1LCIA 3O4VA 2OC4A 4E3ZA 3QXXA 1WL8A 1XQ9A 3NPMA 3PFFA 4XEHA 3HI6A 2Z2JA 1MAVA 1E69A 4R05A 1VJDA 1RU3A 3DA8A 3OFSA 2H92A 1MXFA 4OHKA 4PVDA 3LYHA 1PJLA 4YGYA 1X77A 3BSFA 5UKDA 4D79A 1FTWA 1Q19A 4MR7B 3RRFA 1W1IA 2C8LA 3QUAA 5FWYB 2MINA 1ORIA 4PLZA 4WK2B 1UBNA 5F21A 1F7UA 1JIKA 3T9AA 5DYWA 4BATA 1E96A 3IPAA 5HDBB 1JEDA 4X6UA 4DCOA 3DQQA 1Y1KE 2DQ4A 2MYPA 1N9GA 3MTAA 1KI9A 1DCFA 2YHBA 1HTBA 3OEHA 4R0NA 1PQWA 1BFKA 2BCEA 5JAUA 4G23A 4FN4A 2HZBA 2HM7A 2C9YA 2I7CA 3D2LA 4M9QA 4EMTA 3I39X 1Z4PX 5BSTA 1ILEA 2WHYA 3V33A 2F1RA 2YHSA 4K1LA 1G6OA 1TK9A 5K4HA 3BCUA 1C3LA 3NUZA 1ZITA 1BOFA 3U0VA 1HEIA 2CDAA 2E48A 2YYAA 5JCJA 3CNBA 4L5YA 4IDDA 2VP2A 3G8BA 4M1WA 3HN2A 2XHEA 3MSCA 3BXEA 4JXXA 3MS2A 3U7FB 3OX2A 1H2RS 2OFFA 3HB5X 1LI7A 4GX0A 4X92A 2J0VA 3WYNA 4D3ZA 4YRFA 4LHEA 1X1AA 1QHGA 2OYCA 2A1UA 3HB7A 4NU8X 5C8DA 1LSUA 3LPDA 4NZOA 3ZDXB 4ER3A 1J0EA 2W2NA 1E94E 1FDVA 4OQLA 3U0BA 1LPMA 2C7BA 1K6XA 2IU6A 2H1HA 3BS4A 4X54A 1K4KA 4IPTA 2OC9A 4RD6A 4X1IA 4EPRA 4ERXA 4FS3A 1W48A 2ZI5A 4GOKA 4E1BA 1F6WA 2GB4A 2CJPA 4I36A 5AM3A 5F5NA 1K3FA 1NW9B 3V5NA 2Z3WA 2ZYSA 1VLHA 1RWVA 5ITWA 4LAFA 1VE5A 3OMLA 3IPYA 4PLGA 4CFYA 2NYRA 4HEHA 2GRAA 5DCUA 4CKCA 5ENVA 2IP1A 3KUDA 3WZLA 2VWHA 1PZFA 3CVUA 1GZ4A 1K5HA 3NC1C 5CA0F 3V6LA 2ZJBA 3OBBA 1ZJYA 3G85A 3NEYA 3Q3HA 2EG5A 2QY6A 4IJWA 1EJBA 1PIWA 4U2BA 2E1RA 4LKRA 3ZWKA 1CQXA 2QRKA 3NBZC 2B37A 1EA7A 2CNDA 1ESNA 2E4XA 4PAMA 3K1ZA 3FOAA 5GIPE 5KYWB 2WDZA 3IVAA 3V97A 1H85A 2BI4A 2VRNA 5KAMA 3BUSA 5LC1A 4DXAA 1W47A 5I7HA 3H1EA 1O7JA 3NBYC 3HCFA 4M22A 4E5NA 5FPSA 4UAJA 4JI4B 5EAIA 4KO3S 4HX2A 4XVUA 4QGSA 4GMHA 1E58A 4XIYA 1PLKA 5LMNB 1OLUB 4LC9A 3AX6A 4JGIA 2CCKA 1M0EA 3B3GA 2LIVA 3G1UA 1DEAA 2VSOA 2JFOA 4KIJA 5MGBA 1CUCA 2WC1A 1KVSA 4F60A 5H80A 4PANA 2B3DA 4EG1A 3ZY4A 3L01A 2GFQA 4DIDA 1CNEA 3PE3A 1CR6A 2YY7A 4Q3NA 3LIPA 1Y6RA 2FPWA 1Z47A 1E7SA 2C4WA 4MR8A 2WU4A 5EHZA 3PEWA 2CLLB 4RIEA 2J59A 1QMGA 3NEPX 3TM4A 1BXRB 2W0MA 2WB4A 1K7SN 3JWIA 2I1QA 3EQ9A 5FPQA 1JSXA 2WD9A 1ADJA 1G21B 4QJ4A 2XSZD 2GD1O 3OOWA 3R7SA 5K03A 1TUIA 2HNBA 3WYEA 4KAFA 2C8KA 2YZ2A 4CUJA 3SIWA 2ZR9A 4ENRA 5CJJA 1N32B 4LJKA 5SY4A 1DAKA 1NQTA 2J3JA 4E7PA 3CW2A 4MR7A 5FWYA 1QQBA 1WETA 4O4HF 1ML3A 1LPBB 3C3YA 3RSLA 2D54A 3CG0A 1WE2A 3D5QA 3EWNA 5CVVA 2C7GA 3DDCA 1XJCA 1AB6A 2VUSA 3HR4A 4Q4JB 1JDBC 4R71A 4R8VA 2CLFB 3H18A 3KSBC 1ZVKA 4JYPA 1Y1SA 1Z5NA 2W0SA 4ML3A 3JQ9C 3PDUA 1ZGZA 3V4PB 3ND7A 4IGEA 2EYUA 3G23A 3LMKA 4Y8VA 4FB4A 1O6GA 4GLOA 2GERA 1TD1A 2QAIA 4JKOA 3S40A 3F2VA 4KV7A 1YZYA 3HWSA 3X44A 3MD9A 3KR0A 4KAAA 2QIOA 2F3PA 3L4SO 4GBED 4B80A 2FFAA 3ORSA 2X1LA 3BZWA 4PZCA 3UV7A 3E2MA 2D1TA 3RASA 1RADA 1ESMA 3CO0S 5JVDF 1AHIA 1FBNA 1KZ9A 2AWOA 2HWWA 4R84A 3DVQX 5AESA 1K5DA 1JHUA 3HLTA 1JKMA 2E2WA 2E6UX 3RKSA 4PEVA 4F2PA 1OIVA 4PR0A 3W5UA 5LFAA 1SZJG 1YQWA 2B35A 3RPEA 1FLAA 3LQRA 3SEFA 4MO2A 2AXPA 4WN3A 4XQ9A 1IDOA 2DWQA 2JIRA 4I1IA 3T3EA 3G9ZA 4JR0A 1BS1A 1Z8HA 1PZGA 3PYXA 4XSHA 3DEJA 3KOMA 4ZEWA 3G02A 3KTDA 2MDTA 4JLBA 2GAAA 1XLWA 1O5IA 5DHPA 1G8MA 4PHTA 2QTTA 1U5BB 1YZGA 4EKYA 4FMBB 5M34A 1R6TA 1AXRA 1RM3A 4HN2A 1EVLA 1DKOA 4FU0A 2BBSA 4P58A 4PCAA 2Y2UA 1HORA 3BEDA 3NDRA 1AURA 5BN3B 1X42A 1N4DA 4FKZA 4B17A 1LRLA 1X15A 2JZCA 1ZMTA 3H1FA 4PPFA 1NXOA 3DT9A 4EVQA 4ZQEA 3IUBA 5HILA 3THXB 2JIZD 2IS2A 2NZ2A 3QLVC 3D2BA 3LV8A 2R6AA 1H1DA 5CU7A 1XKLA 5EFZA 2Z98A 5KYWA 4DJTA 1I4DD 2C9CA 2LTAA 2GPYA 1GSIA 2M32A 4MKXA 3H05A 4WAUA 2AB0A 3ZZUA 3ZYCA 2HXYA 2XCOA 3ZE0B 3VZBA 4KXUA 1Y5RA 1R8SA 1AO3A 1JI3A 1VBKA 1QKJA 1QIIA 1KYVA 3ME5A 4FFNA 3QLUC 4D1YA 1RLOA 2Y1FA 4RDIA 2CZGA 1NAHA 1VL1A 2VAWA 4GM4A 2C4MA 4BMSA 5J63A 2X3UA 1N36B 3INGA 4ARCA 5KWVA 5BT8A 4OL9A 4DV5B 1RZRD 2HQSA 2O1XA 3EAFA 2I76A 2IYAA 2TMKA 3OF5A 4P3KA 2OR3A 2XBLA 4FR2A 3GYBA 4NPAA 4XVHA 3ZJ4A 1C7EA 3ONWA 3FMPB 3B51X 3FSEA 4II7A 1LW6E 2PX4A 3M3HA 1WY5A 5J4KA 4Q47A 1W29A 4UHDA 2FP4B 1R27A 3KT8A 4BXOB 4IEEA 1BXRA 5JU6A 1NVMB 3C97A 4NY1A 2DJIA 1PWXA 3AEKB 1BVUA 3MCVA 1GRVA 1G21A 1YA8A 4FEYA 4IWNA 3KXLA 5KREA 3EPPA 4RKEA 3O9ZA 5EE1A 3GA5A 1PDWA 2YC2C 3EOAI 4DYDA 3N86A 1QH0A 2A14A 1ABFA 2EHDA 2VJBA 3HEBA 2PH1A 1YRYE 4YDHB 2PJDA 4R2KA 3LFUA 1RYDA 1GUDA 4MIKA 2PG3A 3EZ7A 3JQ9A 1E2QA 2WIKA 2CBGA 3W8DA 3JZMA 3UMJA 3ZE8A 5ELXA 1NBEA 1SCAA 1NDQA 3AIMA 3CZ9A 1UKZA 3HCCA 4R1QA 4RKRA 5ESXA 3V42A 3VHQA 1WCWA 2YRWA 5I4CA 4Q4JA 5JJCA 2PH5A 1H0KA 3JWJA 1ESCA 4H60A 4IH9A 4R1LA 4BFCA 4RE6A 2QRPA 4GVXA 1N6NA 3FTDA 3CRMA 1P0MA 5JI2E 1Y3AA 2OENG 2WVJA 1NN0A 4S1NA 4BV9A 3KOUA 1FS5A 4OBXA 4AW9A 3GLUA 3U49A 3UJPA 2P75A 5FHRA 1E7QA 1T8WA 3LVFO 1JEQB 4MGYR 1T8TA 1PUJA 2Q5FA 3WDSA 4BKQA 1DKLA 4BQRA 5BOVA 3DTNA 3T9DA 1SIOA 1OGJA 3P9NA 3HXOA 3GDOA 5TJ9A 2JBWA 4KH1A 1WCIB 4N82A 3W1EA 3R3UA 2C20A 2P9YA 2HDNB 4V0NA 1NUSA 1W5SA 1Q16A 4Q15A 4CTOA 2WMOB 5SV2A 4DCJA 2JRLA 4Q82A 4XIFA 1VPTA 2RBGA 3K32A 5JXHA 3ZDDA 4IKEA 4RFSA 5JSYA 4CW7A 2D5LA 4EHFA 4C7JA 4LSGA 4ZVTA 1EMDA 1B8PA 1M0TA 1U8UA 6YASA 3DM9B 3M6IA 3COJA 2BFAA 5CHEA 1QRAA 4PXAA 2WJWA 3EGVA 1E5XA 1NIJA 3W7AA 2W4IA 3H5TA 3KRTA 4KDRA 3JD0A 1DX9A 1RXVA 1DPGA 1GPH1 1JW9B 3MRSA 1ND5A 2LD4A 4RTNA 1M66A 1U5BA 5ICEA 5G0VA 4BAGA 1F2TB 1FFYA 1YVUA 2GCNA 2ZYUX 3CH5A 3AUJB 1NP3A 1T2VA 2F48A 3QLVA 4L76A 2EERA 3FUWA 5EIOA 1XVVA 5BN3A 4Z54A 2ZRNA 4Q48A 1NT4A 2EIHA 1Y7LA 3SHQA 2X7HA 5DX0A 3ABIA 3R3YA 4QTXA 5LPNA 1RE1A 4C6HA 4O2BF 2IYPA 4JXZA 4TT8A 1H1TA 2QL6A 3EJ6A 1PJ2A 2NO0A 3MT8A 2BFMA 2NV0A 3QLUA 1KZ6A 3F6CA 2FW6A 4US2R 1XZQA 1BMFA 1YC2A 4M1TA 1E1KA 4D3XA 3I04A 4QBHA 1I2BA 1FUYB 3L6EA 4N3BA 3IQWA 3EFHA 3H1AA 4ILEA 1PD0A 5AHXA 4BO5A 1Y3HA 4WGGA 4JJGA 3USES 3OTOB 5JAPA 1U7OA 3AONB 3VAYA 1ZH6A 1XTRA 4F1JA 2CLCX 5DWDA 1SC6A 4OBEA 1PR2A 2TMGA 3G0DA 3FYUC 2WE8A 4Z9FA 3ZK7A 5CT4A 4V02A 1DQPA 8GPBA 2HUNA 4IF6A 3SJCA 1R0CA 2I6XA 3H9CA 5EJ8A 3DKKA 4GPIB 4P4UA 2GCGA 1E7WA 1AKQA 1F9AA 2CMGA 2XD9A 3GNTA 4QOHA 5AW7A 2J67A 2L82A 2I4IA 1V6AA 3VPXA 2ZE6A 3T12A 1NBWB 2FP4A 1EX9A 4LHYA 2AD5A 1XYYA 4C4RA 4BXOA 3M6FA 3IPCA 3VNUA 3ZD7A 3E22B 4Y2VA 3AEKA 5G0SA 3HKCB 4BE7B 4Z2AA 5JMPA 1V1JA 1KI7A 1Y4AE 1GKKA 1Z29A 4IJQA 4C7VA 4HFMA 2DLNA 3EEFA 1PJ8A 4AP5A 2PT5A 3AOGA 1WABA 2YWJA 3WISA 3URKA 1UC5B 2A5YB 4QRHA 4CZ2A 2CFCA 2GI4A 2NWQA 3OX1A 4Q5IA 3ELWA 4B3GA 3T7KA 1JJIA 3AEYA 5B4TA 2PLWA 2Y71A 2C97A 2WSLA 3NTLA 4MUKA 2AF3C 3VOTA 3D7SA 1KEKA 1GUYA 2C99A 2V6JA 1YZVA 4LYHA 4RH0A 4MRRA 3RUFA 4DIMA 2ZM6B 5DASA 5IP5A 3AETB 4XIGS 1GPBA 3BJIC 1MX1A 1ARZA 3FFTA 1QDLB 4TWJA 3KTOA 4KO2S 4M98A 3THOA 4Q93A 3VR3A 3MW8A 2P5SA 2UZ4A 4HUQB 3RS8A 4BHTA 2Q5CA 2WZQA 1A9ZA 3F5DA 3EZXA 3JQRA 1CKEA 2ZIAA 3IPLA 1SG0A 1E98A 3DTVB 5FBRB 4OHCA 3BMQB 4C4SA 4FXOA 4JJ6A 4BLOA 5KC9A 1DBIA 2B1QA 4NICA 5F7JA 1JG7A 4NYMQ 5CG2A 1XCOA 3FYTA 4YROA 1KI6B 5HEKA 5HIIA 3G6WA 3TBHA 2UXDB 3ZCRA 3RK4A 4QYIB 3QNUA 5DU2A 1L1RA 2JB9A 4MKZA 2Q3HA 4RYDA 3KTFA 2CC2A 2WYOA 4Y0NA 4Y2QA 1RWQA 3DFMA 3H9GA 2C4KA 4JUAA 4NNJA 2PLRA 4XB6B 3VJKA 4XYLA 1OOEA 1R0YA 2HPZA 3FCYA 3FPLA 3KUCA 2JGLA 3R3HA 4ZKDA 4FX5A 4XUDA 4Q01A 5FNVF 1NBME 3MEQA 3REQB 4JFRA 1EXDA 2PRSA 3CRQA 4AX4A 4PRLA 1WAMA 4N0EA 1EM8B 2GSDA 3UNXA 1IBKB 4B85A 1F2TA 2HXSA 2LR0A 4MS3B 1XTJA 4JUDX 5DKFA 3ROTA 5KBYA 1UP6A 1JIJA 1W0JD 3QGMA 1KSFX 2WV9A 4NI5A 1FX0B 2Q27A 5E7IA 3CE9A 3CGWA 1U0NA 1F38A 1M2WA 1GSAA 3UC9A 4CCAA 2MJLA 4WZZA 3W9YA 2VP9A 2GILA 5CHYA 2DXIA 4LY3A 4EF5A 2KS6A 1DOAA 3EBOA 3G2LA 2P6UA 1L3IA 1Q0UA 3L8YA 1O9GA 4IIVA 2P4HX 3ZCQA 1O08A 1H8ED 4BQOA 2IYSA 4H7JA 4AJHA 1DTEA 2H07A 2XNCA 5EJ2A 2DPYA 3ILYA 4P34A 4X66B 3ELUA 1C50A 1TKAA 3KEFA 4RZ3A 1AS0A 3F73A 4FEEA 1MHTA 1C7RA 1XQ1A 2H7YA 2P40A 3AF3A 4FJ1A 4LE0A 1MV8A 3ADPA 1YRAA 2PD3A 3O1HB 1JQKA 5FFNA 1G55A 1JR4A 1BMQA 1DFHA 4PG6A 4FQ7A 1T2AA 4N6GA 1V41E 4QPPA 3X43A 4RAOA 4BIIA 2Q6VA 1PO7A 1VCMA 3C3DA 3GGJA 5D1HA 2V9CA 4CI9A 3AM5A 1G8JA 1YU6A 3QEMA 4F4IA 1DRKA 3C8DA 1YRWA 4D4IA 1X1DA 3D4PA 3JRWA 4HI0E 3RNOA 3UKJA 3OFVA 2G09A 2OSVA 3ZYZA 3GLRA 3HKCA 3EK2A 2W8ZA 1AN0A 3W77A 3RSOA 4L5CA 3R4VA 1UEJA 2OAEA 1MAUA 2XQJA 5CNJA 2IEAA 2NU8B 5FUBA 3SI7A 4N6OA 2HHCA 6ADHA 2EKDA 4MW9A 4B7CA 2IFTA 3OQ6A 4ZVNA 1O77A 2PHZA 4OK6A 1N6IA 2N75A 1OXXK 2DSNA 1L5LA 5B6PA 4L7VA 1IL0A 2FRXA 2Q6OA 3AETA 3RJMA 2AR9A 4GS5A 5TF4A 3R1IA 3I5AA 5KC8A 5I4KA 4A9AA 2GLXA 1A88A 3L7JA 2QM0A 3ZWBA 4D2IA 4HUQA 5HIMA 2XUFA 5IJWA 4ZXFA 4LW8A 3DTVA 1HKHA 4V0KA 3BMQA 4DQUA 4GX2A 1I1HA 3G9QA 1G60A 1B6GA 3JTMA 3K6JA 4KMOA 1HFWA 3HJFA 2V4MA 4YT8A 1IAQA 1KI6A 4QQRA 4GPBA 1NLMA 1T4BA 3H4IA 1L7RA 3II6X 4TTRA 3UB2A 4C0XA 3CZRA 4QYIA 1ZM9A 1UKEA 1HXHA 4XJVA 1XV5A 3GIDA 4R8RA 4C6TB 1SRRA 3OCUA 2P68A 5T57A 1ZISA 2DWPA 2FN4A 3BD7A 1V5WA 5JI3E 1VJ0A 5ALNA 4U8GA 4ZGGA 1CZOA 1ZG3A 2OXEA 4TLDA 2FG5A 4B3CA 1BGWA 2EGGA 3ESCA 3IALA 4N3AA 1FU8A 3IJEB 4D41A 1FEZA 1LBQA 4TUYF 2YY5A 3REQA 4EFNA 1NN1A 221PA 4PINA 1T5OA 3OCWA 3NP7A 4MGEA 2POQX 5CITA 4KDFA 4H27A 4J0EA 1GZSA 1TPYA 3WGLA 1EM8A 1U2GA 4MS3A 1E1YA 1YRHA 2W2VA 2XBUA 1YCFA 2JAOA 2PWYA 2YJTD 4EUKA 5HZKA 1VG0B 2CUNA 4A6DA 3FFBA 2H2FA 2N42A 1QU2A 5AJXA 2NN3C 4O4LF 5KKAA 4BLPA 4D3YA 5A62A 5MGNA 4MWCA 3R0VA 4MHOA 4OSEA 13PKA 2AS0A 5KVCA 2DCUA 1EP2B 2UXBB 4TKVB 3H3FA 2ZZNA 1D1QA 5FF9A 2C0PA 1QFXA 1N9ZA 3P4XA 1B43A 4TV8B 4D0GA 3BQMB 4KB5A 1JT9A 3T5AA 3AWDA 3OT1B 3OM1A 1CNMA 4YONB 4IXMA 5C1BA 2W00A 1EXWA 4JIMA 2EFGA 5DWQA 4ESVA 4HX9A 3AM1A 4KQCA 1JDNA 5FJIA 4FIDA 1NY6A 4Y18A 1MORA 1ORWA 2CXRA 4WOCA 2AKEA 2GZRA 3E03A 3QZUA 4PU0A 1QBKC 4RF4A 4GOLD 2PL9A 4TMKA 3RS4A 5KYYB 3U7JA 3N7AA 3THYB 2ZVPX 2YYYA 2IH5A 5CA0B 4KODA 3V9PA 2VDNB 1P61B 1O58A 3P2MA 3LAWA 3QWIA 3CX3A 4BZPA 3RTEA 2D5IA 2Z4TA 3DONA 5L3VA 2GVDC 2SBTA 3NTXA 3GOQA 1XF1A 3UFXB 3PIRA 4BUJA 2H4HA 2X2EA 2A5JA 2JLQA 4Q9AA 2X8JB 2X8WA 1XA4A 1Z6ZA 4OQ4A 4DQVA 2PLFA 4ZPXA 1PWYE 3DOIA 2JCYA 2HRCA 3C85A 1JHZA 3E9EA 3RIGA 2RJ3A 3PZRA 4FFOA 3T4PA 2DFPA 1M2EA 2O2ZA 2NU8A 3W5VA 3K1TA 2OQ2A 1IM5A 3JYLA 3C5HA 3GLHB 2I0FA 2OMEA 3MQ4A 4CMHA 3U7EB 1UM9B 1H5NA 2WKRA 3KBOA 3M4ZA 5KTPA 1JQEA 3D59A 4MDFA 4G41A 4BMCA 5JD6A 1O89A 3QV2A 1PT7A 1U2QA 1WS6A 1JEYB 3D8RA 5GGYA 4IKPA 3TPCA 2QUJA 3BCRA 3QMMA 3OZ7A 1JQLB 5FH9A 2MT9A 2HQ1A 1NVEA 3EVNA 3LX4A 2YW9A 3IA7A 1HE4A 2RCNA 4W9RA 3G82C 4YAWA 4EF6A 3D3KA 5JZ9A 2O57A 2IL1A 1K98A 3G9TA 5A5DA 2QLMA 4XDYA 5KWJA 2JFZA 4ZT7A 5EE3A 1HETA 2IZZA 2OAP1 4IDAA 3CJRA 3FHTA 1UZUA 1Y8CA 1V39A 1D6NA 5IT0A 4AYXA 3UMCA 1SUSA 3B9BA 3PFWO 5D84A 4KYTA 1D1PA 4LVUA 3EC2A 3SNKA 3L41A 3WLHA 4C6TA 3NAQA 4K3UA 1JQ5A 1Q0SA 1T5TA 5BRNA 1MABB 5BY2A 4WBNF 1DEKA 1KEUA 2QTMA 3K35A 3QXHA 3OQMA 4GIBA 3FTEA 2FLWA 5BSRA 3KPVA 3A31A 2ZSAA 1GG9A 1QIHA 2ZETA 4FSHA 4WVFA 4JXKA 3PDHA 4NWIA 3REGA 3STWA 2A0WA 2RKWA 1R37A 1YQ9A 4GLLA 5BSHA 3UA4A 3AIOA 4IO1A 3O4JA 3LBYA 3N76A 5DNUA 3JALB 1GVNB 3AVUA 3MS7A 5JVDB 1N5DA 1OKKD 1JBEA 2R68A 3I8OA 4WY5A 3MS4A 1BWQA 2QLBA 4UOQA 2A4KA 3UK6A 3ZBTA 2VYVD 2JI6A 2GN8A 3IIJA 4TKVA 5CCEA 1GPYA 1H4QA 4TV8A 1Z5OA 2JCXA 3W5CA 4NJMA 1CCWA 3N8IA 3U1VA 2DWUA 3O8BA 4ZCPA 2FZ4A 4BX3A 3OT1A 3U80A 2IXFA 4LWQA 1PR3A 1J2TA 1V3VA 2I4OA 2WABA 4QVKA 4XTCS 2XX3A 2AC4A 3Q7QA 1XQXA 4KC0A 4PIPA 3TLBA 1R4AA 5JLJA 2D0PB 5JHGB 1X2EA 3WS7A 4P82A 3MJDA 4GC9A 3GLQA 4J4HA 2YN2A 4BB6A 3IUPA 5DK4A 3ZUGA 4CMGA 5KYYA 1L4BA 3THYA 1KA9H 4EKNB 5CA0A 3KKKA 1BC5A 4HDQB 3EYAA 4P35A 3QU5A 1TECE 2QVYX 4KR6A 2ZWOA 3ENNA 2RAPA 1NN5A 1EK5A 4Z0TA 4INOA 4L15A 1NYQA 3G88A 1KO8A 2QPLA 3UFXA 3M5WA 1JHDA 4CF3A 1TCAA 2B4RO 4PS1A 3IDSA 4ZHQB 2CVOA 2F6RA 2X8JA 4UNPA 3RAFC 3Q8MA 1ZUWA 5AK3A 3ZQ6A 4HRXA 5ADWA 2GKSA 3AIIA 4JHLA 3IV9A 3Q7SA 1C0KA 3G5AA 1P1JA 2PR2A 4XYMA 4Y6PA 5BORA 3CKYA 1A9SA 5EG5A 3C3PA 1QO0A 2NU7B 2Y0PA 5D85A 4D8XA 3HM9A 1K7FB 5FOVA 4RXMA 5TQJA 4FGWA 3GLHA 4QHTA 1ISJA 4R2JA 1XMSA 1Y42X 5JHHB 5G1PA 4ZMSA 2ZIUB 1UM9A 4D6PA 1DTWA 4Z49A 3RTAA 4FMCF 1KZ7B 2FEXA 2VKTA 4JITA 3S81A 3V1MA 5AJVB 2RG1A 4PC1A 3FOFC 4BFVA 4CL8A 1JEYA 1MC1A 2R25B 3F96A 2BIFA 2BMEA 4J4TA 4DLVA 3M2TA 1US8B 4ZODA 2C5HA 3GJ6A 1FLNA 4L73A 4MYTA 4R9VA 2COEA 4F1KA 3PC3A 4YPFA 1EP1B 1W30A 2QNRA 1GQ2A 2QN1A 2XUJA 2ZSIA 1DBPA 3B89A 2NGRA 5FO0A 1EXNA 5IYZB 2GPWA 3TOVA 4R1NA 5CP8A 3HNPA 2IW1A 4PLVA 3RE1A 3VISA 3VMFA 3WAGA 1DCTA 2GJSA 4ESEA 2O7NA 1E66A 1ISIA 2CZQA 4IIXA 1P9RA 7REQA 4WNIA 2FRDC 2XWQA 1IAVA 3L0YA 3KVNA 5AHRA 5T6MA 2Q5OA 4KFCA 4B8ZA 1AG9A 2XUIA 4C29A 3A25A 4HWRA 3WNCA 3BHJA 2XNKA 7ADHA 5DMHA 1ODKA 2OOKA 3DMDA 3DP9A 4QOFA 4RGQA 2GWHA 7MDHA 2XUKA 1MABA 3B1KA 4FOPA 4G25A 3UANA 4F4FA 1CEEA 4ZTZB 4MLPA 2RONA 4UQOA 1RYZA 4G1VA 4X44A 1GRCA 1CT9A 4IVRA 3WBKA 4NF2A 4B34A 3TG2A 2NZ8A 3W06A 4EECA 1LRKA 3ND8A 4RLHA 5TT0A 3EQZA 4EZEA 3U3RA 4G5QA 4RO0A 5IAEA 1GZ6A 1THZA 1JIXA 1OFTA 3GJQA 2QR5A 4XE5A 5ANRB 4IIEA 3TQOA 3X0DA 1H5UA 2WIDA 1ORVA 1ZGJA 3BDAA 3JALA 4HZUB 5CIQA 1FFAA