4KXZH

Crystal structure of tgfb2 in complex with gc2008.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming growth factor beta-2
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 223
sequence length 223
chains with identical sequence J, N, Q
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kxzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kxzH01
3N9GH 1KPRB 2VLMD 2VLRD 1LO3H 3VXSE 5IEKA 1YJDC 1UH3A 4EEEA 4KXZH 5I1EL 5DR5L 3FB6B 4O5LH 2BVPA 3E2HB 4HUKB 1YNTB 1X5ZA 1QLRA 3RA7L 3RHWF 2I9LA 2VN4A 3GBLA 3TO4C 1P4BH 2WUBL 3QWRD 4KC3B 4UDUA 1RK1B 4L3EA 4LDOB 1H15B 2YA0A 4CBPA 3MACL 3ULSA 2MJWA 3WFHA 2FX7L 3QUXC 3FHAA 4D2NA 2KH2B 2QSVA 3NA9L 3DMMB 2CK0L 4Z7NF 4LCUA 3RTQB 4NRYB 2BOBB 2A6DB 3THML 1BGXH 1T21A 1ZVHA 2VISB 4NWUL 4JRXA 2A2QT 2H6PB 2B2XH 5TFSH 3LY6A 5T1MB 3D0LA 3RY4A 3SDXF 4J2XA 3T1WA 5GHWL 3S96A 3TJHC 1FZJA 1U8JA 4OV6F 1DE4B 1FH5L 4LCWD 4PLKD 1IGCL 5AYUL 2VC2L 4CW1B 5CKGA 3BDYL 2YBRB 5KS9E 5LJYH 4WTZA 1P4IH 4MD5A 1BFTA 1R3HA 4F15C 4CN6A 2CJUH 1NBYA 1W8NA 4E41B 12E8L 3U7AA 1U42A 4XCCL 1T7VA 4PJFB 1IC5H 5I15L 4WI5A 5JIIA 4BJLA 3OKKA 4OD1L 4CMMB 5FA3B 4AK1A 3O0RH 1YN7B 2ESVA 5E56A 2FB4L 5E2UH 4YPGB 4EUPB 4QNPF 1NFDE 3BYTA 2EDBA 2OS7A 1LHZA 1KYOK 2P5WD 3MOQA 4FXGA 3QDJD 1G7HB 4HUWA 1UACL 2AV7B 4XH2A 3G04A 3RWGA 4F7PB 2A9MH 5D1XA 5DO2C 3HRZA 2OTWA 3AY4C 1P84J 4J3WA 3RPIA 1N64L 3GJFK 4I13B 1U8PB 3RUGE 3U46A 3P30H 2KDGA 4IRSC 4PJ8D 2IJ0C 4RAUA 3V6OE 1CL7L 1BD2B 4JFHE 4MSWB 2C1PB 3LZFL 3QDAA 4QEGA 4P2CG 3DETD 4RMQA 4ESKA 1AH1A 4XP4L 2VDMH 1ADQH 1KB5A 2MQCA 1QFUH 5IB1B 5KSBE 5ID0A 1KLUB 2ZOLB 3FRPG 2GJZB 5HYIA 2A0LC 4E42B 3LKNA 4N68A 5C0AE 1XGTA 5FA4B 4YFLI 4OAWA 2AQ1A 3S98A 3MJ7A 4XMKH 4YX2L 1I8IB 1RJCA 1MCHA 4NZDA 4UT7L 4OF5A 5FUCE 3D25B 3F6IA 5EIQA 4IIQA 4ZUSB 4YWGL 3BESR 3DRTA 2ICEA 1LD9A 4QKXB 4XXDB 5MP6L 4I18A 4JQXC 4ZYKA 4NOBA 1KLGB 2N56A 1OW0C 3QG6B 5FO7B 4NQTA 5EOCH 1WWAX 1I3VA 3A6BL 3GSRB 4K8RC 1MQKL 4OZHF 4JFZL 4TOYL 1OAZH 3DOSA 3ESVF 3GI8L 4HIJB 4ZUVA 2BNRA 3ZE1F 2I60H 1MCJA 3DX6B 1RZ7H 3QIUC 1A1NB 2X09A 5ALBL 3T0ED 3GSWB 4HJGA 3PJSB 3UYRH 4AEFA 3MOAH 4LARL 5F7HA 2BSSA 2GK0B 4HUXB 4JY6B 5CILL 1R5WB 3TIDB 2JJSC 1KN2H 5IB5B 1LO0H 4JRYD 2UZIH 4KHXH 5TJWK 2WLYA 1EVTC 3WO4C 5EFIB 3FQTA 1JHKH 3VE0A 2VIRA 3MV9B 4MQ7B 5FO9A 3VWJD 2IH1A 3TBTB 4K3DH 3IETB 3S35H 4YEFA 1BJMA 5FK9A 3BN9D 3MRFA 4OCSL 5HVHC 3IDXL 2EYSA 3IDNA 3FT4B 5E8PA 5I73C 1GL4B 3LS5L 1JGVH 1KIPB 4QRRD 1GC1H 5I17A 4DZ8B 4ZSOB 1FFOA 1TZGH 2X4QB 1D7FA 3WUWB 4D9RE 4XAKE 4QHUB 1KJ3H 3KPQA 2K7QA 1FGNL 1VFAB 1FGVH 2Z31B 2EEDA 5ANMA 2VOTA 4PP1C 3QRGH 4YHNA 1HILA 5ID1B 3PWLB 3DVNA 4ZO8A 4OCRL 1T7WA 2B1AL 2BVEA 4HEPG 3VFWB 4I0PC 1FORL 2Y1VA 1JI2A 4Y16A 2EYRA 5FOBB 1BZ9B 3KS0J 1FV1B 3WD5H 3DUHA 1HXMA 1N26A 1JWSB 3MRMA 1BVLA 1GH7A 5K33A 4JM4H 4LIQH 5TPWH 3DHJA 5A3IC 1I8MB 2JE8A 2DLFL 1KPRA 2BCKB 4H88L 3AM8C 4L3CB 2D4FA 3MREB 4ZXBC 3BFOA 4JKLA 3DV6A 3FB6A 4TVPH 1AQKL 2B0SL 2F54D 3WIHL 3I6LD 4GW1A 1YNTA 3OG4B 5I30L 4GMTL 4HBQA 1T83A 3VXOB 2BY1A 3S34L 3TZVD 5HD8D 3P3YA 1RK1A 1INDL 1BPVA 2I5YH 4GXVL 3RBSA 3PV7A 2EDFA 3TO2B 4UTAL 3MRNB 3HZVB 3NACL 2MCG1 1FIGL 1G0YR 1RUKL 3VXUE 3P0YH 5LGJB 1R3KB 4LLYB 2Z35B 4NRYA 2BOBA 2VKWA 2IBGA 4Q2ZB 2VISA 2H6PA 1AQDB 3WFBH 4KKCD 5E1HB 5T1MA 4KUCD 4FXKB 1IAIM 4N0CC 5MEQB 5JLZB 1X7QA 1NFKA 1XF5A 1DE4A 4PFEA 4LVHC 1OHQA 1LGVA 4CW1A 1J7VR 2ORBH 2YBRA 3TESA 1BFVL 2UYLB 4LGPB 3CX2A 1BQLL 3U2SB 4YJZL 1KTKE 5F1KC 4OSUL 3T09A 3GMRB 1GZPB 1MWAA 2BFVL 3KGRA 2XFXB 3G6DH 3VFTB 3MLYL 2L7UA 4XPGH 4E41A 2AK4A 5F6HI 1KELL 4F57H 4WI6A 4WUUD 3R8QA 4X7SL 4PJFA 1LO4H 1BAFH 4X4ZA 1RULH 4CMMA 5FA3A 4WWKC 1YN7A 3TYFB 3MR9A 4EUPA 3EO0A 3QDGE 4YPGA 3NCJL 4OBSA 3ZKMD 1DBBH 4HFUH 1WBZB 2VNCA 1QFOA 1CDHA 2RBLA 3P11H 2AV7A 2IAMA 4AQ1B 4KHTL 4F7PA 3MGTA 4RMWA 1U8PA 4WRLA 4OCYL 2ZUQB 1C12A 2P47B 3LKSB 1BD2A 4MSWA 2NY4D 2C1PA 4M1CC 5BMFH 3BPLB 5GS0L 2Y6SD 1MAML 2UY6A 2AP2A 3FL7A 1P7QB 4PJEE 1KLUA 2ZOLA 1NCAL 2GJZA 4X6EB 4LIQE 5DHXB 1FNHA 5KSBB 4RDQG 1NCBH 5DA0B 5CP3A 4MCYA 2MHAB 3B4NA 1G7LB 2Z8RA 4MNQD 5J13C 5FA4A 2MPAL 4JFDA 2X4SB 3DNKA 2R1YB 3MLWL 5C0AB 4TVPE 3GJFA 1PSKL 2QQLH 1TQCC 2YD3A 3LIZL 1AY1L 5TE4L 2VTFA 5GJTH 3PL6C 2CRMA 1I8IA 1JZ4A 3STBA 2VWEC 5DJDB 5DSCB 3D25A 1QRNB 5HDQL 4ZUSA 1J5OH 4HMEA 4XXDA 4EBQH 5I0DA 4DJMA 1KLGA 4KRLB 4JVPA 3V52H 1GIGH 5FO7A 3RIFK 1GYAA 4Y4HB 5JW4M 3V6ZB 4Z7WB 2PR4H 2XICA 3BXNB 3GSRA 1M71B 2AJYH 3MBEC 5C09E 2M2DA 1T1ZA 2JELH 4N1CA 4HIJA 3DX6A 1A1NA 4NZTL 3S4SA 2ZUUA 3V5DB 2NYYD 4I4WB 1RUPH 3GSWA 3MLRH 4LLQB 1I1RA 3PJSA 4P5TB 4M3KB 3RTQD 1HI6B 4JY5H 2GK0A 4HUXA 4JY6A 3SDDC 1H9VA 3GFUA 1R5WA 4M4RA 4XWGL 4EOWL 3TIDA 4MA8L 3MV8D 1J1PH 4MA1B 5IB5A 3IJSB 5JXAL 1I1FB 4LSRH 1I3GH 3HI6H 3B9KA 5EFIA 2XA8H 4WFEE 3ARDC 5IMOB 1RZIB 1ZVSB 4PB9H 5IVNA 4M7LH 5F9OH 3E1F1 4G9FE 3TBTA 3HNTH 2ARWA 3IETA 2E27H 4OFPA 4X8XA 4WFGD 3FOLB 3C6LB 1UB5B 1Q72H 1Z5LA 4F37K 4X6CF 2OMNA 3FT4A 1YJDL 3L3KB 1J05B 4UT6H 1KIPA 2DBLH 1A6VL 4QXWA 4DZ8A 2HJFA 3B9VA 3Q6GH 4P9HH 2MKLC 1ZEAH 2VXVL 4NNYB 3WUWA 1S9WB 1FC2D 4QHUA 4Z95H 2LTQC 5HHQB 1JNJA 2DKSA 3KYAA 4JY4B 5FGRA 3L5WB 3WKMH 3NN8B 3QAZB 4R8WH 5ID1A 5JHLH 2W92A 3PWLA 1RIVL 4L5FL 5CZVH 3S36L 5T3XL 3VFWA 1T0NB 3OL2A 4Z8FL 5FUZH 3ZHKA 2ERJC 3MLUH 1I85C 4TNWF 5FOBA 1BZ9A 3ALPA 1FV1A 4L9LC 5JPMB 1CL7I 3Q48A 3UYOD 3GSNL 1PY9A 3LPFA 2WUCH 2A77L 2NZ9C 1I8MA 4JG0L 2HJLB 5IT2L 4PG9B 2RJMA 2BZDA 2Y06L 4XMPL 3W5NA 3VD3A 2BCKA 3UBXI 1QG3A 2H1PL 3V4UL 3ES6B 4L3CA 2HFGL 3MREA 3VXRB 5KSAC 2OK0L 1A02N 5IKCB 2PTTB 3G5YA 3ZKND 5H2BA 3SDAB 4UNVA 3WHXB 2DYPA 3B6SB 3RP1A 2VR9A 5EU6B 2W0KA 3VXOA 1QFWM 1TJGL 4RGNC 4C56E 1OQXA 5JDSA 3C08H 4N8VG 5KANG 8FABB 4ODSL 3CFEB 3TO2A 1LVEA 1NUGA 3MRNA 3HZVA 4U6YB 1X5LA 2D7TL 2BY2A 2EXYD 3CDCA 5I8EA 1IKNC 4ZS7H 3MCG1 5LGJA 4LLYA 1F4YL 2Z35A 2KUTA 4Q2ZA 4YBQD 4GG6F 3PDOB 5SWZD 1U3YA 3OXRB 3HG1B 5D2LF 4GAJL 1EK3A 3QUYD 4Y8DC 2XIDA 5TQ2L 1H5BC 5MEQA 1KCUH 5JLZA 1NMAH 5F89B 2HMID 3WN5B 3WIIH 4F7TB 4WW2F 3CXHJ 4G6AD 2Q20A 4RQQB 3L1OL 2JJWA 5T5NG 4WHTB 1V3KA 2UYLA 3U2SA 2DMBA 1GZPA 1MCWW 3MNZB 1BMGA 5KS9A 1J8HD 2BXYA 3RVTD 3KLHC 4EVNB 2XFXA 3VFTA 4EI5B 1G7QB 1UWXK 2XG5A 1JPTH 4KDVA 3O4LB 4PGJA 3VG9C 1QSFD 2VDPL 3BT2L 2Q6WB 3QSKB 4FABH 5EWIL 3TYFA 2AJXL 3MV9D 1JYVA 1LILA 4OLYH 1CK0L 1WBZA 3BUYB 4XI5C 3EYVB 1IGTA 1NFDA 3L3IB 1E4XL 4OZGE 1KPUA 5KVGH 3ZT7A 4NWTL 2FYYB 1E4JA 1XGPB 1R5IB 1TNMA 3LEYH 4NN6B 4WHYG 1WIUA 4WI9A 1T66D 4OLVH 1YEJH 1LO3L 2MWCA 3LKSA 4XHJD 4APQB 2XRAH 4HWBH 5FYLD 5C0BB 1MREH 5ALCH 5B8CB 1IL1B 2ADGB 2DWDB 4IJ3B 2FX8H 3BMWA 2HN7B 2APVA 2Z31D 2CIKB 1P7QA 4K8RL 3RDTC 2OL3L 1C5DB 2O26U 1T2XA 3BP5B 3U82B 4Y5YA 4K07A 4R4BB 4CUCA 4KI5D 5KSBA 1I4FB 4JKKA 1JJUA 2VQUA 1E28B 3JVGC 2WP3T 4K23L 2VXUH 4PJGF 2MHAA 1G7LA 4M93B 1XCTA 2X4SA 5C0AA 5M94B 4U6XB 1PQZB 5GZOC 4S1RH 2F53B 4Z7VE 4NFDA 2XTJC 4GQ9H 5TFSL 2CPCA 1F3DH 3HE6A 1D9KD 5DJDA 1K8IB 5DSCA 1QRNA 1WAAE 3FQRB 1O0VA 1CBVH 1HINH 3ARZA 1ZS8B 1X4XA 4WHCA 5IB3B 2YUZA 3GRWH 4CN1A 4X4MA 1MY5A 3T0DA 4Z7WA 3BXNA 1SJXA 3FRUB 1DQDH 2DQUH 1M71A 3WLWD 2YZ8A 2NY6B 3BKCH 1BOGB 1LNUB 5F3HA 4KVCL 1FFRA 3FKUS 5D7IB 1CU4H 2CUMA 5DJ0B 3HPJB 1IC5L 3C5ZC 4TNWK 3V5DA 4A6YA 1ZLVH 3BPCB 4BSVB 2GEEA 1RZFH 1AD0B 1LDPH 4GG8B 8CGTA 1NAMH 1UZ8B 2J88H 3JWOH 5GIRB 2X4RB 1S5IH 5AZEH 2NY7H 5ITBH 2XN9D 2AGJH 3IJSA 5JW5B 2DQFB 1J0HA 3LRHA 1OB1B 4S2SB 3ZYZA 1H3UA 1RZIA 1CDGA 3GIVB 1ZVSA 1EV2E 3TJEH 4ZDHB 3E6FB 1TZIB 3LH2H 3OKDB 3FOLA 4OLWH 3BKMH 1UB5A 3VXMD 2R1WA 3L3KA 4PJ9B 4LAQH 1J05A 5C71A 4ODHH 5E5MA 4OTXH 4L9DA 3NIDE 2AJVH 3GBML 5F6HJ 1I9RH 2R2HA 1S9WA 3G9VA 3K7UA 4P2OC 3O81A 4O9HH 3SCMB 4JY4A 1F3JB 4XMKL 3L5WA 3V4PL 4NJAL 3NN8A 4UILL 3ZKSD 3RKDD 1PLGH 3MO1B 2ZJSH 4PP2B 4LSVH 5EBGA 1T0NA 1CDBA 4NKDB 3QXUA 4IEFB 4C4KO 2P45B 2X9XA 5SV3A 5JPMA 2E3VA 4I2XB 3OMZA 4WY7L 1WEJH 3QHTC 1IM9D 3KPOB 5B38B 1IAIH 2OQJB 3ARGB 4HDIB 1OAQH 1OSZB 2HJLA 5I1KH 4PG9A 2HT2C 3O6MH 5EUOE 4LLWB 2V6HA 3QUZD 3ES6A 1E4KC 2XOTA 4QRPE 2AJZA 1EX0A 5IKCA 2PTTA 4Y7MA 1Q9OB 2PO6A 4ZAKB 1CE6B 3MOAL 1BLNB 1EZVX 3SDAA 2PW1B 4LSTL 4XC1L 3HAEG 3IDGA 5EU6A 5TF0A 2EKSA 4YBLC 3BD4A 3U4BL 1Y18B 3VFUA 8FABA 5E99L 5T1KD 1AR1C 3CFEA 4YDKH 1MHHA 2XY1A 4U6YA 1ZGLB 4HFWB 2GW5A 1JF1B 4Y4HD 5JA9A 4HC1L 3RZCB 5F7LB 3QPXL 3VXUA 3PDOA 5IVXE 2XQYG 2EDNA 3IFNL 2FJGB 4C58B 1YPZE 2XZCL 5T1LB 1U6AL 1IGIH 1TMCB 4JZOB 5C0RL 4Y5VC 5F89A 1A22B 3BGFC 3KXFD 2NNAB 3WN5A 1P9MA 4U1NB 1GC1L 1YUHB 2AK1L 2IQ9L 2R1XA 1RURL 2R2BA 4RQQA 5D1ZB 3PGCB 4P5TD 4WHTA 4RAVB 4HG4K 4M6OH 1EGJL 3DIFB 4LSDA 3MNZA 4KKAC 1HKLL 5KVFL 4TTDC 4RDQF 2IADB 4EVNA 4OV5B 1FGVL 4OQ1A 2FR4B 1S8DB 1HWHB 4FFZL 4EI5A 1G7QA 3CLEL 4DAGH 2UWEF 3O4LA 4GXUN 5E2TL 4OGXH 4BQ8A 1FL6B 1Q1JL 4LCYB 2Q6WA 4RSVA 2WSKA 2DIBA 5IJVB 4AEIH 1I7UB 3MJ9H 3CK0H 3LMJL 1A6WH 3O9WC 3TPKA 4P23D 3QDGA 3EYVA 2W65B 4J3UA 4W81A 3L3IA 4GOSA 3HZYB 4K3EL 2ADIB 3C6LD 1DANT 5IB2B 1UXWB 1XGPA 1YZZA 2FYYA 1R5IA 3V6BR 5GGTL 1V3MA 3RVVD 4JN1H 4Q9CA 3RGVB 2YHGA 4P9MH 4APQA 4EDXB 5C0BA 3VH8B 3GMOB 1IL1A 2DWDA 1WTGT 3MGOB 5B8CA 3ULUC 2OXHA 4L1DA 5KJRH 1NCNA 5FDYA 1UEMA 1C5CH 1RD6A 3VD4A 2CIKA 4HG4J 1LO2H 4PRIE 1C5DA 2P8MB 3BP5A 4FTVE 3GBNL 5IFAL 4R4BA 4V1DD 1VDGA 4X4YB 3ULUF 3SE3A 1E28A 4U1SB 1U8KB 3SJVE 1U3JA 4QRTB 3ZDYF 4U6XA 3P0YL 5I74C 1PQZA 3QZWA 4NHUB 3I75B 1DQTA 3LDBB 2WAHA 4WHYH 2F53A 1DBJL 3HNVH 3OPZH 5E70A 3QIWD 1FPTH 4WU5B 3UBXB 3HUJB 4WEBH 4BFIB 4Z7VB 4QXUH 2VAJA 5GS3A 1W0VB 1K8IA 1G0XA 3E8UH 3QEUB 3VXRD 1TFHA 1ZS8A 4S11A 1UH4A 2ORBL 3W39B 3R0NA 5IB3A 4JFPB 1N4XH 4J3XA 4OLUH 4K7PX 4OKVB 3FO1B 4OM1L 1G0DA 4OIBA 4I0KA 3O2DA 1MHPH 4NC0B 3F5WB 3FRUA 3G6DL 4DKFH 1ZKAA 1BOGA 5MHSD 3HR5B 3ZLQC 1AI1L 5DJ0A 3HPJA 5HYQB 3EYUH 4FQLH 4FQJL 1LO4L 3NFSH 2RCSL 1RULL 4H26B 5D70H 3MCLL 3BPCA 1HZHL 2OZ4A 3LN4B 4DW2H 1AD0A 5DZLA 3GI9L 4GG8A 5IMKB 1UZ8A 3HZKB 3HG1D 2KL6A 4XPFL 3CVHH 2R8SL 5GIRA 3KPSE 3AFLA 3HMWH 4PRNA 1SY6L 3H9YA 2YUWA 5DJ6B 3T1FB 3CSYB 2DQFA 5JW5A 1WCBA 1OB1A 4S2SA 5C0JA 4RX4D 4LHUB 4Q58C 2B5IB 3GIVA 5LQBL 2YRPA 3VMNA 4ZDHA 3E6FA 1T89A 3OKDA 4NUJA 4EDWL 2UVFA 1YNLH 4G9FA 1TJIH 4JQVC 3TNMB 1QO3A 3BZFA 1C7TA 4OIIH 5H37G 5M95B 1CICB 5I6XC 4PV9A 4PLKC 2X05A 1FAIL 5IF0B 4ONOA 1G1CA 5JA8B 2RQ8A 5KANI 4M1DL 3I9GH 3E3QE 4D9LL 5I8CA 2C4XA 5DJXB 1J0JA 1LO5B 2R15A 5T1DH 4LGRB 3SCMA 4OFKA 1F3JA 5IW3A 4LNRB 3CMGA 1MOEA 1H3PH 3MO1A 4PP2A 1E4XI 5AWNL 5HHOB 5F93C 4ZTOH 1X5YA 4NKDA 3MRRB 3MV11 4M61B 5LG1A 2HLFD 3ULVH 1GIGL 5D6CB 2J6EH 4KXZI 3KPOA 1KJ2L 3NH7L 5B38A 4PD4K 2PR4L 5HHMB 3QHFH 2OQJA 4D0DB 1FFQA 3ARGA 4HDIA 1LP9E 4RRPG 5T5NF 5IBTH 1O7VA 4X80L 4NP4L 3ZHLA 4LLWA 5ITFB 4PJ8C 4HIEB 5I8KL 1XF1A 4LRIA 3MLRL 3C09B 4DFHA 3DETC 1CE6A 1BLNA 2BERA 4QRPB 4JY5L 2G75A 3EGSB 5F9AC 1JWUB 4N1HB 1Y18A 1WFTA 4XPAH 5C07E 2FJHA 3C2AH 3U7YH 3C5JB 4Z18A 5GGVL 1OVZA 3O6FD 1I3GL 2X4NB 3HI6L 4HFWA 1ZGLA 4JFQA 3BDXA 4G9DA 1JF1A 4NPYB 4LFHD 5HHVH 3IU4H 4UQ3B 4BKLB 3BKYH 5IBLD 4H1LB 3RY6A 3RZCA 4HV8B 3HNTL 2F58H 4JPVL 1U2HA 2E27L 4LDLB 2FJGA 3FQXB 4S1DD 4JZJB 2JB5H 3BP7B 1PZUB 1I1YB 2NNAA 1EFXB 4NT6B 3ZKXB 4UT6L 1CVSC 4U1NA 4YEEA 1Q0XL 1KCRL 3SOBH 2ZUYA 5D1ZA 1QKZL 3PGCA 1T2QL 1YEIH 1II4E 2CGRL 3CXDH 4P9HL 4RAVA 4WU7B 4XXCA 1M7XA 3GJEB 3QDME 3CCHB 2B39A 2IADA 4OV5A 4MJ2A 4M5ZL 5D7JB 1S8DA 3WKML 4IMKA 2CDGB 1G9NC 4MJ6B 3L3GB 3CLFH 4R8WL 3T2OA 2K3TA 1RFDL 5DFTA 2H2PD 2ICCA 4OLEA 3T0BA 1FL6A 4LCYA 5FUZL 3MLUL 3T0EC 4JDZB 1EJ6A 2B1HH 2J5LC 1LMKA 2WWKT 4HF5L 4GKNB 2C3HA 25C8L 2W65A 1PG7L 1J9CT 3ME0A 5SX5H 1AHWC 3F58H 1UXWA 4J6RH 1NANH 2WBWB 4PJ9D 4YK4B 4OZGA 1A6UH 4BH7A 3RGVA 4P46A 4EDXA 1MJ7L 1FNSH 2G5BB 4N8CL 3VH8A 7CGTA 1NBVL 3GMOA 5INDA 3MGOA 4Z78A 3KJ4C 3UEZA 2EZ0D 5D96B 3V4VL 3TC9A 2V17L 1IMHC 1CDIA 3VWJC 3V0AC 4YAQA 2VZVA 3ULVE 4R0LB 5J12C 3EO9H 2P8MA 4GRWE 3T2PA 4R2GD 2HP4A 5FDWB 3BN9C 4PRIB 4Z7UE 4X4YA 5CCKH 4U1SA 1U8KA 2Y7QB 3WFCL 4QRTA 4H5SB 4OCWH 4NHUA 3I75A 3EOBA 1E4WL 5F96H 3RQ3A 4LEXL 1A2YB 5EULV 1HCVA 4WU5A 2F5AH 3UBXA 5E03A 4BFIA 2H45A 4Z7VA 1AGEB 2AABH 4K3JH 3K4ZA 1KCUL 4M6NL 3VI3F 4RIRB 2ZCHH 3ZHDA 3H42H 1QBML 4LHQB 4HXAH 3W39A 3RZWA 3BIAX 4JFPA 5I66B 4ZAKD 2BSTB 4O2CB 2I27N 4OKVA 5E9DD 1RV6X 4NQEB 1KPVA 3F5WA 5MENE 2OR7A 1RUAL 1IAKB 5CIPH 3VJ6B 5GXBB 1CGVA 3QQ4B 3ARPA 1S7WB 2BNQD 3CU1A 3ZT5A 3T0XA 4YFEA 2P7TB 5HYQA 5DURB 2Z93B 5LKNA 4GLRH 4H26A 1DSFL 2W59A 2IWGA 1BWMA 4HBCL 4FABL 4NSKB 4XNXH 3QNZB 1QSVA 5F9JB 3LN4A 3PABB 1VHPA 2EDOA 5TF1L 4Y1AE 5IMKA 3HZKA 5MI0B 1UM4H 1OPGH 1EXUB 5T1LD 4NM8L 2E7HA 2EDLA 2WINB 4JM2B 3DSNA 4PS4H 2NY0B 2GJ6D 4NHCL 3TZVC 5HD8C 2OJEB 4QYOB 2R4RH 2VLKB 5DJ6A 3T1FA 1ORSB 3CSYA 1SEBB 3SDCB 5ESQA 3RFZC 1QR4A 2DBJA 2PUQT 3HMXA 4J12A 5H8DA 5I1IH 3LD8B 4KI1A 2B4CH 3QIBA 1CXFA 5I76B 4PUBH 4DEPC 4WIQA 3MUZ1 4KV5F 4KKCC 2NXYD 1X5JA 5A2FA 2PF6A 5KN5B 3UTTE 4KJYB 4KK8D 2PN5A 1FNEB 3TNMA 3LPGA 5IMLA 2AEIT 1ITBB 1CICA 3PWNA 3MLXL 5IF0A 1M6OB 1MCPH 1FBIL 4KU1A 4M7ZC 2BHZA 4KUCF 5SWSE 1LO5A 4GQ9L 1FE8L 4BZYA 4LNRA 1TTFA 4NQDE 2VDKL 4JVWA 1FFPA 2FWOB 2PYED 4NIKB 5HHOA 4W6YB 1L0XA 3S35X 4M61A 5BQ7B 4UZGA 3K0WA 2P5EE 2RAMA 2HWZL 3B9AA 3ZKMC 4PGEB 4Y2DD 2H9GB 5EB9A 1WT5A 1GGUA 3U0WH 2OBGA 4MHHI 3TO4B 5H37H 4D0DA 2DQUL 1FO0H 5CLTA 3SDXB 1Q9KA 4X9IA 4FQQB 4JO1H 5I1HH 3T2NL 1LP9B 2DM3A 5ITFA 3DXAE 3K2MC 4XVJH 3QUXB 5IQ9A 3QCTH 2NY4C 3ZT6A 1OARH 5EUOA 1NCUA 4BZ1H 1RZFL 4E5XA 4QRPA 2Y6SC 4YFDB 1F58H 2CO6B 1LDPL 3EGSA 3GSNB 1A7PH 4OUUB 1J18A 3IFPB 2KQMA 2J88L 1JWUA 5E2VH 1UGNA 3JWOL 3QXVA 4O4YH 1KN4H 1S5IL 5DUPH 2NY7L 2XKSA 5ITBL 4N9GA 2LE9A 5F7UA 1W72L 1DLFH 3N1PC 5C07B 2X4NA 2QLVB 4GAGH 3X3FH 1MFNA 4F15B 3WIHA 4NPYA 1U8QA 2X6MA 3P73B 4UQ3A 4BKLA 1QEWB 1YEFL 5F7KC 4KJPD 3FQXA 1GZQA 4P2QE 4JZJA 3BP7A 2A6JB 4ZQKB 1L7TL 1I1YA 5DDHB 3MX0A 4NT6A 1EFXA 1KACB 4X5XB 3ULUL 3MRHB 3CAFA 5DQ9B 3OXSA 1CDCA 5EH1A 5L88L 3SEPA 2AXJA 2BXZA 3H3PH 4QLRA 4Y4FD 1OL0A 4WU7A 3E2HC 4L4TE 3GJEA 1L0YA 4MQXD 3PWPD 3CCHA 4KUZL 5LCVH 4MLSA 2CDGA 1ZV5A 3QDMB 2R0WH 4MJ6A 4YHZH 2CDFB 2Q7NA 2Y36L 4IRSB 2XACC 1ACYL 1PLGL 4PRAA 1KF9B 1JNLH 1ED3B 1A6ZB 4MAUL 5ILTH 1G6RH 3NFNB 4DK3A 3V6FB 3SKNB 2NYYC 1KUMA 2F74B 1Z0MA 1WISA 1Z9LA 3DMMC 4JDZA 2Q76B 3A67L 3RTQC 2R2CA 1YY8B 4GKNA 3W0WD 3FFCB 1WEJL 4BUGA 3S7GA 1IAIL 5GGRA 5DHVH 4HWZA 1OGAE 1OAKL 1MCEA 4O02H 4FQPA 1KG0B 5HDLA 1R6VA 3DVGA 2VDRH 3O4OC 4LSUH 4MA3B 1S9VB 1UKQA 2GSIB 2BVQB 3KJ6H 3OAUH 2NXZD 4U1MB 5DMKA 2VWEE 4R0LA 1YMMD 4PJHF 3BAEL 3CMOH 2Y4SA 32C2B 3EDKA 5FEBA 5FDWA 2VL5B 4Q6IB 1DUZA 4PRIA 1T5XB 4AY0A 1JIBA 4OZHB 4FTVA 4YDKL 3U0PB 2Y7QA 5ICYB 4JHAH 4Z7UB 4H5SA 5IW1A 2BMKB 3MV01 2JTDA 4GW5A 1CGXA 2HVJB 4AEEA 5FM8A 4H8WC 1A2YA 2V2WB 2OL3B 4X4XB 4YHIB 3BI9X 2ENSA 3U36B 4RIRA 2FEEI 4YUEH 5F1OB 4U3XA 3QIUB 3B8YA 2F8XC 5DWUH 1K8DB 1H3TA 5I66A 3WSQH 3GHBL 2OI9C 5CHNB 4NQEA 1I7RB 5ELIA 3BHBB 5D5MF 1H8OA 3IFLH 1IAKA 3H9SB 5KSVB 5DC4B 4RFOH 5JIPA 7FABH 1S7WA 2E6PA 5BRZE 1OAUL 3VGHA 2P7TA 3BSZH 2Z93A 2V7NB 4YHYB 3D9AL 2HH0H 4UTBL 3FB5B 3WO4B 4AEIL 3UC0L 4NSKA 1FYTB 4I3GA 5HI4D 3EZ8A 4ODBD 3ZKNC 3PABA 5J0BA 5BS0B 1WGOA 5CEYB 2EDEA 2R0ZL 5CUSL 5J11C 5SX5K 4ERSL 2CRZA 3DGGA 2YN5A 4ZPVB 5HVHB 4JM2A 4Y1AB 2YN3A 2JJTC 2YK1L 5I73B 3NCEB 2WIMA 3G5ZB 2VLKA 3QJHA 2VZUA 1ORSA 5E6ZA 1JCKA 1NAKH 1SEBA 3SDCA 1FIEA 4P99A 4QHLB 2ZUTA 2EXYC 1E6OL 4TPRH 1CR9L 2F5BL 3RX8A 1VACA 2XZZA 5FCSH 2BDNL 4P4KD 1C5CL 1HHIB 3FAWA 1UEYA 4LRNH 1MCFA 3KLSA 5I76A 4YBQC 4LPXA 5D7JD 4OM0L 5EORH 3P0VH 5KN5A 1B3JA 2EDJA 2CO7B 3QUYC 4UOJA 4KJYA 1FNEA 1NL0L 4I0PB 3K8KA 3RKPA 2HMIC 5FHAL 3MTRA 2X89A 4XCNB 1M6OA 2IAMD 4G6AC 1JZ8A 1T80A 5JOPD 1K3ZA 4XHQA 3K1KC 5DZNA 1EVUA 1GAFH 4M6MH 3C6SB 5L8KB 4UB0H 4HMDA 3RVTC 2GUOA 4WCYL 3GO1L 3LCYA 4S1SH 5LAXB 1UJ3C 2QQNH 4N0FB 4B7IA 5E8DH 5EBWB 5EU3A 1D6VL 1A4KB 4PPTA 4LSQH 2JIXB 2IANB 3V2AR 5BQ7A 5E0QA 3AS1A 3BN3B 5B4MD 4FQ2H 3ZL4L 4PGEA 2YMXL 1CG9B 3HI1A 2O61B 2H9GA 3TO4A 4Q9BA 4DKFL 5L2KD 2IPTH 5J6HB 3L3JB 3SDXA 4K94C 4FQQA 2Q7YB 5HBBA 1LP9A 4XPBL 1T66C 1X5XA 3MBXH 3QUXA 4XX1G 4XHJC 3CX5K 1QSEE 2WMPA 1Z9MA 2GJJA 4WFFD 2EC9T 5DLML 4DW2L 3BP6B 4NJ9L 4OUUA 3SPVA 2Z31C 1UVQB 3O8XD 3IFPA 5B3NA 1Q9LB 2Y07L 4LFHG 3I02B 4QGTA 4NKIH 2WM0A 3U48A 3BEVB 2B7DT 3HMWL 1JRHH 1M05B 2QSCH 3R1GH 4OF3A 4LVHB 4KI5C 1S7QB 1IEHA 3GSXB 5C07A 3WJLC 5IHBA 3EDEA 1YEHH 1K5NB 3REWB 1F8TH 5C08D 4OZIF 4JKPL 3P73A 5FO8B 2W91A 1QEWA 1MHCB 4UV4L 1IRAY 4PJCF 5ESVA 5IROC 4KI5F 1JHTB 1KOAA 2A6JA 4ZQKA 1DQLH 1D9KC 5DDHA 4EXKA 4X5XA 3FONB 5JUEH 3MRHA 3H0TB 5FF6B 5DQ9A 4FA8A 4WWKB 1FNLA 3QH3B 3BH8B 1U8OB 1SMOA 1UZ6E 3QG7H 5GJSL 3VRJB 5ISZE 1QFWL 1JZ2A 3DX7A 3KPTA 4L4TB 4KTEH 1T3FA 3AY4A 2CKBH 3TYGH 5KZCB 3QDMA 4MXVF 2CDFA 3WLWC 4JO3L 4G8GD 1JV5B 4U1JB 5CJOH 5FM5O 4IRSA 1H3PL 5FYKD 2DQDH 3KYOB 4OZFG 4PJXF 5IMMB 4RFEB 1A6ZA 3V6FA 1WSST 3SKNA 1XR8B 4JJ5B 2FCBA 2F74A 2Q76A 4L4VB 4R7DA 5ICXB 1YY8A 1BOYA 2J6EL 2YRLA 1JMXA 3QHFL 4QY8B 3DUUA 4UIKL 4JG1L 5DS8B 1A6TB 4HT1H 4BK5A 1B4JL 4JB9L 1DFBH 4GUPB 4MA3A 5A16B 5J13B 3MOBL 4NZRL 2XTJE 2WBJD 1CXEA 1MNUL 1A6PA 5EO9B 2BVQA 1TQCB 3AROA 4U1MA 4MS8D 5D2NB 4JE4B 3PL6B 4D3CH 32C2A 4POZD 1FVEA 3OJVC 3RVWD 1JNNL 4HPOL 2VL5A 1VKXB 1KIUA 1T5XA 3LKQB 1WZ1L 4RMUA 3FO0H 1S5HB 3PHQA 2X4OB 3V8OA 4JQXA 5ICYA 1B0RB 2XWBB 4Z7UA 1OAXH 4C54A 1OW0A 4MYWB 5DJZB 1BZ7B 5T3ZH 3UJJL 4GBXD 3KLAA 2D7PA 3IRPX 5HHVL 2HVJA 4X8JB 1U8IB 2YXFA 1ZLSH 4PGDB 3W5MA 2V2WA 2OL3A 2JB5L 3VXSD 2CXKA 3RKDC 3U36A 3QXWA 5D7LB 5J9PA 1KSRA 3QIUA 5CD5D 3EYFB 1K8DA 1IILE 4JPWL 3CXDL 4JHZA 3QI9D 4RISH 4QHMB 1TDQA 3OKYA 5IJKC 4R9HA 3WJJC 1I7RA 3SDDB 4AIOA 2HVKB 3KPRE 1EERB 2LAGB 3BHBA 3OBAA 3H9SA 5KSVA 1E0OB 1N2RB 3D0VB 3EJYD 2JJSA 1U41A 2ZUXA 3AB0C 3BZEB 4XZUB 5KW9H 2EIZB 3QUZC 1F90L 2V7NA 4WTZG 3I6GB 4QXGL 3FB5A 4UOW0 1DQMH 2B1HL 1B90A 5BS0A 1NPUA 2J7LA 4YHML 3GGWB 5CZKA 4TTGA 1TVBB 1YDPB 5CGMA 1X44A 2X7LB 5KTEH 4ZPVA 4Z0BH 1D5MB 3VW3H 4Y1AA 2ADFL 1BJ1J 1UM5L 4BELD 3C60D 4Z7OE 3G5ZA 3D3VD 1A7NH 1Q94A 3S5LG 1FNSL 4QHLA 1WVZA 3I84A 4G6MH 2ZWLT 4CADB 4XCFH 2CH8A 4HGWB 4YQXH 1MCDA 4Y4HC 2WP3O 4ELMF 4L8SB 1MY7A 5C9JB 3DV4B 3UO1L 3RI5F 1YEGH 2DJSA 2FGWH 1UA6H 4U0QB 4BQCA 4E0RB 4I0PA 4J7RA 4N0UE 5C2BH 5FV1L 3UTTA 2ERJB 3CSGA 1BM3L 2Z92B 3DSFH 4XCNA 3LV3A 3S3SA 4L9LB 4DGIH 4LPWA 4P5TC 1X3DA 5FUOH 3O2VH 4OCWL 3FFCD 3C6SA 3CH1B 5SWQB 2R39A 3MZGB 5GGQH 3RU8L 5LAXA 1OT1A 2F5AL 5SWSA 5BV7C 1N0LA 4N0FA 2AABL 3PQYE 4F3FB 1YN6B 4MA1C 4XNZC 2JKXA 3AM8A 4K2UL 1MJJB 3PGFH 1A4KA 1IAII 4ZXBA 2JIXA 2IANA 2R29L 4HXAL 5TH2A 2FEDD 1JYXA 1S3KL 4XB8A 3ET9F 3MXVH 4FQ1L 5T3ZE 5DUMH 2D7QA 4KMLB 1YECL 4P23C 1IQWH 1I9EA 3KPNB 3Q6FB 4RGNB 4GG6B 1QYGL 3C6LC 4N90E 5J6HA 3L3JA 5EA0H 5C0CD 1MCNA 2Q7YA 3RVVC 1PDKA 4KKLD 3D39D 1SEQL 2AKRB 2XWTB 4WEMB 4XCYB 1IM3A 5GZND 2BNUB 4M4PA 1IGYB 1NC2D 2QKIB 2CIIB 3FZUD 4Y2OA 3B2UD 4I3SL 3RWEA 4BA8A 5HYSB 3L95B 3BP6A 1QSEB 4KQ3L 2HT3D 1IVLA 1A3LL 5I71C 1UVQA 2DJ4A 1Q9LA 1KJ2B 3MV7E 5B39A 1H5BB 3I02A 2PYFA 3W82A 4PS4L 1XIWD 4XP6H 4Z7QF 3GSXA 2IG2L 2HKFH 4F2MB 1K5NA 3IYLW 2APFA 4LLMA 4MX7B 4MA7L 4DN3L 1MHCA 5EZIL 3QIWC 3S37L 1NUNB 1T22B 1JHTA 3ARYA 4NUGL 1FL5B 4NO0B 4YGVB 3C8HA 3VG9B 4P2QA 4A2LA 1MCWM 3H0TA 4M7LT 5FF6A 2VLJD 4WWKA 3U7WH 4R4ND 1FYTD 4HIXH 3QH3A 4YXKH 3BH8A 5EZOL 1TVHB 1V3JA 1MEXH 3VRJA 2D03L 4HC1A 1KTRL 3ZE0E 1S9YB 4G7VL 2APTA 4L4TA 4XTRD 5HPMB 2GTZB 1MCOL 1RUMH 1GHFH 4I48B 4G6KL 4LASL 4F9PC 1JV5A 4U1JA 3FQNB 4UINL 1MFEH 4EXPX 1G7PB 3KYOA 1OTSD 5IMMA 1UFUA 1AO7B 4HQQH 4P3DB 2Q87A 3TIEB 2IFFH 5CJQL 4JJ5A 5C9KA 2OR9H 4L4VA 3O6KL 2J4WH 1NGWB 4RZCB 1EGJA 4X6DE 2ZSVB 3QXAB 4H8WL 3RDTB 2HTKD 3X12A 1FVDB 4QY8A 1D5XB 2DM4A 5DS8A 1A6TA 5K93A 2AEQH 1A1MB 1CE1L 5JORB 1E6JH 5L9DH 3MNVB 2VDNH 5A16A 1GGBH 2AEPL 3SDYL 1NUDA 5EO9A 2IMNA 4DFIA 4QRUA 3BJ91 2DKUA 4UNUA 4OZFH 4J8RB 4AT6B 3PL6A 5E08L 1C1EH 2PKDA 1IBGH 5DI8B 4KRPD 5E2VL 4O4YL 1V7MH 2A9NL 4O2EB 1VKXA 3O3AB 3QEQE 4OGYH 4XVUD 5GGTA 3DUSB 3T0VA 4CVUA 3SKUD 1S5HA 3UDWC 2X4OA 1T0MB 1XF2B 1B0RA 1MI5B 1UJTA 2XWBA 1RSFA 1I1CA 1QHOA 5DJZA 1BZ7A 4V2CB 3NZ8A 4TUOB 4X8JA 1U8IA 4OGZA 3CH8A 4I3RL 4PGDA 5HVFB 3MBEA 3K1DA 4JO2H 2BC4B 1HHHB 1PY4A 5D7LA 5DGRA 1JK8A 3C5ZB 3EYFA 1UM6L 4HJJH 3QB7C 3VWKB 3KYKL 2FATH 2HLFC 3MXWH 3SDDA 5LCVL 1FNGA 3DI2B 3HI5H 2J8OA 3STLB 1N2RA 2R0WL 5F8RC 2R4SH 3UJIL 2YPLB 3HFMH 3FMGH 3KPRB 3NCYP 3BZEA 4XZUA 3FN0H 5C8JA 3LQMA 4ZOBA 4XBEH 5HHXL 3I6GA 5JIKA 1AD9B 4HJ0D 3ARDA 4NN5C 4LPCA 2VKXA 1CFVH 1P1ZB 3GGWA 4FP8H 1MFCH 1UCTA 1TVBA 4LCWE 1D5MA 5HVWA 3L7FB 4LVNC 5IVOA 4OCMC 1MFBH 2AEWA 4CAGA 1N8ZA 2W9EH 1U58B 2EDXA 3SQOH 2Q8BH 5DQDL 2FD6L 4EUPG 3F65A 1V7NL 2BY0A 3O6FC 4CADA 1IFHL 2DQHL 2KKQA 3OAUL 5F44A 2DLEA 4P2OB 3OB0H 4BFGA 1MIML 5IBLC 1NGYB 4GRMB 3DV4A 2PW2B 1SBBA 4K94L 3ZDZE 1FRGH 2NY6C 3ARXA 4S1DC 2I24N 4E0RA 1RZJC 2NX5E 1SY6A 4FZ8H 4PJ7E 5FYLL 4DUWA 1R0AH 1CFNB 2W9DH 1I85A 1IC4L 1OM3H 1FL3A 3K3QA 4IDJL 4L9LA 1NSNH 3L5IA 5EBMB 4BFBD 1F4XH 1NMCC 2IEPA 3CH1A 5SWQA 3MJ6A 4PY8I 1BIIB 2V9QA 2JCCE 1ND0B 4F3FA 1YQVH 4BSWB 1MJJA 2H2PC 3CSPA 5J4MA 5KSAA 1QFHA 1RIHH 3P9LB 5I18L 1NLBL 4S10A 2Z4QB 5IOPB 4Z9KB 1JGLL 4W6XB 4AG4L 3KPNA 3Q6FA 4YBLB 4YHOH 4GG6A 4YIQB 3IXAB 4PJ9C 2GFBB 1KB5H 3VGGA 1A64A 3BSZL 4XPHH 2MTPA 2HH0L 2XWTA 3L6FB 1IKNA 4F58H 2BNUA 1RZKH 1IGYA 2QKIA 4WWID 2CIIA 2E5EA 4TVPD 2EZ0C 3R0MA 5HYSA 1QSEA 2EE2A 2OLDA 5TDNA 1CZ8H 2J8UE 1KJ2A 3HLAB 1QOKA 3LB6D 4JHBA 1H5BA 4P57B 4Y5VB 3G08B 4R2GC 2G2RB 1CF8H 3S4SG 3UJTH 2UWEB 1NAKL 4JR9H 2WQRA 4F2MA 1NBQA 3X17A 5E2WL 5JW4Q 3T8XB 3HE7D 4MX7A 1MCBA 4L3EE 2O93L 1LEIA 3D48R 1OP5H 1DVFD 1T22A 5C09D 3P0VL 4NBZB 1MVUB 1FL5A 4NO0A 3T0EE 3H3KA 5DFWH 1W72B 3FTGB 4JRXE 3MGAA 4ZAKC 1PYWA 4NNPH 1TVHA 2D9QB 3VRLF 3O9WB 2X41A 3K8LA 1K4DB 3WFDL 4UB0L 3UTOA 1S9YA 4LKCB 4MLIA 5EU4B 5HPMA 1GXEA 5DJCB 2GTZA 1VFBB 4I48A 4WI4A 2QQNL 3FQNA 5DQJA 4DTGH 1PW3A 3QYCA 1AO7A 4XGZB 1HWGB 1A3RH 4P3DA 4OKDA 3TIEA 1F4AA 4WFED 1NANI 4QRSB 1F4WL 4YDIH 2ZZUT 4RZCA 1NGWA 4G9FD 2ZSVA 3QXAA 2M26A 3RDTA 4GSDL 3RVXD 1FVDA 2DQJL 3I6KB 3ZSSA 1D5XA 4QRRE 1MLCB 1NGQH 2IPTL 4G80B 1A1MA 3FOMB 3OKNB 2ESVE 4KAQH 2DB8A 3JVGA 1BHGA 2ZCKH 1BQUA 5JORA 3MNVA 2QADD 3CFJA 4WUKL 3SGJC 1EHLH 5ICZB 3AVEA 3IRZA 1S7UA 3TBSA 1CTNA 4J8RA 4UU9B 3ZE2F 4TSBH 5DI8A 3Q3GB 2NXYC 3MQIA 3TH4T 4O2EA 4D0BA 4KK8C 1JRHL 2QSCL 3O3AA 4NYLB 5BXFB 3DUSA 5CMAB 4G6JH 3HPLB 3U9PH 5HYJE 1T0MA 3VFPA 1MI5A 1XF2A 4OI7A 3OKMB 2QR0B 1RUQH 4TUOA 1F8TL 1QBBA 3P40A 2QSTA 2OCFD 2DQEH 3MLVH 4XC3L 3MODL 3KLDA 2BC4A 3GSVB 3SE9H 1HHHA 4NRXB 2VLRB 1DQLL 1U8NB 5D8JL 2XT1B 3C5ZA 3SKJH 4R96A 5JUEL 3CFKB 1LEKB 1H0DB 2NY2D 4TNVF 2VO5A 4RMVA 1PX4A 4ZS6D 4UQ2A 3QG7L 5L8LB 3VCLB 4Y2DC 4GLRI 1I9JH 4C56D 3GNMH 2AS5M 4KTEL 3TYGL 3STLA 1A5FH 2YPLA 3KPRA 4CJ1A 5CJOL 4U6HB 1CDJA 4DGVL 2JF1A 2ZP0T 1AD9A 3VG0H 4LU5H 3ARQA 4NQCB 3JV0A 1P1ZA 4KZEL 4N8VB 4TUJB 3INUH 4G7YH 3SBWC 5BV7L 5LWYL 4YHKL 1PD6A 1NCDL 3K80A 2QHRH 4NZUL 3L7FA 4PJBF 4U3HA 4ZFGH 5JNYB 5C0GB 3FO2B 3BEWB 4LCWB 5I6XB 2IQAB 1UG9A 2F15A 3L3HB 1ZSDA 4P2OA 3LHPL 4U6VL 3NOIA 1XF4B 3IT8D 3NGBC 3MA7B 1NGYA 4WUUE 5IESH 4KK9D 3DWTA 4KJPC 4ZNEE 2R2EB 3NIGF 1MWAH 3NTCH 4OQTH 1VPOH 1CFNA 5JQHC 4AJ0A 3WNNA 2AI0H 2ZCLH 5F8QC 5EBMA 3T0AA 4R7NB 4PRHB 5DTFB 2VH5H 3IXTB 3L3OA 4Y4FC 4P49A 4PJDE 2P5WB 1NC4D 3QDJB 4MQXC 4CDHA 3VDBA 3X3GH 1PKOA 4Q7DA 4P46D 1BIIA 1G9MH 1UENA 4EUPH 4BSWA 1E4KA 5CJBA 4PJ8B 1Y6KR 2PXYD 1CI5A 3P9LA 1ZANH 1XMWA 2E6JA 5ANME 2B5IC 4RISL 3VFGH 1XAUA 2HKHH 1IEAA 5LGHH 2EYTB 4MNHB 4TULL 5ECJE 4Y0GA 2COQA 4YIQA 3IXAA 3M8OL 2NR6D 3G5VA 4MNQE 2GFBA 5D72L 5KW9L 3TBWB 1T1WB 2ED9A 3V7AE 4KQ4H 4J23A 1NGPH 4KPHL 3L6FA 1M4KA 4WTWA 3LOWA 1WV7T 2NXZC 4HHAB 1KIRB 4HPYL 1TTUA 5CP3H 1MCIA 3HLAA 2CR6A 2CRIA 3WHE0 5HHNB 4X99B 4P57A 3VFMB 3JTTB 4F33B 4Y5VA 4Y4KB 3VW3L 3G08A 1X9QA 2J8UB 2IGFL 2RIKA 3GJFH 1DBKH 5C0IB 1G7JB 3B2VH 3IAQA 5ETUB 3NABL 4IHOB 3VWKD 1GOFA 3ARFB 5EUKB 4G6ML 1RPQA 3T8XA 3MLTB 3K81A 4OB5H 4LLDB 5GRUH 1T20B 3ZYIA 4H0HB 4XBGB 1KEMH 1FHGA 5AG8A 4KK6D 1MVUA 5DVNA 2YOCA 3GMMB 4LPVA 1FAKT 2P44B 1EO8L 1OD7A 5FYJH 1W72A 5DEGB 4EI6B 5FKAB 1L0QA 2J5LB 4LSSL 4OLZL 3EW3B 3O9WA 3O2VL 5DHYB 2XPGA 1K4DA 2W38A 2AAVA 4LKCA 5K9KB 5EU4A 5DJCA 1AHWB 3CVIL 4JHWH 1CD0A 1VFBA 4IRJD 5CAYB 4K9EC 5GSVB 5DK0B 4Y19B 1OGTB 4JRYB 2V5TA 4XGZA 4NKQB 3KJ4B 4GS7C 3BE1H 1BX2A 4R6UA 3GMPB 3D69B 1J0IA 3MXVL 3VWJB 3ZTNH 5HI4C 2O5ZH 4E41E 5J12B 3WLBB 5DUML 5JQ6L 2BK8A 3I6KA 5HGDA 5A1AA 4GO6B 1AKJA 5GGUA 5FYKH 3FOMA 3OKNA 3CFCH 1NQBA 4KGJA 3OKEB 1F97A 1VB9A 4M7KL 3RPKA 5EPMB 4CGTA 4NFCA 1RZGA 2K1MA 1U2CA 4P4KC 3STZB 5ICZA 1WWWX 5JPNB 3VFNB 2MSPA 2VQ1B 4UU9A 2NY5C 4TSCL 5D7JC 3UROR 4QRQA 1Q0YL 2N4IA 3Q3GA 1BD2E 5FV2A 2VDQH 5C70A 2WK2A 2DJUA 1KB9J 3V0VB 1XR9B 4NYLA 5BXFA 1I8LC 2VITB 5CMAA 4OD3L 3HPLA 4MDIB 3IU3B 4FZEH 4XP6L 3KS0H 4RBPK 1RJLB 5AG9A 2YD2A 2ARJB 4HK0B 3OKMA 3IDYC 2QR0A 4PJFF 3S88L 5JW4N 2WV3A 1HYRC 1ZT4B 1RJZB 4K7PH 3GSUA 3UTPD 5E4EC 2HRPH 3GSVA 2VLRA 3MUJA 4FFYH 1UYWH 15C8L 1XGUB 3BPNC 1AFVH 1LEKA 1H0DA 4YE4L 1MVFA 1IT9L 1BREA 2F54B 3AXLB 5DD6B 5KAQG 2H32B 4UOW1 5B4MC 1MEXL 1VFOA 2YUXA 3VCLA 5DD0H 4X6BB 2LQRA 4AMKH 3NMEA 4WO4D 3WE6B 2ZKHH 2GK2A 1RZJL 1GHFL 1Y0LB 3QWRA 3TZVB 2CRYA 1JP5A 1IJ9A 5T33H 4U6HA 4OT1L 3U9UB 5C0DB 3PF2A 5AZ2H 1YMHB 2IFFL 5FYJE 2E6QA 2OR9L 3HAEB 4PJ5D 3LQAH 4F7EA 2YPVH 4QOKB 3EDDA 4YZFE 4DEPB 5JHDD 5HYFA 3X14B 1HHKB 3RNKB 4TUJA 5HDOA 3VGBA 3O8XC 5JNYA 2DI9A 4JQVA 3PP3H 1ULVA 2DIJA 1GPOH 1JZ5A 3BEWA 4LCWA 2IQAA 1UWGH 2GQHA 1DANU 4XP1H 5L9DL 4HZLB 2X10A 3EKCA 3QJFB 5IQ7H 4M7ZB 1QSZA 4P3CH 2M1KA 1XF4A 3MA7A 5CWSB 5C6TL 1IBGL 3OV6A 1P5UA 4X5WB 1QSFE 5D7SH 5GRJL 4WUUB 2I25N 2IMMA 1D5IL 3MCKB 2J2ZA 1MJUL 3MV9E 1OP9A 1JL8A 3GUTB 4AENA 1CLYL 4I1NB 3IXTA 2P5WA 2NZIA 4KRMB 3QDJA 1XZ0B 5DT1L 4L29B 5MI0C 4WDIB 4PJDB 1OLZA 1YEEH 4ZO7A 1SJEB 4ZSOE 3WL9B 3T77B 4PJ8A 4IBLT 5DJ2B 2GYSA 5IGXL 2NY4B 1TETH 2VZOA 4R90H 5D9SA 3QZWG 3MXWL 5CEZE 1I3RA 4MNHA 5CS7A 2BJMH 2PETA 2NPLX 3HNSL 3HI5L 1IGJB 3HS0B 4BSJA 3ZO0A 2DQCH 3SO3C 1UWEL 4AEHH 5DVLA 4YXHH 3U79A 1VEOA 1H3VA 4YHLH 1WFOA 3TEUA 3TBWA 3FN0L 3SJVD 3Q1SL 3UTSB 4HS6B 4MNQB 1NUFA 5D7KD 1MUJB 1JRHI 3OF6D 2WBJC 1KCVH 4JDVA 3KR3L 5EC2B 3B8SA 1KIQB 1TPXC 4MQTB 5C0EB 4HHAA 1U8LB 4MS8C 4FP8L 1MFCL 1G1YA 3G6JE 5HHNA 3VFMA 2V9RA 4F33A 4POZC 3RVWC 1BEYL 1D5ZB 4KVNH 2J8UA 5C0IA 5IHUH 1G7JA 1OTUD 2KBGA 3FCTB 5DK3A 5DRXA 3C5SB 1GGYA 3DROB 4IHOA 1J1OH 1H3WM 6FABH 1CXKA 3KDMA 4LLVB 5EUKA 1R24B 5JTWA 4LQFL 4WEUD 5HDBE 2R0KH 2NY1D 4GBXC 4R3SA 1JFQH 4LLDA 1FP5A 1T20A 1Z9SA 2BRRH 3CPLB 5KVDH 2RHEA 2EXWD 5C86A 3GMMA 1JHLH 5ADPL 1KJVA 1BBDL 1RAMA 4ALAH 2HLAB 1X5HA 4CVZB 5CD5C 4U1KB 5DEGA 1J11A 4EI6A 5FKAA 1FZOB 3T0EA 1OAYL 5F9WC 1AR2A 3MRJB 1F4XL 4NQCD 3QI9C 4Z77B 5DHYA 1P84K 5F7FA 2UVEA 5L2JA 3OGOE 2XN9E 4JRWA 1BVKB 2OTPA 3WMSA 3KPSD 1AHWA 1ZA6B 4A6YH 3QISA 3EJYC 3MV8B 1JWMB 1JGUH 1QP1A 5GSVA 3HR6A 4U7SA 5DK0A 1OGTA 3O4OB 4JRYA 4K3HA 4Q9RL 4BYHA 3K8MA 4G5ZH 4KKNA 1VGEL 2C3VB 2J12B 4PJIE 3LS4L 3GMPA 2P24B 3D69A 1J1XH 3VWJA 3LKRB 3AS0A 1X5AA 1MQ8A 2DF3A 2X4PB 3VXQB 5F1IB 3OB8A 3KYMA 2V2XA 4YHOL 4UV7L 3GKWH 1YEKH 3WFEH 2P8PA 3D18B 2R23B 5A2IH 3C60C 3OKEA 2H8PB 4QRRA 4ODTH 2APXA 1MRDH 3GM8A 5EPMA 5D71H 4PRHD 1MH5A 2ATKB 3QULB 3C9NA 1NLDH 5B38G 3STZA 5JPNA 1EO5A 3VFNA 2YD4A 2J6EA 2IH3B 1FFNB 3QDHA 3KAAA 3B9EA 5D5MB 1CDUA 1KGCD 1MRCH 5KS9F 3V0VA 3WXWH 1XR9A 1SHMA 2QQKH 5LBSL 4I77L 5E6ID 4JFEB 1JBJA 1A0QH 1RJLA 4XNYL 4CMHC 2OI9B 2ARJA 4HK0A 5HYJA 1NCTA 2G60L 1QUNA 3MROA 3LRSB 4J1UB 3QQ3A 2DQIH 1RJZA 4FHBD 3PE9A 3SGDI 3V6OC 1T04B 1XGUA 1NFDF 2ENYA 4AZ8A 1V3LA 3U4AA 1TJHL 4KRNA 1FDLH 2RR3A 2F54A 5JMOC 3AXLA 2FEDC 2ZUWA 5DD6A 2H32A 3ECBB 4P5MB 4NNPL 4XVTH 4NDMB 1EIBA 5J11B 4ZD3H 4X6BA 2X5PA 1R3IH 3RUGF 1UQSA 1QRNE 4M43L 3WE6A 4Y4KD 5CBAB 3TZVA 1Y0LA 1A7OH 1MRFH 4DCQB 4Q6IC 1HHJB 4JLRB 5ENWB 4X4ME 3ARFD 1A3RL 2V5RA 5IIEB 4KKLC 3FT3B 4Z7WE 1RMFH 3C2SA 5GZNC 2H41A 3HAEA 4KY1L 4P5KB 3QHZL 5KVMC 3FZUC 4LPTA 3B2UC 1F13A 4P2RD 1KBGH 5KSBF 4ISVB 2YKLH 1HHKA 2XZAH 4MJ5A 2HT3C 4P48A 5F71A 5SWZB 3RNKA 1K6QH 4PYHA 3QUYB 3OJMB 3VGAB 1KT2B 5JR1L 1J86A 5FUCC 4HS3B 4KAQL 1XIWC 1WICA 1GGCL 1JPFB 5DD5H 3ROLB 5FGBC 1ZOXA 4HS8L 3O3DB 3QJFA 5F1SA 3PV6B 5EZJB 4HLZG 4DQOH 3BRFA 3FQUB 3IDJB 5A43C 1J8HB 3CDGB 1B88A 2Q3AA 1UJ3B 1GGIH 5CWSA 4XPTH 1YQ2A 3RL1B 5CP7B 2VAAB 4X5WA 1J0KA 4ORZC 3EYOB 5DHVB 2EECA 1CTOA 2RFXB 3JWDH 4WUUA 4XAWH 3MCKA 1CLZL 4ZTPH 5H35B 4Y19D 4ZNEA 4G8IB 1QSFB 3A6CL 4TUKH 4YHYC 3VXNB 4YDVB 2DDQH 1FZKB 2CMRH 3E0GA 4R4NC 3BP4B 4OLXH 1P4LB 2O5YL 1SM3L 1RUQL 1QLFB 1XZ0A 4L29A 2EDDA 4WDIA 2A1WH 3P4NB 1QBLH 2HFEB 4PJDA 2DQEL 4M62H 4DUXA 4XTRC 1KEGH 4HUUB 5J56B 1SJEA 3WL9A 3T77A 1YC8A 5DJ2A 1OTSC 3AS2A 3SKJL 4DVBB 1G7IB 3ZKQD 4RWHA 4ZFOA 3LKPB 5ADOL 2C1OB 4L8DA 3RIFF 3ULVD 3I2CL 1PVHA 4OZIB 2HTKC 1I9JL 1IGJA 3GNML 1HIML 4B50A 5I1CL 2YC1A 5GRWA 1AE6L 1N5YH 4KDTC 1A5FL 5JOFB 4ZUUA 3V5KB 1PZ5B 1UWXH 5DRNB 4HS6A 1ONQB 4MNQA 3CJJA 4ZO9A 4GMSH 1T03L 1MUJA 1NMBH 2YSSB 3V0WH 5EC2A 2QL1A 1H3XA 3VD9A 1KIQA 4U1LB 4YDJB 5C0EA 2FX9L 1U8LA 2BSRB 4MD4B 3LEVL 1MHEB 4G7YL 4FFWD 1WZLA 3PP3K 5FYKU 2R69H 2A6KA 5CINH 4K9EL 5L6YL 3EOTH 4KRPC 1CXLA 3VXRE 1D5ZA 1D9KB 4Y5XB 2FBOJ 5KG9B 1EEZB 3G6JB 1IC7H 2XZQH 4XVUC 3FCTA 4PJXB 3LN9A 5I2IB 5EU6E 2HT4D 1R24A 1WWBX 4OD2B 2M8XA 4YHPB 3UP1A 5MEND 1U36A 3CPLA 1ACZA 1ZLUH 1F5WA 1U0QA 1ZHBB 3D85D 3F7YB 5ESAB 4F37F 3WV0A 1H15A 4JN2B 4YXLH 1MWAL 4OQTL 2LFGA 3CZFB 2HLAA 3LEXB 3O2DH 4CVZA 4U1KA 1D3CA 1FZOA 2B8OT 4X98B 4FNLL 1P2CB 3DMMA 3N85L 1EJOL 3RTQA 4FQCL 4QOKD 4JQIH 3HG1E 3MRJA 4KTDL 5DYOB 4Z77A 5A40E 2A6DA 2NY5L 5I1LB 1JPST 1BVKA 1NDMB 3CDYA 3IDIB 3MLZH 4HX1B 2X4UB 2LU4A 4ONHB 4PRDB 4QTIL 3MV8A 1JWMA 2XN9B 1DLHB 3QWOB 2YD1A 4MJ4A 3QCUH 4EZMA 4ONGH 2C3VA 1ZANL 4HJ0C 4JKWA 4PREB 2HJKB 2P24A 2YRZA 5IUSA 1AGFB 3QRFM 2E7BA 3S9DB 2X4PA 4KMTH 3VXQA 4PJIB 4XBPB 3QR2A 3O4LE 3ALWA 5CSGA 2W0LA 1IARB 3VXMB 2R23A 5KAQF 5KBNC 4PB0H 1SQ2N 2Q8AH 1NDGB 1CQYA 5EBLB 4MJID 3TP4A 1NGPL 2EDYA 4JDTL 2E8YA 2NW2B 2ATKA 1MJ8L 3QULA 5SWSD 3NZHL 5K9JL 1G7HA 1PGRB 5E8EB 5K9OB 2CLZB 4EKXA 1FFNA 4NQDD 1XF3B 5C0BE 4ONFL 2JJVA 5D5MA 4NGHH 3RRQA 1U8MB 2EO1A 3EOYG 5I19L 5I75C 4H20H 1GC1C 1LE5B 2P5ED 1JTTA 5IV2B 3VD7A 3MRGB 4OBRA 4O00A 1T7XA 5FCUL 2C4FT 1IM9B 3EFFB 4J1UA 3LRSA 5IB1A 4UNTA 2BVUA 5GRUL 4LPYA 3VMOA 4P59L 4DK6A 3BOVA 1AXTL 3AB0B 4E42A 3IVKB 2N7BA 4X7CC 1WQVT 3TV3H 3DXAD 5A2JH 1QR1B 3QUZB 3MLSL 3WIFB 2AXGB 1ZT1B 3UTSD 1T04A 2OP4L 5D1QB 2F53E 4TQEH 4MMZC 3ECBA 4MCZB 1PBYA 4UI2A 4JZNB 3TCLB 1URLA 5D2NC 5SX4H 4ELMB 1JTPA 1ZHLB 2G9HB 4FMFA 1Z3GH 2JJTA 4JHWL 5I1GH 3RGHA 5T1KB 4DCQA 1HHJA 1I8KB 1XCQB 4JLRA 5DVOA 3I3EA 5ENWA 1C16B 4RA0C 3JSSA 5GRVK 1A14L 5IIEA 3FT3A 3QG6A 4R97C 4P5KA 4Q9QH 1FLRH 4HH9B 4PJEF 4WI7A 5I8OL 3ZTNL 1FN4B 2O5ZL 4M00A 3GSOB 5D7IE 5SWZA 3WXVL 3S97C 4P2QD 1ZT7B 5I1EH 3QUYA 2VE6B 4GW4B 3LB6C 3JTSB 4I9WE 1KT2A 5FYKL 3IAPA 2AQ2A 5EU5B 3KXFB 3CFCL 4HS3A 5DMIL 4ETQB 3QA3B 1ITCA 3ROLA 3ESUF 3O3DA 1ORQB 3PV6A 1ZE3C 3TA3B 2WUBH 3FQUA 3IDJA 3T65B 1J8HA 3CDGA 4LCIH 4LMQI 4N0YH 3HE7C 2DMCA 1K4CB 3BPOC 1UJ3A 1CLOL 2C3GA 1TZHB 5CP7A 1DVFC 5BV7B 2J3SA 2XYCA 4G3YH 3EYOA 3NA9H 4XNZB 2RFXA 4EIGB 2VN7A 5H35A 3QFJD 4G8IA 1VCAA 4DN4L 1KULA 1QSFA 4OGAD 3THMH 3QXTA 4NWUH 4FZEL 3VXNA 4YDVA 3TFKD 1FZKA 2P49B 3MV9A 4MQ7A 1P4LA 1QBAA 1IE5A 5GHWH 3DVIA 5IFHL 3QQ9D 4P23B 2DMKA 3P4NA 1FH5H 1OGAD 4AENB 5AYUH 2VC2H 3QEHB 3BDYH 3GK8L 4K7PL 3T3PE 4LSPL 6CGTA 2A38A 1L7IL 4Q0XL 1J87A 4HLZH 4JPKL 1QLEL 3AUVA 5HJ3B 1RU9L 4DVBA 1AFVL 2P8LB 4ZSOA 3NAAL 1G7IA 3OX8B 3TVMD 3LKPA 1DBAL 2X4QA 3P77B 2C1OA 1LK3L 12E8H 3P9WB 1M7DB 4UUJB 1VFAA 2Z31A 5I71B 4L8SC 4XCCH 4OZIA 1HSBB 3JUYA 1ZLWK 4AMKL 5I15H 3RVXC 4TRPL 2EICA 2ZKHL 3WHE1 4V1DB 4OD1H 2FB4H 5IVZB 4GRLB 3V5KA 1PZ5A 5DRNA 4GQPH 1NCCH 4JFED 1ONQA 3WJLA 4I2XE 1UACH 2QADC 4WTXA 1JWSA 2YSSA 4M7JL 1ZTXH 4U1LA 4YDJA 1A47A 2EDKA 4RCAA 1AC0A 2BSRA 3QIWB 5IROA 1FCGA 3LZFH 3CXHK 1D9KA 4B7LA 5KG9A 3G6JA 1GPOL 4XP4H 3LPWA 5E9DE 4RWYH 4XP1L 4PJXA 5I2IA 5DC0A 5DD1H 2BHUA 3GEWB 3O3BB 4MQSB 5IQ7L 4M5YL 4OD2A 4YHPA 5E5RB 1KLFA 4L1HA 2BNQE 4GKSB 4OFYD 4U7MA 1ZHBA 3F7YA 5BRZD 5ESAA 3DECA 4JN2A 1XGQB 5JZ7D 2GTWB 1JTOA 3JV6B 4X98A 1P2CA 2NY2C 4YX2H 4WW2C 4IS6B 1HEZB 1R3KA 1K85A 4ZS6C 4UT7H 5DYOA 1CGTA 5I1JL 1AQDA 2GJ6E 1NDMA 5B21A 3IDIA 4FXKA 1YEEL 4HX1A 3EHBD 4ONHA 4P0DA 3DVFA 4XP5H 5ERWB 5T5FH 1G9EA 3GB7B 5CGYD 2R56L 2XN9A 1KXQE 3QWOA 4G42B 2V5YA 1T7YA 3A6BH 3BWUC 4R90L 2QQQA 1XGYL 3GMRA 3J7HA 3BH9B 4PREA 4MB4A 5J8OA 1AGFA 4TOYH 2Z0BA 1EO7A 4PJIA 3FN9A 2GSGB 5GQBA 3HMXH 5ALBH 3QPQD 2R0LL 3VXMA 2EE6A 2AVGA 4AEHL 1TCRB 1NDGA 5EBLA 5A2KH 2C7UB 5B3JE 5CILH 2NW2A 3GMLB 4UIMB 4XT1C 3O6LH 5K9OA 1A9BB 2EC9U 3L5JA 2CLZA 2EEBA 2XNAB 4KK9C 1XF3A 1YEDB 3F8UB 2DM7A 3N9GL 3QNXB 3UX9B 1U8MA 4KVNL 3T3ME 4HCRA 4AL8H 1P7HL 4O5LL 4LVOC 4LGSB 6FABL 1LE5A 5IV2A 3MRGA 4HKZB 4OCSH 4P9HC 5IJKA 3DJ9A 3IDXH 3WJJA 5JW4R 2R0KL 1IM9A 3VGDA 1ZLUK 3LS5H 4GKOA 1P4BL 1CCZA 4P46C 2LU3A 4X6EA 2OTUB 1DZBA 1I7TB 3IVKA 2IC2A 3UCRA 3QUZA 4ETYA 2AXGA 1ZT1A 1RJYB 3GM0A 5DK2B 1S7VB 3I50H 3DX8B 2EH7H 4NN5B 2PXYC 2R1YA 5MEOB 4MCZA 4RMSA 3ILPB 4OZGF 3FB8B 3HUJE 3TCLA 5FGCB 1BGXL 4OCRH 3DYPA 2B1AH 2B2XL 1HQRB 4ELMA 2MKWA 3UMTA 4ZO6A 4LVNB 5SV4A 3VMPA 4A6YL 1JYWA 5T1KA 3PWUB 1XH3B 5HYEA 2NR6C 1XCQA 5DRZB 4LBEB 4PV8B 4UBDD 3O6FB 3GZKA 4L4JA 1P4IL 5D93C 4DGYH 4WI3A 4Y4HA 1NEZG 1FN4A 3V6ZA 2DLFH 3GIZH 3GSOA 1CDYA 2EDHA 4H88H 2CJUL 3WKNA 4DUVA 2GKIA 1R5VB 4AIXA 1SJVA 2VE6A 4GW4A 3JTSA 43C9B 3O11B 3GKWL 2B0SH 3WFEL 3WIHH 1G6VK 4ETQA 4GAFB 4U1HB 4I4WA 2GY5A 1WBXB 3VWKC 3O0RL 4LLQA 4P5TA 1ORQA 4U31A 4Z7VF 5E2UL 5HI5D 1NMCB 5ISZD 1HI6A 5DMJB 3S34H 1N5AB 3H8NA 3T65A 5K59E 1INDH 1IZKA 1K4CA 4GXVH 2A9ML 4G6FD 4UTAH 5EZLB 3BWAB 1WAAF 3NACH 4WVRA 1EUUA 3P30L 1FIGH 1RUKH 4KK6C 1I1FA 3NIFE 2HTLD 2FDBP 5EC1B 3S6CA 3IFOB 1A0QL 3SE8H 3U83A 1QQDB 5IMOA 5DC9B 2Z8WC 4BQ6A 2VDML 1ADQL 4KROD 5J3HD 4P23A 5DJYB 3DRQB 1QFUL 4ZOAA 4DKEH 3C6LA 4AH2B 3QEHA 3TN0B 1BFVH 1BQLH 3P4OB 4IRJC 4KDWA 4OSUH 1TIUA 2VSDA 5HJ3A 2BFVH 5EOTB 3OAZH 3OX8A 5FKPB 5TE6H 4D0CB 1HHGB 4NNYA 3P77A 3V5HB 2WANA 5HHQA 1G84A 1M7DA 2HFTA 4UUJA 4XVTL 4X7SH 4RNRB 4PJAE 1ROWA 4B41A 3L5XH 4PRPB 2E9IA 2FSEB 5HHOE 1U3ZA 4R2GB 4V1DA 5IVZA 1MRFL 4NC1C 3NCJH 4WHDA 3EDFA 1ZK9A 2APBA 5IK3B 4NKOB 4KHTH 5HHME 1JNHB 4OCLC 1KBGL 3RX7A 2EC8A 5EOCL 2XZAL 3M1BB 4OCYH 3QIWA 5IEKB 1M1SA 4H0IA 1WFUA 4YC2C 3NIDF 1OAZL 5GS0H 2JLLA 1MAMH 2I60L 1RZ7L 2AQ3A 5HHPB 3VXRA 5D1QD 1QTYT 3ARED 5C3LD 2I9LB 3UYRL 3WEXB 3O3BA 1F2QA 1HH9B 1NCAH 3B5GA 5E9DB 4CVWA 4DQOL 3WHXA 2IBZX 3B6SA 1X6LA 4JO4H 4GKSA 3D2UD 4F9PA 3HRPA 2MPAH 5A2LH 1PKQB 2BNQB 3RJDA 1KN2L 3JWDL 4XAWL 1LO0L 4LCUB 1XGQA 1PSKH 2UZIL 2B20A 4KHXL 3LIZH 2GTWA 3JV6A 1AY1H 3SGKC 2DQGH 5TE4H 4HIHB 1JHKL 4IS6A 1HEZA 3CC5B 4C59B 5DUBB 4K3DL 2VSCA 1X5FA 3OXRA 3S35L 3HG1A 5CJ5A 5HDQH 1QBLL 2J1KA 5EUOF 4M62L 4WO4C 2BVTA 3GB7A 2GJ6B 2OXGA 2VQTA 1JGVL 4G42A 4F7TA 3MRDB 4D9QD 4RX4A 4OZ4B 3TA3D 1NBYB 1TZGL 1KJ3L 4Z5RB 4FFVD 4NO3B 2GSGA 3QRGL 2DWEB 3MRLB 2NXYB 1I1AD 4NZTH 4HAGA 3OKKB 3S5LB 1N5YL 3JWOC 1TCRA 2DD8H 5JOPE 3UDWA 1WIPA 3L7EB 2EDRA 2C7UA 1QZ1A 4NM4H 4PY7B 3WDIA 43CAB 4GMSL 3RWGB 3GMLA 4UIMA 3WD5L 5D1XB 4XWGH 3HRZB 1NMBL 5IVXF 3WDHA 4EOWH 3BUYA 3V0WL 4MA8H 3RPIB 1YPZF 1A9BA 3MYJB 1S7XB 4JM4L 2E9WA 1INEH 4LIQL 5TPWL 2XNAA 3PQYD 1YEDA 5CINL 3QNXA 4FQXD 2PYEB 2ADGA 1KB5B 4TVPL 4QCIB 1UB6B 1D5BB 4MAYD 2HN7A 4JCMA 4HKZA 5T3ZD 4Y2DB 4HKXB 5B39G 3NPSC 4N90D 1A6VH 1B6DA 2W9LA 3VI4E 2OTUA 1I7TA 1TQBB 4GRLD 1I4FA 4PJBB 2I5YL 3UXFA 1RJYA 3ZDXE 1CD8A 1S7VA 3TNNB 3DX8A 4DOHB 5MEOA 4FXLA 2E7LC 1UH2A 4L5FH 3FB8A 5DJAB 4R26H 1HQRA 3S36H 3MV7D 3WFBL 4IIQB 4Z8FH 3DRTB 2DTMH 3PWUA 1XH3A 1R3LB 5DRZA 4WJ5B 3FQRA 4LBEA 4ZOCA 1EZVY 4N9OB 4NQEE 5C08E 3O6FA 4HK3J 2XKUA 2IBZY 4XP9H 1JPGB 1UXSB 2A77H 1G7MB 4NQSB 3QQNA 3RY5A 5IT2H 2Y06H 3NGBB 4XMPH 4KMTL 1U3HD 2H1PH 3V4UH 4XPGL 1R5VA 2HFGH 1LNUA 43C9A 2OK0H 1K3IA 4F57L 5D7IA 3BJLA 4PB0L 2ZNWA 1EDQA 1MPAH 1OTUC 2Q8AL 1BAFL 1CXHA 1WBXA 4YDLC 5GS2H 3DPBA 4BSVA 4Y4FB 1DBBL 4HFUL 5J57B 1N5AA 3PWPB 2NY1C 3P11L 4ODSH 5F7EH 1EMTH 2CK2A 2VLKE 3AMKA 2X4RA 2ITCB 3BWAA 2D7TH 2EXWC 4NGHL 5IWLC 3TT1H 1DBMH 3NVQA 3U30C 1T1XB 2X1OA 2IH1B 5BMFL 4PLJD 3IFOA 2H26B 3SGEH 1QQDA 3ISWA 1JN6B 1TZIA 3W0WB 5DJYA 3DRQA 2X4TB 3L1OH 3V9FA 4PJ9A 3P4OA 4MNGE 1FLTX 3IDUA 1NCBL 4PBWD 1CIDA 4G8FB 4NBXB 4D8PB 5EOTA 4FRWA 4MHHG 3HHRB 5FKPA 4D0CA 4KJQD 1HHGA 3NCBB 4OCXH 4MVBD 3V5HA 2NXZB 2QQLL 4Y88A 4RNRA 1L4IA 4U1GB 5GJTL 1NKOA 1YMMB 4IOIB 3WS6A 2VDPH 3BT2H 4Y16B 3DGCR 4PJAB 3QEQD 2AJXH 4J4PD 2OYPA 1CK0H 4J3OC 5DMYA 1J5OL 4QF1B 2P42B 4Z7NE 4EBQL 4NKOA 1RVFH 1VFUA 3V52L 1JNHA 3E3QC 1FLRL 5CSZB 4I2XA 3O3EB 4GRWH 4F8TA 2FEEL 3SDXE 1AXSB 3M1BA 1PEZA 1YNKH 2AJYL 1AIFB 1OSZA 5T3XE 3DV6B 2JELL 4JFFD 1NCWH 4ZODA 4GW1B 1CXIA 1NGZB 5HHPA 1RY7B 5E6IC 1RUPL 3BO8B 4K8RH 2OL3H 1Q9OA 4ZAKA 3WEXA 5J7CC 4X9BA 1HH9A 5E9DA 5HGBB 4LLUB 2PW1A 2I07B 1FC1A 1ZMYA 4LCIL 4N0YL 1JZ6A 1A21A 5F88B 4Z0XB 4XB7A 4K23H 3BQUD 4G3YL 1J1PL 1PKQA 2BNQA 4K7PY 4LSRL 4WFHD 4GS7B 4QNPE 4HIHA 3MPCA 2XA8L 1XFPA 3CC5A 4PB9L 1IGMH 1LP9F 4M7LL 5F9OL 4XMLH 5DUBA 1KNOB 1X7QB 4HK3N 1XF5B 5IR1B 5T1LA 3D3VE 3LVEA 4JZOA 2HRLA 1Q72L 2PTVA 4Y4KC 2GJ6A 2DBLL 1YUHA 3HZMB 3ARBD 1MWAB 3OAZK 3MRDA 3ARFC 5HI3D 1MAKA 3Q6GL 4OZ4A 3SGJA 3DIFA 2CLVB 1ZEAL 2AK4B 4P4KB 3EO1B 1OP3K 4Z95L 4KVCH 4Z5RA 2FR4A 4NO3A 2DWEA 3MRLA 4EN3D 5CBEB 1EH9A 5JHLL 1O5DT 3MSPA 3MC0A 1C5BH 3S5LA 5K9QG 2NX5D 2DAVA 3MR9B 5CZVL 2FHCA 3EO0B 3DI3B 2ATPB 4PGCB 4N5ED 3L7EA 3TBYB 1N0XH 1UT9A 1NCCL 4PY7A 5IJVA 3FFCE 2VERN 2IAMB 3IDYB 43CAA 1I7UA 1V8HA 1A4JB 3MGTB 1F45A 1ZTXL 5EN2B 1SYSB 3MYJA 1S7XA 3HZYA 2ADIA 2WUCL 1C12B 2VXSH 3TN0D 5E4EB 1T6VN 5IB2A 1CWVA 4K3GA 3DARA 3BPNB 5JXED 2PYEA 2I26N 2D9CA 4DVRH 4RWYL 3KVQA 4QCIA 1UB6A 3QT2A 1D5BA 4KZDH 5DD1L 5HYSG 1EHAA 4S0SD 4Y2DA 2DICA 1XEDA 1HE7A 4HKXA 2X40A 4PRPD 4OZHE 5C0CE 2ZPKH 5L2KB 3C08L 4MCYB 3GBMH 4JFDB 3D39E 3ZE1E 4PJBA 4J3TA 1FSKC 3GJFB 3EUUA 1JZ7A 4KMQA 3HC3H 4UAOC 1RIUH 4ZUWB 3TNNA 4NO5B 3NCYS 3V4PH 1KYOJ 2YXMA 4PG2C 4NJAH 4ZS7L 4UILH 5DJAA 1WFNA 3WDJA 5TGBB 2UUDH 3ULVC 2SEBB 3O8XB 3SBWA 2X9WA 3P4MB 2VRAA 3HUJA 5F7WC 4XP5L 5T5FL 1W0VA 1NMAL 1R3LA 3VA6A 4WJ5A 3QEUA 3WIIL 1DN2A 4WY7H 3RVUD 2F8OA 4MB3A 3ULVF 1JPGA 1UXSA 1CGUA 1G7MA 3E6HB 3FO1A 4NQSA 1M7IB 3H9SE 5C08B 4GRWF 4MXWH 4L3ED 1T1ZB 4HULB 4HH8A 1J12A 4Z7UF 3HMXL 4FFWC 2LV4A 3S4SB 5BZDB 1XT5A 2FECL 2VLJE 3HR5A 1JPTL 1FYTE 4LSTH 4XC1H 4JRXD 2NTSP 4Q97A 3BZDA 5BS0E 3UPCA 4Y4FA 2HT4C 4OLYL 3U4BH 5E99H 3PWPA 3UAJD 3O6LL 4IOFD 4JVUA 4NQUA 5EIIB 5CD3B 5KVGL 2ITCA 4ENED 3HCVB 4U2ZA 4G8GB 3BVNB 2QJDA 3LEYL 3B9KB 4U49A 2DOCA 4OLVL 2VABB 1YEJL 4HC1H 1T1XA 4AL8L 5BO1H 2XRAL 4HWBL 3BUTA 3RHWK 1MREL 5ALCL 3QPXH 4LHUA 1MCLA 2FX8L 4GT7A 2H26A 5CZXD 3IFNH 2XZCH 5BJTB 1U6AH 1JN6A 4LPUA 3EJJX 1Z5LB 3MJ8B 3GSQB 5C0RH 3W0WA 3GMNB 4ZMAT 1BWWA 5HTSA 4W70A 2XY2A 3B43A 2AK1H 2IQ9H 2X4TA 4Y8AA 1RURH 3SO3B 2HJFB 2ESVD 1QPXA 5C7XH 1EGJH 5FM5M 2V2TB 4G8FA 1HKLH 3FT2B 4D8PA 5KVFH 2VXUL 2QBWA 3I50L 4MNGB 3D87B 2EH7L 2WBJB 5D1XD 4ODUB 3K74B 4FFZH 1TPXB 2PTUA 5DJXA 4S1RL 4OI8A 3CLEH 2ITDB 5E2TH 1YMMA 4IOIA 1Q1JH 1INQB 2D31B 1Q38A 4PJAA 2IANE 3EJZD 4KKBD 5HYJD 3LMJH 1CBVL 1HINL 3MRRA 4POUB 4QF1A 3LQZB 4DGYL 4TVSa 4K3EH 3GRWL 5CSZA 3PDDA 5D6CA 5F7DB 5TDPB 4GBXB 3O3EA 4CN4A 5GGTH 4OF6A 3GIZL 2YWZA 1AXSA 1DQDL 1NFIB 1AIFA 3BKCL 1PX3A 3VXSB 1KENH 3G5YB 1CU4L 3KPLB 2YD6A 5H2BB 1KCKA 1NGZA 4HIEA 2QEJA 3EYSH 1J8KA 1KXVC 2VDLH 4U1IB 3BO8A 3U6RB 2DYPB 5F9WB 2XV6B 3QI9B 4JFOB 3GBNH 4MD0B 5IFAH 5JDSB 5HGBA 2WW8A 4LLUA 5IP4A 4M3JA 2I07A 1NAML 2Z91B 5F88A 4Z0XA 4X83A 3MZTA 5AZEL 5DFVD 1EFQA 2GHWB 1HN1A 2AGJL 5I8EB 5JDJA 3G6AB 3C5JA 1LK2B 2BOCB 3M17B 1DBJH 1BQSA 3QUMH 5C2UB 3SE8L 5KOVC 3UZEA 5D6DC 4H1LA 3TJEL 2DI8A 3LH2L 1KNOA 4HV8A 2WWMD 3MLPA 5IR1A 2BNRD 4DKEL 5C0ND 1BJ1H 4OLWL 3BKML 3C60B 4LAQL 4MGXA 1A7RH 3D3VB 4ODHL 2GITB 4OM1H 4OTXL 3SN6N 3HZMA 4OQTA 5KS9B 1JI1A 2AJVL 1F3RB 1I9RL 5TE6L 5DGQA 2C9AA 2CLVA 4P2YA 3WNPA 1IQDB 3EO1A 3HTLX 4P4KA 1X4ZA 2A74B 3MRPB 4O9HL 5D7JA 5E8NB 1AI1H 4ACPA 2WBKA 5CBEA 3L5XL 4FQJH 3L3GA 2RCSH 5HGHB 3MCLH 1HZHH 1I8LA 4LCCC 2ZJSL 4OJFH 4LSVL 2ATPA 4PGCA 1CVRA 1T5WB 1N3NB 1UADC 3QWQB 4L4VE 3GI9H 3TBYA 5C0FB 4CMHB 1IGTB 3KHOA 1NFDB 3HKFA 4XPFH 1A4JA 5F7YC 2R8SH 1KPUB 1WLHA 3ORJA 5DRWB 3MJGX 4NNXB 1SY6H 2IPKB 5EN2A 2B4CC 1RI8A 1SYSA 3BRGC 1T4KB 1OAQL 2CKNA 3RUGB 3FO9B 5I1KL 3IB4A 3O6ML 2F8VA 5LQBH 2G5BA 4NN7C 4OGAC 4YPJA 5JMRA 1E27B 5D2NE 4EDWH 5F6IB 3TFKC 2ZSWB 2DL9A 4Y5YB 2D7MA 2ZG3A 3QQ9C 4B53A 1WK0A 4JO4L 4Y16D 5L2KA 1FG9C 1FAIH 1XCTB 3IKCB 4M1DH 5C0CB 4D9LH 5SX4I 4JGJA 4ZUWA 3D39B 2DQGL 4NO5A 1NC2B 2DN7A 3TVMC 1JE6A 4F80A 5FAAA 3R4DA 5TGBA 3HE6B 2X1WL 2SEBA 2CDEB 2HYMA 3O8XA 5AWNH 5D7LE 3P4MA 3IS0X 1AGEA 1IGIL 2Q3ZA 3CDFA 2QSQA