4KY4A

Crystal structure of non-classical ts inhibitor 2 in complex with toxoplasma gondii ts-dhfr
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
608
structure length
489
Chain Sequence
KPVCLVVAMTPKRGIGINNGLPWPHLTTDFKHFSRVTKTFNAVVMGRKTWESMPRKFRPLVDRLNIVVSSSLKVCASLPAALSLLEEEYKDSVDQIFVVGAGLYEAALSLGVASHLYITRVAREFPCDVFFPAFPGDDILSNKEATYRPIFISKTFSDNGVPYDFVVLEKRSSAAAIAPVLAWMDEKELIRAVPHVHFRGHEEFQYLDLIADIINNGRTMDDRTGVGVISKFGCTMRYSLDQAFPLLTTKRVFWKGVLEELLWFIRGDTNANHLSEKGVKIWDKNVTREFLDSRNLPHREVGDIGPGYGFQWRHFGAAYKDMHTDYTGQGVDQLKNVIQMLRTNPTDRRMLMTAWNPAALDEMALPPCHLLCQFYVNDQKELSCIMYQRSCDVGLGVPFNIASYSLLTLMVAHVCNLKPKEFIHFMGNTHVYTNHVEALKEQLRREPRPFPIVNILNKERIKEIDDFTAEDFEVVGYVPHGRIQMEMAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent and selective inhibitors of Toxoplasma gondii thymidylate synthase for opportunistic infections.
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase
source organism Toxoplasma gondii
total genus 143
structure length 489
sequence length 608
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4ky4A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4ky4A01
5FCTA 1JU6A 3N5EA 4ISKA 4PSYA 1AO8A 3JSUA 3SRQX 1DREA 2KCEA 3QLWA 1RX3A 4DDRA 3FQ0A 4X5GA 2LF1A 4KNZA 3IRMA 3B9HA 5HS3A 3SH2A 1DR5A 2VETA 5ECCA 1HW4A 2G8AA 1BP6A 1AOEA 1B49A 4QJCA 1LUDA 4IXFX 4GEVA 1RX5A 3QLSA 5HF2X 4EZ8A 2FZIA 3FREX 1U71A 2FZHA 4PSGA 1RA8A 1TSLA 4XRBA 5H38A 4O7UA 1F4EA 3EHIX 4JEFA 1F4BA 3IHIA 4IQQA 4FOXA 3D80A 3KY8A 4ECKA 3OAFA 3IA4A 1HFRA 1BSPA 3GI2A 1TLSA 1DNAA 4FQSA 3SAIA 1DIUA 2C2TA 1LY4A 3IJZA 1DHJA 3R33A 3IA5A 1THYA 3EF9A 1RX6A 3DATA 1HZWA 1JTQA 4IQBA 4M2XA 7DFRA 2P4GA 4XSCA 4G6WX 4H96A 5HI6A 1S3YA 3K47A 3QLYA 2B3ZA 1U72A 5HF0X 4DFRA 5CCCA 1RH3A 2BLBA 3QLRA 4ELBA 4KAKA 2H2QA 4EJ1A 1IA2A 1LY3A 5HSUA 4PDJA 1TYSA 1KLKA 3LG4A 3FRFX 4KJLA 1TSZA 1OHKA 3F0VX 1TSDA 3C0AA 1CI7A 3JWMA 5WRNA 5HT5A 1BJGA 4LAHX 1TVWA 4KJJA 4OSGA 2AZNA 2OBCA 2CD2A 2W3VA 4KL9A 1RB3A 3DL5A 4P68A 5HQZA 2A9WA 3GG5A 1CD2A 2W3WA 1RX9A 4KYAA 4EILA 2G86A 4KJKA 8DFRA 1DLRA 5HSRA 1EV8A 3TD8A 4KY4A 3QL3A 3VCOA 4M6JA 4XT7A 5JA3A 1DHIA 3K2HA 3SQYX 1TLCA 1BQ2A 1NCEA 3HJ3A 4HOFA 1IA4A 1OHJA 2AAZA 4HA7A 2BBQA 1DYJA 4ELEA 1TJSA 3EELA 4I1NA 3D84X 1ZPRA 1DYHA 3BHLA 1RF7A 4FOGA 1DG8A 1EVGA 3BNZA 3CLBA 3JTWA 4FHBA 1F28A 4Q0DA 4I13A 3UM8A 2DRCA 5CC9A 4X5IA 3KFYA 1VZEA 1JTUA 3GHCA 4PSSA 3EJLA 1BO7A 2W9GA 3ZPGA 3FRAX 1VZDA 3DL6A 4M6LA 2TSRA 4FGGA 3JWCA 5EAJA 5H39A 3Q1HA 4QHVA 3QLZA 5U26A 4HA9A 4ISWA 1DG5A 4XE6X 1JMHA 4E28A 4X5FA 4QJZD 4GYHA 4H0RA 3NZBX 3QFXA 2D5NA 3GH0A 3CD2A 3I3RA 1B02A 3RO9A 1BO8A 1DR1A 1IA3A 2GD9A 3EEJA 1TSYA 1PD8A 4XT5A 3DAUA 3UM5A 1RC4A 4OR7A 4G95A 1LCBA 1RX2A 3N5GA 3IX9A 3IK1A 4QLGA 5DFRA 1AXWA 1NJEA 2O7PA 3OCHA 4KFJA 3FL8A 2HM9A 1BDUA 3FRDX 1B5DA 1DHFA 3F8ZA 3QLXA 5HUIA 2OIPA 1RX7A 3TQ8A 1SEJA 3BZ0A 3ED7A 3M09A 4XT6A 2RD8B 3IRNA 3FY9X 1JMFA 2BLAA 3ZPCA 3GYFA 3FQZA 1TRGA 1QZFA 4H98A 1RD7A 4XSEA 5FDAA 1IA1A 4LRRA 4DQ1A 2FTOX 2HXVA 1VZBA 1DAJA 3F91A 3QGTA 1RE7A 4LAGX 4LAEX 3FS6A 3GH2X 3SA1A 1PD9A 3KGYA 1AOBA 3V8HA 3TQ9A 5JG0X 1J3IA 3UM6A 1B5EA 3NZAX 1TDBA 4KM0A 1MVTA 1AN5A 3DG8C 1QQQA 3L3RA 1I00A 1F4DA 3TMSA 3NTZA 1NJCA 4F2VA 1RA3A 3DG8A 1JUTA 4EINA 4H0UA 1RG7A 4IXED 1F4CA 4E5OA 3NXVA 3JW3A 3NRRA 1DRBA 1SYNA 3I8AX 3EEMA 4X5JA 3B5BA 4M7VA 2RD8A 2G8DA 3NXXA 1DDSA 3DGAC 1TSNA 4KBNA 4G2OX 1RX8A 3DGAA 1F4FA 3SRWX 4O1XA 4KPWA 2BL9A 3FQCA 4G3MA 4P66A 3BYXA 3FQFA 2CIGA 4NX6A 2KGKA 3F8YA 3SRUX 3EAWX 4O1UA 4NX7A 4Q6AA 2INQA 2VF0A 3NZCX 1BPJA 4X5HA 4EIGA 3CL9A 1DR3A 1D1GA 4H97A 4KNEA 1BQ1A 5HVEA 5BY6A 4Q0EA 4M7UA 3EBUA 4H95A 3FQVA 3EX8A 2QK8A 2DHFA 1KMVA 2ANQA 4XT8A 1KMSA 4KEBA 3FRBX 1JOLA 3KJSA 1HFPA 2ZZAA 4QI9A 2L28A 4FGTA 5DXVA 3SGYA 3SRSX 2W9TA 1RA2A 3NXTA 1RX1A 3JWFA 3JW5A 1DDUA 3JVXA 3C06A 4PTJA 3IK0A 5J7WA 3NZDA 3HBBA 1VDRA 2G6VA 1RA9A 2W9HA 4QLEA 3QYOA 2W9SA 4LEKX 1DRHA 2TDDA 1F4GA 1FWMA 1VZAA 4TU5X 4ELHA 3FYVX 4QLFA 5H3AA 1M79A 1TVVA 4HOGA 2TSCA 3FQOA 1E26A 1BOZA 3S9UA 1DLSA 4H1IA 3EDWX 3NXYA 1DRFA 4KY8A 1LCAA 1NJAA 2ONBA 1TDUA 2RDAA 1TDRA 4HOEA 2FTNA 1J3JC 3NXRA 3INVA 4DP3A 3S7AA 3BHRA 3IROA 2W3BA 3QJ7A 1HW3A 1J3JA 4GH8A 2W3MA 3CSEA 1AIQA 1DR7A 4KLXA 4ELGA 1YHOA 1BKPA 4FGHA 1TSVA 4DPDA 1PDBA 1DYIA 1JMIA 1VJ3A 2JYBA 1DR6A 4TMSA 1CZ3A 3SR5X 4FOAA 1EV5A 1BSFA 1S3UA 3FYWX 1JUVA 2HQPA 4G8ZX 1J3KC 3UWLB 4DPHA 1BIDA 1DF7A 1J3IC 4PSTA 1J3KA 3TQAA 3NXOA 1DR4A 3OB7A 1JMGA 2XW7A 1LCEA 5HVBA 1DRAA 1RX4A 5HT4A 3EGYX 3EEKA 3N0HA 4GD7A 1KCEA 3GHWA 3ROAA 3GHVA 2W3AA 4RGCA 1HFQA 3EIGA 4CD2A 1KZIA 1BZFA 5ECXA 1M78A 1TSWA 4UP1A 2C2SA 4EIZA 3TQBA 3F0SX 5HQYA 3HB8A 1DYRA 1YPVA 3F0XX 3NZ9X 4ELFA 1EVFA 3F0BX 2G8XA 3S3VA 1DG7A 3IX6A 3NZ6X 1JUJA 2ITHA 5U27A 2D0KA 3BFIA 1TVUA 2TDMA 1RA1A 3QL0A 1HVYA 2ANOA 1JG0A 2BLCA 3N5EB 3UWLA 4P3QA 2G89A 4M6KA 1TISA 3JWKA 3DRCA 5HPBA 1U70A 4XECX 3FY8X 1AI9A 1S3VA 1NJDA 1AJMA 3DFRA 4XT4A 1RB2A 3F0UX 2FTQA 1TSXA 3FL9A 1JOMA 2FZJA 1S3WA 4KD7A 1DR2A 1NJBA 4IRRA 1MVSA 4IXGX 1DISA 4XSDA 3BGXA 3K74A 4EB4A 1BKOA 1TSMA 5E8QA 1KZJA 1DDRA 1TDCA 1ZDRA 4P3RA 3M08A 3KGBA 6DFRA 4O1XD 1M7AA 3NU0A 1FFLA 1BP0A 1RTSA 3QYLA 3SA2A 4Q67A 4KM2A 3E0BA 1VZCA 3QG2A 3F0QX 3SRRX 3K45A 4PTHA 3RG9A 3H9KA 3KJRA 1TDAA
chains in the Genus database with same CATH superfamily
5FCTA 1JU6A 3N5EA 4ISKA 4PSYA 1AO8A 3JSUA 3SRQX 1DREA 2KCEA 3QLWA 1RX3A 4DDRA 3FQ0A 4X5GA 2LF1A 4KNZA 3IRMA 3B9HA 5HS3A 3SH2A 1DR5A 2VETA 5ECCA 1HW4A 2G8AA 1BP6A 1AOEA 1B49A 4QJCA 1LUDA 4IXFX 4GEVA 1RX5A 3QLSA 5HF2X 4EZ8A 2FZIA 3FREX 1U71A 2FZHA 4PSGA 1RA8A 1TSLA 4XRBA 5H38A 4O7UA 1F4EA 3EHIX 4JEFA 1F4BA 3IHIA 4IQQA 4FOXA 3D80A 3KY8A 4ECKA 3OAFA 3IA4A 1HFRA 1BSPA 3GI2A 1TLSA 1DNAA 4FQSA 3SAIA 1DIUA 2C2TA 1LY4A 3IJZA 1DHJA 3R33A 3IA5A 1THYA 3EF9A 1RX6A 3DATA 1HZWA 1JTQA 4IQBA 4M2XA 7DFRA 2P4GA 4XSCA 4G6WX 4H96A 5HI6A 1S3YA 3K47A 3QLYA 2B3ZA 1U72A 5HF0X 4DFRA 5CCCA 1RH3A 2BLBA 3QLRA 4ELBA 4KAKA 2H2QA 4EJ1A 1IA2A 1LY3A 5HSUA 4PDJA 1TYSA 1KLKA 3LG4A 3FRFX 4KJLA 1TSZA 1OHKA 3F0VX 1TSDA 3C0AA 1CI7A 3JWMA 5WRNA 5HT5A 1BJGA 4LAHX 1TVWA 4KJJA 4OSGA 2AZNA 2OBCA 2CD2A 2W3VA 4KL9A 1RB3A 3DL5A 4P68A 5HQZA 2A9WA 3GG5A 1CD2A 2W3WA 1RX9A 4KYAA 4EILA 2G86A 4KJKA 8DFRA 1DLRA 5HSRA 1EV8A 3TD8A 4KY4A 3QL3A 3VCOA 4M6JA 4XT7A 5JA3A 1DHIA 3K2HA 3SQYX 1TLCA 1BQ2A 1NCEA 3HJ3A 4HOFA 1IA4A 1OHJA 2AAZA 4HA7A 2BBQA 1DYJA 4ELEA 1TJSA 3EELA 4I1NA 3D84X 1ZPRA 1DYHA 3BHLA 1RF7A 4FOGA 1DG8A 1EVGA 3BNZA 3CLBA 3JTWA 4FHBA 1F28A 4Q0DA 4I13A 3UM8A 2DRCA 5CC9A 4X5IA 3KFYA 1VZEA 1JTUA 3GHCA 4PSSA 3EJLA 1BO7A 2W9GA 3ZPGA 3FRAX 1VZDA 3DL6A 4M6LA 2TSRA 4FGGA 3JWCA 5EAJA 5H39A 3Q1HA 4QHVA 3QLZA 5U26A 4HA9A 4ISWA 1DG5A 4XE6X 1JMHA 4E28A 4X5FA 4QJZD 4GYHA 4H0RA 3NZBX 3QFXA 2D5NA 3GH0A 3CD2A 3I3RA 1B02A 3RO9A 1BO8A 1DR1A 1IA3A 2GD9A 3EEJA 1TSYA 1PD8A 4XT5A 3DAUA 3UM5A 1RC4A 4OR7A 4G95A 1LCBA 1RX2A 3N5GA 3IX9A 3IK1A 4QLGA 5DFRA 1AXWA 1NJEA 2O7PA 3OCHA 4KFJA 3FL8A 2HM9A 1BDUA 3FRDX 1B5DA 1DHFA 3F8ZA 3QLXA 5HUIA 2OIPA 1RX7A 3TQ8A 1SEJA 3BZ0A 3ED7A 3M09A 4XT6A 2RD8B 3IRNA 3FY9X 1JMFA 2BLAA 3ZPCA 3GYFA 3FQZA 1TRGA 1QZFA 4H98A 1RD7A 4XSEA 5FDAA 1IA1A 4LRRA 4DQ1A 2FTOX 2HXVA 1VZBA 1DAJA 3F91A 3QGTA 1RE7A 4LAGX 4LAEX 3FS6A 3GH2X 3SA1A 1PD9A 3KGYA 1AOBA 3V8HA 3TQ9A 5JG0X 1J3IA 3UM6A 1B5EA 3NZAX 1TDBA 4KM0A 1MVTA 1AN5A 3DG8C 1QQQA 3L3RA 1I00A 1F4DA 3TMSA 3NTZA 1NJCA 4F2VA 1RA3A 3DG8A 1JUTA 4EINA 4H0UA 1RG7A 4IXED 1F4CA 4E5OA 3NXVA 3JW3A 3NRRA 1DRBA 1SYNA 3I8AX 3EEMA 4X5JA 3B5BA 4M7VA 2RD8A 2G8DA 3NXXA 1DDSA 3DGAC 1TSNA 4KBNA 4G2OX 1RX8A 3DGAA 1F4FA 3SRWX 4O1XA 4KPWA 2BL9A 3FQCA 4G3MA 4P66A 3BYXA 3FQFA 2CIGA 4NX6A 2KGKA 3F8YA 3SRUX 3EAWX 4O1UA 4NX7A 4Q6AA 2INQA 2VF0A 3NZCX 1BPJA 4X5HA 4EIGA 3CL9A 1DR3A 1D1GA 4H97A 4KNEA 1BQ1A 5HVEA 5BY6A 4Q0EA 4M7UA 3EBUA 4H95A 3FQVA 3EX8A 2QK8A 2DHFA 1KMVA 2ANQA 4XT8A 1KMSA 4KEBA 3FRBX 1JOLA 3KJSA 1HFPA 2ZZAA 4QI9A 2L28A 4FGTA 5DXVA 3SGYA 3SRSX 2W9TA 1RA2A 3NXTA 1RX1A 3JWFA 3JW5A 1DDUA 3JVXA 3C06A 4PTJA 3IK0A 5J7WA 3NZDA 3HBBA 1VDRA 2G6VA 1RA9A 2W9HA 4QLEA 3QYOA 2W9SA 4LEKX 1DRHA 2TDDA 1F4GA 1FWMA 1VZAA 4TU5X 4ELHA 3FYVX 4QLFA 5H3AA 1M79A 1TVVA 4HOGA 2TSCA 3FQOA 1E26A 1BOZA 3S9UA 1DLSA 4H1IA 3EDWX 3NXYA 1DRFA 4KY8A 1LCAA 1NJAA 2ONBA 1TDUA 2RDAA 1TDRA 4HOEA 2FTNA 1J3JC 3NXRA 3INVA 4DP3A 3S7AA 3BHRA 3IROA 2W3BA 3QJ7A 1HW3A 1J3JA 4GH8A 2W3MA 3CSEA 1AIQA 1DR7A 4KLXA 4ELGA 1YHOA 1BKPA 4FGHA 1TSVA 4DPDA 1PDBA 1DYIA 1JMIA 1VJ3A 2JYBA 1DR6A 4TMSA 1CZ3A 3SR5X 4FOAA 1EV5A 1BSFA 1S3UA 3FYWX 1JUVA 2HQPA 4G8ZX 1J3KC 3UWLB 4DPHA 1BIDA 1DF7A 1J3IC 4PSTA 1J3KA 3TQAA 3NXOA 1DR4A 3OB7A 1JMGA 2XW7A 1LCEA 5HVBA 1DRAA 1RX4A 5HT4A 3EGYX 3EEKA 3N0HA 4GD7A 1KCEA 3GHWA 3ROAA 3GHVA 2W3AA 4RGCA 1HFQA 3EIGA 4CD2A 1KZIA 1BZFA 5ECXA 1M78A 1TSWA 4UP1A 2C2SA 4EIZA 3TQBA 3F0SX 5HQYA 3HB8A 1DYRA 1YPVA 3F0XX 3NZ9X 4ELFA 1EVFA 3F0BX 2G8XA 3S3VA 1DG7A 3IX6A 3NZ6X 1JUJA 2ITHA 5U27A 2D0KA 3BFIA 1TVUA 2TDMA 1RA1A 3QL0A 1HVYA 2ANOA 1JG0A 2BLCA 3N5EB 3UWLA 4P3QA 2G89A 4M6KA 1TISA 3JWKA 3DRCA 5HPBA 1U70A 4XECX 3FY8X 1AI9A 1S3VA 1NJDA 1AJMA 3DFRA 4XT4A 1RB2A 3F0UX 2FTQA 1TSXA 3FL9A 1JOMA 2FZJA 1S3WA 4KD7A 1DR2A 1NJBA 4IRRA 1MVSA 4IXGX 1DISA 4XSDA 3BGXA 3K74A 4EB4A 1BKOA 1TSMA 5E8QA 1KZJA 1DDRA 1TDCA 1ZDRA 4P3RA 3M08A 3KGBA 6DFRA 4O1XD 1M7AA 3NU0A 1FFLA 1BP0A 1RTSA 3QYLA 3SA2A 4Q67A 4KM2A 3E0BA 1VZCA 3QG2A 3F0QX 3SRRX 3K45A 4PTHA 3RG9A 3H9KA 3KJRA 1TDAA
chains in the Genus database with same CATH topology
5FCTA 1JU6A 3N5EA 4ISKA 4PSYA 1AO8A 3JSUA 3SRQX 1DREA 2KCEA 3QLWA 1RX3A 4DDRA 3FQ0A 4X5GA 2LF1A 4KNZA 3IRMA 3B9HA 5HS3A 3SH2A 1DR5A 2VETA 5ECCA 1HW4A 2G8AA 1BP6A 1AOEA 1B49A 4QJCA 1LUDA 4IXFX 4GEVA 1RX5A 3QLSA 5HF2X 4EZ8A 2FZIA 3FREX 1U71A 2FZHA 4PSGA 1RA8A 1TSLA 4XRBA 5H38A 4O7UA 1F4EA 3EHIX 4JEFA 1F4BA 3IHIA 4IQQA 4FOXA 3D80A 3KY8A 4ECKA 3OAFA 3IA4A 1HFRA 1BSPA 3GI2A 1TLSA 1DNAA 4FQSA 3SAIA 1DIUA 2C2TA 1LY4A 3IJZA 1DHJA 3R33A 3IA5A 1THYA 3EF9A 1RX6A 3DATA 1HZWA 1JTQA 4IQBA 4M2XA 7DFRA 2P4GA 4XSCA 4G6WX 4H96A 5HI6A 1S3YA 3K47A 3QLYA 2B3ZA 1U72A 5HF0X 4DFRA 5CCCA 1RH3A 2BLBA 3QLRA 4ELBA 4KAKA 2H2QA 4EJ1A 1IA2A 1LY3A 5HSUA 4PDJA 1TYSA 1KLKA 3LG4A 3FRFX 4KJLA 1TSZA 1OHKA 3F0VX 1TSDA 3C0AA 1CI7A 3JWMA 5WRNA 5HT5A 1BJGA 4LAHX 1TVWA 4KJJA 4OSGA 2AZNA 2OBCA 2CD2A 2W3VA 4KL9A 1RB3A 3DL5A 4P68A 5HQZA 2A9WA 3GG5A 1CD2A 2W3WA 1RX9A 4KYAA 4EILA 2G86A 4KJKA 8DFRA 1DLRA 5HSRA 1EV8A 3TD8A 4KY4A 3QL3A 3VCOA 4M6JA 4XT7A 5JA3A 1DHIA 3K2HA 3SQYX 1TLCA 1BQ2A 1NCEA 3HJ3A 4HOFA 1IA4A 1OHJA 2AAZA 4HA7A 2BBQA 1DYJA 4ELEA 1TJSA 3EELA 4I1NA 3D84X 1ZPRA 1DYHA 3BHLA 1RF7A 4FOGA 1DG8A 1EVGA 3BNZA 3CLBA 3JTWA 4FHBA 1F28A 4Q0DA 4I13A 3UM8A 2DRCA 5CC9A 4X5IA 3KFYA 1VZEA 1JTUA 3GHCA 4PSSA 3EJLA 1BO7A 2W9GA 3ZPGA 3FRAX 1VZDA 3DL6A 4M6LA 2TSRA 4FGGA 3JWCA 5EAJA 5H39A 3Q1HA 4QHVA 3QLZA 5U26A 4HA9A 4ISWA 1DG5A 4XE6X 1JMHA 4E28A 4X5FA 4QJZD 4GYHA 4H0RA 3NZBX 3QFXA 2D5NA 3GH0A 3CD2A 3I3RA 1B02A 3RO9A 1BO8A 1DR1A 1IA3A 2GD9A 3EEJA 1TSYA 1PD8A 4XT5A 3DAUA 3UM5A 1RC4A 4OR7A 4G95A 1LCBA 1RX2A 3N5GA 3IX9A 3IK1A 4QLGA 5DFRA 1AXWA 1NJEA 2O7PA 3OCHA 4KFJA 3FL8A 2HM9A 1BDUA 3FRDX 1B5DA 1DHFA 3F8ZA 3QLXA 5HUIA 2OIPA 1RX7A 3TQ8A 1SEJA 3BZ0A 3ED7A 3M09A 4XT6A 2RD8B 3IRNA 3FY9X 1JMFA 2BLAA 3ZPCA 3GYFA 3FQZA 1TRGA 1QZFA 4H98A 1RD7A 4XSEA 5FDAA 1IA1A 4LRRA 4DQ1A 2FTOX 2HXVA 1VZBA 1DAJA 3F91A 3QGTA 1RE7A 4LAGX 4LAEX 3FS6A 3GH2X 3SA1A 1PD9A 3KGYA 1AOBA 3V8HA 3TQ9A 5JG0X 1J3IA 3UM6A 1B5EA 3NZAX 1TDBA 4KM0A 1MVTA 1AN5A 3DG8C 1QQQA 3L3RA 1I00A 1F4DA 3TMSA 3NTZA 1NJCA 4F2VA 1RA3A 3DG8A 1JUTA 4EINA 4H0UA 1RG7A 4IXED 1F4CA 4E5OA 3NXVA 3JW3A 3NRRA 1DRBA 1SYNA 3I8AX 3EEMA 4X5JA 3B5BA 4M7VA 2RD8A 2G8DA 3NXXA 1DDSA 3DGAC 1TSNA 4KBNA 4G2OX 1RX8A 3DGAA 1F4FA 3SRWX 4O1XA 4KPWA 2BL9A 3FQCA 4G3MA 4P66A 3BYXA 3FQFA 2CIGA 4NX6A 2KGKA 3F8YA 3SRUX 3EAWX 4O1UA 4NX7A 4Q6AA 2INQA 2VF0A 3NZCX 1BPJA 4X5HA 4EIGA 3CL9A 1DR3A 1D1GA 4H97A 4KNEA 1BQ1A 5HVEA 5BY6A 4Q0EA 4M7UA 3EBUA 4H95A 3FQVA 3EX8A 2QK8A 2DHFA 1KMVA 2ANQA 4XT8A 1KMSA 4KEBA 3FRBX 1JOLA 3KJSA 1HFPA 2ZZAA 4QI9A 2L28A 4FGTA 5DXVA 3SGYA 3SRSX 2W9TA 1RA2A 3NXTA 1RX1A 3JWFA 3JW5A 1DDUA 3JVXA 3C06A 4PTJA 3IK0A 5J7WA 3NZDA 3HBBA 1VDRA 2G6VA 1RA9A 2W9HA 4QLEA 3QYOA 2W9SA 4LEKX 1DRHA 2TDDA 1F4GA 1FWMA 1VZAA 4TU5X 4ELHA 3FYVX 4QLFA 5H3AA 1M79A 1TVVA 4HOGA 2TSCA 3FQOA 1E26A 1BOZA 3S9UA 1DLSA 4H1IA 3EDWX 3NXYA 1DRFA 4KY8A 1LCAA 1NJAA 2ONBA 1TDUA 2RDAA 1TDRA 4HOEA 2FTNA 1J3JC 3NXRA 3INVA 4DP3A 3S7AA 3BHRA 3IROA 2W3BA 3QJ7A 1HW3A 1J3JA 4GH8A 2W3MA 3CSEA 1AIQA 1DR7A 4KLXA 4ELGA 1YHOA 1BKPA 4FGHA 1TSVA 4DPDA 1PDBA 1DYIA 1JMIA 1VJ3A 2JYBA 1DR6A 4TMSA 1CZ3A 3SR5X 4FOAA 1EV5A 1BSFA 1S3UA 3FYWX 1JUVA 2HQPA 4G8ZX 1J3KC 3UWLB 4DPHA 1BIDA 1DF7A 1J3IC 4PSTA 1J3KA 3TQAA 3NXOA 1DR4A 3OB7A 1JMGA 2XW7A 1LCEA 5HVBA 1DRAA 1RX4A 5HT4A 3EGYX 3EEKA 3N0HA 4GD7A 1KCEA 3GHWA 3ROAA 3GHVA 2W3AA 4RGCA 1HFQA 3EIGA 4CD2A 1KZIA 1BZFA 5ECXA 1M78A 1TSWA 4UP1A 2C2SA 4EIZA 3TQBA 3F0SX 5HQYA 3HB8A 1DYRA 1YPVA 3F0XX 3NZ9X 4ELFA 1EVFA 3F0BX 2G8XA 3S3VA 1DG7A 3IX6A 3NZ6X 1JUJA 2ITHA 5U27A 2D0KA 3BFIA 1TVUA 2TDMA 1RA1A 3QL0A 1HVYA 2ANOA 1JG0A 2BLCA 3N5EB 3UWLA 4P3QA 2G89A 4M6KA 1TISA 3JWKA 3DRCA 5HPBA 1U70A 4XECX 3FY8X 1AI9A 1S3VA 1NJDA 1AJMA 3DFRA 4XT4A 1RB2A 3F0UX 2FTQA 1TSXA 3FL9A 1JOMA 2FZJA 1S3WA 4KD7A 1DR2A 1NJBA 4IRRA 1MVSA 4IXGX 1DISA 4XSDA 3BGXA 3K74A 4EB4A 1BKOA 1TSMA 5E8QA 1KZJA 1DDRA 1TDCA 1ZDRA 4P3RA 3M08A 3KGBA 6DFRA 4O1XD 1M7AA 3NU0A 1FFLA 1BP0A 1RTSA 3QYLA 3SA2A 4Q67A 4KM2A 3E0BA 1VZCA 3QG2A 3F0QX 3SRRX 3K45A 4PTHA 3RG9A 3H9KA 3KJRA 1TDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCT A;  1JU6 A;  3N5E A;  4ISK A;  4PSY A;  1AO8 A;  3JSU A;  3SRQ X;  1DRE A;  2KCE A;  3QLW A;  1RX3 A;  4DDR A;  3FQ0 A;  4X5G A;  2LF1 A;  4KNZ A;  3IRM A;  3B9H A;  5HS3 A;  3SH2 A;  1DR5 A;  2VET A;  5ECC A;  1HW4 A;  2G8A A;  1BP6 A;  1AOE A;  1B49 A;  4QJC A;  1LUD A;  4IXF X;  4GEV A;  1RX5 A;  3QLS A;  5HF2 X;  4EZ8 A;  2FZI A;  3FRE X;  1U71 A;  2FZH A;  4PSG A;  1RA8 A;  1TSL A;  4XRB A;  5H38 A;  4O7U A;  1F4E A;  3EHI X;  4JEF A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  3D80 A;  3KY8 A;  4ECK A;  3OAF A;  3IA4 A;  1HFR A;  1BSP A;  3GI2 A;  1TLS A;  1DNA A;  4FQS A;  3SAI A;  1DIU A;  2C2T A;  1LY4 A;  3IJZ A;  1DHJ A;  3R33 A;  3IA5 A;  1THY A;  3EF9 A;  1RX6 A;  3DAT A;  1HZW A;  1JTQ A;  4IQB A;  4M2X A;  7DFR A;  2P4G A;  4XSC A;  4G6W X;  4H96 A;  5HI6 A;  1S3Y A;  3K47 A;  3QLY A;  2B3Z A;  1U72 A;  5HF0 X;  4DFR A;  5CCC A;  1RH3 A;  2BLB A;  3QLR A;  4ELB A;  4KAK A;  2H2Q A;  4EJ1 A;  1IA2 A;  1LY3 A;  5HSU A;  4PDJ A;  1TYS A;  1KLK A;  3LG4 A;  3FRF X;  4KJL A;  1TSZ A;  1OHK A;  3F0V X;  1TSD A;  3C0A A;  1CI7 A;  3JWM A;  5WRN A;  5HT5 A;  1BJG A;  4LAH X;  1TVW A;  4KJJ A;  4OSG A;  2AZN A;  2OBC A;  2CD2 A;  2W3V A;  4KL9 A;  1RB3 A;  3DL5 A;  4P68 A;  5HQZ A;  2A9W A;  3GG5 A;  1CD2 A;  2W3W A;  1RX9 A;  4KYA A;  4EIL A;  2G86 A;  4KJK A;  8DFR A;  1DLR A;  5HSR A;  1EV8 A;  3TD8 A;  4KY4 A;  3QL3 A;  3VCO A;  4M6J A;  4XT7 A;  5JA3 A;  1DHI A;  3K2H A;  3SQY X;  1TLC A;  1BQ2 A;  1NCE A;  3HJ3 A;  4HOF A;  1IA4 A;  1OHJ A;  2AAZ A;  4HA7 A;  2BBQ A;  1DYJ A;  4ELE A;  1TJS A;  3EEL A;  4I1N A;  3D84 X;  1ZPR A;  1DYH A;  3BHL A;  1RF7 A;  4FOG A;  1DG8 A;  1EVG A;  3BNZ A;  3CLB A;  3JTW A;  4FHB A;  1F28 A;  4Q0D A;  4I13 A;  3UM8 A;  2DRC A;  5CC9 A;  4X5I A;  3KFY A;  1VZE A;  1JTU A;  3GHC A;  4PSS A;  3EJL A;  1BO7 A;  2W9G A;  3ZPG A;  3FRA X;  1VZD A;  3DL6 A;  4M6L A;  2TSR A;  4FGG A;  3JWC A;  5EAJ A;  5H39 A;  3Q1H A;  4QHV A;  3QLZ A;  5U26 A;  4HA9 A;  4ISW A;  1DG5 A;  4XE6 X;  1JMH A;  4E28 A;  4X5F A;  4QJZ D;  4GYH A;  4H0R A;  3NZB X;  3QFX A;  2D5N A;  3GH0 A;  3CD2 A;  3I3R A;  1B02 A;  3RO9 A;  1BO8 A;  1DR1 A;  1IA3 A;  2GD9 A;  3EEJ A;  1TSY A;  1PD8 A;  4XT5 A;  3DAU A;  3UM5 A;  1RC4 A;  4OR7 A;  4G95 A;  1LCB A;  1RX2 A;  3N5G A;  3IX9 A;  3IK1 A;  4QLG A;  5DFR A;  1AXW A;  1NJE A;  2O7P A;  3OCH A;  4KFJ A;  3FL8 A;  2HM9 A;  1BDU A;  3FRD X;  1B5D A;  1DHF A;  3F8Z A;  3QLX A;  5HUI A;  2OIP A;  1RX7 A;  3TQ8 A;  1SEJ A;  3BZ0 A;  3ED7 A;  3M09 A;  4XT6 A;  2RD8 B;  3IRN A;  3FY9 X;  1JMF A;  2BLA A;  3ZPC A;  3GYF A;  3FQZ A;  1TRG A;  1QZF A;  4H98 A;  1RD7 A;  4XSE A;  5FDA A;  1IA1 A;  4LRR A;  4DQ1 A;  2FTO X;  2HXV A;  1VZB A;  1DAJ A;  3F91 A;  3QGT A;  1RE7 A;  4LAG X;  4LAE X;  3FS6 A;  3GH2 X;  3SA1 A;  1PD9 A;  3KGY A;  1AOB A;  3V8H A;  3TQ9 A;  5JG0 X;  1J3I A;  3UM6 A;  1B5E A;  3NZA X;  1TDB A;  4KM0 A;  1MVT A;  1AN5 A;  3DG8 C;  1QQQ A;  3L3R A;  1I00 A;  1F4D A;  3TMS A;  3NTZ A;  1NJC A;  4F2V A;  1RA3 A;  3DG8 A;  1JUT A;  4EIN A;  4H0U A;  1RG7 A;  4IXE D;  1F4C A;  4E5O A;  3NXV A;  3JW3 A;  3NRR A;  1DRB A;  1SYN A;  3I8A X;  3EEM A;  4X5J A;  3B5B A;  4M7V A;  2RD8 A;  2G8D A;  3NXX A;  1DDS A;  3DGA C;  1TSN A;  4KBN A;  4G2O X;  1RX8 A;  3DGA A;  1F4F A;  3SRW X;  4O1X A;  4KPW A;  2BL9 A;  3FQC A;  4G3M A;  4P66 A;  3BYX A;  3FQF A;  2CIG A;  4NX6 A;  2KGK A;  3F8Y A;  3SRU X;  3EAW X;  4O1U A;  4NX7 A;  4Q6A A;  2INQ A;  2VF0 A;  3NZC X;  1BPJ A;  4X5H A;  4EIG A;  3CL9 A;  1DR3 A;  1D1G A;  4H97 A;  4KNE A;  1BQ1 A;  5HVE A;  5BY6 A;  4Q0E A;  4M7U A;  3EBU A;  4H95 A;  3FQV A;  3EX8 A;  2QK8 A;  2DHF A;  1KMV A;  2ANQ A;  4XT8 A;  1KMS A;  4KEB A;  3FRB X;  1JOL A;  3KJS A;  1HFP A;  2ZZA A;  4QI9 A;  2L28 A;  4FGT A;  5DXV A;  3SGY A;  3SRS X;  2W9T A;  1RA2 A;  3NXT A;  1RX1 A;  3JWF A;  3JW5 A;  1DDU A;  3JVX A;  3C06 A;  4PTJ A;  3IK0 A;  5J7W A;  3NZD A;  3HBB A;  1VDR A;  2G6V A;  1RA9 A;  2W9H A;  4QLE A;  3QYO A;  2W9S A;  4LEK X;  1DRH A;  2TDD A;  1F4G A;  1FWM A;  1VZA A;  4TU5 X;  4ELH A;  3FYV X;  4QLF A;  5H3A A;  1M79 A;  1TVV A;  4HOG A;  2TSC A;  3FQO A;  1E26 A;  1BOZ A;  3S9U A;  1DLS A;  4H1I A;  3EDW X;  3NXY A;  1DRF A;  4KY8 A;  1LCA A;  1NJA A;  2ONB A;  1TDU A;  2RDA A;  1TDR A;  4HOE A;  2FTN A;  1J3J C;  3NXR A;  3INV A;  4DP3 A;  3S7A A;  3BHR A;  3IRO A;  2W3B A;  3QJ7 A;  1HW3 A;  1J3J A;  4GH8 A;  2W3M A;  3CSE A;  1AIQ A;  1DR7 A;  4KLX A;  4ELG A;  1YHO A;  1BKP A;  4FGH A;  1TSV A;  4DPD A;  1PDB A;  1DYI A;  1JMI A;  1VJ3 A;  2JYB A;  1DR6 A;  4TMS A;  1CZ3 A;  3SR5 X;  4FOA A;  1EV5 A;  1BSF A;  1S3U A;  3FYW X;  1JUV A;  2HQP A;  4G8Z X;  1J3K C;  3UWL B;  4DPH A;  1BID A;  1DF7 A;  1J3I C;  4PST A;  1J3K A;  3TQA A;  3NXO A;  1DR4 A;  3OB7 A;  1JMG A;  2XW7 A;  1LCE A;  5HVB A;  1DRA A;  1RX4 A;  5HT4 A;  3EGY X;  3EEK A;  3N0H A;  4GD7 A;  1KCE A;  3GHW A;  3ROA A;  3GHV A;  2W3A A;  4RGC A;  1HFQ A;  3EIG A;  4CD2 A;  1KZI A;  1BZF A;  5ECX A;  1M78 A;  1TSW A;  4UP1 A;  2C2S A;  4EIZ A;  3TQB A;  3F0S X;  5HQY A;  3HB8 A;  1DYR A;  1YPV A;  3F0X X;  3NZ9 X;  4ELF A;  1EVF A;  3F0B X;  2G8X A;  3S3V A;  1DG7 A;  3IX6 A;  3NZ6 X;  1JUJ A;  2ITH A;  5U27 A;  2D0K A;  3BFI A;  1TVU A;  2TDM A;  1RA1 A;  3QL0 A;  1HVY A;  2ANO A;  1JG0 A;  2BLC A;  3N5E B;  3UWL A;  4P3Q A;  2G89 A;  4M6K A;  1TIS A;  3JWK A;  3DRC A;  5HPB A;  1U70 A;  4XEC X;  3FY8 X;  1AI9 A;  1S3V A;  1NJD A;  1AJM A;  3DFR A;  4XT4 A;  1RB2 A;  3F0U X;  2FTQ A;  1TSX A;  3FL9 A;  1JOM A;  2FZJ A;  1S3W A;  4KD7 A;  1DR2 A;  1NJB A;  4IRR A;  1MVS A;  4IXG X;  1DIS A;  4XSD A;  3BGX A;  3K74 A;  4EB4 A;  1BKO A;  1TSM A;  5E8Q A;  1KZJ A;  1DDR A;  1TDC A;  1ZDR A;  4P3R A;  3M08 A;  3KGB A;  6DFR A;  4O1X D;  1M7A A;  3NU0 A;  1FFL A;  1BP0 A;  1RTS A;  3QYL A;  3SA2 A;  4Q67 A;  4KM2 A;  3E0B A;  1VZC A;  3QG2 A;  3F0Q X;  3SRR X;  3K45 A;  4PTH A;  3RG9 A;  3H9K A;  3KJR A;  1TDA A; 
#chains in the Genus database with same CATH topology
 5FCT A;  1JU6 A;  3N5E A;  4ISK A;  4PSY A;  1AO8 A;  3JSU A;  3SRQ X;  1DRE A;  2KCE A;  3QLW A;  1RX3 A;  4DDR A;  3FQ0 A;  4X5G A;  2LF1 A;  4KNZ A;  3IRM A;  3B9H A;  5HS3 A;  3SH2 A;  1DR5 A;  2VET A;  5ECC A;  1HW4 A;  2G8A A;  1BP6 A;  1AOE A;  1B49 A;  4QJC A;  1LUD A;  4IXF X;  4GEV A;  1RX5 A;  3QLS A;  5HF2 X;  4EZ8 A;  2FZI A;  3FRE X;  1U71 A;  2FZH A;  4PSG A;  1RA8 A;  1TSL A;  4XRB A;  5H38 A;  4O7U A;  1F4E A;  3EHI X;  4JEF A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  3D80 A;  3KY8 A;  4ECK A;  3OAF A;  3IA4 A;  1HFR A;  1BSP A;  3GI2 A;  1TLS A;  1DNA A;  4FQS A;  3SAI A;  1DIU A;  2C2T A;  1LY4 A;  3IJZ A;  1DHJ A;  3R33 A;  3IA5 A;  1THY A;  3EF9 A;  1RX6 A;  3DAT A;  1HZW A;  1JTQ A;  4IQB A;  4M2X A;  7DFR A;  2P4G A;  4XSC A;  4G6W X;  4H96 A;  5HI6 A;  1S3Y A;  3K47 A;  3QLY A;  2B3Z A;  1U72 A;  5HF0 X;  4DFR A;  5CCC A;  1RH3 A;  2BLB A;  3QLR A;  4ELB A;  4KAK A;  2H2Q A;  4EJ1 A;  1IA2 A;  1LY3 A;  5HSU A;  4PDJ A;  1TYS A;  1KLK A;  3LG4 A;  3FRF X;  4KJL A;  1TSZ A;  1OHK A;  3F0V X;  1TSD A;  3C0A A;  1CI7 A;  3JWM A;  5WRN A;  5HT5 A;  1BJG A;  4LAH X;  1TVW A;  4KJJ A;  4OSG A;  2AZN A;  2OBC A;  2CD2 A;  2W3V A;  4KL9 A;  1RB3 A;  3DL5 A;  4P68 A;  5HQZ A;  2A9W A;  3GG5 A;  1CD2 A;  2W3W A;  1RX9 A;  4KYA A;  4EIL A;  2G86 A;  4KJK A;  8DFR A;  1DLR A;  5HSR A;  1EV8 A;  3TD8 A;  4KY4 A;  3QL3 A;  3VCO A;  4M6J A;  4XT7 A;  5JA3 A;  1DHI A;  3K2H A;  3SQY X;  1TLC A;  1BQ2 A;  1NCE A;  3HJ3 A;  4HOF A;  1IA4 A;  1OHJ A;  2AAZ A;  4HA7 A;  2BBQ A;  1DYJ A;  4ELE A;  1TJS A;  3EEL A;  4I1N A;  3D84 X;  1ZPR A;  1DYH A;  3BHL A;  1RF7 A;  4FOG A;  1DG8 A;  1EVG A;  3BNZ A;  3CLB A;  3JTW A;  4FHB A;  1F28 A;  4Q0D A;  4I13 A;  3UM8 A;  2DRC A;  5CC9 A;  4X5I A;  3KFY A;  1VZE A;  1JTU A;  3GHC A;  4PSS A;  3EJL A;  1BO7 A;  2W9G A;  3ZPG A;  3FRA X;  1VZD A;  3DL6 A;  4M6L A;  2TSR A;  4FGG A;  3JWC A;  5EAJ A;  5H39 A;  3Q1H A;  4QHV A;  3QLZ A;  5U26 A;  4HA9 A;  4ISW A;  1DG5 A;  4XE6 X;  1JMH A;  4E28 A;  4X5F A;  4QJZ D;  4GYH A;  4H0R A;  3NZB X;  3QFX A;  2D5N A;  3GH0 A;  3CD2 A;  3I3R A;  1B02 A;  3RO9 A;  1BO8 A;  1DR1 A;  1IA3 A;  2GD9 A;  3EEJ A;  1TSY A;  1PD8 A;  4XT5 A;  3DAU A;  3UM5 A;  1RC4 A;  4OR7 A;  4G95 A;  1LCB A;  1RX2 A;  3N5G A;  3IX9 A;  3IK1 A;  4QLG A;  5DFR A;  1AXW A;  1NJE A;  2O7P A;  3OCH A;  4KFJ A;  3FL8 A;  2HM9 A;  1BDU A;  3FRD X;  1B5D A;  1DHF A;  3F8Z A;  3QLX A;  5HUI A;  2OIP A;  1RX7 A;  3TQ8 A;  1SEJ A;  3BZ0 A;  3ED7 A;  3M09 A;  4XT6 A;  2RD8 B;  3IRN A;  3FY9 X;  1JMF A;  2BLA A;  3ZPC A;  3GYF A;  3FQZ A;  1TRG A;  1QZF A;  4H98 A;  1RD7 A;  4XSE A;  5FDA A;  1IA1 A;  4LRR A;  4DQ1 A;  2FTO X;  2HXV A;  1VZB A;  1DAJ A;  3F91 A;  3QGT A;  1RE7 A;  4LAG X;  4LAE X;  3FS6 A;  3GH2 X;  3SA1 A;  1PD9 A;  3KGY A;  1AOB A;  3V8H A;  3TQ9 A;  5JG0 X;  1J3I A;  3UM6 A;  1B5E A;  3NZA X;  1TDB A;  4KM0 A;  1MVT A;  1AN5 A;  3DG8 C;  1QQQ A;  3L3R A;  1I00 A;  1F4D A;  3TMS A;  3NTZ A;  1NJC A;  4F2V A;  1RA3 A;  3DG8 A;  1JUT A;  4EIN A;  4H0U A;  1RG7 A;  4IXE D;  1F4C A;  4E5O A;  3NXV A;  3JW3 A;  3NRR A;  1DRB A;  1SYN A;  3I8A X;  3EEM A;  4X5J A;  3B5B A;  4M7V A;  2RD8 A;  2G8D A;  3NXX A;  1DDS A;  3DGA C;  1TSN A;  4KBN A;  4G2O X;  1RX8 A;  3DGA A;  1F4F A;  3SRW X;  4O1X A;  4KPW A;  2BL9 A;  3FQC A;  4G3M A;  4P66 A;  3BYX A;  3FQF A;  2CIG A;  4NX6 A;  2KGK A;  3F8Y A;  3SRU X;  3EAW X;  4O1U A;  4NX7 A;  4Q6A A;  2INQ A;  2VF0 A;  3NZC X;  1BPJ A;  4X5H A;  4EIG A;  3CL9 A;  1DR3 A;  1D1G A;  4H97 A;  4KNE A;  1BQ1 A;  5HVE A;  5BY6 A;  4Q0E A;  4M7U A;  3EBU A;  4H95 A;  3FQV A;  3EX8 A;  2QK8 A;  2DHF A;  1KMV A;  2ANQ A;  4XT8 A;  1KMS A;  4KEB A;  3FRB X;  1JOL A;  3KJS A;  1HFP A;  2ZZA A;  4QI9 A;  2L28 A;  4FGT A;  5DXV A;  3SGY A;  3SRS X;  2W9T A;  1RA2 A;  3NXT A;  1RX1 A;  3JWF A;  3JW5 A;  1DDU A;  3JVX A;  3C06 A;  4PTJ A;  3IK0 A;  5J7W A;  3NZD A;  3HBB A;  1VDR A;  2G6V A;  1RA9 A;  2W9H A;  4QLE A;  3QYO A;  2W9S A;  4LEK X;  1DRH A;  2TDD A;  1F4G A;  1FWM A;  1VZA A;  4TU5 X;  4ELH A;  3FYV X;  4QLF A;  5H3A A;  1M79 A;  1TVV A;  4HOG A;  2TSC A;  3FQO A;  1E26 A;  1BOZ A;  3S9U A;  1DLS A;  4H1I A;  3EDW X;  3NXY A;  1DRF A;  4KY8 A;  1LCA A;  1NJA A;  2ONB A;  1TDU A;  2RDA A;  1TDR A;  4HOE A;  2FTN A;  1J3J C;  3NXR A;  3INV A;  4DP3 A;  3S7A A;  3BHR A;  3IRO A;  2W3B A;  3QJ7 A;  1HW3 A;  1J3J A;  4GH8 A;  2W3M A;  3CSE A;  1AIQ A;  1DR7 A;  4KLX A;  4ELG A;  1YHO A;  1BKP A;  4FGH A;  1TSV A;  4DPD A;  1PDB A;  1DYI A;  1JMI A;  1VJ3 A;  2JYB A;  1DR6 A;  4TMS A;  1CZ3 A;  3SR5 X;  4FOA A;  1EV5 A;  1BSF A;  1S3U A;  3FYW X;  1JUV A;  2HQP A;  4G8Z X;  1J3K C;  3UWL B;  4DPH A;  1BID A;  1DF7 A;  1J3I C;  4PST A;  1J3K A;  3TQA A;  3NXO A;  1DR4 A;  3OB7 A;  1JMG A;  2XW7 A;  1LCE A;  5HVB A;  1DRA A;  1RX4 A;  5HT4 A;  3EGY X;  3EEK A;  3N0H A;  4GD7 A;  1KCE A;  3GHW A;  3ROA A;  3GHV A;  2W3A A;  4RGC A;  1HFQ A;  3EIG A;  4CD2 A;  1KZI A;  1BZF A;  5ECX A;  1M78 A;  1TSW A;  4UP1 A;  2C2S A;  4EIZ A;  3TQB A;  3F0S X;  5HQY A;  3HB8 A;  1DYR A;  1YPV A;  3F0X X;  3NZ9 X;  4ELF A;  1EVF A;  3F0B X;  2G8X A;  3S3V A;  1DG7 A;  3IX6 A;  3NZ6 X;  1JUJ A;  2ITH A;  5U27 A;  2D0K A;  3BFI A;  1TVU A;  2TDM A;  1RA1 A;  3QL0 A;  1HVY A;  2ANO A;  1JG0 A;  2BLC A;  3N5E B;  3UWL A;  4P3Q A;  2G89 A;  4M6K A;  1TIS A;  3JWK A;  3DRC A;  5HPB A;  1U70 A;  4XEC X;  3FY8 X;  1AI9 A;  1S3V A;  1NJD A;  1AJM A;  3DFR A;  4XT4 A;  1RB2 A;  3F0U X;  2FTQ A;  1TSX A;  3FL9 A;  1JOM A;  2FZJ A;  1S3W A;  4KD7 A;  1DR2 A;  1NJB A;  4IRR A;  1MVS A;  4IXG X;  1DIS A;  4XSD A;  3BGX A;  3K74 A;  4EB4 A;  1BKO A;  1TSM A;  5E8Q A;  1KZJ A;  1DDR A;  1TDC A;  1ZDR A;  4P3R A;  3M08 A;  3KGB A;  6DFR A;  4O1X D;  1M7A A;  3NU0 A;  1FFL A;  1BP0 A;  1RTS A;  3QYL A;  3SA2 A;  4Q67 A;  4KM2 A;  3E0B A;  1VZC A;  3QG2 A;  3F0Q X;  3SRR X;  3K45 A;  4PTH A;  3RG9 A;  3H9K A;  3KJR A;  1TDA A; 
#chains in the Genus database with same CATH homology
 5FCT A;  1JU6 A;  3N5E A;  4ISK A;  4PSY A;  1AO8 A;  3JSU A;  3SRQ X;  1DRE A;  2KCE A;  3QLW A;  1RX3 A;  4DDR A;  3FQ0 A;  4X5G A;  2LF1 A;  4KNZ A;  3IRM A;  3B9H A;  5HS3 A;  3SH2 A;  1DR5 A;  2VET A;  5ECC A;  1HW4 A;  2G8A A;  1BP6 A;  1AOE A;  1B49 A;  4QJC A;  1LUD A;  4IXF X;  4GEV A;  1RX5 A;  3QLS A;  5HF2 X;  4EZ8 A;  2FZI A;  3FRE X;  1U71 A;  2FZH A;  4PSG A;  1RA8 A;  1TSL A;  4XRB A;  5H38 A;  4O7U A;  1F4E A;  3EHI X;  4JEF A;  1F4B A;  3IHI A;  4IQQ A;  4FOX A;  3D80 A;  3KY8 A;  4ECK A;  3OAF A;  3IA4 A;  1HFR A;  1BSP A;  3GI2 A;  1TLS A;  1DNA A;  4FQS A;  3SAI A;  1DIU A;  2C2T A;  1LY4 A;  3IJZ A;  1DHJ A;  3R33 A;  3IA5 A;  1THY A;  3EF9 A;  1RX6 A;  3DAT A;  1HZW A;  1JTQ A;  4IQB A;  4M2X A;  7DFR A;  2P4G A;  4XSC A;  4G6W X;  4H96 A;  5HI6 A;  1S3Y A;  3K47 A;  3QLY A;  2B3Z A;  1U72 A;  5HF0 X;  4DFR A;  5CCC A;  1RH3 A;  2BLB A;  3QLR A;  4ELB A;  4KAK A;  2H2Q A;  4EJ1 A;  1IA2 A;  1LY3 A;  5HSU A;  4PDJ A;  1TYS A;  1KLK A;  3LG4 A;  3FRF X;  4KJL A;  1TSZ A;  1OHK A;  3F0V X;  1TSD A;  3C0A A;  1CI7 A;  3JWM A;  5WRN A;  5HT5 A;  1BJG A;  4LAH X;  1TVW A;  4KJJ A;  4OSG A;  2AZN A;  2OBC A;  2CD2 A;  2W3V A;  4KL9 A;  1RB3 A;  3DL5 A;  4P68 A;  5HQZ A;  2A9W A;  3GG5 A;  1CD2 A;  2W3W A;  1RX9 A;  4KYA A;  4EIL A;  2G86 A;  4KJK A;  8DFR A;  1DLR A;  5HSR A;  1EV8 A;  3TD8 A;  4KY4 A;  3QL3 A;  3VCO A;  4M6J A;  4XT7 A;  5JA3 A;  1DHI A;  3K2H A;  3SQY X;  1TLC A;  1BQ2 A;  1NCE A;  3HJ3 A;  4HOF A;  1IA4 A;  1OHJ A;  2AAZ A;  4HA7 A;  2BBQ A;  1DYJ A;  4ELE A;  1TJS A;  3EEL A;  4I1N A;  3D84 X;  1ZPR A;  1DYH A;  3BHL A;  1RF7 A;  4FOG A;  1DG8 A;  1EVG A;  3BNZ A;  3CLB A;  3JTW A;  4FHB A;  1F28 A;  4Q0D A;  4I13 A;  3UM8 A;  2DRC A;  5CC9 A;  4X5I A;  3KFY A;  1VZE A;  1JTU A;  3GHC A;  4PSS A;  3EJL A;  1BO7 A;  2W9G A;  3ZPG A;  3FRA X;  1VZD A;  3DL6 A;  4M6L A;  2TSR A;  4FGG A;  3JWC A;  5EAJ A;  5H39 A;  3Q1H A;  4QHV A;  3QLZ A;  5U26 A;  4HA9 A;  4ISW A;  1DG5 A;  4XE6 X;  1JMH A;  4E28 A;  4X5F A;  4QJZ D;  4GYH A;  4H0R A;  3NZB X;  3QFX A;  2D5N A;  3GH0 A;  3CD2 A;  3I3R A;  1B02 A;  3RO9 A;  1BO8 A;  1DR1 A;  1IA3 A;  2GD9 A;  3EEJ A;  1TSY A;  1PD8 A;  4XT5 A;  3DAU A;  3UM5 A;  1RC4 A;  4OR7 A;  4G95 A;  1LCB A;  1RX2 A;  3N5G A;  3IX9 A;  3IK1 A;  4QLG A;  5DFR A;  1AXW A;  1NJE A;  2O7P A;  3OCH A;  4KFJ A;  3FL8 A;  2HM9 A;  1BDU A;  3FRD X;  1B5D A;  1DHF A;  3F8Z A;  3QLX A;  5HUI A;  2OIP A;  1RX7 A;  3TQ8 A;  1SEJ A;  3BZ0 A;  3ED7 A;  3M09 A;  4XT6 A;  2RD8 B;  3IRN A;  3FY9 X;  1JMF A;  2BLA A;  3ZPC A;  3GYF A;  3FQZ A;  1TRG A;  1QZF A;  4H98 A;  1RD7 A;  4XSE A;  5FDA A;  1IA1 A;  4LRR A;  4DQ1 A;  2FTO X;  2HXV A;  1VZB A;  1DAJ A;  3F91 A;  3QGT A;  1RE7 A;  4LAG X;  4LAE X;  3FS6 A;  3GH2 X;  3SA1 A;  1PD9 A;  3KGY A;  1AOB A;  3V8H A;  3TQ9 A;  5JG0 X;  1J3I A;  3UM6 A;  1B5E A;  3NZA X;  1TDB A;  4KM0 A;  1MVT A;  1AN5 A;  3DG8 C;  1QQQ A;  3L3R A;  1I00 A;  1F4D A;  3TMS A;  3NTZ A;  1NJC A;  4F2V A;  1RA3 A;  3DG8 A;  1JUT A;  4EIN A;  4H0U A;  1RG7 A;  4IXE D;  1F4C A;  4E5O A;  3NXV A;  3JW3 A;  3NRR A;  1DRB A;  1SYN A;  3I8A X;  3EEM A;  4X5J A;  3B5B A;  4M7V A;  2RD8 A;  2G8D A;  3NXX A;  1DDS A;  3DGA C;  1TSN A;  4KBN A;  4G2O X;  1RX8 A;  3DGA A;  1F4F A;  3SRW X;  4O1X A;  4KPW A;  2BL9 A;  3FQC A;  4G3M A;  4P66 A;  3BYX A;  3FQF A;  2CIG A;  4NX6 A;  2KGK A;  3F8Y A;  3SRU X;  3EAW X;  4O1U A;  4NX7 A;  4Q6A A;  2INQ A;  2VF0 A;  3NZC X;  1BPJ A;  4X5H A;  4EIG A;  3CL9 A;  1DR3 A;  1D1G A;  4H97 A;  4KNE A;  1BQ1 A;  5HVE A;  5BY6 A;  4Q0E A;  4M7U A;  3EBU A;  4H95 A;  3FQV A;  3EX8 A;  2QK8 A;  2DHF A;  1KMV A;  2ANQ A;  4XT8 A;  1KMS A;  4KEB A;  3FRB X;  1JOL A;  3KJS A;  1HFP A;  2ZZA A;  4QI9 A;  2L28 A;  4FGT A;  5DXV A;  3SGY A;  3SRS X;  2W9T A;  1RA2 A;  3NXT A;  1RX1 A;  3JWF A;  3JW5 A;  1DDU A;  3JVX A;  3C06 A;  4PTJ A;  3IK0 A;  5J7W A;  3NZD A;  3HBB A;  1VDR A;  2G6V A;  1RA9 A;  2W9H A;  4QLE A;  3QYO A;  2W9S A;  4LEK X;  1DRH A;  2TDD A;  1F4G A;  1FWM A;  1VZA A;  4TU5 X;  4ELH A;  3FYV X;  4QLF A;  5H3A A;  1M79 A;  1TVV A;  4HOG A;  2TSC A;  3FQO A;  1E26 A;  1BOZ A;  3S9U A;  1DLS A;  4H1I A;  3EDW X;  3NXY A;  1DRF A;  4KY8 A;  1LCA A;  1NJA A;  2ONB A;  1TDU A;  2RDA A;  1TDR A;  4HOE A;  2FTN A;  1J3J C;  3NXR A;  3INV A;  4DP3 A;  3S7A A;  3BHR A;  3IRO A;  2W3B A;  3QJ7 A;  1HW3 A;  1J3J A;  4GH8 A;  2W3M A;  3CSE A;  1AIQ A;  1DR7 A;  4KLX A;  4ELG A;  1YHO A;  1BKP A;  4FGH A;  1TSV A;  4DPD A;  1PDB A;  1DYI A;  1JMI A;  1VJ3 A;  2JYB A;  1DR6 A;  4TMS A;  1CZ3 A;  3SR5 X;  4FOA A;  1EV5 A;  1BSF A;  1S3U A;  3FYW X;  1JUV A;  2HQP A;  4G8Z X;  1J3K C;  3UWL B;  4DPH A;  1BID A;  1DF7 A;  1J3I C;  4PST A;  1J3K A;  3TQA A;  3NXO A;  1DR4 A;  3OB7 A;  1JMG A;  2XW7 A;  1LCE A;  5HVB A;  1DRA A;  1RX4 A;  5HT4 A;  3EGY X;  3EEK A;  3N0H A;  4GD7 A;  1KCE A;  3GHW A;  3ROA A;  3GHV A;  2W3A A;  4RGC A;  1HFQ A;  3EIG A;  4CD2 A;  1KZI A;  1BZF A;  5ECX A;  1M78 A;  1TSW A;  4UP1 A;  2C2S A;  4EIZ A;  3TQB A;  3F0S X;  5HQY A;  3HB8 A;  1DYR A;  1YPV A;  3F0X X;  3NZ9 X;  4ELF A;  1EVF A;  3F0B X;  2G8X A;  3S3V A;  1DG7 A;  3IX6 A;  3NZ6 X;  1JUJ A;  2ITH A;  5U27 A;  2D0K A;  3BFI A;  1TVU A;  2TDM A;  1RA1 A;  3QL0 A;  1HVY A;  2ANO A;  1JG0 A;  2BLC A;  3N5E B;  3UWL A;  4P3Q A;  2G89 A;  4M6K A;  1TIS A;  3JWK A;  3DRC A;  5HPB A;  1U70 A;  4XEC X;  3FY8 X;  1AI9 A;  1S3V A;  1NJD A;  1AJM A;  3DFR A;  4XT4 A;  1RB2 A;  3F0U X;  2FTQ A;  1TSX A;  3FL9 A;  1JOM A;  2FZJ A;  1S3W A;  4KD7 A;  1DR2 A;  1NJB A;  4IRR A;  1MVS A;  4IXG X;  1DIS A;  4XSD A;  3BGX A;  3K74 A;  4EB4 A;  1BKO A;  1TSM A;  5E8Q A;  1KZJ A;  1DDR A;  1TDC A;  1ZDR A;  4P3R A;  3M08 A;  3KGB A;  6DFR A;  4O1X D;  1M7A A;  3NU0 A;  1FFL A;  1BP0 A;  1RTS A;  3QYL A;  3SA2 A;  4Q67 A;  4KM2 A;  3E0B A;  1VZC A;  3QG2 A;  3F0Q X;  3SRR X;  3K45 A;  4PTH A;  3RG9 A;  3H9K A;  3KJR A;  1TDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...