4KYIB

Crystal structure of the phospholipase vipd from legionella pneumophila in complex with the human gtpase rab5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recruitment and activation of the Legionella phospholipase VipD by the host GTPase Rab5.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding/transport protein
molecule keywords VipD
total genus 44
structure length 164
sequence length 164
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kyiB00
1A2KC 3V4FA 3BERA 4QKQA 3LNCA 4TLAA 1FPMA 5H68A 3TK1A 1GNPA 3X1YA 1RE0A 3HYRA 4FN5A 3RDPA 1NLYA 4JMPA 1YE8A 2XITA 4LYAA 3DL0A 3JVUA 5CIQA 4B32A 1NIPA 2ZYUX 3S1AB 2VHCA 1R5BA 2BMEA 1KK1A 4Q03A 2PJRA 2ZE6A 2EWWA 2RH5A 3K9LA 4YMTA 2O52A 2AR7A 3JVVA 4Q1AA 3EC1A 1II9A 1KO4A 4Q4HA 1W44A 3GEEA 1E9CA 3PFIA 2B7BA 1D2EA 3FFBA 5D3MA 5EXPA 3VR5A 4DXAA 4IEEA 1F3OA 1W0KD 2C03A 2GCNA 5IHPA 1COWA 2IWRA 1TF2A 3B9QA 4ITRC 1P61B 2C95A 1MABA 1QHGA 5SZKB 3TAHA 3AGPA 3AVUA 1QG4A 3UWKA 2OAQ1 4TTQA 4NYJQ 3B2EA 3QY0A 3RRZA 1GIAA 3W6OA 3NC1C 5E95A 3WHKA 5J4HA 3R20A 4HUTA 5KYKA 1KDRA 4P31A 4LGMA 2HCJB 4KFTA 4CGZA 1TADA 2ODBA 3BXZA 2Q3FA 3KQNA 4Q9HA 2IS2A 3G5UA 2IHYA 3KXKA 2PX0A 4NTZA 1Z2CA 3NC0C 3CX8A 1KAOA 5F9HA 3PG5A 4JYCA 4B6FA 4DKXA 4GOXA 1A5TA 2P5SA 2NO6A 5IRCD 1VPLA 4HLUA 4NPHA 2YVUA 4A82A 4EJSB 4UKDA 4BRUA 1TL7C 4XWAA 1CR0A 1EGAA 1P7CA 3PEUA 4F7WA 4RKFA 1RRCA 1W48A 5B64A 1NY6A 3FGNA 4M22A 2C96A 4DUGA 3MGCA 5SZIA 3SU8A 1HYQA 1E2QA 2W00A 4IXNA 4CRWB 2IYSA 1Q21A 4LJ6A 3ASYA 3SJAA 4ZIRA 2CBZA 1Q1ZA 2HLDA 1WBBA 2IX3A 1CBUA 1U81A 3L2OB 1KY2A 2FSFA 1UM8A 2QI9C 1TX4B 2VHUA 4LBVA 5KDOA 4V03A 2BV3A 1FW6A 4KI0A 4TLDA 4PC6A 1NP6A 1GNRA 2G0TA 3KKPA 4Q1CA 3AGQA 2RHMA 2WOJA 4QHSA 3T1QA 1K5DA 3CPJB 2R2AA 2ZRMA 2F6RA 1NG9A 5C4GB 1A1VA 2ZI7A 5AUPB 3AVWA 1RPZA 1FNMA 4LWZA 4FCVA 4Q4JB 2C04A 2YC4C 3L0IB 4RFSB 3U3MA 2IYTA 2ZRPA 2IXGA 1G4AE 3X1ZA 4BFSA 1EG7A 4DSTA 3RSOA 2FFQA 2JDIA 5JHHB 2ZU6A 4DSNA 3S1AA 1A7JA 5JBQA 2BC9A 2ZRAA 3SNHA 3CBQA 2BBWA 5A5GA 3KXLA 3BB1A 1VIAA 2C99A 3O47A 2JLXA 1KI9A 2VF7A 3VAAA 4TQ9A 3ZLJA 2IF2A 4QBHA 2O0JA 3CZQA 3B1VA 1XEWY 1N6KA 4TLEA 3EC2A 5CLLA 2RMKA 1BKDR 5GJCA 1XEWX 3W6PA 2CJWA 2GJ9A 2VSXA 3FMIA 4QGFA 3OAAD 3C7KA 2YWFA 3K9HA 1KSHA 4Q9JA 3SBDA 1PVOA 1X8JA 3W9YA 3H86A 1GILA 4PSKA 4Q4LA 5FUWA 2C5LA 4IJMA 4LHVA 4AKGA 4MYUA 3TLXA 1VHTA 4MGIR 4ESHA 4HZUB 2QAGC 4V0OA 5KDDA 4HUQB 4NBSA 2OESA 4NCKA 1Z6AA 4YXWD 3I5XA 4UNQA 2X19A 4PAMA 3SYNA 4C0JA 4GDFA 3I5YA 1S0UA 2GNOA 2H1LA 4DEXA 2P65A 4LX0A 2NPIA 3AV0B 5EP1A 2WKRA 3TQFA 1DELA 1W46A 5TY0A 1TQ4A 4UXHA 5E3HA 1YR9A 4HEJA 4GMDA 1E79D 2EU8A 4DC9A 1KNXA 5B58C 2FX3A 4QL3A 2JDID 3M0EA 3NBYC 5EE5B 5B2ZA 5UKDA 2IYLD 2ZJOA 5GJWC 3UMSA 4P4SA 4F38A 3B1YA 2WAYA 1Q22A 4D4LA 3T5GA 3I73A 3T34A 2BKEA 4BZPA 4DUGD 5JI2E 1ZD9A 4C0QC 4Q9IA 4M1WA 2F3TA 4OHVA 1D2MA 1N25A 4OQNA 4PO1A 4RY2A 4OI0A 1P9RA 4V0NA 3FMFA 4GSYA 4NYJR 5L3QB 1EFHA 1DAHA 4KYIB 1JBKA 3HU2A 4IDPA 2W6IA 4IOKA 3ZD7A 1QVAA 2FSGA 1D6JA 4KLZA 1HH4A 4E03A 2RGGA 2G1KA 2G6BA 4AURA 2HT6A 2DFKB 3GP8A 2AKAB 1OH6A 1LY1A 2RB4A 2N46A 4P3YA 4QBFA 3KJGA 3IPYA 3U7FB 2XTZA 1G3UA 1II8B 4RSGA 4HZIA 5H8WA 5HZKA 5JI3E 4DJTA 5CJ2A 4QGAA 4TYYA 1UEIA 1ZW6A 4PPNA 5L3VA 1GOTA 1XEXB 3TGPA 4M4SA 2A9KA 1F2TA 3CF6R 5JWRA 3QSYA 2VQSA 3RS3A 1NVWQ 1VKJA 2AX4A 4ZKEA 2QAGA 4BECA 3LWNA 2GESA 1E79A 3W3ZB 1G18A 2J5XA 1NVUQ 1QRAA 4P4UA 1OB5A 3CRVA 2SHKA 1FQKA 2HJGA 2RHDA 4BRWA 2ZITA 3SN6A 1N5KA 2QQ0A 3TRFA 4CEHB 3W5IA 2BJWA 3DVLA 1VCOA 1TQ2A 1ZU5A 3EZ9A 3KB1A 3DOFA 1X1RA 4B75A 1NNEA 2J0SA 2J1LA 4KSBA 4CDGA 4JS0A 3UANA 3C4JA 5FOSA 1XD2B 3UMFA 3IEUA 3K53A 1DAEA 3KQHA 2ZM5A 1ZM2A 1DAIA 1EX7A 1TF7A 2OO7A 3SEAA 4WXPA 1JXOA 1FUUA 1CR4A 1EXMA 4QM7A 2HYDA 1Z6TA 2XZOA 4JLNA 4M9XA 2CEAA 1DAFA 2NTYC 2YOFA 2ZUBA 5E4FA 3MWKA 2YOHA 2AHOA 3O8DA 3NKVA 4ZKDA 5J5CA 4YXWA 2WOOA 1E3MA 3SQWA 2XOKA 4PHHA 1KI4A 4RVCA 2AFHE 3A1VA 4KSCA 3KKMA 3Q7PA 2Z0MA 3ND8A 1KNQA 3CIOA 3TUZC 1F2UB 1U9IA 3B8HA 4KXFB 4DEYA 4IVRA 3F3YA 1OXVA 1H65A 2PCLA 2WPDD 3B1ZA 2DWOA 3VNUA 2RGAA 3IIKA 5HKKA 1CLUA 2W2XA 5IF9A 2FZLA 1SVIA 2WSMA 4NE2A 1LS1A 4UNPA 3LVQE 2WICA 4AC9A 3KQLA 4OK6A 5DSZA 2XAUA 2QY9A 5AUQA 5BN5A 1WXQA 2FFAA 3I72A 4NYIQ 4O2LA 2YJTD 5FTNA 3C15C 5KO2A 1CJKC 1XTSA 2XZPA 3H1TA 3PVSA 1X6VA 1AS0A 2WJYA 4KODA 1YR6A 1H8ED 2GRJA 2P3SA 2ZXUA 4DSUA 4TZ6A 1ZNZA 1G6OA 4R9UC 3I61A 3I8SA 5CDFA 1P9WA 1SKYB 1ZIOA 2BHRA 4JVSB 2IBMA 3DHWC 3O8RA 3CRRA 4LCBA 3DMNA 2NIPA 4YMSA 1II0A 2XTNA 4PXAA 3W8NA 1UADA 2J41A 2VSFA 3ZQJA 4PSAA 1NKSA 2OFOA 3PITA 4L9WA 3ZZTA 1KI8A 1GDDA 4C0KA 3W5JA 3U61B 4HLCA 1Z0DA 2PL3A 4KBGA 2RGXA 4Q01A 4XVQA 2TMKA 3GEIA 1G3IA 1LTQA 4M1MA 4A0HA 3LLUA 2NO7A 1CF4A 1SZPA 2O8CA 3T12A 2BOVA 3G0HA 1R4AA 4MDFA 4B6EA 4HDOB 3ZJYA 5EZ6B 4R7ZA 3R8CA 2ZEJA 5GADl 4OHYA 3K0SA 3BB4A 2YC2C 4OQMA 4ZIRB 3L0PA 1GAJA 4Q4AB 4AYTA 5SZHB 4DVGA 2GVDC 2FF7A 4DLUA 4XWOA 1J7KA 3BS4A 1E4VA 1ZJ6A 121PA 5AJYA 1E9FA 4FIDA 2IT1A 3QKRA 1E2IA 2QROA 1JPNA 1BO6A 4L5BA 1N6OA 4EJSA 1QVRA 1OIVA 1VMAA 2AN9A 1QG2A 4C2TA 4YC7A 4LI0A 1MRNA 2IL1A 2QP4A 3VR3A 4PTLA 1NLFA 4QGGA 3AEZA 4TMWA 3A36A 4A8JB 2G77B 4Q7KA 1OYYA 2GCPA 2ZPTX 2YOGA 2CVHA 1U99A 1ZM7A 1ZBDA 1LF5A 5AWFC 3PR1A 4EPVA 1W4AA 1IN6A 4M9ZA 1BYIA 3EZFA 2XOKD 5EP4A 3DKPA 2BIFA 3L0SA 4AWXA 3EARA 1RC8A 4DCTA 4I99A 4KVGA 2KBFA 3AVOA 3FDIA 3SJZA 5LB2A 4RJLA 1TTTA 2D7CA 3AP1A 3BAFA 3KDSE 1IN8A 4IEIA 1KO8A 1GRNA 2HT1A 2QP3A 3MAAC 2XXAA 3TVTA 5G41A 3T1OA 3UG7A 2RGNC 3T15A 5FR2A 1S9DA 1AZSC 1E2MA 1EX6A 2ZRHA 2WWXA 2CDNA 2GZAA 4D26A 3CX7A 3ZZ0A 4CVNA 2F1JA 4A6XA 1ZNYA 2NPFA 3O8CA 2GJKA 4OI1A 1JECA 3LXXA 1M74A 4JIMA 5BQ5A 1CKEA 1G5RA 1S1CA 1YRBA 1RYFA 1KSGA 1IN4A 5KPJA 5FI0B 2IA5A 2FSIA 1G9XA 2VL7A 3OEED 5TDHA 2ZR9A 1W4RA 4Q02A 1M8PA 1KI1A 2XGJA 1N5LA 5EQTA 2QG6A 4C0AC 1L4YA 2H8KA 4M1TA 4W5HA 5FPYA 3ADCA 3ICEA 5FH9A 4G01B 2ZRDA 2ORWA 3IBGA 1U8ZA 4JBXA 4EPYA 2GXAA 4TYPA 4WVFA 4YONB 1Z29A 2AK2A 4CEHA 1SVOA 3ZZUA 2D3WA 4FMBB 3G82C 2HYIC 2VBCA 5EE9A 2J0QA 1KDOA 1LNZA 3TIFA 2O8BA 1AJEA 3FTQA 3EA5A 2QUZA 5DI9A 1NY5A 5KUTA 2QEQA 1GVNB 1EFTA 2CJWB 4KYUA 1RJ9A 5J47A 4A4DA 1KOFA 1ANKA 1KK3A 1R10A 1NVVR 3LRPA 2A7QA 3QF7A 3QEOA 4JLOA 3TKLA 2JATA 2JLWA 4XSHA 3VR1A 1ZNWA 1NBMA 3LAWA 5AJWA 2YHSA 3A1UA 3U3KA 1U8YA 2IYZA 4NYMQ 1W5TA 4H1UA 2VTKA 1BOFA 4EPRA 1SXJC 1ETUA 5EZ5A 4US2R 1WBDA 1RJ9B 3A4NA 2GETA 2REOA 3KJIA 4GNKA 4Q4HB 4BFXA 5KSPA 5FBVB 1JR3D 1M2OB 3DMDA 1HE1C 3SFVA 1KYIA 4Z8YA 4QHYA 2L0XA 5EP2A 3WP0A 1XPUA 1SHZA 3I1FA 3THOA 1FOEB 1OF1A 2R6DA 3AKEA 3P26A 4X8LA 2O8BB 1XD2A 3OE7A 3A4LA 2AD5A 3KJHA 4XVRA 1GL9B 1XXHB 2J7KA 3B85A 2VO1A 3CO5A 4QBGB 1GITA 3AQ4A 3P20A 3T61A 1CJVC 3GEHA 1EWQA 4Q1FA 4ERNA 4Q18A 4P4SB 2BBOA 4TTRA 2ODNA 4MRVA 3C41J 2ZAOA 3R9IA 2Z4RA 4DRZA 4Z1MD 4LBWA 1IXZA 3IKJA 3JZAA 3CM0A 3PUWA 5J4KA 2C9CA 4JVLA 2EYQA 4MYTA 5FL7A 2CNWD 1YZUA 1XF9A 2QTHA 1M7GA 4TLCA 3LQRA 1WCV1 4HATA 4MH0R 1C1YA 1UBCA 3H0KA 1IQPA 2PMDA 1KHTA 3RC8A 1ZCBA 1FX0B 1QHHA 3RC3A 1S8FA 1RZ3A 3IO5A 1DBSA 2ZU0C 4PHGA 3GLIE 4NU0A 1W49A 2V9PA 1ESMA 2OCYC 1CJMA 2C2HA 2F1HA 1FNNA 4LPKA 4URYR 4MUAA 3LVRE 1X8KA 1QBKC 4Q7MB 1WF3A 2FE4A 3TNFA 2JLZA 2XJ4A 3NVAA 1E2GA 3EPKA 5L3QA 1LFDB 1SXJD 1DTSA 1GUAA 1KK2A 3FKQA 1T6NA 2C98A 1I4TD 5DE3A 1B23P 3GLHB 3CZPA 3H4MA 2WMOB 3AVXA 3AVTA 3GLFA 1AKEA 2UZ3A 3T35A 3Q5DA 3QOFA 1B0UA 3TSOA 4N0DA 5BYJA 4M0LA 1OKKA 1FMJA 3GMTA 3V4RA 1D8TA 4JLJA 2ZSAA 5EXSA 3RRNA 4C7OA 3QPVA 1CR1A 5TVKA 2V7QA 2CK3D 3ND9A 5JJLA 1XMIA 1OFTA 3EASA 2B92A 4GP7A 3QG1A 4MRPA 2I1QA 3EG5A 4A8JA 4D80A 4EAQA 3PEVA 1HURA 3WNDA 3K0CC 4KVAA 2MMCA 4GBMA 4R2HA 4Y0VA 2CNWA 5FTLA 4M1YA 4Z54A 2AWOA 3C5CA 3T1TA 1XP8A 3CNOA 1E9SA 2OCBA 1UDWA 2BMJA 2QMOA 4G5OA 5L3RA 5BYKA 2BEJA 1TNDA 3LBNA 5P21A 4BFUA 3R8FA 4ABYA 1E9AA 4LJAA 2WMNB 3B13B 3QKTA 4LV8B 1DO2A 1E9DA 1OFHA 2ZSFA 1YRAA 4Q7LA 2ZAMA 5KNDA 1KDPA 4HDQB 2QE7A 4BEBA 2ZE5A 4JL8A 4O25A 3U7EB 2ZIAA 3P4YA 3RHFA 3VR2A 3ZIAA 1G7RA 1RKBA 2ZR7A 4AY2A 3U44A 2PX3A 3BE4A 4US0R 1Z6GA 1DEKA 5FFMA 1RYHA 2GILA 3K70D 2ECKA 3DZ8A 1TU3A 3IUYA 2MSDB 4FMCF 1E9EA 4JL6A 4OK3A 2GZDA 3EWAA 3K0FA 4O2RA 4JLAA 3TW8B 1WMSA 3B82A 4DCNA 3D6TB 3ZYCA 4PHTA 1IN7A 1W4BA 3RRYA 1QDEA 2J0VA 5JS8A 2QA5A 5JHGB 5DI3B 2PBRA 5KU1A 1JB1A 1OKKD 1DAKA 4P0TA 4PC3A 5DLQC 4PO8A 3EXAA 2ZRNA 3D7MA 1IJFA 1LVGA 3MWLA 4I1SA 4JLVA 1UAAA 4MA4A 4GI7A 3TW4A 4YMWA 3UATA 4TSFA 4CF7A 4GP6A 4UXJA 4AKIA 3LW8A 1Z47A 2A5GA 4GRAA 4ZDIA 4DCSA 2K5UA 2PLFA 2VP9A 2XEXA 1WRBA 1JEEA 1P2UA 3BBPA 1OSNA 2O0KA 4JSTA 2IW3A 2G0NA 3L43A 4QG7A 4F92B 3FB4A 2FEMA 4TWZA 2IS4A 1DG1G 3K1JA 4I1VA 1Z63A 3CNLA 3TVDA 4RD6A 5EXTA 4JSYA 1LV7A 4BWYA 1G3RA 1OJLA 1IHUA 4IRUB 1XJQA 2ATVA 2WJGA 2IXFA 2GEUA 4W5JA 2AWNA 4RFSA 2NO9A 1G4UR 3U7HB 2P6RA 2KB0A 3LX8A 4FXPA 4XSGA 3HR8A 4KU4A 4KFSA 4IOJA 3QXHA 4Q21A 4DHEA 2VHJA 1CTQA 2HXSA 3IO3A 4TYQA 4MRRA 4PPGA 1FP7A 2EWVA 2ZANA 3QKRB 4IVQA 3HYTA 4ZDWA 4A92A 3Q7QA 3B7GA 2RGBA 2NZJA 1E9RA 2XJ9A 4FW9A 3TSZA 4BLPA 1E98A 2QGNA 4L8GA 4JLPA 2FOLA 3KKQA 2HXYA 4CZ2A 2IEYA 4R98A 4M1KA 2OM2A 4NKRA 4LV5B 4Q9LA 2Z5FA 3W3AA 1ZRHA 3VHLB 3L8YA 5GJBA 1P2TA 2R6FA 1S1MA 5L8VA 1NL3A 3X1XA 2J0UA 2LKDA 4M21A 3THYB 3T1VA 2GEDA 2PCJA 4G5SA 4DDTA 3U4QA 1EFRD 3EPHA 5F3WB 1P75A 5AJXA 2REXB 1UKVY 1KO5A 2ZVPX 4LOAA 2F55A 3SJCA 3R7WA 5CB6A 1PUIA 1QZXA 4JZKA 3VR6A 1WP9A 4PC1A 4B44A 2GDJA 2H5EA 5D3MB 1E2HA 2QPOA 1Q1QA 1AZTA 3UPUA 1T0HB 1HA3A 2ZRCA 4FMDB 1G5PA 1OHHA 2JEOA 3B9PA 1N6LA 1BS1A 1IN5A 4IOLA 4W7SA 4E07A 1R0ZA 3OFNA 4FMCB 1FUKA 2A3RA 4OQFA 4Q19A 2WHXA 4YLGA 3CNNA 4J0QA 4C2UA 4KLNA 1N6RA 1VG9B 1L7VC 1XZQA 2GKSA 4LHYA 3WYFA 4CIDA 1IOZA 1IBRA 3KKNA 3L82B 3U3OA 2FWRA 4MQBA 2JGNA 2WJVA 4MKHA 4RKEA 1G64A 5BN4A 2J9RA 1OH5A 1I4LD 5AUOB 3GLFE 2BBSA 2X1VA 4B3DA 2A78A 4U00A 4D82A 4TMXA 1WB9A 1EK0A 4N0EA 1CULC 1YQTA 3QUSA 5LDDC 3AF4A 1JAIA 2FH5B 2OV2A 2O8CB 3TUJC 2A5YB 4B3BA 1KY3A 2GXUA 4TTPA 1Q20A 4ARZB 4LBZA 5FOTA 3TUIC 5FTKA 1BIFA 2WTUA 2ZRKA 3GJ0A 2A5FA 1VIYA 4CW7A 4AG6A 3H2YA 4TYNA 4LPSA 4DIDA 721PA 4FINA 1MH1A 3AKYA 1NMZA 5EUMA 5LD2B 1D9XA 2I1VB 2JASA 2P2LA 1I2MA 1GFIA 2JLSA 2CMKA 2C78A 5J4LA 1VHLA 4MKGA 2V55B 1F5NA 5KNBA 1XWIA 1VECA 3KXIA 4YMVA 5JJIA 1C4OA 4OI4A 5CM8B 3HU3A 4D4KA 2QRNA 4IOMA 2HF8A 1ZNXA 1KI6A 4IFBA 4ARZA 2O8FB 2J46A 5JSZB 3DKVA 4GFDA 3AF2A 4EJSC 2H18A 4RCYA 4PANA 1K6MA 3I4LA 4MKFA 3I92A 4EQ6B 2KE5A 1F60A 3KFVA 4KFRA 4DLXA 3PCRB 4BLOA 2IYRA 1AIPA 2FGJA 3BORA 4LDJA 1C9KA 2ORIA 1OXXK 3SHFA 2F43B 4XVUA 3TQCA 2AD1A 4JT2A 2CLSA 3ASZA 1RRGA 4KCGA 4GPTA 4D0NA 1II8A 2XB2A 1RRFA 5DO9A 4AG5A 1FP6A 2VP0A 2DCUA 3RRMA 3U3JA 3NG1A 2IYYA 1FTNA 3DM9B 1DPFA 5JECA 5C46F 3LQQA 1YR8A 2WKPA 4BLTA 1ZP6A 2WIAA 3HJNA 4Q9KA 2H7VA 4QGHA 2RGCA 3TSWA 1AA9A 3ZVNA 2O8DA 5B30A 3N5CA 2OILA 2WJIA 2XNDD 4JKYA 1OLOA 4XD7A 4CT4B 4L9SA 2WWWA 5JWOA 1XFAA 4JJZA 5HE8A 4S35A 1OH8A 3EPJA 1NVXQ 4PQRA 1UBGA 2BVNA 4URVR 4BFTA 1GZSA 3QVUA 2MMGA 4N3NA 4A2PA 4LHWA 1CIPA 4LYHA 2KBEA 4D2IA 5C18A 5K8UA 4AKHA 4E5UA 1FX0A 1XTKA 4NMMA 2ZROA 3GJXC 3VQTA 2ZJAA 3EWSA 1UKZA 2NO0A 2ZI5A 3CPEA 4B74A 3AF3A 4LHZA 3RS7A 1ZC4A 1SVLA 2YZ2A 1HQCA 3ZH9B 1OH7A 4PPQA 2ERXA 3GLGB 1ODFA 2ZRJA 3ZVRA 3LBHA 1Q1BA 3RSLA 2GTPA 2QENA 1G5TA 3EPLA 2FV8A 4FWTA 4KITB 2WIBA 2EYUA 2R9VA 1G3QA 4V0ME 2E87A 1UPTA 1SHKA 3B5JA 3IIJA 3VKWA 1AGRA 1J8MF 1NMXA 4Q1DA 1U0LA 4GL2A 5FOWA 2UZIR 2P0EA 3AKDA 2DFTA 1LS6A 1TMKA 1CU1A 4EUNA 1XDBA 4K46A 1Z0IA 3KB2A 3Q5EA 4ZDJA 4TYWA 4B76A 621PA 1WQ1R 3I32A 4U5XA 4JBWA 3KTAA 4RD4A 5F9FA 1JR3A 2I3BA 2CCGA 5HCIA 1KZGB 2EFEB 4OBEA 1W36B 1QHYA 2GBLA 4A2QA 2OLJA 3EIQA 1P4SA 1XTRA 2D62A 3WMGA 3RVBA 3RS0A 3KZ1E 1WDTA 5E7JA 3OE7D 5K8LA 3SYKA 3MJRA 4A0FA 1N0WA 5D3QA 4QNMA 3AUYA 4P33A 1WE2A 4LZZA 2BCGY 3BJIC 1GSIA 2WAXA 2XZLA 2IHBA 2BM0A 2VF8A 3RABA 3C8UA 2NZ8A 4U02A 4IDHA 3RLFA 1T3SA 3E1SA 3NTUA 2V3CC 2FSHA 2VP2A 1E2KA 2GHIA 4BPBA 2WJJA 1AS2A 1LB1B 1DS6A 1KMQA 4RD2A 4ASUD 5FL7D 221PA 1V5WA 3QKSA 1K8RA 3FYHA 2W6ID 3R7WB 1F2UA 1CP2A 4B2PA 2ZRIA 4BLQA 3I62A 421PA 1J90A 5JFGA 1N3BA 4WZAE 4YMUA 3IQWA 3THYA 2VLIA 3FMPB 4BFZA 4DZZA 4NCNA 5TARA 1T5LA 1AM4D 4I1OA 1EFRA 4URXR 4GOKA 4MUBA 4TZ0A 2FPMA 4F4CA 1YVDA 3OHMA 1W1WA 1R0XA 2IYQA 4LJ4A 5CLQA 1Z83A 4G1UC 2PLRA 4X8MA 1SXJB 1XNJA 4NCHA 1G7SA 3NH9A 1YZQA 2CCKA 1NIJA 1PZNA 1ELOA 1N2CE 1Z5ZA 1XTQA 4LJ5A 2BCJQ 4HB0A 3CH5A 1G16A 1Z6YA 2FZ4A 1R6BX 4UNNA 3QXXA 1RVDA 1TF5A 4M1SA 2AL7A 2OFXA 4B34A 4NDZA 4AK9A 4U7DA 1Q3TA 2GF9A 1OXTA 1UEJA 1ZUHA 1KMHB 4EKDA 1N6IA 4NHOA 4QFMA 1E2NA 5L3SA 3KFXA 3ZS9A 1GKUB 1ESNA 2E1RA 4QHTA 5B57C 3QPUA 1T5IA 5DNYB 2BJVA 1GRRA 1LF0A 1S9HA 2DR3A 2C9OA 2GBLC 3WRXC 3KQUA 2QBYA 4M53A 1KSFX 4C0SA 3AM1A 3CR7A 521PA 4MGKR 3BH6A 3GLHE 2QM7A 4WBSA 4QJ3A 2FMXA 1GP2A 1YHNA 1L4UA 2ZJ2A 1XJCA 2GK6A 1AGPA 2C9YA 4ON9A 3C16C 2IXEA 1MABB 4HAVA 3MG9A 1N5IA 1NRJB 5FBLB 2PEYA 4ZDKA 1A4RA 2H16A 3BFXA 2B8TA 4ZCLA 2R6AA 2YYZA 4WZ6A 4IDQA 2UVQA 3EW9A 4AI6A 2XB4A 4ACBA 4UQOA 2OFWA 4PZZA 1GG2A 2OG2A 3N2EA 4JL5A 4PAOA 5K8IA 1XPRA 5G3ZA 3LH5A 1SULA 1R0WA 1E96A 821PA 3FWYA 3FKSA 3LV8A 1XZPA 1W2HA 1E69A 3ECCA 4M9SA 2D74A 5CYOA 3DDCA 3JZMA 3NXSA 1AN0A 1XU4A 1ZUNB 2W6JD 3WXMA 3RNLA 4XH9B 3X2SA 2HLDD 1P3JA 3EZ7A 4BGDA 4FD2A 4BZQA 5J40A 3QI2A 4IHQA 3LBIA 2VHQA 1XRJA 3GLIB 4BFVA 2NMVA 4PHFA 1U98A 1Q44A 4ZPXA 3NEJA 1PLKA 2QTVB 3PV0A 5KDLA 1GM5A 2QZ4A 4R2IA 4BEJA 4PFSA 1UBFA 3RANA 1MT0A 4TSFD 1E2FA 1JJ7A 2ZJZA 3A37A 4TMKA 5HE9A 4NP6A 2Q3MA 1ZM4A 1VYTA 3X1WA 5IT5A 4KV9A 1JAHA 2CVFA 2Q3HA 3GJ8A 1F6BA 1ZVQA 3K0AB 4ZO4A 2WWGA 4A8JC 3SR0A 5JZVA 2O8EB 2WPDA 2QAGB 2BM1A 4FCTA 2CL6X 4UXIA 1OFIA 2R8RA 3BIFA 3HP1A 5FOXA 4DIEA 4CEIB 2GK7A 3I3SR 3M1IA 4MGYR 4DT1B 2RGNA 1FMLA 1X8LA 5DN6D 1W47A 3QJYA 1S3GA 4B2IA 3KQKA 3UXMA 2X2FA 4LJ8A 1OE0A 3FVQA 3THXB 1Q1EA 3LFUA 1E99A 1E1QA 2WM9B 1E2DA 3EZ6A 3BK7A 3B60A 3HPQA 2W0MA 2G9NA 5CYPA 2W2TA 3AP3A 4A1FA 5FL3A 4IDOA 4DT1A 3VU9B 1SVMA 3IHWA 4Z8XA 2Z4SA 2HF9A 2F1RA 2QORA 2RCNA 4NCJA 2JJ2A 2PH1A 4HI0E 4IDNA 2H17A 2QRZA 1JI0A 1PV4A 3OESA 4TMTA 1M6NA 3DPUA 3QIAA 3OEHA 1KTVA 3MUFA 5JEDA 1KI6B 3IGFA 4G5QA 1AKYA 1O87A 2BDTA 4MYHA 5GVSA 1E0KA 1XCPA 2XSZA 3BD9A 4TL9A 2GJAA 1SGWA 1AS3A 2REBA 3EZ2A 4OHXA 3W8RA 3K8YA 4BUJA 5M04A 1KJZA 2X8AA 2LWIA 4GMXA 1HE8B 1E1RA 2QT1A 2VP4A 4QRHA 3SBEA 2W0SA 3TAUA 2AXPA 1FTSA 2WJHA 4TQAA 3GJ7A 4DB2A 3ADDA 1CRPA 4G5GA 4ILEA 2ZE7A 3ZGXA 1CXZA 1UBEA 2GF0A 4O0MA 5J4VA 3A1WA 2CHGA 4KHZA 1VCMA 4Q47A 5JSZA 1VG8A 1Z3IX 2ZQ5A 1OXUA 3HPRA 2ONJA 1Z08A 3TJZA 1W7AA 4DSOA 1J99A 1W2GA 1HTWA 1T9HA 1G20E 4PX9A 4XTCS 3CW2A 4EIWA 3J81k 1E1QD 2BEKA 2FDCA 2OHFA 3GQBA 5TV2A 3L8ZA 2Q0HA 3RWOA 4RD1A 4C4PA 4BLRA 2QGZA 2O5VA 5KPDA 4NH0A 3THWA 2A2ZA 1W5SA 1W36D 1X3SA 1N6PA 2ZYTX 4NYMR 1SXJA 4DLRA 2O8DB 3MWYW 1E2JA 4QJ4A 2QSYA 5CM9C 3CR8A 4G5RA 5CK4A 2HEIA 2XX3A 2ZSDA 4URZR 1ZAKA 1AQYA 2WSSA 4WZBE 1N6HA 2MSEB 1S4QA 4HLQB 2ZTSA 2GXSA 3SZRA 3X1DA 4DDVA 4B35A 1G7CA 1SKYE 5JRJA 1DADA 2QAJA 4QJ5A 2QQEA 5A0FA 1GTVA 2XSZD 2ASEA 1XCMA 1P9NA 1G21E 1W4CA 1QF9A 4Q7JB 5F98A 2JLVA 3CRQA 5C4MA 2AKYA 1R2QA 5KOYA 4BZXA 3CH4B 3VTKA 3QEJA 1H8HD 2CL0X 1U9IC 1GRQA 4F4IA 2YWEA 3WYAA 1VYUA 3OIVA 4Q4JA 2RKOA 4F91B 1KI3A 2QP9X 2YKGA 1T91A 1G3MA 3LA6A 1GWNA 2OEPA 2ZRFA 3BRWD 3BWDD 5HR5A 1DOAA 2D2FA 1U90A 2ODEA 3THXA 1X86B 4ZCMA 1JR3E 3U2QA 4CEJB 1A82A 1YKSA 1ZU4A 1HUQA 4HLUC 1NVVQ 3CX6A 2OZEA 5FOUA 3IPXA 2CCJA 2CE7A 3Q3JB 2V1UA 4DDWA 1EWRA 1ZIPA 3K9NA 4A36A 3AH8A 2FNAA 3KTAB 4RZ2A 2DFNA 1JQJC 3OZXA 1HQYE 3N70A 1V43A 4HAXA 4B33A 3V9PA 1XXHE 3K0AA 3THWB 2O8EA 3AB3A 4C0BA 5L3SB 1JNYA 1G7TA 4HAUA 2FJUA 4URUR 3TE6A 1Q3HA 4PZLA 1A2BA 3SQXA 1JR6A 4QOSA 3L0OA 3QQ5A 2WVJA 1U2RA 1M7BA 2D4HA 3U60B 1T0JB 3KKOA 1ONBA 3AF0A 4A0GA 1GKIA 1G8HA 2VEDA 3IILA 1TPZA 4M1OA 2QTFA 1KO1A 3U3RA 4NONA 1CEEA 1OXSC 3GLGA 3F8TA 2GVZC 1TUEA 4I81A 5EXXA 1NN3A 3SJBA 3CPHA 3FFAA 3WP1B 5FBRB 3O8BA 1NN0A 4EPWA 2N42A 4OQLA 1NBMD 4LRWA 3EIHA 4HB4A 4WA7A 2CE2X 2VPPA 1NBME 4EPXA 3U7GA 1XPOA 4AD8A 1N0UA 3I8XA 4HYYA 4I1UA 1HT2E 1MV5A 3T06B 4JT4A 4MRSA 1H8EA 4PPFA 1E0SA 1G1MA 4BASA 1XMJA 4EDHA 1KSJA 3F5FA 3FMOB 5DYGA 3W6NA 2DBYA 4B43A 5FI1B 5HPYB 2D06A 3MMPA 5LB4A 2F43A 4RD3A 3OAAA 2IYXA 5EE1A 4BFYA 4EFLA 2W6JA 4YQFA 1ZD1A 2JJ1D 2A5DA 2ZYVX 1CJUC 1ZM9A 2GEVA 5DH9A 4LHXA 1T8TA 3LW7A 4A9AA 2WSSD 3GJ5A 4YDSA 4ACAA 2R6GA 5DGXA 3UMRA 1OV4A 1Y3AA 2B8WA 2OLKA 3CKLA 2ZVQX 3PUXA 3IQXA 4JLKA 5AR1A 2W58A 4C9BA 5EJEA 4D4MA 5ELXA 4MGZR 3U6BA 4HLDA 4HAZA 1KI2A 3VFDA 2X77A 2ZJBA 4K8OA 2J59A 4EFMA 2B7CA 4CYMA 2OBLA 1KKLA 4LYFA 1HY3A 3EIEA 5DHFA 4QC2A 3U6KA 2Q21A 1DE0A 2FFBA 2IK8A 4LC0A 2ZRBA 1VTKA 2J45A 3CUEF 2FPKA 2EVWX 3PUZA 3MLEA 5KSOA 3H84A 4ZCIA 4W5WA 3K0EA 4KBFA 1UKEA 5KHOC 2PZFA 2ZREA 4FI3C 2FN4A 4JLDA 3KX2A 3WBJA 2OCAA 5JEEA 4MRNA 2P6NA 1HEIA 2UKDA 2ZRLA 2ORVA 2ZUDA 4IVPA 5ANRB 1EESA 2PT5A 1VDZA 5JRZA 4X8OA 4HZUA 4HB3A 2G1JA 5EUQB 8OHMA 2QL6A 2NOAA 4O3MA 2QT0A 1NN5A 1XD9A 2JJ8A 1P2SA 4E09A 4DBLC 1L2TA 2RAPA 2CHQA 1XEFA 1NN1A 3WRYC 4JVMA 3OFND 1OPXA 1NKTA 2JJ2D 3VU9A 4DLWA 4Q48A 2ONKA 1YZGA 2O0HA 5EP3A 2VYFA 2IYVA 2P5TB 3WMEA 4DWJA 3DEFA 3OEHD 3K9GA 4H1VA 3QXCA 5EE0A 2ANCA 2CK3A 3QXSA 3QKSB 1KDTA 3Q72A 1VYVA 4GOJA 1YZNA 2PZEA 2WKQA 3GLGE 1J8YF 5E7MA 5HKKD 1VG1A 2ZSEA 3WY9A 5DI3A 3C14C 2CLDX 3RS4A 1XB2A 1ZUIA 3GPLA 1G8FA 3PQCA 2W83A 3PENA 4OKSA 4AIIA 1FZQA 5CJPA 4POAA 1RW4A 1TU4A 3AKCA 3KUDA 3BB3A 4US1R 4OHZA 3K0FB 1FQJA 3KL4A 1NJGA 4JBYA 1IAQA 5DHAA 3EA0A 1ZYUA 5H70A 2YV5A 2HUPA 4TL8A 3VX4A 3GJ6A 3GCGA 1KK0A 2DPXA 2JJ1A 3A4MA 4BE7B 2QPTA 2F3RA 4CT5A 4FMDF 2KJQA 2AXNA 1YJ5A 2B6HA 4TL7A 3RWMB 2G83A 2IS6A 2BMFA 2GJ8A 3HWSA 4MKIA 2H57A 2PMKA 1IM2A 4FWIB 4LJ7A 3ZDQA 2QSZA 1BMFD 3GFPA 2JLQA 1YU9A 1VCNA 3ETLA 2DYKA 2ZUCA 3N2IA 2IWHA 4CEJA 1M7HA 1QHHB 2B21A 4ZI2A 1T4GA 5IDVA 1M1YE 1U94A 2N1BA 4K81B 1UFQA 1M34E 1MR3F 1VG0B 2OUKA 5F2EA 4Z51A 3NBZC 2VHTA 1J2JA 3NWJA 4OQXA 2EFGA 3W34A 5AJVB 4Z1MA 3TBKA 2OBNA 1Q57A 2EFCB 3WHLA 2IUSA 3VKHA 2H92A 2JIZD 4TMZA 1DVRA 5AUNB 3REGA 5E7IA 3ZVMA 4LC1A 3TR5A 1YZKA 1P73A 2IEZA 3KUCA 2OBMA 3PUVA 1W0JA 1TEVA 2PJZA 4Q1EA 4DCVA 2FA9A 3E2IA 5A4JA 3BH7A 5CITA 1ZCAA 1IY0A 1P60A 2ODWA 1BH2A 1YZLA 2D2EA 3NHAA 2A5JA 1O3YA 3NDBB 2BWJA 2ZETA 3QG5A 1GKYA 4GZLA 5FTMA 3EAQA 1GL7A 3DOEA 2QN6A 3NH6A 1UF9A 2BBTA 5EE3A 1GNQA 3GJ3A 3PIRA 4PO9A 2XNDA 4XD7D 3CLVA 4Q1BA 5CDFE 3SDZA 5LD2C 1QHIA 1OW3B 3QF4A 2ZI6A 4IFEA 4OHWA 1TEXA 1ZC3A 1DAGA 4JKIA 4OYHA 4B2LA 1CJTC 4DLTA 5JMTA 3AF1A 1E4YA 1GL6A 1QHXA 2XTMA 4H9GA 5FUVA 1CRQA 1TAGA 1P2VA 2HV8A 6Q21A 1R0YA 3BH0A 3IBYA 1T8UA 3LD9A 3PEYA 5JJKA 1Z07A 4QXAA 3V00A 2OSBA 1KIMA 1KJYA 5HCNA 3P1JA 2OCPA 3WYGA 3QPWA 2ZI4A 3WNBA 3MFYA 3QNUA 2VA8A 4B73A 3R9WA 3WBKA 1JQLB 2HJVA 2PT7A 1W0KA 3HU1A 4IKEA 1IONA 2PEZA 2V6IA 3HR7A 2ZJYA 4Y0AA 3D8BA 1TQ6A 3QVVA 5DN6A 3SS8A 1Z2AA 4PR0A 5JCPA 4TLBA 1JEDA 3F0TA 1OYWA 2IYUA 4DLZA 4HUQA 2JLYA 1CS4C 1FFHA 1G17A 4ESVA 4LYJA 4UNSA 4DCUA 2WWYA 3PJRA 4KFUA 1IXSB 4GT1A 1G6HA 1KI7A 2DY1A 1ZMXA 3SHWA 4W9MC 3AVYA 2C8VA 2GAOA 2CXXA 3GFTA 1IJEA 3QF4B 5BN3A 1N0VC 3B1XA 5G53C 4D4JA 2ZSBA 1DAMA 1D9ZA 2LCFA 3LX5A 3TR0A 2VP6A 2FEOA 2KSQA 2RGEA 1OT3A 4UJ3A 1NSFA 1R8SA 2ATXA 4LJ9A 5FPSA 3VHXA 3FHOA 3DO6A 4L4UA 4PAQA 1E2LA 4I4LA 1Y63A 2YINC 5DYIA 3BOSA 5TB5A 1E2EA 2WWHA 3GLHA 2V7QD 4PC7A 2GZHA 5K8TA 3B6EA 4YDHB 3U5ZB 2IYWA 3K0CA 3UIEA 3CB4A 3NBFA 4KJZA 3SE0A 2JIZA 3KJEA 4GZMA 1G41A 1AK2A 2EFDB 3AUXA 2WV9A 1JJVA 2AFIE 4XTRA 5FBWB 3ADBA 4WIAA 4V0KA 2V6JA 3AVVA 5CK5A 3QE0A 5BW8A 1SVWA 3M4YA 3A8TA 5KNCA 1RFLA 1OB2A 4OK5A 1SQ5A 3NDPA 3B1WA 5HTKA 2EW1A 2Q6TA 2F9LA 4WOPA 2J7PA 4B3CA 4EPTA 1E2PA 4TT3A 4CEIA 2NQ2C 1Z22A 3BGWA 1I4DD 3Q9LA 2VH5R 4RZUA 4WW0A 5SZJA 5J4YA 3Q85A 4P32A 4D6PA 2ZR0A 2YWHA 4Q5IA 3OIWA 2F1IA 3GJ4A 3VNVA 3LDAA 4LY6A 3ONWA 3B78A 3A58B 4G0NA 5DIFA 2KWIA 4D0GA 3NBXX 1G8GA 2VP5A 4HDCA 4A15A 5FOVA 1Z0AA 3OIYA 3W90A 2GCOB 4OJKA 2IUTA 1SVKA 2D7DA 4G3XA 4KO8A 4DLSA 4ZV4A 2EQBA 3MWJA 3UG6A 2Y8EA 1Z0FA 4NZYA 4HAYA 4NYIR 4UNRA 4V02A 2XXAB 3A1SA 2FU5C 3A1TA 1NJFA 4DDUA 2VIIA 3ADKA 3DZDA 3AP2A 3FHCB 4JJKA 3E70C 1FL9A 2IC5A 1NI3A 2V1XA 3SYLA 1T3LA 1LW7A 1N5JA 3GLFB 2WZQA 3K09A 4DB4A 4FCWA 2GXQA 2WBLC 3K70B 2RGDA 4B47A 1KO7A 3ICQB 2FPLA 4JYBA 3ZS8A 2HDNB 2CHVA 4HSEA 3UKDA 2OE2A 4HB2A 3NIBA 4TT3D 2QBYB 4XWKA 5LBIA 1MO5A 2JA1A 2Q9CA 4PSVA 5FPHA 3IEVA 4JLBA 1E0JA 2V8OA 1JALA 1NSTA 1Z8FA 3UWOA 4C7OB 1E9BA 3AVQA 3OF5A 1RRPA 2I4IA 2VSOA 4A6PA 2WWFA 3IDQA 3FKSD 1UJ2A 3RAPR 3GFOA 3SI7A 5KTYA 3LXRA 2AK3A 4RZXA 5DISB 3RS5A 4AYWA 4RZ3A 5FPTA 4EFNA 4B3GA 3RS2A 1HV8A 2NG1A 2OAP1 3VMFA 5CIWA 3ZVLA 5FPKA 1EFCA 2ANBA 1XD8A 4A2WA 4KAXA 1ZD8A 1R5NA 4URWR 5GVRA 4ZI3A 4B3XA 2YNMA 2QM8A 3T5DA 1XJ0A 2JAQA 4OL0A 1COWD 4V0MA 2BMDA 2W2VA 1G291 1KKMA 1Z0JA 5AK0A 1MKYA 4BLSA 3FPAA 3VKGA 1W0JD 1R5OA 1XX6A 2DFLA 3BFVA 4R71A 2F9MA 5LPNA 4RFVA 4II7A 4X8HA 3NEYA 2ZS9A 4M8NE 2A30A 3MSXA 2Q9BA 1PLLA 1UDXA 5JS7A 2OXCA 3QKUA 1MO6A 3OEEA 1JXMA 1OIXA 1X1SA 1OHHD 1KZ7B 2HCBA 1ZINA 1NMYA 3ZD6A 5H1YA 4JLMA 1QHNA 3WMFA 4C3ZA 1IY1A 1ZM3A 3FE2A 2C77A 3K70C 1F48A 4PQFA 3FHTA 1G8PA 1PUJA 2ZJ8A 3CF2A 3CRMA 3TH5A 3P4XA 2ZJ5A 4TN1A 3CONA 3WNCA 3AVPA 2GWHA 4D81A 1P72A 2WWIA 4Q00A 5IK2D 1PJRA 1XTIA 4N1AA 1P62B 3BFKA 3UK6A 3E5HA 5G40A 4MDEA 1TUIA 1OIWA 2FG5A 2Z6VA 3MJHA 3HDTA 3OIUA 1S3SA 2F7SA 4JVNA 3M6AA 5TMPA 4ASUA 1JPJA 3Q8XB 3QENA 5FR1A 1XCGB 4C0HA 2YWGA 3DM5A 3FOZA 1NF3A 3PUYA 2FFHA 5KSZA 3TMKA 1S96A 4C0LA 4LUCA 4B3FX 2R65A 1AQUA 2R6CA 4BQSA 1TQDA 4BFWA 2E9SA 2J0UB 4MYCA 4P4TA 2ZS7A 1E1RD 1SKQA 1WA5A 1XTJA 1KAGA 1YR7A 2IUUA 1S2MA 3CWQA 5HZHA 1XMSA 4LBYA 1J70A 4Q66C 2DWQA 3NHBA 1U0JA 2GCOA 4LJYA 3QXJA 1Z6XA 2GJSA 1KMHA 1E0AA 3CWZA 1I2DA 5TXGA 4S2EA 5IK2A 2CL7X 2QMUA 4OJQA 3IIMA 1XXHA 2BKUA 1DO0A 1Q0UA 1L8QA 3K09C 4LSGA 2OXRA 4L15A 2PZGA 3MRSA 2QU8A 3PXGA 5FUXA 4NL4H 1KGDA 1Z28A 3SOPA 1IY2A 4M2LA 2G3YA 1XEXA 3LY5A 2VRWA 1E94E 1SVSA 5C2JB 1YZTA 2EFHB 2MSCB 2ERYA 3IHLA 2G88A 4D0LB 2IF0A 4TQUS 2DB3A 1CR2A 3P32A 1BYUA 2QPAA 4L16A 4A0RA 2CLCX 1MO3A 5AJZA 3LO5A 1NLZA 4LK2A 4IW3B 4NCIA 1EFUA 2QMHA 1Q12A 2XNSA 4DLVA 1MOZA 4PC2A 1P5ZB 2ZRGA 1D2NA 2NGRA 1H8HA 2QMEA 5FBQB 3EX7C 4M9QA 4F4JA 2GAAA 2J7PD 3CRW1 2ZI3A 2OT3B 1PLJA 2R44A 3C5HA 1D5CA 4F93B 5JCZA 3A6PC 3R9XA 2IS1A 2Q9AA 4TL6A 3QBTA 4WXRA 5FUYA 3ZQ6A 5BWMA 3RYTC 4DLYA 3QBVA 2GA8A 4QM6A 5BXQC 1P6XA 2X2EA 3VR4A 4PZYA 4MITA 1HT1E 3MCAA 2JCSA 2KI5A 3BC1A 1N6NA 3D3QA 2O8FA 4XOIA 1SXJE 1BMFA 1MO4A 4XJXA 1G8YA 1QHSA 1W36C 2DHRA 5GJVC 4PQYA 2J3EA 1DG3A 2P6UA 4D25A 2JLUA 3GD7A 1NG1A 4TMVA 5JWHA 3VX3A 4RCZA 5KSYA 4HAWA 4LV6A 3PEWA 4AYXA 5JLJA 4OI2A 4WAUA 3P27A 2DWPA 1U8AA 4QBIA 5FTJA 4EQ6A 3SFZA 1XBTA 5C1BA 4IXMA 1DARA 2P67A 1E6CA 2ZI9A 1R8QA 1RIFA 1Z0KA 1US8B 1U0HC 2V54A 4E22A 5G3YA 1R7RA 3CF0A 3LLMA 4V0LA 4C30A 3U4QB 3MD0A 1US8A 2Z43A 2JLRA 2R62A 1KJWA 1E32A 1IXRC 1MRSA 2ZE8A 2ZYWX 5CB8A 4B71A 3REFA 2QE7D 1G19A 1UKYA 3U44B 4Q4AA 3ZIAD 1OFUX 4AKEA 3GLIA 1F2TB 2ZS8A 3SC3A 2V4ZA 4RD0A 4UJ5A 4B48A 2LKCA 1Z06A 4XIGS 1T3HA 1VCIA 1K5GA 2QNRA 4QNRA 2NO1A 1XMVA 2J87A 2Z83A 2FGKA 3D31A
chains in the Genus database with same CATH superfamily
1BA3A 3EXHC 1IM5A 1OC2A 4QEDA 4LZJA 5DX8A 1P0MA 2O20A 2O8NA 1ZJ5A 4KN6A 4TLAA 4Y2QA 3T99A 1NVDA 2H5JA 4WX2B 5DRTA 3TK1A 2Q6VA 1JUDA 2G9UA 2WU1A 4G0YA 4LCJA 2QVCA 1DDGA 3FYTA 2VZ8A 2MSLA 2UZAA 3J7AC 4ZYLA 3JVUA 4B32A 3DZGA 1NIPA 4R40A 5FI5A 2AN4A 4IHAA 3WRYA 2KW5A 1ZHOA 4DMGA 2XT9A 3ELYA 4CWAA 3FVTA 4Q03A 2ZE6A 4BUZA 2RH5A 4MUFA 3C6KA 4EH1A 1P2FA 5I4KA 3DJYA 1B3BA 4RZIA 2NNLD 1TVMA 3NGLA 1CS0B 1II9A 2W11A 5D3MA 2JI9A 2QVXX 4WGGA 4YAKA 2WSIA 1F3OA 1Z74A 2ET6A 1PSWA 6AT1A 4RDIA 1TF2A 1KA9H 2C95A 1MABA 4BB5A 2OQRA 2P4UA 2P4EA 3DMPA 3E82A 1PZHA 3KSZO 1WZ2A 4X91A 2QN9A 1Y1PA 3QY0A 4YDQA 1WXGA 3IELA 9GPBA 1NUSA 2WE7A 3W6OA 4W5QA 1FX1A 5BWCA 2J5QA 3NC1C 5JCJA 3R20A 2BKAA 2G71A 2QZPA 2GT1A 1LNSA 2HCJB 2RAVA 4D42A 3BXZA 3AM5A 5A9SB 2JAWA 4CMKA 1FXWF 3KOOA 3KXKA 2PX0A 1L4BA 1SG0A 2DFDA 3TQHA 3NC0C 4TWJA 3KHSA 4CI0B 3OQJA 4M83A 4QU8A 5LQUA 3QFFA 1GYQA 2CXSA 2X4DA 5EJ6A 2P5SA 3I9NA 3I01A 1WP4A 5K3CA 5IRCD 1VPLA 2FAXA 1UBKS 2YVUA 4EJSB 1AMOA 1RJFA 4F7WA 3PFBA 1RRCA 4Z99A 4O2BF 1UANA 3FGNA 3R0VA 3A9WA 4DUGA 3AMVA 3U4CA 2VBGA 2B34A 5JQGA 2Y1FA 3TRDA 2HRZA 2WM2A 4J4HA 1DG9A 3CA8A 2UUAB 3C5VA 1YAHA 3NAMA 1SCUA 3AEQA 3BWBA 1YRWA 2GN8A 2HLDA 1Q1ZA 3EVBA 3SJAA 3G0BA 1PJCA 1VLJA 2WU4A 3FVRA 1I4OA 1WBBA 1KY2A 2H7YA 2QI9C 4UM5A 3IEPA 3VPFA 2C58A 3BXOA 3NX4A 2BV3A 3IPCA 2I91A 2FEXA 1QO9A 4PC6A 2IPXA 2PH5A 5ALYA 3UY4A 1ZD4A 2G0TA 1YVEI 2ERCA 1YB2A 1PO7A 1EJ0A 4Q1CA 4QHSA 1DT5A 3OPVA 4AP9A 2E4XA 5FULA 1TCAA 2LNDA 1U28C 2FQ1A 2R2AA 2Y68A 4H3SA 4YRJA 1E58A 4UREA 3S27A 2L82A 3UXYA 3CVYA 2CDBA 3FRIA 4RA9B 3VGPA 1EEHA 1CNMA 2J9XB 3IOYA 3SZLA 3B1FA 3GRPA 2OP1A 4OMUA 2YC4C 4ZJZA 2IYTA 4FDUA 2ZRPA 4K9SA 1FTWA 1M0WA 3X1ZA 5KTOA 1Y33E 4IIVA 4YAUA 4UMDA 3OQIB 4NK4A 5G4KA 2XNKA 1BE1A 1X7DA 2JDIA 2JZCA 5JHHB 2RBEA 3ACBA 3NRJA 3DCNA 4FJ1A 2JH9A 4I4NA 4I50B 4ANFA 2LUOA 2YVAA 4LRTB 2BC9A 5D87A 2R25B 3CBQA 2BBWA 4BBPA 3BB1A 3H6GA 3EEBA 2C99A 2JZOA 3OBIA 4IUYA 3GG9A 5F3DA 1KI9A 2VF7A 3LNTA 4CKEB 4TQ9A 4TXJA 4E0BA 4WJKB 5LJIA 4QBHA 3FFTA 3HVRA 1FIUA 1U4SA 3QFTA 3B1VA 1DKMA 2GBGA 1VC2A 2EEZA 2I65A 3EC2A 3AR4A 3PNBA 3I42A 1BKDR 2GK3A 3QYFA 2O8VA 1EPUA 3CIFA 4QELA 3N75A 1GQYA 2CJWA 1U0FA 3DKKA 3FCCA 4X85A 4LF5B 3F74A 3ZWKA 4E2XA 2P9CA 2QUKA 3S5JA 4DWOA 1NF2A 3SBDA 1X8JA 2ZJ7A 3H86A 5M34A 3NBQA 1BW9B 2XQFA 4HTFA 4MYUA 3IEIA 3LVFO 1VHTA 3KJQA 4HRVA 4U3JB 3TLXA 3PFHA 5K01A 4OUKX 4ZYVA 1NQVA 1WCYA 4LXGA 4G8CA 2ZK7A 2BUBA 1K92A 4YXWD 4Y18A 1NZDA 1H4VB 1QR2A 3SYNA 2HSGA 1QKIA 1S0UA 3IOMA 4DEXA 2P65A 1CHNA 3A9VA 4IV0A 3FD8A 3URKA 2NPIA 3AV0B 2G0AA 4C29A 1SR8A 4DJJA 2GK4A 1ZUD1 2AQHA 4DXHA 4KHPB 4BO2A 4YRSA 1TOAA 4BNGA 1AKNA 2AFRA 5AHKA 2UUPA 2EU8A 4DC9A 3FOFC 2H4WA 2ZTUA 4Q3DA 1IHDA 3ICVA 2JLCA 3H9UA 5UKDA 3GFVA 2Y0DA 3NBKA 5E6SB 3N6XA 3V1UA 4D8VA 2HW8A 3EIWA 4Q3AA 5GJWC 3UMSA 2EFJA 1RPTA 4F38A 1X1AA 2GPTA 2WAYA 3H65A 3I73A 3T34A 3EBLA 3N6VA 1C7EA 3HDGA 1KVSA 5LXTB 1D2AA 1DAOA 2VJBA 4Q9IA 5IX8A 1DWUA 3M8KA 4UTNA 1N25A 2R2GA 1RNLA 4OI0A 1DX9A 4KK4A 3ZE7A 4KAFA 2M2IA 1NZFA 2D0PB 3D6HA 3L0CA 3RT1A 3P0FA 3N5KA 2B36A 2VDQB 4DE5A 1NXOA 4NYJR 3ZC3A 1G9SA 3GU3A 1DAHA 1KORA 2WK1A 3G23A 3I5MA 2VBFA 1AQIA 1A95A 3FCYA 3HU2A 2Y6VA 2AVDA 1NW7A 4QTTB 3FUUA 3T7RA 2IOHA 4LVNA 4JXXA 1IUOA 1OLSB 1UJMA 4GG1A 4YALA 1KJJA 4E03A 2IOFK 5G1PA 5FA5A 5LA6B 4E3WA 2R84A 2G1KA 2G6BA 2EP8A 3Q3HA 5DMHA 1RYDA 2DFKB 4MPPA 4E31A 1PT6A 2YXPX 1BS9A 3RJTA 3WJ1A 2RB4A 4AS1A 5JS8A 2F1OA 2N46A 2QLFA 4QBFA 2WNSA 3ZD9A 3IPYA 2GZ3A 4FYJA 4NBRA 4GYKA 4WZAB 3QE4A 1YUMA 2E4AA 5FLEX 1L1EA 1JDVA 1JKJA 3MJFA 1UJ6A 1XCLA 3I1YA 3OM1A 3KOXA 4ZEWA 2HGZA 5G0WA 3BYZA 4IH4A 5L3VA 3QVKA 3CX4A 2CWWA 4MJ7A 5CCBA 3AFGA 2VQSA 2QTMA 2QAGA 3UAOA 2WG1A 1E79A 3ZLBA 1G18A 2WVAA 2J5XA 2OXTA 3EXEB 2J3JA 3O84A 3DR3A 3E5RA 2SCUA 1Y6ZA 3GMSA 3CRVA 3FCEA 4QU0A 4YP7A 4P8RA 2I8CA 2HJGA 2RHDA 2NSHA 4AMZA 3BUSA 4PPYA 3EWIA 1SC1A 1QO0A 3FOWA 3KS9A 3KT6A 3FWHA 3I64A 1CY4A 3W5IA 1G9TA 4DGSA 1TQ2A 5B1EA 1ZU5A 2WYIA 3KB1A 3P71T 3D3EA 1KS2A 4AY3A 5LIPA 3UANA 1QIKA 2AQKA 2WMYA 2V6FA 1XD2B 1WMDA 3QJGA 3E22B 3KQHA 1GCOA 1ZM2A 4GXNA 3C6YA 4QQ8A 1Z38A 3SEAA 4WLFA 3IP1A 3BVPA 2D0IA 3U4HA 1RXWA 3WKAA 2XZOA 2LRHA 4M9XA 4DTCA 2IHVA 3WWYA 1XZBA 3L6CA 4KW7A 5JO9A 1POXA 3K15A 3NKVA 5J5CA 4RVSA 2EFYA 3ICPA 1I6LA 4LDAA 3QKWA 1SXQA 3KWLA 2EZ4A 2IXAA 2QG9A 1M75A 3NUQA 4RVCA 4YPOA 3SVLA 3A1VA 1N0IA 5AKZA 2BT4A 3VH3A 2VG8A 3Q7PA 3ZW9A 4DVJA 3DXXA 4ETMA 3TPCA 3PDWA 2CLMB 2JI4A 4KVFA 5LNK6 2UU9B 4ATNA 1U9IA 5GZ3A 1UIMA 4IVRA 1GNVA 2D5IA 3NHLA 3OH8A 1OXVA 1DX4A 1H65A 2WPDD 2ZBPA 4NENB 2XE6A 2G9ZA 2X9VA 3CJQA 3CNQS 1I3CA 4Y2JA 4F6RB 5EIWA 4XQCA 4KWCA 1T2VA 2FZLA 3L3BA 1SVIA 2WSMA 1X80B 2V7GA 4UNPA 3ZKAA 2M6RA 3KPJA 3LVQE 4LZPA 3KQLA 2PKEA 1B2RA 2PHZA 4JR0A 2V6GA 4OF4A 1JKIA 2XAUA 1DT3A 3L7KA 1U6JA 4OK6A 5DSZA 5AUQA 2HIMA 4LSZA 3W06A 1V1MB 2FFAA 5C52B 1QSGA 3MEQA 4NYIQ 3S2SA 3HE3A 1Z2DA 3BEDA 5FTNA 3C15C 3BN3A 2XXBA 4KQXA 3QP9A 2XZPA 1GCUA 4NI5A 3H1TA 2PX2A 5LQKA 2VBIA 2A0XA 5HOEA 4KODA 1SD2A 3DB2A 2A88A 4GLFA 2P3SA 2ZXUA 4DSUA 4ZEVA 2ZUFA 2ZAIA 1KPGA 4FGSA 4R9UC 4UFPA 4G86A 3SXUB 4N6GA 3TXAA 1SKYB 2HUNA 2XUGA 4MP8A 5JZMA 3ESYA 1KJQA 3FH0A 5AI8A 2YXDA 2RE8A 4QGBA 3DMNA 4YMSA 1II0A 4DIMA 4Z2AA 2HSEA 2A35A 2V8BA 2VSFA 3CE9A 1PD0A 4IXTA 1U7ZA 2FPIB 1NKSA 2FQYA 3FY4A 1V5IA 1X38A 4RE5A 1KI8A 2P6PA 1A8IA 1P33A 3DULA 3T7AA 4HLCA 2PL3A 4NZOA 4Q01A 4XVQA 2TMKA 5M29A 1G3IA 1LTQA 1QANA 3FLAA 4UNIA 1E5QA 1PK9A 5CVVA 5AMXA 1CWUA 2H52A 1R4AA 3ZHSA 3ZW8A 1YBAA 1NBOA 1WPXA 4R7ZA 2X14A 4Z4EA 1KU6A 2MWMA 3BB4A 2JKZA 1A77A 2CDAA 6GPBA 2O7QA 4XIYA 3L0PA 4ZIRB 1RZRD 4AYTA 5SZHB 2R1VA 4U6NA 1N57A 1GGVA 2VOEA 1XYYA 2IQ5A 2ZAGA 4ONEA 3BS4A 1SZDA 2Y2VA 3SP1A 3CUSA 1WM1A 4FOPA 2PXAA 2HJSA 2ZIZA 1A9OA 2HHAA 1E9FA 3GCDA 1QTRA 1N6OA 1YD7A 1BHSA 1QG2A 3A0UA 5BSRA 1J2RA 3T3EA 3EVGA 3D7RA 4JH0A 1ZXXA 4Q3NA 3EFEA 1P7PA 1BQEA 2ZG6A 3E03A 4ID9A 2YYAA 5TEVA 2VUIB 2WHPB 3AEZA 3L18A 1Z2EA 4J0GA 4A8JB 4AZVA 4DLLA 3W5CA 3O8OB 1U2DC 2NU7A 2CVHA 1ZM7A 5AWFC 3RV3A 2Q27A 3USCS 1UQRA 1R9NA 2C61A 1R16A 2Z2YA 4BNKA 2FZKA 2C88A 2KX7A 5F12A 3EZFA 5EP4A 4C7XA 2BIFA 3NALA 3L0SA 4DR5B 3OKAA 4EENA 3V4VB 4U7PB 4B5KA 2B25A 3ETDA 1E2BA 4DCTA 1HE2A 2ESRA 5K6AA 3OWOA 2XV1A 3AVOA 3SJZA 4BGUA 4CL0A 5AVVA 1E1MA 5HRUA 1U3TA 4MAMA 1TTTA 2D7CA 2C5BA 2JFUA 2XNHA 3O21A 1HOTA 4M0UA 3ZZMA 1KO8A 3ANLA 3KOZA 3N76A 2QP3A 2Z6QA 3EZXA 3TVTA 1W581 1KYZA 1YASA 2XY4A 2I1WA 1I2CA 4GYYA 2OQVA 3RTGA 1U0TA 3HCDA 3ENWA 2G1AA 4L8VA 4JUIA 4AX4A 8GPBA 3NEAA 3UPDA 3L6EA 3DHEA 2CDNA 2R87A 3GVHA 5KCZA 2GZAA 1KEZA 3BHJA 3CX7A 4FYWA 4MX8A 3ZZ0A 2PUBA 4UAUA 1I32A 2NTEA 3MGGA 2NPFA 3BBLA 1SUCA 2NNWB 3ORSA 3O8CA 2GJKA 3PE6A 4KREA 1GTRA 1JECA 4B4WA 3KEOA 3ZE1B 2DKFA 3RU2A 5LU8A 4OYYA 4CTNA 3TB6A 1EBFA 5IPFA 4RM3A 5KNCD 5IZ4A 3BE8A 5TDHA 3MT0A 3DAGA 2FMIA 2C3OA 1WHSA 1QHEA 1EYZA 4DA6A 4ECAA 1O94C 2P9YA 1CVIA 3KEGA 3KYIB 4YLEA 4IRXA 2QG6A 1WCIB 5EQTA 1V9CA 3PPYA 4M1TA 5FPYA 3WLPA 2WM8A 3H1EA 5E0OA 4HRXA 3ED1A 4OQQA 5ELLA 3JAWA 2PX5A 1GZ6A 4X6YA 1RLUA 3TZEA 3K9QO 2XVMA 1TT5A 1XU9A 3Q7EA 4YONB 4KXXA 4KPFC 1E1NA 3ILHA 4EG7A 5SYNA 1Z29A 2NSLA 5CA0F 2AK2A 5LQNA 1KVTA 4KQ6A 3ZZUA 1V37A 2D3WA 2XECA 3EAGA 4QLAA 2CNOA 1OQAA 1Q1AA 2FSSA 3CKKA 4CODB 5FV4A 1FVHA 3A25A 3ET4A 2VSYA 2O8BA 4FHGA 1KARA 2CJXA 1Z5NA 3PGJA 3E58A 5TQJA 1W1UA 3DDUA 2O9JA 4QEKA 4DF3A 2YVLA 3N05A 1GR1A 2EX1A 2H5IA 4JB3A 3SX0A 5T6MA 3I6QA 5AOCA 3TW6A 5BOSB 1LDGA 1ZLYA 4KYUA 3AR8A 4I6GA 5J47A 4BVFA 4OQZA 2H1IA 3QF7A 3QEOA 1O08A 1C0KA 3DLTA 4XR9A 2V9ZA 1OX5A 2XDQA 3F6BX 3VDXA 2GFQA 3AY3A 4OXRA 3A1UA 3TLMA 3WK4A 4WACA 2Z57A 3PR3A 4IG9A 3H8SA 2KYRA 1JPUA 1U8YA 1YGPA 1VJ0A 1P7ZA 1QH0A 1R88A 4I3HA 1QAOA 3A2LA 1SXJC 1ST3A 2CNNA 4US2R 1J21A 2FY8A 3KJIA 2REOA 3DBOB 4Q4HB 5BVGB 1DOZA 4I3FA 4YAFA 4CM9A 1Q0LA 1HE1C 3GZNA 3WL4A 4CKCB 4R51A 3CWCA 1VQ1A 4HGRA 1CQIB 3ZWBA 3NHKA 4B1FA 4L5CA 1FOEB 2MDTA 4DYVA 2C5HA 1FDTA 4YMLA 4LI3X 3EPPA 1NVFA 4MIYA 4YP5A 1TCUA 3P94A 3OE7A 2PG3A 3KJHA 3KP1A 2QX9A 4CMGA 4HYQA 3I37X 3IVCA 4PZPA 3ESDA 3T61A 3GEHA 2NAFA 3ZU6A 1UOQA 4I5GA 1N2XA 1GT91 1H2AS 4Q1FA 2IU0A 4ERNA 1L7DA 1VJ5A 2BBOA 4TTRA 1TVKA 3L84A 3W2FA 4MRVA 3VU3A 4UEWA 3R9IA 3I2KA 1ARZA 4H4DA 1GRVA 3IKJA 1NJ8A 5J4KA 1RAGA 2QZZA 5AW8A 2DVMA 1GFSA 4N4AA 4JVLA 1FRZA 5FL7A 4URHA 2CNWD 4K9RA 2H6EA 4PZUA 5E9JA 3OSUA 4G1FA 1Y6GA 3M6VA 4D99A 4HXGA 5J2TF 3VNRA 3W8EA 1UBCA 3GRCA 4MVJE 3IJ5A 5A4DA 3H0KA 3AERA 4HDAA 5F2NA 5E1DA 1L7EA 1ZCBA 4C2BA 1FX0B 1QHHA 1QV7A 1YOVA 1N0HA 2VYVD 4BEVA 2VPZA 4JOQA 3V8QA 1JEYB 3UHPA 5ITZB 2MR5A 3JQAA 1AK9A 4NU0A 4EG3A 1W49A 1QIDA 2LZ0A 3PBKA 1P9OA 1ESMA 3GPIA 4P2GA 1QP8A 2OCYC 3IT3A 1ZD5A 2W2NA 3SPXA 3MVEA 4Q12A 1H0SA 4URYR 3X2FA 2BFEB 2BP7A 4Q7MB 3H1AA 3TOZA 1WXWA 3VSEA 3ZNPA 3OT1A 3VVCA 1MPTA 2I2DA 1K3TA 4F71A 2JLZA 1ESZA 1MQSA 4ND7A 4AJNA 3KQVA 3DR5A 1V2GA 2PIAA 4OXNA 1QFYA 1KK2A 4PVDA 4UBNA 3N74A 1LK0A 1TKRA 2HFKA 1JA0A 3ZUGA 3KOWA 3GLFA 2GNAA 2UZ3A 1VSTA 2Z1DA 1Z35A 1UCFA 3GZ4A 1K8ZB 1R8XA 2AI3A 3IVXA 3LGAA 3Q5DA 4KXMA 3OLZA 3Q3GE 4MMZB 2O5RA 4WOCA 1Y3HA 1BDBA 3LGSA 1UZAA 4ZEOA 3IVAA 3GMTA 1KOGA 3V4RA 1W34A 1PR5A 5EXSA 3PF9A 4J2HA 4XJTA 1AV7A 2Q0XA 2JIOA 2Q6LA 5J2UA 4C7OA 3EBOA 2CK3D 5IDXA 3SEFA 1OA0A 1MJ5A 3EVDA 1G8AA 5JJLA 1XMIA 4F8JA 2B92A 2C7GA 4GP7A 5F35A 4E11A 3EG5A 1WPGA 4MA0A 4D80A 3PEVA 3K0CC 4MWGA 3CLUD 3D7SA 1JIUA 4M1YA 5FTLA 3GPBA 4NBVA 4YJ2B 4EEKA 3N8KA 4G4SO 1SCJA 3UYLA 3JWGA 1NJ1A 2ZT8A 1O0CA 1XP8A 3EH1A 2R6HA 2QMOA 4Y98A 4DPLA 5A0TA 4N65A 2H1HA 4OLFA 3F6CA 4JWTA 3FBWA 3L05A 4K2HA 1G66A 4LJAA 1A2QA 2VYVA 2IHZA 2WMNB 1T9KA 2QQ5A 3AXSA 1BROA 3EEYA 3QKTA 4IMIB 4LV8B 4YRRA 5KNDA 4OU5A 2P5UA 4HDQB 3UGKA 2ZE5A 2V7WA 4JL8A 3HVIA 3V7WA 3OTWA 3PWKA 3IA2A 3NTQA 3RI3A 2PM8A 4IYRA 1G7RA 3VR2A 4JU8A 5JANA 4FHEA 4WFJA 5BV0A 4AY2A 4INOA 4DY6A 3RT9A 4US0R 1HX7A 2DZDA 1Z6GA 4F5DA 3A1DA 2J08A 1SCUB 5FFMA 2WB2A 4WQMA 1N7GA 3HN6A 2ECKA 5EHIA 1TU3A 1DQSA 3IUYA 2MSDB 3WGZA 2W4MA 2ES4A 4OJMX 1PJQA 5AKXA 3TW8B 4WJLA 4HDSB 1UT5A 1AHIA 2QXUA 5B3AA 4UQPA 4UVEA 2QJTA 2CSXA 2ORED 2CHUA 1BHQ1 1IN7A 4UBOA 5AKIA 4ZXFA 2XODA 4JLUA 3AIIA 5FF9A 5TX7A 5B6JA 1EBBA 1ZY2A 5CDGA 2CNLA 1CT9A 1JN0A 3O9MA 4P4NA 5TT0A 2PD3A 1IQRA 1Z34A 4OHMA 2UXCB 2IZOA 4PO8A 3EXAA 4XGIA 1MJNA 3VPGA 2E48A 1ORHA 3A1FA 4I1SA 1SOWA 1PDVA 1IVSA 3HXPA 1SIUA 2I62A 2QUAA 3WLRA 4B6SA 1N4DA 1V26A 5CAEB 1J06A 4L4ZA 5IAOA 2K5UA 2PLFA 1UBUS 1TZBA 3MQFA 2PLAA 1ECLA 1Q11A 3HYCA 2FSPA 1WRBA 1JEEA 1MA0A 1ZW1A 4OXIA 3BBPA 3PD7A 2BY4A 3TBFA 1P77A 4R9NA 5CCXA 1DTEA 2W37A 2A9PA 2AMFA 2IDJA 5EKUA 1Z63A 4I1VA 5AQ1A 3E2PA 3RE1A 3TVDA 5EXTA 1JSLA 4LFCB 3H1PA 5EIAA 1PGQA 2Q1YA 1BWSA 4DMFA 4D79A 2ATVA 5KHAA 2IXFA 4OYRA 3ZU3A 1MZVA 4DM3A 4L8FA 1NBAA 1BFDA 5IZCA 1U63A 1YNOA 5K1ZA 2PKQO 4E51A 1W6UA 2JARA 1I36A 4PWZA 3VO9A 4XSGA 5DX1A 4A8PA 1QUFA 2H2AA 5A7HA 1MB2A 1Z17A 4IOJA 3OCVA 3QXHA 4Q21A 2XB2A 4LXTA 4DGQA 1PWEA 4DHEA 3P8ZA 2HXSA 2Y66A 4UW9A 3PICA 5AKKA 5LZ4A 4IMRA 3LXMA 2Y4OA 2Y1XA 3WSWA 2M32A 1STOA 1V4VA 5BN1A 1R6AA 4IVQA 1FQOA 4ZDWA 2NZJA 4FW9A 1HYHA 1FSGA 3STWA 1EX1A 2YIMA 5GONA 3WQHA 4JLPA 2P62A 2FOLA 4JUDX 3KKQA 2HXYA 2XD9A 4JP5A 3LUHA 2I4RA 1X13A 1DV2A 4QUAA 3O73A 3M3DA 4NKRA 4P5PA 4UZSA 4FYKA 3W3AA 3T5MA 3H3FA 2X7JA 3DUWA 1P2TA 2Q7XA 2R6FA 4BTLA 5L8VA 4PNEA 2J3DA 1EM8A 4GOLD 2ZBFA 3HRIA 3X1XA 4U6SA 2FPUA 2LKDA 3L7MA 1HTBA 4M21A 1PCXA 3THYB 3U4QA 4G5SA 5A4AA 4ZVNA 4HGYA 3EPHA 3LZDA 2PQ0A 4QATA 4GVPA 1P75A 1A9YA 1P4JA 2ZVPX 4KKVA 1OFUA 4REQB 2O48X 4YIKA 4EHHA 4K6CA 2P41A 2XKBA 4JZKA 3VYTB 3NVMB 2GDJA 4BP8A 5E2BA 3GOHA 1SMKA 3IIEA 3KV3O 3VC1A 5JSHA 3N53A 5AI4A 2BSQA 1T0HB 4G4IA 2ZRCA 3PNMA 4FMDB 3B9PA 2MSKA 3D59A 2DC1A 2ABWA 3O8LA 4HS9A 1R0ZA 4MW1A 2X1HA 3OFNA 4OQFA 1P9LA 3ANXA 4PBSA 4YLGA 3CNNA 5EPEA 4C2UA 1UFRA 1WVIA 1DWQA 1WLSA 4KLNA 2PUTA 1MC5A 4G5XA 1VG9B 1Y9ZA 1M67A 4LHYA 3IQZA 4IDBA 4CIDA 4FR5A 1IOZA 1IBRA 1EG2A 2C83A 2NV6A 3EFOA 4FHCA 4WY8A 3GG2A 3U1VA 3WZMA 4ZMBA 1JDNA 2FW1A 1QVZA 2J9RA 2M1ZA 3Q0IA 3ZXIA 2ZBGA 3DWGA 2H48A 3JPWA 3NAGA 5IC5A 2C57A 3KT3A 2GVNA 5DM4A 4K6FA 1ZVKA 3V2HA 3H5WA 1ZJZA 1GAEO 2A78A 4CM7A 1WB9A 2ILVA 1ZL2A 2Q5EA 3NIWA 5LDDC 1QVVA 3AF4A 2BM9A 2X0FA 2PY6A 2A5YB 5LQJA 1KY3A 3KAQA 1J97A 4EHJA 3D1JA 3G0GA 4K9KA 2COUA 5FTKA 1KMNA 1HRDA 2WTUA 2ZRKA 5JAMA 5F51A 1ZONA 2A5FA 1GGNA 3GJ0A 4XWWA 1U28A 4IJWA 4Q3KA 2PRJA 4YRBA 4BGVA 1CZUA 4QUIA 5EINA 4FINA 3OQOA 1MH1A 2ZBDA 1NMZA 1PX0A 3SIRA 4N40A 1JL3A 3QJ5A 3SY8A 1X7GA 3K31A 1PW7A 3V5NA 2HHLA 1ZH2A 1CZKA 1SXGA 4RSRA 3V6MA 4Z7JA 3EDCA 3WAJA 2FPGB 3GWZA 3KXIA 4YMVA 1NJ6A 4OI4A 4KAAA 1BX3A 4PYNA 4NAUA 4YASA 2ZSUA 3PQEA 4DV3B 2YVKA 3FG9A 2YFKA 2W98A 3OO1A 5ECDA 1IUPA 4DQDA 4F2DA 1KI6A 4IFBA 4JENA 2O8FB 4CM8B 1Y1LA 5JSZB 1RQ7A 5AW4A 4EJSC 3N8NA 3PXDA 3CKYA 4IIGA 5IAGA 1HXHA 1QFSA 2E55A 3NM5A 5BSVA 1F60A 5GZ1A 3PCRB 4ZOEA 3B6ZA 1U7PA 3L02A 5D5HA 2SBTA 2PH3A 3BMQB 4LDJA 2JFVA 2ORIA 3TEFA 3ZU5A 4FOTA 1IK6A 2CFOA 2JGIA 3WFZA 3MXTA 5E1BA 4XVUA 2F43B 4K9OA 4JT2A 3GRUA 3LT0A 3J80A 2C2OA 1RRGA 2QD1A 1RWVA 1W96A 3UO8B 5EYPA 3C7TA 1AO3A 4DYDA 3PCXA 2QUIA 3C3BA 3SCZA 3OQMA 5HA5A 3I1IA 4CLOA 2VJLA 3CF4G 3E9QA 2HRRA 1FTNA 3O90A 4Y67A 2ROQA 2Q2NA 3D7LA 1YR8A 4LGVA 1W75A 2W2MA 1PR4A 3BD8A 3DZJA 3H6KA 4YRTA 2ZATA 2H7VA 3HUTA 4HNSA 2HEGA 3PFKA 4TKLA 3WGTA 3TSWA 3AR2A 3ZOKA 2FLWA 4WASA 5BV2P 1K89A 3UWMA 5KYGA 4J07A 1BCSB 5B30A 5CX1A 1JMYA 3KVNA 4KOAA 2OILA 2WJIA 1OLOA 2EX4A 4BNXA 2GEBA 2VXBA 1NDUA 4FGZA 5DYNA 5H3CA 5HF5A 1XFAA 2DPYA 1O1YA 4JJZA 5HE8A 4YUAA 1OH8A 4NWIA 1Z0UA 1COZA 2AN5A 3WV4A 4B46A 3EOZA 1QO0D 1SD5A 5K3BA 2PUGA 4BFTA 2VZ9A 1Y3IA 1GZSA 1ZIXA 3QVXA 3CR3C 3AJ9A 3QNWA 3AJEA 4KVZA 3JQAB 4M36A 4ND6A 4P3KA 2YW9A 2Y0BA 3U9TA 1ABEA 3WWEA 2Q4OA 4DWVA 1FX0A 1NX6A 1XTKA 1YOVB 1FXSA 2HA7A 3BQ9A 2WKWA 4MDFA 2WU8A 2X5XA 3EWSA 2ZI5A 3HWRA 4MZDA 3CPEA 4KIGA 4B74A 4C0WA 4KPEC 3PI7A 2M6KA 1NOIA 3RS7A 3T54A 1L8LA 1MV8A 2FKAA 3AOEC 2VPYA 3SD7A 4PPQA 3FUTA 3ZH9B 4E1VA 1KZ4A 1ODFA 3PE3A 5CB4A 1U0SY 5B6PA 1FFEA 3DVAB 3LHFA 1G5TA 1T5OA 1Z0ZA 3MOIA 4H7PA 4HO1X 3D3JA 2G72A 4YFVA 2PN1A 2R9VA 1G3QA 4V0ME 5L40A 8LDHA 1H4TA 1SY7A 4RLHA 3DEYX 1O0BA 1W8IA 4Z4HA 4UQLA 4XQGA 3E7XA 3VYWA 4C78A 5KI6A 1NMXA 5ECYA 1W29A 1SU6A 1XA0A 2IYNA 1ATZA 3ZDEA 4LNAA 4C4YA 2P0EA 3AKDA 5DWVA 2OD9A 5KTNA 1BGVA 2PA0A 4EUNA 4K46A 1Z0IA 2TS1A 3BGIA 3IOEA 1WTAA 2FP4B 4ZDJA 2RCYA 4CR7A 1F2DA 2W2OA 3MWDB 4PZCA 5JNLA 1BXKA 2LW7A 621PA 1WQ1R 2QM3A 1QTIA 3E1KA 4U5XA 1PV1A 1RD4A 2QTLA 1SUWA 3DE6X 1XJ5A 4O0LA 4QDJA 4PNZA 1DRWA 4RD4A 4ARSA 1PG0A 2DUMA 3QIVA 5CLIA 5K0SA 4ZZ1A 2CMHA 2EFEB 5BN4B 1VLZA 3DTVA 1UXGA 1MAWA 4J9UE 1KHHA 5IBCA 1K86A 2B0CA 2BKXA 5D7BA 4D9CA 1ML3A 3AW8A 3DOCA 3MF4A 4MWZA 2PYDA 3RVKA 2D62A 1JQ3A 4MR9B 5C8ZA 4RPJA 5HK8A 5BSHA 4JHXA 2C7BA 2JA2A 4BVKA 5K8LA 1KVUA 1G98A 4HH1A 2ATEA 3MJRA 4M55A 1C7JA 3BWMA 3SYKA 4EMTA 4RSHA 2BTQB 2NZXA 4QQFA 1QQ7A 4XIJA 1GUYA 2P6MA 1WE2A 4P33A 3BJIC 2ZB8A 4Z0PA 2WAXA 4R41A 2H9YA 1YTUA 2G9RA 2IHBA 4Y7CA 3FWPA 4OM7A 4C7MA 5LZ9A 3VBCA 1LQTA 4LZOA 5BWLA 2VHZA 7REQA 2W6CX 3VGJA 3GFQA 1GQRA 4RD2A 4ASUD 3PD0A 1P1HA 1BDJA 2CBGA 4L9AA 3LYUA 4UBMA 5G02A 3CINA 5GY7A 4FQ7A 4HR7A 4W82A 1F2UA 3R7WB 3G9XA 3CEMA 2RGYA 4G81A 1J90A 1GPH1 1V6CA 3EDOA 4WCFB 2PMBA 1IZ0A 1C3XA 1LZLA 1TUBA 3R3VA 4WKPA 4DRXB 2CZGA 2BRUA 3OIFA 2V7EA 4DZZA 4LWOA 4NCNA 3G6WA 1T5LA 5A6SA 1APBA 3Q2IA 4OGLA 4Y1RA 3BSWA 2BF7A 3V46A 4F3TA 3EUEA 4G4GA 4GOKA 2HK7A 4MUBA 4UVHA 4D5GA 4URXR 3I9FA 4ZVUA 3M33A 3TRHA 3P2YA 3N0RA 4J1TA 3HZOA 4O4HB 3BICA 5IYZA 4CM1A 3DBLB 1A9XB 3DV9A 3UC5A 1D1PA 2C4NA 1C9EA 2PU7A 3HK2A 3NH9A 1B76A 1YZQA 3MBKA 2P4HX 1R4MA 1SCDA 2EGGA 4KUGA 1YS1X 1ELOA 1R9GA 5ABPA 5KX5F 1Z5ZA 4UHBA 4K6GA 1QOPB 4HB0A 4BBZA 2JRLA 4MIOA 5BUQA 5EHNA 4C4XA 5IBRA 2FZ4A 2I7DA 5AJHA 1HE5A 1EKXA 3QXXA 4UNNA 5DOZA 1ZK1A 5C9ZA 1IQ0A 1RVDA 3OIDA 2WI8A 2IZZA 4M1SA 2AL7A 3SVZA 3X3HA 1G0OA 4WBNF 1F6WA 1OXTA 2V5UA 3DFMA 2BDEA 4REOA 1E5LA 4ND3A 1N6IA 2DTDA 3GZJA 3HV0A 2DJIA 1QGYA 3KTDA 4GZ3A 5LP1A 2E5WA 1EH5A 3A2KA 1CQIA 3KFXA 1NFRA 1GKUB 2UZ1A 3JD0A 4XUDA 2AMVA 4P4GA 4FFLA 2BJVA 5BSEA 2DR3A 2C9OA 2XIQA 4CLEA 3IURA 1BSVA 1KSFX 4I4IA 3AM1A 2XYVA 4PYMA 3G2OA 4MGKR 2IEAA 3JTMA 3OTIA 2QM7A 1MW8X 4QJ3A 3G2PA 1PL7A 3OSZA 3K8ZA 1L4UA 2ZJ2A 4TXNA 3UB2A 3ZYZA 1NPTO 2WQ7A 2EP7A 2GK6A 1EE1A 3G8YA 3LPAA 2BFPA 3H9JA 3EEQA 3HGQA 1AG9A 1L4KA 4RTSA 3PXEA 3V7UA 2HK9A 3MG9A 3SC6A 2Z2ZA 1R9JA 4AQ7A 3FCUB 4UBJA 4LTMA 3WMWA 1T2NA 2B8TA 1BQ3A 4ZCLA 4F8YA 4MOWA 5HGJA 2R6AA 2AVNA 1I1QB 2OC9A 1B3RA 4IDQA 2OVFA 1RACA 3TTVA 2PS0A 4FS3A 2XB4A 4R8MA 1K6JA 4ACBA 2MU1A 1RHUA 5CVEA 1OFVA 3O2SB 1LI4A 1GG2A 2OG2A 2GAJA 3N2EA 4JL5A 1DDOA 4PAOA 3FNRA 2W42A 2XE7A 2UXBB 4XGKA 1R0WA 5TPZA 1OU0A 1U3VA 5AI5A 2WW8A 3FBGA 4QDKA 1WNFA 5HJ2A 4FBGA 3WLKX 5AM3A 3UJNA 2OGZA 3O4FA 4EUKA 4D96A 2LE0A 3ECCA 3KQQA 4Y9UA 1F4PA 2Y4NA 1NI5A 2Z3VA 2XADA 3EZ7A 4D8XA 3TMYA 4BS9A 5IULC 3A6LA 1MTZA 3QI2A 4WADA 5J40A 3WWPA 1NT2A 2D1YA 4G1CA 2W22A 5GOZA 4NULA 2O06A 4JJ4A 4A26A 2IEIA 2BGKA 3KALA 3G9TA 5KDLA 3ZQUA 4A91A 1I0LA 4DW8A 3ANNA 4KGVA 1JLKA 1UBFA 3QVSA 4R2IA 4TSFD 3HLYA 4IH1A 4PLCA 5K0GA 2BGNA 4QT4A 4TMKA 4TWBA 3ECAA 2Q3MA 4L07A 5BV1A 1VL1A 3MGAA 3V32A 4B31A 3JZDA 3HO6A 5IT5A 1Z4QA 4KV9A 1WW8A 3I8OA 3GYGA 1Q7CA 1T6ZA 4MYRA 1ZVQA 4UEJA 1QGZA 4ZO4A 3NUZA 3SR0A 3BHMA 2G08A 2A1UB 4NMLA 5FOXA 1C30A 1CUGA 2H08A 4DIEA 1QZUA 1KZ9A 5C31A 5A4MS 1NU8A 2GK7A 3I3SR 1I7NA 4YJKA 3TI7A 4YREA 4DT1B 4EO4A 3S8MA 2WUFA 1XKTA 2AXQA 1ZK2A 3QJYA 3TM4A 3ITNA 3U80A 3M4ZA 3ZK8A 2J6CA 3QK7A 4RHXA 5ILQA 3KQKA 3LUPA 2Z09A 1OE0A 4RF3A 5DNCA 1XWWA 1Z6PA 3INYA 1L5HB 3LFUA 2CHEA 1E1QA 1UWLA 2CDRA 4ICIA 4UZFA 4EI7A 1KZ6A 3IRUA 4OHKA 1ISPA 3BK7A 3TNYA 1WDLA 4XEHA 1VPEA 4FFWA 4E5PA 4QPJC 3QLUC 4L4XA 2W2TA 4L8WB 1YHYA 2G9NA 5TGZA 4RC9A 1HSOA 3VU9B 4IIJB 4DT1A 4ZO8A 2Q4DA 3IHWA 3M82A 4LDNA 3OX2A 1FFXB 4JNCA 4MPRA 4Z8XA 3RRBA 3IBSA 2QORA 2C54A 4NBTA 4NCJA 5DHAA 2F17A 4LRUA 4YMGA 1JTVA 4FYPA 1MJGM 1P0FA 4HI0E