4KYIB

Crystal structure of the phospholipase vipd from legionella pneumophila in complex with the human gtpase rab5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VipD
publication title Structural basis for the recruitment and activation of the Legionella phospholipase VipD by the host GTPase Rab5.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding/transport protein
total genus 44
structure length 164
sequence length 164
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kyiB00
1KI4A 2OESA 2OLKA 3ZQJA 3PITA 1DG3A 1A4RA 2GXQA 5BW8A 4M53A 3CRRA 1XP8A 4HLUA 4ZV4A 2X8AA 2BJWA 5J4LA 3SQWA 3DZ8A 2D62A 2F1JA 4LPSA 4RSGA 1DELA 4XSHA 3H2YA 4US1R 4WZBE 1FUKA 3QIAA 4ZDKA 2WAYA 1XEWY 1CR4A 2IC5A 2XSZD 2IEYA 2ERXA 2OHFA 3FVQA 1VKJA 4IJMA 5JJKA 1LVGA 3TKLA 2Z4RA 1TUEA 3P4XA 4FI3C 1NF3A 1DO2A 2R2AA 3BD9A 3CNNA 1CEEA 4BPBA 1NVUQ 3IIKA 5KHOC 1II8A 1A5TA 3AGQA 2ZSEA 2QGNA 4RCYA 2ZI9A 4A2PA 5ELXA 2O8CB 1KO1A 1ETUA 2OG2A 2RCNA 3K0CC 5HCNA 4B33A 4C0LA 2LCFA 1E9AA 1QRAA 4MYCA 4EDHA 2JLWA 3P4YA 4AYXA 5FPKA 1FQJA 3OIWA 4QGFA 1Z2CA 1KK0A 1KI1A 1TUIA 4I4LA 4C2UA 1KSHA 2CCGA 5LDDC 2IL1A 3PIRA 4PC1A 4PXAA 4QNRA 2V1XA 4BZQA 4DWJA 1ZD1A 3EC2A 1ZM9A 1QG4A 2PJZA 3BH6A 1L7VC 1XXHE 2W0SA 2GXSA 1XF9A 4QBIA 2F43B 1IN7A 2J0VA 4HLQB 2FEOA 5EXTA 2WTUA 2IYRA 421PA 5AUPB 3K9NA 4PSKA 2WJHA 4KVGA 3I32A 4XVQA 2AKAB 1K8RA 1RKBA 2ODWA 2ZVQX 3HR7A 3GLFE 4MGKR 2CLSA 1NMXA 4B6FA 1Z28A 4XTRA 4FMCF 4DZZA 5FL3A 2QMHA 1M8PA 1WBBA 1E6CA 3LV8A 2HT1A 1D2MA 2WKRA 3VR6A 1ZM2A 4M1YA 4NU0A 3CZQA 4IEIA 5J4KA 3C4JA 4BFXA 2JATA 1CBUA 1US8B 1Z6XA 2GJSA 5K8LA 1SQ5A 3A58B 1FP6A 1WF3A 4ZDWA 3AGPA 3LD9A 4DCNA 2VHTA 2WV9A 1U0HC 3EPJA 1Z0IA 5JS8A 1OXTA 2A3RA 2QROA 3R9WA 2H5EA 5HZKA 2J5XA 3GEIA 2PLRA 4TN1A 2OBMA 4PPQA 1P6XA 1M34E 2V6IA 1RFLA 3EW9A 2I3BA 4NTZA 1YZQA 4X8OA 3OESA 4GPTA 2ZJBA 1CTQA 4KVAA 4NL4H 2XZOA 5HKKA 3EPLA 2VF7A 5G41A 3RS3A 2Z6VA 3RC3A 1KMHB 3TJZA 3W3ZB 2LWIA 1ZM4A 1OFUX 2ZSDA 1SVLA 4D82A 4F93B 2HLDD 1YZLA 3B6EA 4R71A 3HP1A 3DEFA 3AVVA 2ZS7A 2YC2C 4MITA 4C30A 1W4AA 2H16A 2PT5A 5FR2A 2BMDA 1VHTA 2DWPA 3EWAA 4F4IA 1U0LA 1SZPA 2EWWA 2IBMA 5JMTA 4PZZA 4TMKA 3W34A 1G3RA 1RRGA 4KXFB 3NBZC 4OHVA 3GJ0A 1RYHA 5KU1A 2FF7A 1ZUHA 3CR8A 3TW4A 3OHMA 3X2SA 3CPHA 1IM2A 3PXGA 1N6HA 2YINC 2ZRKA 1KDRA 2OAP1 2IYWA 4Q1BA 1OXUA 5LD2C 1FNMA 1VYTA 3ADCA 2PMKA 3KUDA 3VR5A 2W2TA 4B32A 4PR0A 3VNVA 3B1XA 4EJSC 1OSNA 3PEVA 2WWIA 1NVVQ 4KBFA 1G7TA 4DSUA 3ASYA 1XPRA 2ZRLA 2BDTA 4DRZA 2XB2A 2ORVA 1W0JA 4URWR 1IOZA 1F2UB 1UADA 1HEIA 2IXFA 3QJYA 4RZUA 3HDTA 3AH8A 4Q4AA 1OIVA 2ZSFA 2WWXA 2WKPA 5C4MA 4ZI3A 3IIJA 5AJXA 2ODBA 1EXMA 2ANCA 2P6UA 1X8KA 5DYIA 3RWMB 1Q22A 3PUVA 2BKEA 3K9GA 2RGGA 2IF0A 4EUNA 1DS6A 4ESVA 2F7SA 2QMOA 3QXSA 3AVXA 1Q20A 3GFTA 3UPUA 4AKHA 3NVAA 3Q3JB 4CT5A 5K8UA 4D25A 3GJ7A 2ZUDA 1XNJA 2XXAA 3N2EA 1VHLA 2JEOA 4JVNA 4RKFA 2GEUA 2ZAMA 1G4AE 1GM5A 3FWYA 4IHQA 3T12A 5J4HA 2JA1A 4B35A 2GVZC 1E99A 1CIPA 2YJTD 4PQFA 3S1AB 2GF0A 2ZJ5A 5KNCA 1G3UA 1N6OA 1XD9A 4TWZA 2ORIA 3NH9A 3ASZA 3WHLA 3QF4A 4TL6A 2QRNA 3LWNA 3A36A 3TQCA 3AF2A 5JCZA 1P2TA 2XXAB 2X19A 1ZUIA 3EASA 2BMEA 1OIXA 1W48A 4JMPA 5G40A 1W2GA 3KQLA 1KAGA 3I1FA 1A7JA 2ZITA 1ZM7A 3SN6A 1KJYA 3DVLA 3FKSA 5FL7A 3QF4B 4RFSA 1GTVA 3MFYA 3EZ9A 4HDOB 3K0CA 1W4BA 4KFUA 4NONA 2BIFA 1OB2A 2O8FA 4W5JA 1MRNA 4J0QA 1X1RA 5F98A 4EPXA 1GL7A 2O8EA 1OJLA 1QHIA 2WKQA 1RJ9B 3ZD7A 4M21A 2AL7A 5FPHA 2B21A 3TSWA 4URZR 4OQNA 5CIQA 2WWYA 5ANRB 1N5IA 1XDBA 5CK4A 3RVBA 4NYJR 3LXRA 2FMXA 2PZFA 1M1YE 4JSYA 3SBDA 3RDPA 3KXIA 3DMDA 4TSFA 5E7IA 1L4YA 2ZRBA 4Q21A 3GFOA 3PUYA 4P4UA 1E96A 2J0QA 1TEXA 4B76A 2WWHA 3LH5A 4KFSA 4Q4LA 3AKYA 3T06B 4PC3A 2HXYA 1KSGA 1IY2A 1YKSA 1NSTA 4Z8YA 2WHXA 4E07A 5DN6A 1JEDA 2QAGC 4G5GA 1MH1A 1ELOA 1E9FA 3SJZA 5A5GA 1W0KA 2YYZA 5KDDA 1FFHA 4LJ8A 2XJ4A 2F9LA 1ZCAA 2OLJA 3ZVLA 4QKQA 1UEIA 5JCPA 5FUYA 4LX0A 1UBGA 2C9YA 3QBVA 5FOTA 4P0TA 3CR7A 2PH1A 1T0HB 4G5QA 2ZRIA 3I92A 2OSBA 1ZIPA 3LBIA 1ZC4A 3QBTA 3JVUA 2ZUBA 5G3YA 2O0HA 4RJLA 4URYR 2IUSA 2ZR7A 2XOKA 3AEZA 1JXMA 4DHEA 1W0JD 3X1XA 4WAUA 1XZQA 1CJVC 3CX8A 4JL8A 2OCAA 3AVYA 5FFMA 4C0QC 2J59A 1Z5ZA 3K09C 3IILA 3KUCA 1ANKA 2CE7A 1AGPA 3U60B 3FGNA 3O47A 1G18A 2W2XA 4JLAA 2CLDX 3VU9A 2Q0HA 1W5TA 1TF2A 2GWHA 1HE1C 1R0XA 2A9KA 2QZ4A 2V6JA 1KK2A 1SGWA 2FSFA 2R6GA 4GT1A 4IOJA 4HUQB 2G3YA 3KDSE 2QNRA 3WYFA 2BOVA 3RABA 1KI2A 4YDHB 1HY3A 3TAHA 4UNSA 4IKEA 2Q21A 4PO1A 2EYQA 2LKCA 3MGCA 2REOA 4MRSA 2D2FA 2FZLA 2GJAA 1NBMA 2C5LA 2FFAA 3CB4A 1RPZA 3CH4B 2EVWX 4KODA 2C95A 2V7QA 3GLGA 2ZRPA 1II9A 3C16C 4TYYA 1QHXA 3PG5A 3PJRA 5JJIA 4DUGA 1K6MA 2ZM5A 1WBDA 3H84A 3AVTA 3AKEA 3IKJA 3P27A 1GL6A 1P62B 4Y0AA 4QJ4A 4D0NA 1GP2A 3DOFA 4PHFA 4RD4A 1KSJA 4KITB 1KMQA 5DGXA 2F55A 1PVOA 1DPFA 3FKSD 4U02A 4ACAA 3CWQA 3K0AB 1NMZA 2ZI3A 4II7A 5FL7D 4FINA 2ZI6A 1OT3A 2QAJA 5BXQC 2BBTA 5JHHB 3B7GA 4DEYA 1PUIA 1R5BA 1SXJC 3IUYA 4HATA 4BLSA 5D3MA 1KJWA 2QUZA 1FQKA 5HPYB 2OUKA 3QVVA 3LQRA 4XWAA 3AVUA 4AC9A 1P9WA 1NIJA 2E9SA 4BFSA 3AQ4A 1ZBDA 1PLLA 2ZXUA 4Q9JA 1ZM3A 4R2IA 2UVQA 4DSTA 3CKLA 4DDVA 3NKVA 4TSFD 3FFAA 5AK0A 1ZAKA 1BS1A 2F3TA 5D3MB 1Q3TA 4XSGA 4NPHA 3AVPA 1H65A 3LNCA 3SBEA 2DCUA 1NP6A 4AD8A 3U7HB 5BYKA 4C7OA 1U9IC 2UZIR 1J7KA 3KX2A 5E7MA 1SULA 1AA9A 5GJBA 1QHHA 4AK9A 5JEDA 2VH5R 4E22A 3RRNA 4Z1MA 4GL2A 5HE8A 5DN6D 4PSVA 3NWJA 4UJ5A 1E0JA 3OEEA 2AK3A 1XMVA 3W8RA 1DAKA 1LS1A 3GD7A 3B9QA 5JRJA 3MLEA 1IAQA 2DFNA 3GLHA 1T3SA 2R9VA 5L3QB 2CVFA 2PMDA 3PEUA 3UIEA 3N5CA 5L3VA 1Q1EA 4AY2A 1MO3A 1Q1ZA 2PX3A 2QEQA 4JLJA 4M0LA 2QORA 4LY6A 2FH5B 4JJZA 4PHHA 1JR6A 4NYMR 2XOKD 5FPSA 5CJPA 3ZVNA 1DAFA 2QM7A 1OKKD 2OEPA 3B1ZA 1TQ2A 4RD6A 4TTRA 5IK2D 4XD7A 4B74A 3WNCA 4M22A 2H57A 4Q1DA 1G5RA 2FV8A 3NC1C 3QKRB 3RLFA 4CIDA 5SZKB 3U3JA 4I99A 4DLUA 2XTNA 2ZYVX 2WJGA 5FBLB 1ONBA 2QBYA 4KCGA 4Q66C 2RB4A 3V00A 1LB1B 2XAUA 1NLFA 1XJ0A 3G5UA 3FMOB 1PLKA 5E3HA 2ZI4A 4LJ6A 1HV8A 2WSSA 3THWA 4GOJA 4M1OA 4CYMA 5CDFA 3K70B 4I1UA 1ZINA 2JLRA 3ADDA 3CUEF 3R7WB 1GZSA 4W9MC 1E94E 2CEAA 1P9NA 4GOXA 5JSZA 1E1RA 4GNKA 1VTKA 2YOGA 4LDJA 2QBYB 3E1SA 4NCHA 1P5ZB 4RD1A 2MMCA 2QAGA 2O8DA 1WE2A 3GQBA 2O8BA 1NBMD 2ZJYA 3IQWA 1LY1A 4RD2A 1PJRA 1EX6A 4L9SA 4HAVA 2V7QD 1E98A 1CU1A 1SVWA 3Q5EA 5EXXA 5A4JA 4C9BA 2REXB 1KNXA 1Z0FA 2F1HA 4DUGD 1QHYA 3R8FA 3A1TA 3Q9LA 4A6PA 2EFGA 2ZPTX 1Z3IX 3W5JA 3O8DA 3EXAA 4GSYA 4LJ5A 5FPTA 1GNRA 1VG8A 3EZFA 4NCKA 4CEIB 1T91A 2CK3D 4FCVA 2O8BB 1AIPA 2VP4A 3CF6R 3TVDA 1N6IA 1CRPA 1Z6GA 4LHZA 3THXA 1UKZA 1UKEA 4FN5A 4M9ZA 3RAPR 4US0R 4G5SA 2JLXA 4AG5A 3ZZUA 1UEJA 1XTRA 1ZC3A 3K09A 2H17A 3RRYA 3KFVA 5BN3A 1GDDA 2ZR0A 2NMVA 1IHUA 3A6PC 3KJIA 2ODNA 4RZ2A 3AVWA 5G3ZA 1VIYA 3KKQA 1Z8FA 4W5HA 1S0UA 2C9OA 2GCNA 3WYGA 1XD8A 2XNDA 3HJNA 2VHJA 4JS0A 1GOTA 4L15A 2JLQA 2IHBA 4LJ7A 1T6NA 1QVRA 1MKYA 2VRWA 3WMEA 4N0DA 4E09A 3GEHA 4NBSA 2MMGA 1X1SA 2ZE8A 3LLUA 5IRCD 3AF0A 1LW7A 3C5HA 1S3SA 4JL5A 4LYAA 1XRJA 3OIYA 4MGIR 4D4MA 1GFIA 1JAIA 4Z8XA 1YZUA 4DCVA 4QHTA 1DO0A 3QXCA 1XTQA 4B3DA 2F1IA 2ZRFA 5B30A 2ZS9A 3OEED 4JLNA 5C1BA 1ZU5A 1KKLA 1VMAA 2ZSBA 3SDZA 5C18A 1KO5A 3DM5A 3KXKA 2HF8A 4KFRA 4WW0A 4O25A 2W6JA 3NHBA 5C4GB 2CMKA 1OIWA 2VHQA 1CJTC 2B92A 2ERYA 3LO5A 3GJ8A 3T15A 4OI4A 1ZYUA 2D74A 3T5GA 1I4LD 5CLLA 1JALA 1QG2A 3U6BA 1OH6A 2Z43A 3NH6A 1SXJA 1HUQA 4CF7A 3DZDA 3U5ZB 3PV0A 3IO5A 1DADA 5FUWA 2HYDA 4CEJA 4MDFA 1JR3A 2CXXA 4B2IA 3MJHA 5IHPA 5EZ5A 2NIPA 1CKEA 3CNLA 1TF7A 3ADKA 3K9LA 4PC2A 1JI0A 2ZYUX 4V02A 5DSZA 2Q9AA 4I81A 4TMVA 4URUR 4A2WA 3WRXC 4LV5B 5KPJA 1BMFD 1WP9A 3GJ4A 2WSSD 3W3AA 4A15A 5P21A 5CLQA 4CEJB 2OILA 4CRWB 2WWGA 3W5IA 1U9IA 1NL3A 3IIMA 1XFAA 2GDJA 4PC7A 2IYQA 2YKGA 2NO7A 2DB3A 4JYCA 4UXJA 5TXGA 4TYWA 4IVPA 4EQ6B 2GAAA 3AUXA 2F9MA 5FOXA 3RS4A 2J0UB 3QPVA 4Q4JA 3LAWA 1E0KA 3SQXA 2CNWA 3I8SA 3EIHA 1KOFA 5DI3B 3C15C 3K53A 4LJ4A 1E2JA 1HQYE 2QGZA 1M7HA 4PTLA 1KI8A 5F9HA 3DKVA 4R7ZA 1OXVA 5KPDA 3VX4A 2PT7A 3CIOA 3KKPA 4DLVA 1J2JA 3AB3A 4V0LA 1FW6A 1XMJA 4AKIA 3D31A 4LOAA 1G8HA 1TADA 4NKRA 4Z51A 2WIAA 3TUIC 4F4JA 4DDUA 2J87A 4P32A 2WOOA 1E9SA 4IXMA 2W83A 4HZUB 4DVGA 1N6LA 2IF2A 5KNBA 4EPWA 3TQFA 2RHDA 2R62A 3MUFA 1AQYA 2ZRGA 3H0KA 5FPYA 2EW1A 3RSOA 1VDZA 2QTFA 4Q5IA 2HT6A 2EWVA 2P2LA 1BIFA 3CH5A 1WQ1R 2XJ9A 4MUAA 1OLOA 1P7CA 1G64A 5GJCA 1D2EA 3AV0B 1S8FA 3L0IB 4ABYA 3ZVMA 2HXSA 1CULC 2XNDD 5TMPA 4PZYA 1XX6A 3I5XA 3U4QA 4LUCA 3BGWA 1J99A 2ZJ8A 4DEXA 3ND8A 1WCV1 2FGKA 2PZGA 1Z47A 1LV7A 4XH9B 2LKDA 3B1YA 1YQTA 3B82A 3RHFA 1DEKA 4HUTA 5KSPA 5FI0B 2ZIAA 4PANA 1UFQA 3U3MA 4OI2A 1L4UA 2Q6TA 2GKSA 3BH7A 2IS6A 4FIDA 1R7RA 4LYJA 1FP7A 1JQLB 1P2SA 5JHGB 2DPXA 1CP2A 4F91B 1II8B 3BC1A 3EAQA 2C99A 3SJCA 4C0BA 1JPJA 2D7CA 4MKIA 2W6JD 3QG5A 2HCJB 2YVUA 3V4RA 3THYA 4HYYA 5F9FA 2BCJQ 2AK2A 1TF5A 4M1MA 2G0NA 3KTAA 5JJLA 4JT2A 4QNMA 2JLZA 3LLMA 4ZDJA 4LYHA 3PQCA 1MRSA 3VQTA 4QHSA 1G9XA 3FPAA 1OFHA 4TLCA 3VTKA 1VYUA 4NCIA 1DG1G 4GFDA 2ZRCA 4N1AA 1O87A 3CRQA 5BN4A 1JR3D 3ZQ6A 1OW3B 4BZXA 1TTTA 3EIQA 3PFIA 1W36C 3SJAA 1N0WA 4GDFA 3KTAB 4MUBA 4HB4A 1TU3A 2P5SA 4DCSA 3P26A 4BQSA 2ZRNA 3DOEA 3NEJA 4BASA 4N0EA 1Z2AA 1W4RA 4N3NA 3FB4A 5JS7A 1CJKC 2OFWA 4H1VA 1T5IA 2DFKB 3IHWA 4JIMA 3OAAD 3RANA 3IPXA 2HEIA 3L0SA 4IDNA 1B0UA 2YV5A 3CF2A 3F3YA 1CRQA 4UNPA 2G83A 5CB6A 5SZIA 1OHHA 3SFZA 1W49A 1GRRA 2B8WA 3CRMA 4U5XA 5AUNB 2OV2A 5AJYA 3L0PA 3B60A 3U44A 5GVSA 1FOEB 3QKTA 4YC7A 2VIIA 1X86B 1E0AA 1KI3A 3DKPA 5GJVC 4HZIA 4A82A 2BKUA 1E2EA 1G8PA 5AJVB 4FWTA 1N6PA 4PX9A 1EGAA 1NLZA 4Q47A 1E2GA 1ZVQA 3W9YA 4G1UC 3RS2A 3X1WA 2CHQA 1J8YF 5EZ6B 1MO4A 3U44B 4PO8A 3E5HA 4OQFA 3LA6A 4LZZA 1E3MA 2DBYA 3E2IA 1U8ZA 4US2R 3WMGA 4YMUA 2QM8A 1GKUB 2IXEA 4ZCMA 3VX3A 3CWZA 3UMSA 1WMSA 3CO5A 2WSMA 3F0TA 1SVMA 2FSHA 1W5SA 4C0KA 3PCRB 4M4SA 4UXIA 2GCOA 2ZRMA 3RS5A 1NJFA 3WNBA 1JEEA 1X8LA 3L82B 1N6NA 1E2IA 2IWHA 2WPDA 1GITA 5CM8B 5LB4A 2R6FA 2CHGA 1R0WA 5FI1B 1GKIA 2V54A 3NBYC 2HJVA 1ODFA 1W4CA 1KJZA 4LJ9A 1R5OA 5DI9A 1NVXQ 2IX3A 1DVRA 1KO7A 1U2RA 2ZAOA 2Z4SA 1KO8A 4GP7A 4KI0A 3I3SR 5DYGA 1LFDB 1LS6A 2DY1A 3T1VA 3HYRA 4CGZA 3CZPA 2QU8A 4KV9A 4Q4AB 2A7QA 3EC1A 2F3RA 4ZI2A 4DLZA 4OHWA 4Q02A 5SZHB 2D3WA 4X8MA 4A8JC 4YLGA 2C8VA 1U98A 4V0MA 5FH9A 2FX3A 2OT3B 3ZDQA 1F2TA 1S1MA 5L8VA 4MKFA 2QP9X 4D2IA 5JFGA 3B85A 1N25A 1Z0DA 3NBXX 4XWKA 4KFTA 2QQEA 4DDWA 4Q18A 1WXQA 1G20E 1Z07A 2ZJ2A 3Q85A 4KJZA 4JBXA 1I2MA 3QI2A 2IA5A 2X77A 3EWSA 4QBFA 2GILA 2PL3A 4AYWA 3LW7A 2F1RA 1NN1A 2YOHA 4HB3A 4PPFA 5KSOA 4DBLC 1E1QA 3U3RA 5EUMA 4Q7JB 3LDAA 1DOAA 4ZPXA 1XMIA 2ZTSA 1FTSA 2FSGA 2P65A 3AF1A 5KOYA 3QF7A 4MYTA 1GNQA 1G17A 4LV8B 1WDTA 2IYZA 2ZJAA 4QGHA 2G9NA 2Z83A 2EQBA 4BFUA 4LBZA 1U99A 4Q4HA 5CB8A 4HAZA 1RRFA 1VG9B 4V03A 4EIWA 5HR5A 2QE7A 4V0NA 3B8HA 3AP3A 3UG7A 4DJTA 1ZNXA 2C03A 1COWA 3DL0A 5HKKD 3VKHA 1DARA 4B47A 2ONKA 1YU9A 4RFSB 1R4AA 2GJ8A 4Y0VA 2JJ1A 2AD1A 2J46A 2O8FB 3SHWA 2WIBA 3HYTA 1G1MA 1HTWA 4Q03A 4MKHA 4DDTA 1KI6A 3OZXA 4ZIRA 1ZD8A 4NYIR 1KYIA 2O8EB 4LCBA 2GZHA 2MSCB 2QY9A 1QBKC 1TNDA 5KO2A 3FKQA 2GK6A 4M1WA 4YMSA 4HEJA 1DTSA 1YZKA 2ZETA 3BBPA 3IHLA 3LVQE 3QNUA 5D3QA 1P72A 3X1YA 1JPNA 4URVR 1MO6A 4DLXA 3CX6A 1AZSC 2Q3FA 3RRMA 2ZQ5A 2AD5A 4YONB 2FNAA 4AKGA 5FR1A 2H8KA 3GJ3A 1Z6AA 1A2KC 1S9DA 2C04A 3CX7A 3T1OA 4IVRA 3MCAA 1D6JA 3EIEA 4L16A 4CW7A 2J1LA 3GJ6A 2YWFA 3OEHA 3A1WA 4BLQA 1F48A 4FMDF 2FFHA 2ZI7A 4BFZA 2QMEA 2P0EA 2WJIA 1Z06A 3I8XA 4LBWA 2ZJZA 2KBEA 3SYKA 4LGMA 4BLTA 1E9RA 2R6DA 4WZ6A 1KO4A 5TVKA 4TTPA 4K46A 3LVRE 5B58C 4DLWA 3B1WA 3OIUA 3LRPA 1RE0A 1G19A 2OCYC 1IN4A 3CRVA 4PAOA 4JLVA 1NG1A 4NCNA 4PQRA 3WBKA 1X8JA 4V0OA 3PUXA 1H8HA 2GBLC 3KQNA 3MMPA 4TLEA 4BFYA 3TUJC 4G3XA 4TLBA 1U94A 5J47A 1GRNA 3NTUA 2HCBA 4PZLA 3VU9B 4BRUA 4MYUA 1VCNA 1YJ5A 2OXCA 1GKYA 1NI3A 4B6EA 3VHLB 2ZROA 4ITRC 4DCUA 3DMNA 3BS4A 4M1SA 5FTLA 1OH8A 4RKEA 5EXSA 1AKEA 1MO5A 2WWFA 4EJSA 3RC8A 3TH5A 2AKYA 2DFTA 3GJ5A 4HAXA 3A4MA 4TL9A 3VAAA 1N5LA 2VF8A 4OJQA 3I73A 3NHAA 1E1QD 4D0GA 2QG6A 5KSZA 4XJXA 1M74A 1UDXA 2ATXA 4M9QA 1E2FA 3GLGB 4AKEA 2GVDC 4ARZA 1K5DA 4MGZR 2IYSA 5LD2B 4BFVA 1XD2A 5JRZA 4RFVA 3MG9A 1Q12A 3AP2A 3SU8A 4EJSB 4LI0A 4HAYA 1AS2A 3NDPA 5LPNA 2BBOA 4KAXA 4D4JA 2XTMA 3BE4A 1W44A 4BWYA 1SVKA 5E95A 4NH0A 1COWD 2ZR9A 3NIBA 3SE0A 3VFDA 2JIZA 2ZE5A 3HU1A 2QQ0A 1TL7C 4Q48A 3UG6A 4IXNA 4ARZB 1HA3A 1RW4A 2BEKA 3GLIA 1E9EA 3T5DA 1KSFX 4BRWA 3HR8A 4DXAA 3MSXA 1JJ7A 1OB5A 5E7JA 2A5FA 1UJ2A 2YWGA 1TEVA 4A8JA 2D2EA 2B7CA 1UBCA 2NZ8A 3GJXC 521PA 3O8RA 5DIFA 2VLIA 1PLJA 1QHNA 3LFUA 1KK1A 3KJEA 3MWKA 4TQUS 4NZYA 1IXSB 1KDTA 1NY6A 2VP2A 1RIFA 1UKVY 4DSOA 2HF9A 5K8TA 1W0KD 4GOKA 2FN4A 4DB2A 4UKDA 3GPLA 2JGNA 1YR7A 2QENA 2JASA 4GMDA 4LHXA 1Z29A 2BC9A 4MKGA 1UPTA 2OO7A 4FCWA 5GJWC 4C7OB 4KSBA 3TMKA 2G0TA 5EP3A 2OCPA 4DLSA 1QHHB 4RD3A 4BEBA 5AJZA 3B5JA 2ZRHA 3PUWA 3CM0A 2R44A 2VP9A 1RRPA 1G6OA 4QXAA 5HZHA 4F7WA 5CM9C 3VHXA 2WJJA 4BFTA 5DISB 4Q01A 5DNYB 4LHVA 1C9KA 2RGXA 2FSIA 3K0FA 1NN0A 2WJYA 4P33A 3B2EA 3WP0A 1P75A 3H1TA 1XTIA 2A5JA 1EESA 4DIDA 2OBLA 2JJ2A 1G8YA 3GLHB 3U7GA 2QT1A 1YR9A 4HAUA 2VA8A 1G3QA 2AFIE 2N42A 2V8OA 2RHMA 4BE7B 3ADBA 1SKQA 5JEEA 4JJKA 2DYKA 2O52A 4NYMQ 5EUQB 3FDIA 1E4YA 2IEZA 1E32A 1H8HD 2B7BA 4JKIA 3W6NA 4A0GA 5AR1A 3QPWA 3VR3A 4UJ3A 2V4ZA 1OXXK 4IDQA 3SYNA 4UNRA 5TB5A 1J70A 1E2KA 4KLNA 3X1DA 1GRQA 5DO9A 3K1JA 3QXHA 2W0MA 1XPUA 2XZLA 4HLUC 1I4TD 3Q5DA 2RGCA 1NKSA 2R6AA 3R9XA 3WHKA 1N6KA 4LWZA 2ZRAA 3LW8A 4A4DA 1TMKA 2FPKA 2ASEA 3A4NA 3OFNA 2AXPA 4YMVA 3THWB 3AVQA 5A0FA 1F6BA 1KTVA 2ZANA 4ACBA 4BLOA 4DCTA 3CLVA 2NGRA 5JSZB 2Q3HA 5CJ2A 2NO1A 3SOPA 3T1TA 4D81A 4HSEA 1GG2A 1NMYA 4IFEA 3R8CA 2QAGB 3EARA 2O8DB 1VIAA 2XX3A 3TIFA 2GEVA 4HLCA 5DH9A 1CLUA 4HB0A 1T8UA 4YXWA 2JLVA 3X1ZA 1XXHA 2QI9C 1F5NA 3IPYA 3QE0A 3QEOA 1X6VA 2J7PA 8OHMA 4TMZA 3KJGA 5JWOA 1QF9A 1YZNA 2WMOB 2GA8A 3TUZC 2ZREA 2QP4A 5FBWB 4EPRA 2SHKA 3BFKA 3D3QA 1R0ZA 1T9HA 3BJIC 1YHNA 2IUUA 3THXB 4QG7A 3FOZA 2JIZD 3TK1A 3IGFA 2JDIA 2YC4C 2GBLA 3G82C 1J90A 4FXPA 2JLUA 3L43A 1AGRA 1V43A 2ATVA 3JZMA 1VECA 2AHOA 1DBSA 4MA4A 5FOWA 2CE2X 2J9RA 3DDCA 2CHVA 3BB1A 2XB4A 3MWYW 1XEXA 2XEXA 1G41A 2PX0A 4KSCA 4GZMA 3JVVA 2W00A 3OF5A 3BAFA 1KDOA 4ILEA 1ZRHA 4HB2A 4D80A 5L3SA 4Z1MD 4S2EA 1U0JA 5J40A 2V3CC 2QPTA 1FZQA 2OM2A 1ZJ6A 4L4UA 4B44A 1G4UR 2G6BA 1FPMA 4EPYA 3WXMA 1ZUNB 2WICA 3GP8A 1EX7A 1NBME 3FMPB 4PC6A 1T5LA 2IYXA 3AF4A 2GETA 3EZ7A 1XJQA 3U3OA 3GLGE 1FL9A 5CK5A 4ZCIA 2QP3A 3M4YA 4FMCB 1ESMA 5FBRB 1KDPA 3TW8B 1ESNA 3D8BA 5L3SB 3PVSA 4JLKA 4MYHA 5J4YA 4OHZA 2ZSAA 1L2TA 1KI7A 3BH0A 4QRHA 2VBCA 1KKMA 3SHFA 3QKUA 1EK0A 4XD7D 2FFQA 3SZRA 2KBFA 4C2TA 3SYLA 1VCOA 3AUYA 4XTCS 2JJ2D 1E2QA 1Q3HA 1XWIA 2FE4A 1WA5A 4O2LA 3MRSA 2IWRA 1OH7A 4TL8A 3AVOA 3AF3A 1OYWA 2VP0A 1Q0UA 1OE0A 1RVDA 4MRNA 3WYAA 3FTQA 1OV4A 1SXJB 2REBA 1DE0A 3FE2A 4FMBB 4JLOA 4JZKA 4OK6A 1S96A 1WRBA 5H8WA 2VP5A 5F3WB 2W58A 1JJVA 1OF1A 4WVFA 3I61A 1G16A 4HDCA 2VSOA 1K5GA 5GVRA 3IEUA 4ZO4A 1E1RD 4FCTA 2GJ9A 1KAOA 1T3HA 4U00A 1T4GA 5EP4A 3HPRA 3QOFA 4JVSB 3UATA 1P9RA 1LF5A 3ETLA 4OK3A 2YHSA 3ECCA 1Z6TA 2G1JA 2GTPA 4OHYA 2WJVA 4LJYA 4ZKEA 2RKOA 2VSXA 2NG1A 2IUTA 1R5NA 1V5WA 3REGA 1E4VA 2RGNC 5LB2A 5CYOA 4RZXA 3PENA 1NIPA 2IK8A 2JLSA 3T34A 4TYQA 1AN0A 2ONJA 1A82A 1EG7A 2FDCA 4KO8A 4Z54A 3T1QA 1NKTA 3U7FB 4Q4JB 4W7SA 3TBKA 2Q9BA 1E2HA 1TX4B 2CJWA 1ZCBA 4O2RA 4D4LA 3ZD6A 2J7PD 1KZGB 2A2ZA 3GLHE 1ZD9A 2E1RA 1SVSA 1MOZA 1U90A 1YE8A 2HLDA 2PEYA 2WBLC 3F8TA 5H1YA 3CONA 2H1LA 4QL3A 4I1OA 2DR3A 4LBVA 4QC2A 2AWNA 2VYFA 2D7DA 3DM9B 2UZ3A 5EE5B 3CPJB 3WBJA 4K8OA 6Q21A 2A30A 4DT1A 2JDID 2IYVA 5AJWA 1O3YA 1SVIA 2D4HA 2VTKA 1DAMA 5TY0A 1I4DD 4YMTA 5DHAA 1G8GA 2GXUA 3I4LA 5KDLA 4F92B 2NPIA 3IEVA 3U61B 2O8CA 3KKMA 2AXNA 3KKOA 4XVUA 4LC1A 5UKDA 2ORWA 1E79A 1T8TA 5CDFE 5KDOA 1A1VA 4DT1B 1IBRA 3L0OA 4EPTA 2GAOA 1Q57A 3U4QB 4AYTA 4B3GA 3DHWC 3MJRA 1G3MA 4PHTA 3G0HA 2JAQA 3ZH9B 3QUSA 1KY3A 1G3IA 5TV2A 2BMJA 1OFTA 4RY2A 1GUAA 3UWKA 4JBYA 2ANBA 3BIFA 1L8QA 3SEAA 4AURA 3VR1A 2F43A 2YWHA 2OAQ1 2BBWA 3GEEA 3RRZA 2OBNA 5CIWA 4O3MA 3TGPA 4QOSA 2HJGA 1SXJD 3LX5A 4IW3B 5B57C 5B64A 4OL0A 4JLPA 1Q1BA 5FTKA 721PA 1G21E 4D6PA 1DAGA 3THYB 2IS1A 3C8UA 2VPPA 2FFBA 4H1UA 2PEZA 2FZ4A 4C0SA 2CVHA 1AJEA 4XWOA 1US8A 2PZEA 3Q8XB 4JYBA 4KBGA 1RRCA 1TQ6A 1H8EA 2XITA 2JLYA 3C14C 2WM9B 5HE9A 4BZPA 4B43A 1NN5A 2KB0A 1PZNA 1SKYB 2NOAA 2CL6X 4YDSA 1HH4A 3D6TB 2N46A 1I2DA 5GADl 2WVJA 4A1FA 2BWJA 3R20A 1TAGA 4B2PA 1II0A 1D2NA 121PA 3P1JA 4PAMA 2B8TA 1NSFA 4ZCLA 3TLXA 3VKWA 5FTMA 4QGGA 4WBSA 3LY5A 4Q1CA 5EJEA 2AWOA 2CNWD 2FPLA 1LNZA 2BM1A 1AS0A 2ZE6A 4QM7A 1KMHA 5HTKA 1XCMA 4MH0R 1XEWX 1NJGA 3CPEA 3EA0A 3IBYA 2HUPA 3IBGA 1ZNYA 2AN9A 4L9WA 4B48A 3D7MA 4EFLA 1CS4C 3K0EA 4JVLA 5IDVA 1EFHA 3MAAC 4FMDB 4P31A 5LBIA 3M6AA 3ICQB 2VL7A 3CRW1 1BYUA 1JB1A 2I4IA 2QTVB 4QJ3A 1W1WA 1UBFA 3B9PA 3KB2A 4QFMA 4CEHA 2RGEA 2C98A 3RWOA 4B71A 3PEYA 4M9SA 3I5YA 2EU8A 1TPZA 1SXJE 2JCSA 2DWOA 1XTKA 3A8TA 3H4MA 3SNHA 4DLRA 4FWIB 1JR3E 3ZGXA 4PAQA 1CJMA 1M2OB 2KWIA 2ZJOA 4L5BA 1QDEA 1VCIA 3KL4A 4X8LA 1NVVR 1KZ7B 3U3KA 4LJAA 4HAWA 5KYKA 2QTHA 2FA9A 3KQUA 4EKDA 1F2UA 3T35A 2OZEA 4UNNA 4CEHB 2D06A 1PV4A 4PQYA 2WAXA 4D4KA 1RYFA 2PLFA 4GI7A 2P3SA 4GBMA 1CR2A 1E79D 3CBQA 3EPKA 4LRWA 2V9PA 2GCOB 4RZ3A 4AWXA 4A36A 1P73A 1CR1A 1G7RA 2ZS8A 4AIIA 1G5TA 3DO6A 3HPQA 1ZU4A 2RGNA 2QSYA 4GP6A 3ZS9A 4MQBA 4A6XA 4A9AA 5FOSA 3TRFA 2X2EA 4EFMA 5FUXA 1F3OA 4LK2A 5J4VA 1RC8A 1UDWA 4JVMA 4B3BA 5FTJA 1W2HA 4PPGA 4NMMA 3QXXA 821PA 3C7KA 2QMUA 3Q72A 5C46F 2A5YB 1KY2A 5EE1A 2NZJA 5B2ZA 4MRPA 4B75A 1P60A 4C3ZA 1NY5A 1AZTA 2L0XA 5FBQB 3S1AA 2CDNA 3UMFA 3QY0A 2NO9A 4A0FA 1P61B 3O8BA 2CCJA 2PCLA 1MV5A 2MSEB 1FTNA 2GEDA 2VSFA 2E87A 1G291 2GK7A 2HV8A 5FOUA 2G77B 4C0HA 2IS2A 4V0KA 1HT1E 3QVUA 1IJFA 3B1VA 1S2MA 1P3JA 3PUZA 1XTJA 4L8GA 1F2TB 4TTQA 5FOVA 2QT0A 2R65A 4ERNA 4OQXA 3UXMA 3UMRA 4Q9HA 2G88A 2IYUA 1H8ED 4LC0A 1VPLA 2C9CA 2NQ2C 2FGJA 1IY0A 3KJHA 2CL7X 2VEDA 3N70A 3Q7PA 3VR4A 3ZYCA 5JECA 1VYVA 2NTYC 1VG0B 1UBEA 1R8QA 5JI3E 1HQCA 4YQFA 4Q7LA 4TMXA 2GRJA 4B73A 1P2VA 3BB3A 2BEJA 2B6HA 4NCJA 1RJ9A 4D0LB 3CF0A 1QVAA 1OHHD 1G7CA 2WZQA 2ZI5A 4IFBA 2W2VA 4XVRA 3WP1B 4F38A 4TT3A 1W47A 3ZIAA 4TL7A 1XTSA 4Q7MB 3EZ2A 4PPNA 4Q4HB 5FTNA 2BM0A 2IYTA 1E2PA 2EFDB 4B3XA 1CJUC 1HURA 1NN3A 1FUUA 2NO0A 4TYPA 4KYUA 1D9XA 4B3CA 3K70C 1YRAA 3R9IA 4E5UA 4TQAA 5BQ5A 4TQ9A 2DHRA 2GHIA 3TR5A 4NYJQ 4IOMA 4ON9A 1DAHA 3W6OA 2AFHE 4KHZA 5SZJA 3U7EB 4OI0A 1EWRA 4IOLA 2PCJA 1IN5A 4MGYR 4ZIRB 3L8YA 1KI6B 3RNLA 1FMJA 1CR0A 1AQUA 3AKCA 1R8SA 2A78A 4NYIQ 4EPVA 3VNUA 3A1UA 1C4OA 2DWQA 1GSIA 1XMSA 3NBFA 2RAPA 3QENA 3SJBA 1M7GA 4B3FX 1RZ3A 1D8TA 1E69A 1LTQA 4S35A 4ZDIA 2XGJA 4I1VA 2BBSA 1UAAA 3ZLJA 1EFTA 1SKYE 2OFOA 1MT0A 4LSGA 1YR8A 4TZ6A 4URXR 1OYYA 4Q1AA 2DFLA 1JXOA 5EQTA 1BKDR 1Y63A 2WPDD 3IO3A 4P4TA 4KU4A 1W36B 4NP6A 3K0SA 1OXSC 4UXHA 1D5CA 3M1IA 2WMNB 4WZAE 2BMFA 2FWRA 5K8IA 1XU4A 5M04A 1CXZA 4RD0A 4QGAA 3ND9A 3BWDD 4D26A 4QHYA 2V1UA 3KB1A 3TNFA 2J7KA 3ZJYA 4GRAA 3SS8A 1XPOA 1KGDA 2JJ8A 4LHWA 1OKKA 3SR0A 1OH5A 5IK2A 2BCGY 1E0SA 3KFXA 4Q7KA 1Q44A 4HUQA 2AX4A 3WNDA 5J5CA 1QZXA 3P32A 2HDNB 3B13B 2P5TB 5E4FA 4C0JA 2VHUA 2QA5A 4A0HA 1XBTA 3TSOA 1BOFA 1E2DA 2BJVA 1E2NA 3CW2A 4DKXA 3O8CA 4OJKA 1W7AA 3TSZA 3W6PA 4EAQA 2PBRA 2EFHB 4OI1A 1IXZA 1NRJB 1EFRA 1ZP6A 4P4SA 4PHGA 1JAHA 1VG1A 2XZPA 4RCZA 4WOPA 4Q1FA 1Z22A 5KSYA 1XJCA 3BORA 4E03A 4M2LA 2BV3A 4X8HA 1T3LA 1S4QA 5L3RA 1S1CA 2VO1A 4RVCA 2ODEA 1J8MF 4CT4B 4IVQA 3FMFA 2A5DA 3KKNA 3K0AA 1KIMA 2R6CA 3PEWA 1DAEA 3GCGA 3RS0A 3A4LA 2ZVPX 3QG1A 4TMTA 1Z83A 1DAIA 4P4SB 1KHTA 2RH5A 3GFPA 4BGDA 1GAJA 2QE7D 2ZEJA 1XCPA 2R8RA 4AI6A 2OE2A 2CK3A 2I1VB 3U2QA 2CL0X 5TDHA 3TE6A 4QBGB 1U8YA 3NC0C 4ZKDA 2JJ1D 3AKDA 4G5RA 4TT3D 1Z0JA 2YZ2A 3VR2A 4OK5A 1XD2B 1HT2E 3ZIAD 4LHYA 4U7DA 3HU2A 3KQKA 4LPKA 2P67A 3K8YA 2A5GA 2Q9CA 2XTZA 4HI0E 3VMFA 2UKDA 1FX0A 3EG5A 1M6NA 2O5VA 5CYPA 1N5JA 4DB4A 4ASUA 4XOIA 3BFXA 3QPUA 4M8NE 5EP1A 1E9BA 5F2EA 2FG5A 3GLIB 1P2UA 3ONWA 3WY9A 4BLPA 3C5CA 5H68A 3CNOA 5AUQA 4BLRA 4JLMA 2X1VA 2OCBA 3ZZ0A 2OFXA 1Z0KA 3A1VA 4V0ME 4IRUB 4A8JB 1W36D 3HU3A 5CITA 3LBHA 1JECA 4LV6A 4F4CA 1AK2A 1FX0B 5IT5A 1E9DA 5TARA 1SHZA 4M9XA 5IF9A 3V9PA 3OEHD 1LF0A 4JBWA 4CVNA 3IQXA 3K9HA 2MSDB 2YNMA 4OKSA 4O0MA 1G7SA 1R6BX 1JQJC 2GJKA 2J3EA 4NHOA 5L3QA 4B34A 2CCKA 2NPFA 1HE8B 1UM8A 4FW9A 3EZ6A 1ZIOA 3BXZA 3FHOA 3EX7C 2BHRA 5EE9A 3QKSA 5JI2E 4PO9A 3LQQA 2Z0MA 4B2LA 5JZVA 2AR7A 4WXRA 3QKRA 3EPHA 2EFEB 1UKYA 1IY1A 1NLYA 1AM4D 2V55B 1OFIA 3VKGA 1TQ4A 2G1KA 5KNDA 2WOJA 4DLYA 1FNNA 1IXRC 4BUJA 3K0FB 3WRYC 3NG1A 1CF4A 2Q3MA 2EYUA 3LXXA 2IT1A 3A1SA 1ZNWA 1ZW6A 3QKSB 1XB2A 4LYFA 4HDQB 3W8NA 2IW3A 1MABA 1OPXA 2O0JA 3AP1A 4PSAA 2X2FA 1G5PA 2FU5C 2J41A 5HCIA 4JL6A 4WA7A 3R7WA 3RSLA 5AUOB 2C78A 1MR3F 2YWEA 4I1SA 5JWHA 3V4FA 4BEJA 4UNQA 2GESA 1A2BA 2QRZA 3PR1A 5BN5A 621PA 1GNPA 5DHFA 3ZVRA 1BMFA 4R98A 3BB4A 5C2JB 1MABB 3JZAA 2W6IA 1R10A 1X3SA 4CZ2A 2IS4A 1EFRD 4XIGS 4K81B 5EE0A 4JT4A 2FEMA 2HYIC 4DLTA 2KE5A 3SI7A 4CEIA 1N0VC 1N2CE 3SC3A 2RGAA 4EFNA 3UANA 1KNQA 3N2IA 1Y3AA 1ZNZA 2VP6A 3FHCB 4DC9A 3QSYA 3KQHA 4A92A 3M0EA 5JBQA 1N3BA 4HLDA 2IXGA 1N6RA 1C1YA 4PFSA 4W5WA 3MWJA 3TAUA 4MDEA 2ZRJA 4NE2A 1JBKA 221PA 3OE7A 1VCMA 3P20A 3I62A 3GLFA 2TMKA 3WMFA 3ZZTA 3QXJA 2RGDA 4QJ5A 4FD2A 4GMXA 1SVOA 1XXHB 4TZ0A 2GCPA 5FBVB 3H86A 2WWWA 2C96A 2P6NA 2VQSA 4KYIB 2GZAA 3I72A 2KI5A 1YR6A 1P4SA 4Q9LA 2GXAA 4NDZA 4MRRA 3FFBA 4C4PA 3GLFB 3T61A 4Q9IA 1WB9A 1W46A 3IDQA 2XSZA 4ASUD 2J45A 1U81A 3NDBB 2QSZA 3U6KA 2IHYA 4OYHA 2KJQA 2ECKA 4Q1EA 3UKDA 1BH2A 3KZ1E 1G6HA 2EFCB 5BYJA 3MD0A 1E9CA 4M1TA 3L8ZA 4A2QA 4ESHA 1D9ZA 1Z6YA 3FYHA 4DIEA 2IYYA 1XEFA 4MRVA 4BFWA 1TQDA 1TU4A 2N1BA 3A37A 1ZMXA 3W90A 3B78A 1FMLA 2Z5FA 3NEYA 1NNEA 1IN8A 1XEXB 5G53C 2H7VA 3LBNA 3BOSA 5DLQC 2QPAA 2K5UA 4M1KA 2BVNA 4Q00A 1F60A 1U8AA 1E2LA 1KK3A 2XNSA 3GMTA 1SHKA 2OXRA 3C41J 4QBHA 4TYNA 1Z0AA 2RMKA 4YMWA 1GILA 1NG9A 4TLDA 2YOFA 3RS7A 1NVWQ 1B23P 2GZDA 2CLCX 4IDPA 2C77A 3BFVA 4JSTA 4LBYA 4KLZA 2O0KA 4R9UC 3ZS8A 5H70A 5FUVA 1G8FA 1HYQA 3FMIA 2GNOA 2VHCA 5KUTA 4TMWA 1S3GA 3E70C 1JNYA 4OQMA 4GZLA 1GWNA 4QM6A 4IDHA 2ZUCA 1UF9A 1Q1QA 4C0AC 1EFCA 3BERA 3EA5A 3NXSA 4Q9KA 3KXLA 3AM1A 4POAA 1E2MA 3TR0A 3ICEA 2FPMA 3SFVA 5EXPA 2QN6A 1YZGA 1Z63A 3TVTA 3K70D 4Q19A 4IOKA 2IYLD 2FOLA 2P6RA 2J0SA 3GLIE 2ZU6A 4BECA 1YZTA 4EQ6A 3OIVA 2QPOA 1BYIA 4R2HA 5EE3A 1PUJA 1Z08A 2CBZA 2ZYTX 1GIAA 2I1QA 5AWFC 2J0UA 1R0YA 1QHSA 3BK7A 3OFND 4IDOA 4IEEA 3MWLA 5DI3A 4G5OA 1XCGB 3HWSA 4WXPA 3J81k 2W6ID 1N5KA 1M7BA 1KI9A 1AS3A 1YVDA 2Y8EA 3OAAA 3QQ5A 5JLJA 1YRBA 2C2HA 3FHTA 4OQLA 2ZE7A 4TLAA 4UQOA 4DSNA 1IONA 3L2OB 5DE3A 1IQPA 3UK6A 1EWQA 1N0UA 4YXWD 4OHXA 1IJEA 3UWOA 4G01B 1EFUA 3Q7QA 3THOA 1BO6A 1T0JB 5JWRA 4G0NA 4HZUA 1Q21A 4WIAA 5BWMA 4OBEA 2H92A 2RGBA 3RYTC 4AG6A 2ZU0C 4H9GA 1GVNB 2KSQA 3QEJA 2PJRA 5KTYA 4JKYA 1XZPA 3F5FA 3OE7D 1QHGA 2H18A 2ZYWX 3BRWD 4JLDA 1R2QA 2ZRDA 1AKYA 5EP2A 1GL9B 2CJWB 2F6RA 2NO6A 4P3YA 1S9HA 3LX8A 4JLBA 3REFA 2GF9A 4A0RA 4CDGA 2QL6A 1IN6A 2FJUA 3DPUA
chains in the Genus database with same CATH superfamily
1KI4A 1J09A 5E9WA 5J2UF 2O2EA 3H11A 4MR8A 4FLMA 3PITA 3HCRA 4LWOA 1RXVA 4RK1A 1HSOA 1Z18A 1W5FA 2RHCA 1GQQA 4OU5A 2GXQA 3BA6A 2DEUA 4KX3A 5HK8A 3JR3A 1LNSA 4NPAA 3RJ9A 4FGZA 3D2CA 2F1JA 2DLCX 4XSHA 2GHQA 1SH7A 3BQ9A 4EZBA 1B73A 4MUFA 4DCOA 3NGXA 1FUKA 5IN4A 4JI7B 2EKDA 2IC5A 3RC9A 1JEOA 2XRYA 4IJMA 3HXMA 5EKDA 2GF2A 5JJKA 4CIWA 4EEXA 2FVXA 1TKBA 1ZKMA 1JFTA 1NXQA 1GU7A 1S89A 2JJYA 4DS3A 1CZUA 3RIGA 5BSVA 4FI3C 3HB1A 3MOIA 4CI9A 3U7QB 4BPBA 3IIKA 1E3SA 4DOMA 3QEMB 2GPJA 2QGNA 1FFEA 4RCYA 5ELXA 1AURA 1RRMA 1ETUA 4R8RA 4C0LA 2B3DA 2XCRB 2I6TA 3EEBA 5BUSA 2PUVA 5TQ2B 3P4YA 1NP7A 3D3WA 3IS3A 1K7XB 4K0KB 1NW3A 1SUAA 3OIWA 4FD3A 2CHFA 1XOIA 2PHZA 3CW8X 3GN2A 1KK0A 1TUIA 2NZVG 3PHHA 3QMWA 4C2UA 1KSHA 2UUCB 3ANYB 4HFMA 3M82A 4PXAA 2HOQA 4QNRA 3WMRA 4CFZA 4YCAA 1ZD1A 1YK1A 5EWJB 1HI9A 2PJZA 3O3CA 1NLUA 3AESB 3E9RA 4MCIA 1PT5A 2J85A 2ZJ0A 4LOHA 4L78A 1ETHA 4QBIA 1ZQ1A 3CKYA 1N7IA 3JVEA 2NUBA 3NCTA 4O4LB 2FEOA 1UPUA 3AZOA 4HPJB 2IYRA 4AMUA 1G98A 1UJBA 3G59A 4JIGA 4JSRA 5AUPB 3KJFA 3K9NA 3D6AA 4M1QA 4R16A 3I32A 1K8RA 3HR7A 4DE5A 5FT9A 2OFPA 4Z2YA 4DMGA 4B6FA 5IVPA 1L8XA 3ZDXB 4XTRA 4K9NA 4CTOA 5I7SA 1T24A 2WD8A 4FMCF 2CF5A 1XMOB 2QMHA 1M8PA 1L6RA 2BR3A 5ITWA 4RLQA 1E6CA 3LV8A 4XKJA 2WKRA 4BFCA 3CZQA 3MTBA 3DTTA 3S4YA 1AQNA 4OGKA 1OAOA 1CBUA 1US8B 1Z6XA 1PDOA 1V8ZA 3N6RA 3ELYA 1SQ5A 1VBFA 1DFGA 4IPTA 4DT1B 1I5OA 4BLUA 4H31A 2VATA 4DCNA 3LD9A 3PQ2A 1MHTA 4R2WA 2JRCA 1T9GR 4M0EA 3WYCA 1MIOB 1JHAA 3PI7A 4WXMA 4GC5A 4E11A 4DR7B 5C8YF 1QCYA 1U1EA 1VXOA 3M5CA 3T4UA 1T4CA 4TN1A 1P6XA 1M2WA 1RFLA 2HLNA 2IFTA 1YZQA 4GPTA 2EG5A 1CTQA 1CR6A 1POXA 2GD0A 4KI7A 4KVAA 3UK7A 4NL4H 4ZGWA 5JAMA 1Z13A 4BP9A 2JCGA 5DBFA 2VF7A 4LJRA 4XW2A 1T3TA 1OLSB 1SVUA 2R3SA 4NK4A 1G2PA 3E2MA 4KV7A 3RC3A 4ZICA 4LVUA 3W3ZB 3V1MA 2FRDA 1OFUX 2BPOA 4NJEB 4B9EA 1I2CA 2H11A 2Q7XA 1PW5A 4L5IA 3ISVA 3B6EA 1E3EA 1V16A 2ZB4A 3NFRA 2NAPA 1X15A 1JKJB 1DX6A 4NQRA 2QR2A 2PGXA 2YC2C 5FCDA 5I4KA 3RTCA 3RRJA 2H16A 1MN6A 2C4KA 3HVHA 2EWWA 1CQJB 3EH1A 5DF1A 4DREA 4YR7A 3AILA 4JYMA 2W42A 3QTTA 3GJ0A 3TF5A 4UZFA 4NFYA 4Y6PA 4R9VA 1GQRA 2CFOA 2I0FA 2JGDB 4ZALA 2OOSA 2MT9A 2NXCA 4BHTA 5L45A 1H5NA 3CPHA 1U2GC 3P0IA 1S2GA 3MSCA 1M2GA 1RC0A 1U0EA 3OCZA 4Q1BA 5LD2C 2NXEA 1VYTA 1U2DC 3OD5A 1O8BA 2PMKA 3AEQB 4N5HX 4R1QA 5EA2A 3W79A 2W2TA 1NFQA 3VNVA 2A1UA 2BFNA 3B1XA 1OSNA 2QTZA 3H1AA 3STVA 2WWIA 1XO1A 3H2GA 4HP8A 4QREA 1K9SA 5CW1A 3UV3A 3OQHA 2XGSA 1UADA 9LDBA 4KWCA 1AVTA 4KN6A 4KIGA 2ZZNA 3H99A 3AH8A 2HREA 3KJQA 4B82A 3M6UA 3BFPA 3N75A 4CMKA 2J5RA 4XUCA 1OIVA 3PICA 5KOHA 5KOJB 4R83A 5DLEA 3OX1A 4IYRA 4KQ2A 5AJXA 2O2ZA 3ND7A 4LFAB 1G6KA 4G1EB 3RWMB 5ES3A 2XKJE 3S5UA 4EG7A 2HPZA 4YAEA 2E55A 2RGGA 5K0LA 2IF0A 5ICEA 2VYVA 2A9VA 3WYNA 4ZEMA 4ESVA 2ZBUA 1RLJA 2BEUB 4BUZA 3KYBA 4KR7A 2GBIA 5E6RB 1A50B 4ND2A 5KU7A 3LQYA 3GJ7A 5A4DA 2ZUDA 1XNJA 1N33B 1VHLA 1P2DA 4CFYA 4MB2A 4FZRA 3KYDA 2WQ6A 1M6VA 4UVEA 3FVVA 4ZVTA 1GM5A 1E59A 4IHQA 4TTJA 3DD1A 4XWWA 2IYAA 3TXXA 1CIPA 5ADVA 4BNDB 1FLDA 3F4LA 4U8HA 3B38A 1TT5B 3ZHYA 1XD9A 5JATA 2B5OA 2HZ7A 2ORIA 3C24A 3NH9A 1MD9A 5JNLA 3DPIA 2QF7A 1CZLA 1GZUA 4JJ8A 1TXGA 1ULBA 1NUQA 4MMXB 5JCZA 2G40A 3AF2A 2XXAB 1PE0A 4JH0A 1ZUIA 4BTLA 3HHPA 5CW2A 2EKBA 1V5EA 1W48A 3HCOA 3SZGA 3I2IA 1M8JA 4RW0A 2JF0A 1O9GA 4DA9A 1A7JA 1EWVA 2DQSA 4XYEA 2P3LA 1KJYA 4HMPA 3KYIB 2C00A 2C4TA 1LJLA 3HR4A 4YO7A 5ESWA 1VSQA 4RFSA 5HFJA 2IYEA 1KZ4A 2FPGA 2GK4A 3K0CA 4KQ1A 5DM2A 5DCLA 4O33A 5CCDA 4NULA 3TQRA 4PTZA 4BKOA 4EPXA 1GL7A 4W7IA 5A3JA 4C04A 3BT7A 3AIKA 2IPAB 3MIIA 2BGRA 3OP4A 5AW1A 4M21A 2AL7A 5K3BA 3H83A 2B21A 4WEOA 5FPHA 3PC3A 5CIQA 1BGXT 4IF4A 4R8MA 4AVYA 3UMGA 1Z38A 4EUEA 2WWYA 3RVBA 5E4JA 3LP5A 4NYJR 1K2VN 1SCNE 3HN2A 2FOIA 3SBDA 3TD6A 2VNHA 3RDPA 3G9ZA 2NV6A 2IEGA 3KXIA 4TSFA 4Z7OB 1XAGA 4UPDA 3QMPA 3PUYA 3JW8A 4CKYA 1E96A 1M6HA 5CNKA 4ER5A 1BXZA 2BSXA 4B76A 4DBVO 1FYFA 2WSBA 4E4YA 3F1LA 3IVGA 4KFSA 3VO2A 4EY3A 4Q4LA 5L6MB 1Z3CA 1KSGA 5ED4A 5KNLA 3LVFO 4YBZA 5EHXA 1P74A 1YKSA 3AR4A 5LWHA 5MFZA 2AA3A 2Y1KA 2PL1A 1JDPA 3D64A 3HSKA 4DPKA 4E07A 3NRBA 4MEBA 4PBTA 4QFDA 2H65A 1XTVA 1PNRA 3PGXA 3ZPXA 5A5GA 1ESZA 4QELA 3RODA 5KDDA 5G4LA 5JASA 3RT9A 2IDZA 4MIYA 4D9HA 2OLJA 2JFWA 1UEIA 2DPYA 3R23A 1W75A 2X5OA 4NVRA 5KZMB 2GRUA 3IJ5A 5CVCA 2W90A 4KQIA 2DC1A 3Q2IA 1T0HB 3EGXA 2ECFA 4KXQA 2H51A 3I92A 1R74A 4P6VF 3I39X 3ANLA 5FHQA 4F5DA 1P7PA 1Y7PA 4FGWA 3ILHA 3ESCA 5C51B 5G3YA 2SECE 2O0HA 2BHSA 1YIAA 1Z7WA 1V96A 4E5MA 3WB1A 4U6NA 3R5HA 2BW0A 4K03A 2WTEA 1W0JD 3MUNA 2O59A 1JVSA 4Q12A 1EX9A 4IJ5A 1T35A 2NSJA 3FIJA 3ITNA 2A14A 2FN8A 2R6R1 1IPEA 3MYYA 4C4SA 5JDCA 2R1TA 1TVKB 4YCBA 2AQHA 4M83A 5FFMA 3GAAA 1YJXA 4C0QC 5KKCA 2Q4EA 3K09C 4OFWA 1Q0TA 3IV6A 1ANKA 2VZ9A 4CDRA 2RJ3A 5BWOA 5MN4A 2XYPA 3U60B 1K8YB 4AIRA 3FGNA 1X80B 4G0YA 3OO0A 1QYXA 1G18A 2OP0A 4X1IB 4Y6QA 4JLAA 5GM2A 3A3KA 4R01A 4BX9A 4HGPA 2OPHA 5IBPA 3O1IC 3R0XA 2XXBA 1W5TA 2GWHA 3QU4A 3JYLA 1R0XA 1XRRA 4J76A 4QLOA 2ZUTA 2R6GA 2CD7A 2FWJA 1GTL1 4GT1A 4QULA 1FTQA 2G3YA 1AXGA 1NUSA 4HTAA 1ENPA 1HDEA 3ASVA 5A7FA 4OHUA 4ENWA 2Q21A 4JT8A 3O93A 2C5FA 2H1WA 4PO1A 1TJPB 4UVDA 2F00A 3JYNA 4KNWA 4UTNA 2H00A 4HQ6A 4MUIA 3C5WP 1KP3A 1X1QA 4W1PA 3ROGA 4LZOA 3UYLA 4CMEA 4Z5XA 4IHKA 4UHCA 1CY7A 1QGDA 1M75A 2MR5A 2E4WA 4HDRB 4AJ2A 4MHTA 2I3GA 5ITSA 4OGLA 5JANA 1VBMA 3CH4B 4B31A 4YP9A 1K8QA 2Z8ZA 4OH1A 1ZGZA 4AB1A 3SEQA 1VKHA 3ETDA 3MD9A 1QHXA 3ORFA 4DUGA 2BEWA 2DHQA 3JR7A 4LY3A 1K6MA 2YN4A 1P5RA 3ZC3A 3WFJA 3WO0A 2XDAA 4MW5A 4RELA 4YBRA 1A9YA 2R1ZA 4CLEA 5BSKA 3AHGA 1BVHA 2JGJA 4ND5A 5K2OA 3FG9A 3L7KA 1KETA 4PHFA 1AMOA 1PVOA 3PXBA 2FPRA 2MDTA 4EHKA 5JD5A 3K0AB 1NMZA 4AY4A 4EY5A 3VHRA 3P9ZA 4S2UA 5BUCA 4I50A 4G67A 4CKWB 4G63A 5BXQC 1E9VA 4J75A 4RXUA 4Y2SA 1B8PA 5EFZA 4HATA 5JHHB 5LXTB 5TGDA 3NKLA 2C83A 5D3MA 1WKBA 1DPGA 2K7ZA 3OY2A 4BMYA 1QOQB 2FZWA 4LFCB 4I5FA 5SICE 1NQAO 3LVBA 3QVVA 4RETA 1C1DA 2C8KA 3KVVA 5FLKA 2O48X 4E5DA 4AJPA 3AVUA 3EGDA 4YIHA 1NIJA 4BFSA 1ZBDA 1PLLA 2LVBA 4DC0A 3I1YA 3ZOZA 1S6YA 2JH3A 2IE8A 1VBKA 3KUKA 3LCJA 3TOCA 3W05A 4R2IA 3RPEA 4U8GA 1R16A 3SFTA 1C9JA 1I3MA 2HADA 3H1FA 4WTOA 3FCXA 4G4SP 3GARA 3PIDA 2DP4E 3FFAA 3SKVA 3V3KA 3OT1A 1UWCA 1QCZA 4REOA 1Q3TA 3FNIA 3WGGA 1Y4DE 2H1HA 4ER7A 4ZVNA 3KOYA 4AG3A 1OV6A 1H65A 2JCBA 3U7HB 5BYKA 4H7EA 1JA1A 2PYZA 2UZIR 1MW9X 3RYIB 4DG9A 1OILA 5GJBA 3KP1A 3A1CA 3DV9A 3KU1A 3QKWA 5F73A 3RRNA 4AJJA 4GL2A 2JI4A 4PXSA 2R68A 5DN6D 3CX4A 4PSVA 4J0JA 3NWJA 2DSNA 3CEAA 4ZWNA 5CNIA 3OEEA 3LBFA 1O2DA 2Q27A 1QP7A 7MHTA 1E5LA 2WMDA 3OPVA 1LS1A 4KXWA 4AMGA 4BNUA 4KNYA 3Q1KA 1KAEA 3B9QA 2IXAA 1IAQA 5IDYA 3GLHA 1F2VA 1XZMA 1RLTA 1FNBA 1V71A 3PEUA 2GZSA 1UKCA 3LHFA 3U37A 4EK9A 3FTNA 4QLBA 5L3VA 1Q1EA 3HKDB 3QWIA 4QDTA 1GHTA 1ACMA 2QVCA 1E1CA 2QORA 4LY6A 4AXXA 2WPNA 4JJZA 4PHHA 3AF6A 1JR6A 2XOKD 3ZVNA 1FRNA 2Z58A 2GA9A 1OKKD 2OEPA 3WQSB 5IXJA 10MHA 3E15A 1PFVA 2J6BA 4M22A 2ZBQA 2FV8A 3HYCA 3NC1C 3QKRB 5CH8A 4CIDA 1LBEA 4S1VA 2GM9A 1K06A 3IE0A 1TVCA 1GDHA 2AOTB 1RQRA 1ONBA 4K6FA 1ZZGA 4D5EA 4MK4A 4R6WA 1EWTA 1LDBA 3G5UA 2I2AA 2HH9A 4OYLA 3N87A 3FMOB 1K63A 2PKWA 5LKRA 3GRVA 4F0JA 1Z45A 3QMVA 3MCTA 1WOMA 3SMVA 5BURA 1TK3A 6LDHA 4LF8B 1QH1B 5EJ5A 4X7RA 3L1UA 3W8FA 2VN8A 4DRXB 1UJ4A 3N7AA 3ADDA 4NAHA 3AJ9A 2X0NA 4K26A 4GOXA 4KR3A 1T3GA 3KU4A 1VE3A 2H7CA 3O4GA 1Z68A 3QA9A 1CFJA 4J49A 3X1MA 5C81A 5KYYB 2C5EA 4ZO9A 1P5ZB 1U9CA 1NDUA 2I3DA 3EQ6A 3NT2A 3VZCA 2O8DA 4D9MA 1FUYB 1NBMD 2QXYA 3KVRA 3IQWA 4P92A 4RD2A 4F04A 4LRSB 3X2EA 1H2BA 4I4TA 3HQ4O 4YRJA 4JR0A 1E7MA 1YACA 3L84A 1KNXA 5DT2A 4EY7A 4MS3B 2WYVA 4M9CA 2PT9A 4JGBA 4KXVA 4MQEA 3T5BA 1Z3IX 1DQRA 3FDZA 4NDNE 4XX0A 3OHPA 2ACVA 1VG8A 3EZFA 4KSYA 4NCKA 1CE8A 1R9JA 1T91A 2YXDA 4YT2A 3MWFA 4CWAA 3L7AA 2IOFA 1NTRA 4FN5A 3T8YA 3VR2D 4M9ZA 4US0R 4B17A 3UMJA 3CB2A 4G5SA 1R18A 4BN4A 2RHTA 1VMEA 1YHZA 1ZC3A 2C2WA 4XM0A 1KEKA 3RRYA 2F59A 3R0JA 4A6EA 2FFJA 3KFVA 1RXEA 3IX7A 1IQUA 2JA2A 1E7SA 2QYOA 1XVIA 2ODNA 3WK6A 3HLTA 3MBKA 3SYTA 1HDOA 1PEAA 4LF9B 2OOKA 3KKQA 1XYYA 1DIBA 2GEJA 2VNKA 4W5HA 2NU9B 4KMOA 5JAIA 3AHDA 1F7UA 1TTQB 4J16C 2FPIA 2XNDA 2VNSA 2FHSA 1GOTA 1USWA 2RG7A 2JLQA 4CMGA 5LDGA 1T6NA 1RZRD 2VRWA 3OJFA 4RDCA 5GPBA 3NETA 3O8NA 1ZY2A 3H2IA 4K2AA 5DOZA 4E09A 3I61A 3V8RA 3OE4A 4HNVA 2D1FA 3DWGA 2IH2A 1JLKA 1YFKA 1X1SA 2ZE8A 3ZR4B 3GRRA 1JHMA 2V5VA 3UV6A 5FFNA 2C29D 4JL5A 4LYAA 4YCSA 3UFXB 5HUQA 3ILXA 3HUDA 2OHHA 4NFHA 3AR6A 3W6UA 2GYYA 3Q6NA 1CX9B 5FA6A 3VVMA 1JAIA 4Z8XA 1YZUA 1V4NA 2CXQA 2P68A 3P9NA 4IZIA 2XUZA 3A6ZA 3ESYA 4D79A 3CCBA 4QHTA 4A2CA 1SQFA 4IIJB 1DO0A 2R1UA 3OICA 4CG1A 1WZ2A 2WIFA 5F7XA 1P77A 2ZRFA 4D8XA 1VMAA 4Q9NA 4C4TA 2R86A 2VJLA 2ZSBA 3OLYA 3WL5A 2J3MA 2VF2A 2HF8A 2PUAA 4WW0A 3F71A 5DP1A 4DLPA 1FE8A 1CJTC 3H6GA 3KEQA 2OBYA 5BSRA 4YUWA 2B92A 2R6HA 3SOZA 5I4IA 1EFPB 3T15A 1YR2A 4OI4A 1ZYUA 1DQSA 2D74A 2QXTA 4QPCA 2Q2VA 3LPMA 3TL2A 3HSYA 5BWNA 1JALA 4AWBA 1NUTA 1YV9A 1YKFA 1GPUA 2NPOA 3NH6A 1OH6A 3X43A 3ZDCA 1BE1A 2HIMA 4YRGA 5HMMA 13PKA 3IO5A 4OSEA 3HZRA 4R0NA 2Q5QA 4ALLA 2PGIA 3KJZA 1SKAA 1JR3A 2CXXA 5JD4A 2Z57A 3MJHA 4Z0PA 2QTWB 3JWPA 5EZ5A 3SPXA 1IB0A 3JQAD 1EZ4A 3CNLA 3N76A 4KIJA 3ZK8A 3K9LA 2CFSA 2C3MA 2JIOA 2H5LA 2BT4A 3UHPA 4YV1A 1UP6A 4A2WA 5TC4A 5HS4A 3VVCA 3WRXC 5ILQA 4LV5B 3ZJVA 3M2TA 5KYWB 5KPJA 4P1ZA 1PZEA 1NUAA 1UK8A 3M8KA 2YFQA 3TJMA 1X77A 1ZN8A 3VBCA 5IS2A 3IV7A 4CEJB 2AJDA 1I7DA 1L5GB 3FHJA 3KTDA 4NBVA 4CRWB 4YTEA 3IIMA 3IP5A 4P7BA 2IYQA 2YKGA 2NO7A 5BQXA 1QK4A 1MEOA 1Q19A 1RI5A 2PS1A 3ECSA 4QYMA 1T9AA 2QMYA 1L4EA 5KTNA 3EIFA 2YN0A 1RKUA 3VPXA 3U19A 3HXTA 2G8LA 1DFIA 3I2KA 1R9MA 3DLIA 2H7YA 1OLUB 1JR4A 4REQA 5BR8B 2HJ9A 2D1QA 3EIHA 1DDGA 5DI3B 5ICMA 3C15C 3K53A 3GLUA 4ID3A 1HQYE 1TMGE 1WDWB 2RARA 1UUFA 4PTLA 2OSVA 3ESAA 3JD3A 1JPVA 4MX8A 5KPDA 1SWVA 5F9HA 1OMOA 3LWZA 3KKPA 4XDGA 2O6HA 5FX2A 1XMJA 2R5FA 3EF1A 3A4YA 3KPWA 4LOAA 3KHUA 5IAAA 3OLQA 4GX5A 4XI9A 3TUIC 5L4LA 2DERA 5E9AA 4K05A 2WOOA 3DE3X 2B99A 1VXRA 2E21A 2P27A 3NWPA 3LDHA 1E9SA 3QH4A 4KAJA 3DB1A 5CTAA 4FOSA 4Z9XA 4DVGA 1N6LA 2B4KA 2IF2A 5JISA 2I4TA 4EPWA 3VOBA 2HPVA 1I10A 1UWKA 5FWAA 2CMHA 4Y9UA 3UQZA 2CBXA 4PEVA 1AQYA 1V1RA 3H0KA 3ROFA 2H2IA 2I6XA 2X4LA 4DLBA 5K99A 3AI7A 5H81A 5BMVA 5TSDA 1KQNA 2VUSA 4FEAA 4NY1A 1O6GA 3VZQA 1UZLA 1P7CA 3QVJA 4GXTA 1I8TA 2CWWA 2EDAA 2VWHA 4Z53A 2F4VB 1U7PA 2ZT5A 5EJ8A 1AO3A 6CHYA 2X8LA 5TMPA 1NOIA 5JR3A 1TM3E 5DGCA 3UEOA 3CG0A 1EI9A 4FUTA 3RVJA 4HDSB 1C9MA 5JT1A 2XIJA 3ND8A 3H1BA 3AV3A 5TMDA 3SY8A 3H2KA 3AR7A 4JJIA 2B1IA 3G7UA 2CJXA 5AVYA 3L6RA 4QVKA 1EUYA 1YQTA 2FSVA 4UW9A 3RHFA 3SEZA 2DH5A 3G0CA 4HUTA 4AZ0A 4EECA 5KSPA 2WM8A 1Z12A 5FI0B 2Q0QA 4PANA 1UFQA 4CCSA 5KTSA 2QQFA 2Q6TA 3BH7A 3A05A 1VP9A 5AQEA 1FP7A 2B4TO 1UOPA 4XOUA 1JQLB 5C34B 1CP2A 1KJQA 1TI7A 3W06A 4EM6A 1PGJA 3MJSA 5JVDA 1XL1A 4EHJA 2Q1SA 1EBFA 1IEVA 3G5MA 2BE9A 3RK1A 2C99A 5JAHA 4C0BA 5JH7F 2XMPA 4IZOA 4FDUA 1T9KA 3U1VA 1SCUA 2D7CA 1BEZA 2H2FA 2Q3CA 2QSJA 4MUXA 2BFMA 3SJBA 2HCJB 3KOMA 2V9CA 4FYWA 4WESB 3LYUA 1S01A 5F9FA 4XGKA 4NU5A 2G0NA 3ZWPA 4LQLA 2CYBA 3BCRA 3ZWWA 4JT2A 4QNMA 2WK1A 5JJLA 1DJMA 3NYIA 4TXLA 2PANA 4LYHA 1GG8A 3TPFA 2XZTA 1CIJA 1Z7YA 1Q83A 2OPBA 2Q8QA 3KQOA 4N47A 1DWQA 1MPXA 2C9BA 3B12A 4UU1A 4JBHA 4LWPA 3VM6A 4GFDA 1PV2A 4L73A 2WJ6A 5BN4A 2RE8A 2FQYA 1E1YA 4E31A 1AC5A 1OW3B 1M5RA 2O1SA 3EIQA 3QV1A 1TYZA 4WFJA 4GNRA 3LT2A 4NNJA 4E46A 3KKEA 3KTAB 1B42A 4C08A 1XP5A 2PMCA 5G2OA 4CKCB 3LL4A 5HKOA 4J1TC 4TQGA 2XUOA 1E4OA 2O1XA 2UZ1A 1NV9A 3BWEA 5AT1A 1DX4A 4ZAFA 1NQOA 1WWKA 3P26A 3A3PA 2HCFA 4YO8A 4NBKA 3WL6A 1W4RA 4RNDB 3FB4A 2FI1A 3WOHA 4Z1OA 1FB5A 1CJKC 2WRZA 4GF5A 3VH4A 4AJOA 1Z2DA 3KD2A 3IPXA 3W2IA 5CVJA 3FRJA 1B0UA 1S7GA 3F3YA 1QG6A 1XGKA 3RK0A 1CRQA 2JVKA 2Y1CA 3H7AA 2G83A 3RUAA 1HFEL 3OQNA 1VI6A 3WYEA 5SZIA 3SFZA 2C4WA 5CXUA 3EXFA 2CJFA 1RXWA 2RHRA 2VPZA 1ILWA 1I32A 3PVZA 4C5BA 3D54D 4G4IA 3L0PA 2CW5A 3DC7A 2GJ4A 3U44A 4RIHA 4WECA 3WX0A 1X86B 3Q2KA 1QJ4A 1E0AA 3DKPA 4XIFA 3HXPA 1HDRA 2Z2IA 1QS0A 5AJVB 4FWTA 4O2BA 5ALWA 5LOVF 3GL9A 2HSWA 3S99A 2O3TA 3CWCA 4HNAA 2VDUE 1J25A 5KNDH 1W8IA 1C7RA 2CMFA 4QXRA 3STUA 4D0SA 1VI5A 1J8YF 1HDGO 4RAQA 2X3FA 2XLBA 5EJGA 1ZJZA 3JRWA 1P0QA 4QPPA 1NYTA 3HCNA 4LZZA 4LMAA 3AM3A 4AF8A 1LPBB 2DM6A 1LSOA 1FX1A 4UE6A 2G5CA 1LPAB 4II2A 2IXEA 4ZCMA 1UMKA 1OOEA 2JC3A 3CO5A 2XNCA 5DEOA 3F0TA 5TJ9A 1T1RA 2FSHA 1W5SA 3IR6A 4C0KA 3PX7A 2VT3A 3DAGA 2QRPA 3KELA 5ALTA 4KXNA 1SXHA 3BSWA 3L82B 3MNFA 4ND6A 1N6NA 3DLCA 2IWHA 2AH5A 2WPDA 3OLCX 5CM8B 3HJUA 4F6LA 2PL9A 1NWCA 5DDIP 2V54A 1I0LA 4P3PA 3Q15C 4R1MA 4TVOA 1XQYA 1BE6A 3EEFA 1ODFA 1X7HA 1KJZA 2XMDA 4M0CA 4YALA 5KQGA 1NVXQ 1WLSA 2QRUA 1KYZA 1A97A 3I28A 2FZEA 1IB6A 2IPMA 2NUPB 3KT3A 1H93A 2OHVA 4GMKA 2ZAOA 3ENQA 2Z04A 3LDGA 1QVVA 1XZGA 3CLHA 1XMPA 4IF6A 2GQ0A 1IRIA 4CGZA 1ZJ4A 2JHGA 1K89A 1IBSA 2W8ZA 1S2OA 3NAQA 1DZ3A 1HE2A 3PKJA 4RVNA 2HUNA 3NCHA 1GZDA 4NJMA 3U7JA 3CVYA 5EJ7A 1SKUA 5EHZA 4UBIA 4KV9A 3FMVA 1O9BA 4DMRA 1L4HA 2BELA 3A6FA 1P44A 2H48A 3DYVA 1OTYA 4H3SA 1RP7A 4EFKA 2HHAA 4W8HA 1PZHA 2D3WA 4L3WA 4X8MA 1PGNA 3E3LA 4A8JC 1PX0A 1U98A 2RI0A 2V4MA 3OM8A 2DKOA 4ZO6A 3GOQA 1OBOA 5FH9A 4YUVA 1IN1A 1XZLA 3IP9A 5CJJA 4Y2TA 4ZD6A 4MKFA 3SQDA 3CNBA 1QSGA 3AUUA 4OV6B 5GOZA 4ZEOA 4WN9A 3VZSA 4XWKA 1KE1A 1I6KA 2Q1WA 4PG6A 2O5RA 1G20E 4UAJA 5LZ5A 2ZJ2A 4AP9A 4GKBA 2HWKA 1A9QA 1I2MA 2ZUUA 3SVLA 2IHUA 2JZCA 4G9GA 3ANNA 4I9NA 4BO5A 1FLVA 3UJ6A 1NN1A 1EXWA 4B4OA 2ID8A 3RUFA 2BFCB 2ZAIA 4LZLA 3UJCA 3WLHA 3FCSB 3M4ZA 1GGEA 5AVRA 1IUOA 1BW9B 4ND8B 2OZLA 2X8JA 3AUTA 2P65A 4OYRA 5BOSA 3E48A 3QF7A 4BJ6A 4LS3A 4LV8B 2NM0A 1WDTA 5F4ZA 1BX0A 2ZJAA 3I23A 3L49A 4IS2A 4LBZA 4PS1A 4HNUA 2GN2A 4Q4HA 3DP9A 5CPBA 3A26A 1RRFA 2N9UA 2X1HA 3MMXA 3OM0A 4NRDA 3UWPA 2QE7A 5HZMA 5K0BA 3AOGA 3T0FA 4QO8A 4WEQA 2UYOA 3UG7A 4E0BA 3GAZA 3PD7A 1ZNXA 2QJWA 3FPSA 4HWPA 4ZVSA 5HKKD 1ZN7A 3H5RA 1P18A 4GLFA 4GZ6A 2ONKA 1JHUA 5JD3A 2AJLI 1K92A 1R4AA 2GJ8A 4Y0VA 2A8YA 5HJEA 2AYYA 3KHTA 4QQFA 3CH6A 1RHMA 5JRDS 4ZHQB 5JXGA 2PVCA 2XUHA 1GCOA 4ZIRA 1G1MA 1HTWA 5ALFA 3GMDA 2XRZA 1KI6A 1FFXB 1NJ5A 2O8EB 3RREA 4UTZA 5LYJF 2GZHA 2PZAA 1QBKC 2Y27A 4PTYA 2JFPA 3K20A 1DSSG 3FKQA 4O4IB 2MSWA 2POCA 2FWIA 2A84A 3FROA 4KRYA 4M1WA 3W7BA 4A0QA 4HEJA 2MHCA 1YZKA 3IHLA 4BNWA 1SUIA 1W93A 5CVUA 3PRJA 1JPNA 2Z3WA 3DB2A 4URVR 1TYCA 4DLXA 1MENA 4KDRA 1AZSC 2B30A 1PFKA 1U0FA 3LDUA 4YJGB 1A9PA 5E3IA 4G0VA 4K9QA 4Y6SA 4GXRA 4AKGA 3H8SA 5FR1A 3L1HA 4KR0A 1P91A 1S9DA 3PC8C 1U2PA 5DNVA 3TRHA 4AJIA 3EIEA 4L16A 3CG4A 1ZR2A 4RTMA 1PK7A 1JNXX 2Z5GA 5FLEX 1JKFA 4LF5B 1F48A 1J56A 1KYXA 2ZI7A 1Y48E 3R5SA 4EB6A 1HLFA 1N9KA 2ODPA 2ZPUA 5JYDA 1I24A 1DC8A 1CZNA 5DHUA 4W9RA 5FBKA 3RTEA 4CV1A 1C8KA 1Z06A 4OO3A 1XQWA 3PNQA 1QFZA 1KR5A 3F78A 3DNFA 4WSOA 2AUNA 3TTVA 4V1CA 5JAOA 1F38A 3PJGA 4G0WA 2ZXEA 4GM0A 1KO4A 2BEVA 2VA9A 3BPSA 3T7AA 1ULHA 4I4IA 4GP9A 4QUGA 4Z9BA 3ZCSA 5B58C 2QRQA 4JU9A 1ODKA 2FQQA 5ARDA 1RSZA 1G19A 1I6WA 2AG6A 1WUYA 3T9CA 4ENRA 1IN4A 4GMFA 2IYPA 2OKGA 4PQRA 4W9NC 1H22A 2UZAA 3L0ZA 5KYUA 1H8HA 2VS1A 1CUHA 2N3ZA 2AOVA 3M81A 4WD3A 4TLEA 4YI5A 2AG1A 3TUJC 4G3XA 1PF7E 3AEUB 3IUSA 4TLBA 5I48A 2Q3EA 3PLNA 4OOFA 1WY5A 4O5OA 4A8TA 4MCAA 5J47A 1GG5A 3GOHA 3NTUA 3RTBA 1AQ6A 4W6QA 1U2SA 2CUKA 3I0NA 3M6IA 3RUHA 1Z0UA 1VCNA 4MYUA 3MRXA 1KXZA 2ZYIA 1FVXA 4OEHA 1U6IA 4EYQA 1GKYA 4B6EA 3F7TA 5MGBA 4NOJA 1T5OA 1EK1A 1GNTA 1KMNA 2ZROA 4DCUA 1KEPA 2GLTA 1KVRA 4QTXA 1J0EA 1E1NA 1EGQA 1JIVA 1V3VA 1T0BA 4L4SA 3TQIA 3FJYA 2OGSA 3WLAA 4CKEB 1FXSA 2GPSA 1RYBA 3TH5A 3LC0A 4HAXA 3RC8A 3AERB 3HACA 3KPVA 1ID8A 1V3TA 1OXKB 2REQB 4TL9A 2OXTA 2VF8A 1T1GA 1F9EA 2VJBA 3I73A 4KQKA 4OJQA 3NHAA 3ROEA 5IBCA 2JKZA 4RO0A 5EXDA 4D0GA 5K7SA 3WGUA 1HM5A 4XJXA 4K1XA 4PM4A 2ATXA 4NX2A 1J4AA 4FE3A 3HBMA 2XWPA 4AKEA 4DW8A 3Q9UA 3GLGB 2BGIA 2GVDC 4ARZA 4MGZR 5IXSA 1IWPB 1NW9B 5LD2B 3R3YA 1DBWA 5SY9A 2YY6A 3MG9A 3PJDA 3B53X 3SU8A 3WG9A 3B5IA 3UA4A 3V4OA 1F9AA 1GUZA 3NDJA 1N4DA 2BBOA 3ODPA 4XASA 4KAXA 4B7AA 5LPNA 3O4FA 2IP2A 2XTMA 1KHHA 1W44A 3IUPA 3QYJA 4G5YA 3R9KA 4R2LA 3EVBA 2BAGA 2LPMA 2YJ4A 3DV2A 2ZR9A 1AD2A 1RBYA 2ZE5A 3THRA 1PBTA 5J2TA 1TL7C 4QARA 5DYTA 3KYCB 4IXWA 3UAWA 1IBLB 2IH4A 3KWJA 3F7OA 1HA3A 5JRJA 1O1YA 5EN4A 1KSFX 3CUYA 4P98A 3HR8A 1C29B 2EBUA 2DFVA 3MSXA 2IZOA 7AT1A 5KKNB 1I01A 3OBBA 3PUHA 3UT0A 1QMGA 1ODIA 5ITZA 3A31A 1HO3A 4O1HA 3GZJA 4AM8A 1NXSA 3BMCA 4X3OA 4YWJA 3OQ1A 5EKUA 3W0LB 3DOOA 4PR3A 1YJ8A 2FQWA 1XZNA 1FFSA 4UAVA 3NHYA 3KLBA 4Q3CA 5IP5A 4AMZA 5FORA 1XROA 3R40A 3CLUD 1QQTA 2NO4A 3DE7X 4BS9A 1KK1A 3D9QX 4HDNA 4NZYA 3SKYA 1CS0A 2HA2A 4HXFB 1RIFA 4DSOA 2HF9A 1XFDA 2QU7A 4GOKA 4XFDA 4UKDA 3GFBA 1Y3FE 2JGNA 2QENA 3LKBA 2JASA 4ND4A 3UAGA 1Z29A 5BORA 1RI3A 2Q62A 1FU7A 1UPTA 1EIWA 3NR2A 4FCWA 4MV7A 3T54A 1BFDA 1W52X 3K4PA 3O8QA 2JZOA 1AA6A 5AW3A 4C7OB 2G0TA 3DCYA 3F6CA 4MS1A 3MS2A 3B5JA 3W04A 3PUWA 4PY2A 3CM0A 5EJIA 3GZNB 5CB4B 1KFJB 4J3JA 1FRVA 2X9QA 2R8ZA 2X0KA 4P2GA 3WGYA 3I01M 1E5VA 5FNVB 5DNYB 1C9KA 2PSEA 2GNPA 3HJTA 3JQ9C 3K0FA 4O5AA 2HCRA 2LD4A 4P33A 2JBWA 2D59A 1XTIA 3E53A 2HIGA 4XQGA 1NDQA 3HCPA 5DM4A 1S5PA 4DIDA 1H2RS 1KC3A 3OSZA 3C3JA 1BHO1 1WY7A 4UDYX 3X1KA 1G8YA 2G8NA 2HNBA 2I3ZA 2QT1A 4BRSA 1WABA 3AHIA 3U7GA 4O8ZA 5KVVA 1F1BA 3PFFA 2R48A 3B6IA 4KE8A 16PKA 4QQNA 1I3CA 1YS2X 2I9PA 2P9FA 5CVDA 4HV4A 1JKMA 4E5SA 4BKPA 1UFOA 3GG9A 5H82A 3E5RA 2ZSJA 2X9VA 3VHXB 4ZT4A 4EARA 4N8DA 3T7KA 4J6FA 2NNWB 4WZBA 1MTZA 2PTGA 5CLHA 1AXEA 2Q3LA 1PFYA 4HNHA 5CLFA 1OD6A 4UVHA 3VR3A 2HDOA 3HVJA 2NO5A 3JQAB 4GKKB 1OXXK 4R3NA 5AM5A 1J70A 4UC0A 1GRQA 3TEFA 3VVBA 3CEMA 2IGTA 3RARA 4E1BA 5ALRA 2CD9A 1YB1A 3FAKA 3UKJA 3UJDA 2RGCA 3QMMA 5BWMA 3BXHA 3PGJA 3JPYA 1N6KA 2OHXA 2PXCA 3IH5A 3LQ2A 4A4DA 2PX6A 3THWB 3A4NA 4YMVA 1BJRE 2AXPA 3LF2A 4UCXA 5A0FA 3WKEA 3H9BA 4GPIB 1V0JA 3VSBA 3TKYA 4O3FA 4F85A 4GR9A 2OXIA 3UWSA 1P29A 1T2UA 5CJ2A 2NO1A 1X7XB 1XUOA 4MQ6A 4E32A 3NANA 1SQ6A 1Y1SA 4TSRA 1NMYA 3G49A 4JWKA 4MDHA 4Z4GA 3R8CA 3DE0X 1VIAA