4KYIB

Crystal structure of the phospholipase vipd from legionella pneumophila in complex with the human gtpase rab5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
b'ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VipD
publication title Structural basis for the recruitment and activation of the Legionella phospholipase VipD by the host GTPase Rab5.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding/transport protein
total genus 44
structure length 164
sequence length 164
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kyiB00
1TEXA 2D3WA 3SBEA 4LC0A 4TMZA 4M9SA 3S1AB 1EESA 2J9RA 4G5OA 4A6PA 2IL1A 2Q3MA 1HY3A 2FZ4A 2X2FA 3KQUA 2GCOB 1W4AA 4OHYA 2VHQA 2C9OA 3B1YA 3G82C 3PXGA 1VG1A 4PANA 1E2GA 1XFAA 5KTYA 1CR4A 3OIWA 3P27A 4V0LA 2O0JA 1YU9A 2PH1A 2QSYA 4UQOA 5DI3B 2CE7A 2GAAA 2O8FB 3SHFA 3O8BA 3R7WA 4QJ4A 3EW9A 2YWGA 2OFXA 5EXSA 2ANBA 1YZNA 1E0KA 4NKRA 2QUZA 2ZJZA 5FBRB 1BYUA 5FL3A 4MRSA 2WKRA 1TEVA 2P65A 2JLWA 1Q1ZA 3NC0C 4I1VA 1E2EA 3VKWA 4ACBA 2GXSA 2V1UA 4LRWA 4P32A 2BCJQ 4GRAA 3U61B 5LB2A 1GTVA 4OHXA 2P6NA 2ZS8A 4KJZA 3I62A 4PC2A 3F5FA 2AXNA 1N5IA 2PT5A 2DWPA 2R44A 1JEDA 4GFDA 3VX3A 2WKQA 4OBEA 4AG6A 2O0KA 3T5DA 3RSLA 3EWSA 1KI9A 1T0JB 5TMPA 2E1RA 1KJYA 1YKSA 2KB0A 2ZE8A 3GEIA 5KSYA 1PVOA 1JR6A 2FEMA 3QEJA 2A7QA 2WSMA 2HUPA 2OM2A 2VRWA 3UMRA 1L2TA 4P4SA 721PA 5JSZB 2J87A 4KVAA 2IUUA 3GFOA 1CS4C 4TMWA 5JHGB 2FMXA 1GKIA 1YRAA 5FTLA 4M22A 4U7DA 3PUWA 3U6BA 4TMKA 4AYWA 1CU1A 3KKMA 1NVWQ 4GP7A 5HE8A 4CYMA 3EX7C 4CEHB 4OI4A 3ZZTA 1NN1A 1VCOA 3CLVA 3RS3A 1G17A 3DHWC 3GJ5A 2VP6A 4LC1A 1EWRA 4LUCA 4M9XA 5K8TA 2C9YA 5HR5A 5SZKB 2B21A 3THOA 3HPQA 1X6VA 4EIWA 2HJVA 4KI0A 1W36B 4LI0A 4WIAA 3T1QA 4CVNA 3ADDA 1ZMXA 2GKSA 1H8ED 2ATXA 1OH8A 4TN1A 5DGXA 3SN6A 1GG2A 2ZUDA 1PUJA 4IHQA 2A5FA 4KO8A 3GLIE 2XB2A 3TSWA 4HEJA 4OHVA 3MAAC 4YMSA 1CR1A 4O2RA 3IQXA 1BMFD 2CHVA 2EQBA 4DSNA 2AK2A 4IFEA 1QHGA 1II8A 1JXOA 3IILA 4EFLA 1F5NA 4F91B 3M1IA 1L4YA 1GUAA 2MSCB 1TPZA 2XNDA 2X1VA 3AVOA 2ORIA 2G6BA 4A0HA 1EFRA 4D81A 2DWOA 2QT1A 2L0XA 1H8HA 2OCYC 5JEDA 3Q5EA 5G41A 1XTJA 1T3SA 2OFOA 2BKUA 4JBWA 4QNRA 5HPYB 1E2MA 4QHYA 5JLJA 4CEIA 4XWAA 3A1WA 3KJEA 3UG7A 5EE1A 5E4FA 5KU1A 1FPMA 3AF1A 1E69A 2O8BB 3AEZA 3CX7A 2K5UA 2VF7A 5KNBA 3H0KA 4RD6A 2I1VB 3ONWA 3N70A 2Q0HA 2O8EB 2QN6A 3C7KA 5JECA 3X1DA 3OIVA 1CXZA 2XOKA 2WIAA 5AJXA 3LWNA 3VKHA 3TRFA 1M74A 1OH6A 4H1VA 1DAKA 3TVTA 4IW3B 1ZNXA 1Q1EA 4KAXA 1JNYA 5CB8A 3AH8A 3DM9B 3UWKA 2ZSAA 4PHFA 1IOZA 2OG2A 2OLJA 2QQ0A 4JLAA 3EARA 4AKEA 1KI4A 1FQKA 3IBGA 1GZSA 3SZRA 1G3RA 1GP2A 3H84A 5BN3A 1F2TA 1TF5A 4B32A 2QMOA 5JBQA 4PO8A 2C2HA 1OFHA 1XMJA 4HLCA 3UMFA 4E09A 4F38A 3F3YA 4PQYA 5B58C 4BFUA 3RRZA 3ZVLA 1E2FA 2JLRA 1UBEA 3KFXA 3GFPA 4HB0A 4Z8YA 2ZIAA 4KLNA 8OHMA 1YR7A 1XCGB 1XXHE 2PMKA 4FMCF 4NYJR 1PLKA 1SVIA 2D7CA 5F3WB 3FWYA 4FMBB 2WWGA 4RD1A 4AY2A 4AURA 2J7KA 1QDEA 4E22A 5JJLA 4YMVA 2C8VA 4TT3D 4XOIA 2XSZD 2IT1A 3ADBA 1EX7A 2VBCA 1E3MA 2GAOA 1M2OB 5DN6A 4Q1AA 1OH7A 1E79A 4Z51A 2WSSA 3MGCA 4JMPA 4EPXA 2F3TA 3EPKA 3VX4A 5JMTA 2VTKA 5D3QA 2O52A 1AGPA 3I1FA 2JLZA 3QPWA 4TSFA 5J47A 5LPNA 3MWYW 5EE3A 1ZNWA 4Q7JB 1SVKA 4BFWA 3GLFA 5KNDA 1GRRA 3G5UA 4ASUD 3B1ZA 1CEEA 1KO4A 2C04A 2W2VA 1VECA 2W58A 4F7WA 3I5YA 3E70C 4PC7A 4HAUA 1ANKA 1Q3HA 3O8RA 1V43A 3OHMA 2VP4A 3EC2A 1XF9A 4M53A 4DSTA 4X8MA 1GVNB 4JJKA 2QAJA 3IHLA 1FUUA 1COWD 1OYWA 2GTPA 4OJKA 1XX6A 1ZCAA 3EASA 4QG7A 5FUYA 4K81B 2YWHA 1WQ1R 1LF0A 4R2IA 2I4IA 2CK3A 4PTLA 3FHCB 3IHWA 1SULA 4W9MC 5F9FA 2JCSA 4XWKA 2R6FA 5FTKA 2FFAA 3RS4A 2J41A 3MWKA 2AL7A 3AVXA 1XTSA 3BRWD 1KI1A 3EC1A 4FD2A 4CIDA 5C4MA 4TYNA 4OQLA 1N6RA 5DHAA 5A5GA 4QRHA 3ZVMA 5HCIA 4RD3A 1RZ3A 2GNOA 4FINA 1HQCA 5L3RA 1V5WA 1FP6A 2ZANA 2ZETA 3TQFA 2VHCA 4GP6A 2WWIA 3QXJA 1GL6A 3U44A 4B2LA 1W49A 2YNMA 2IYUA 3O47A 2W6JA 4EPWA 2WPDA 4B33A 3W90A 1HH4A 1ONBA 1OXSC 3VR5A 1KI6A 1G18A 2FX3A 2WMOB 3TR0A 4PR0A 3CH4B 3AVUA 3T61A 2LCFA 1VKJA 4A2PA 4PAMA 1PZNA 2VIIA 2W00A 1NY5A 1U0LA 3A1UA 2DB3A 4NYIQ 3QF4A 1U9IC 5KDOA 2C9CA 2OILA 1W7AA 3PCRB 1GRNA 2FPLA 2OCAA 3CPEA 3KXKA 1R5NA 2R8RA 3KJIA 2JLUA 2N46A 1ZJ6A 4MKFA 3C14C 5FTJA 1E1QD 1EK0A 2RHDA 2TMKA 3U3OA 1H65A 5FPKA 1XPOA 4Q1CA 1P5ZB 4FW9A 5HE9A 5JCPA 2CEAA 2CE2X 1NVXQ 1ZUHA 1Z06A 2WM9B 1VYUA 4EFMA 3K0EA 5EP3A 4JIMA 4C2TA 4A1FA 4DB4A 4X8HA 2NIPA 1F2TB 4N1AA 4JLPA 2WBLC 621PA 4QM6A 2AX4A 3VTKA 3ZJYA 1UF9A 3V4RA 3NWJA 5CM9C 2I3BA 3LXRA 3VFDA 4NPHA 3L43A 2JLQA 1Z0KA 2IS1A 1SKYB 4IOLA 5FFMA 1IXSB 1JB1A 2KSQA 4IFBA 4ITRC 3ICEA 2QMEA 1X3SA 3ZGXA 4JVNA 2YKGA 3NHBA 1YZLA 2QRZA 2R62A 4Q4LA 2GF9A 3FDIA 1G9XA 4AG5A 2W2XA 4LDJA 1WBBA 4PC6A 3CF2A 1FMJA 1OHHA 2R65A 4BUJA 2WWYA 1P2TA 2V8OA 1FQJA 4WXRA 4MRVA 4Q9KA 4LPKA 4BFVA 3TSOA 3EPHA 2WJGA 2JDIA 5A0FA 3FB4A 1DAMA 4RVCA 3QG5A 2QPTA 3OEHA 1OKKA 2KBEA 5K8IA 2IWHA 1R7RA 1LVGA 1ESNA 3FKSA 3TH5A 1NRJB 1E9SA 2ZRBA 2ZU6A 3CPHA 3GLFB 2BEKA 3QXSA 3HDTA 2IXFA 5KHOC 3D3QA 3KX2A 3RS0A 3NDBB 5EE9A 4G3XA 3NG1A 3MSXA 1I2MA 2ZI7A 1BYIA 4DLTA 4EJSB 2F43B 1WA5A 3EZ7A 1W0KA 1NIJA 1XCMA 3QUSA 4X8LA 5DISB 2A3RA 1CLUA 4G01B 4GT1A 1EGAA 4BZXA 4O3MA 4IOJA 4C0LA 3VQTA 3P1JA 2J59A 1P73A 3PJRA 1XTIA 1N6LA 3K9GA 4M9QA 4Q4AA 2IHYA 1ZRHA 2ZS9A 4PQRA 3UK6A 1KNQA 1G4UR 1Z6YA 1JPJA 3VR3A 2JIZD 5BXQC 4DCNA 3G0HA 3A1VA 2H8KA 3GLHB 3W3AA 3QE0A 1T5LA 1SVLA 1F48A 4QXAA 4XD7D 2XTZA 2KJQA 2OCBA 2FFHA 1DAGA 1GNQA 1XB2A 1FTSA 1KI3A 1ZAKA 3I3SR 3K0AA 4UXIA 4XWOA 4DVGA 4D4JA 2FFBA 1ZVQA 2I1QA 4IVQA 2RKOA 1T9HA 4BLRA 5FPHA 1ESMA 1J99A 1F3OA 4MDFA 5FBVB 3CWZA 1AS3A 4PO9A 1Q1QA 4BLPA 4UXHA 1RPZA 3GEEA 3HR7A 2PEYA 3PQCA 4F4JA 1ZC3A 4B3DA 1EX6A 2A5JA 1FW6A 4RD2A 2ZUBA 3MJRA 2R6AA 3KXLA 5DH9A 2P5SA 5DE3A 3HJNA 2BCGY 5FL7A 4B43A 1DPFA 1AIPA 3T1TA 4Q4JB 1CP2A 2P0EA 1LW7A 3QKTA 3ZH9B 1GAJA 3U2QA 2BOVA 1W36C 4TQUS 3IKJA 3RSOA 1FNNA 2X2EA 1E1RA 1NVVQ 1XEFA 4LJ4A 1YJ5A 4E07A 1QZXA 1G4AE 4UNQA 4QNMA 1XPRA 1TTTA 1P61B 5CDFE 4FMDB 3T1OA 2GBLC 2WJYA 3RYTC 1SHZA 3SJAA 2AHOA 5AR1A 4DCTA 1QF9A 4IDPA 2PCLA 3REFA 2NO6A 1F2UB 2IYVA 3ECCA 2A5GA 2IYRA 1X8JA 2HLDD 3AP2A 1SVOA 3IIMA 2BKEA 4QHTA 3K70B 4LGMA 2AKYA 3W6OA 5KO2A 3NKVA 3E5HA 5FOTA 4LY6A 3L0OA 1XD2B 3ASYA 5AJZA 3SJBA 3UMSA 1N3BA 1UBFA 3LQQA 4KXFB 3LVQE 4BZQA 2REBA 3VU9B 5FBWB 1P9NA 3B9PA 4OQNA 1UFQA 1TU4A 3U60B 3VKGA 2IUTA 4IDNA 2YC2C 4OKSA 4MGYR 4WOPA 2RGBA 3A36A 4RZ3A 1WDTA 2PL3A 3EZ6A 3L0IB 3MRSA 5JJIA 4TQ9A 2EYUA 1A2BA 3U3KA 3VHXA 1IN6A 3EG5A 5TARA 1NVUQ 3OAAD 4NYMQ 4A6XA 4L16A 1G7TA 2ZJYA 2LKCA 4GMDA 1N2CE 4EPRA 2GJ9A 1K5DA 1IY0A 5LB4A 4BWYA 4B76A 4JS0A 3UWOA 3C8UA 3RVBA 1KTVA 3AV0B 3LW7A 3WHLA 5FH9A 1FOEB 4YONB 3RRMA 2X77A 4ZDWA 2VLIA 3T06B 3TLXA 2CLCX 2OO7A 3B8HA 4W5JA 2HXSA 2WZQA 5EE0A 3TW8B 5H8WA 1EFUA 4ILEA 4L15A 3AF3A 3D31A 2J7PA 1KI8A 2PX0A 2VH5R 2CVFA 4LHZA 4N3NA 2N42A 1T6NA 3AQ4A 3TIFA 1B0UA 1A4RA 4M2LA 1J8YF 3QSYA 1W4CA 2JEOA 4B3GA 1R6BX 3BAFA 5AUOB 3MUFA 4HLUA 4MGZR 1SVMA 2NZJA 2ZYVX 4ZCMA 2ZU0C 4D0GA 2ZVQX 4YXWA 4JJZA 1G7RA 3U4QB 1WCV1 4FCVA 1R0YA 1XEWY 1N6HA 3BJIC 1WB9A 4DIEA 1KDPA 2BJVA 5J4YA 4C4PA 2UVQA 1YR9A 1NLFA 4JYCA 4EQ6A 2D62A 3DL0A 4HB2A 4KSBA 2ONJA 4M1TA 3AVYA 2IBMA 4E5UA 3K9LA 5HCNA 3LLMA 4UXJA 2J0UA 3W8RA 3F0TA 3ND9A 4ZKEA 3X1WA 5BN4A 3QQ5A 1W0JD 3AP1A 4IOKA 1P75A 3KL4A 3UANA 3K0FA 3U7FB 1BS1A 2H92A 1NL3A 3A58B 1JR3A 4UNPA 4B48A 1SXJB 2IXGA 4LV8B 3C16C 4DCVA 1G6OA 4NH0A 1UPTA 2G83A 5FBLB 3CF6R 1G3IA 1XMIA 2CMKA 1II0A 4JLOA 2QY9A 4LPSA 5J4VA 1VTKA 5TY0A 2OLKA 4RFSA 1VG0B 2FFQA 4DLRA 1S9HA 1J7KA 2OUKA 1U8ZA 2HYDA 3MWJA 5HKKA 2CLSA 1DOAA 1D8TA 2EFHB 1KKLA 5JI2E 1NP6A 1RRPA 1WE2A 2WOJA 3DDCA 4HUTA 1Q44A 4JLBA 4MRRA 2J3EA 1IN7A 2OHFA 1N5KA 5EP2A 2BMDA 1DVRA 1N25A 1BH2A 1E9AA 5FR1A 2GBLA 2BM1A 4ARZA 2QP4A 2R6DA 3T5GA 1AA9A 1XCPA 2CJWB 2VP5A 2PCJA 3RDPA 3K8YA 4I99A 5IK2D 3R9WA 3REGA 4X8OA 4CDGA 1OFTA 3I32A 1R8SA 2RH5A 1GITA 3MFYA 4NL4H 2XXAA 1RW4A 3R9XA 3QOFA 1E9EA 2IS2A 4IDOA 3W8NA 1FTNA 3LX5A 4B2PA 4LCBA 5JI3E 2J46A 5L8VA 3K53A 4C0SA 2H1LA 3LX8A 2F1IA 2IYTA 3TQCA 3J81k 1MV5A 4TL7A 1G7SA 1Z6XA 3NC1C 1FP7A 1XWIA 2J0VA 3PEVA 4PSKA 5AJVB 2Z4RA 1AS0A 1KKMA 1QHHB 5JJKA 1QVRA 2WJVA 3AKYA 1CIPA 2EFGA 1RRCA 1E9RA 1TQ2A 5GVRA 4M9ZA 3ZDQA 5KNCA 3FFAA 3R8FA 1OB5A 1ZBDA 1CR0A 1SKYE 2OZEA 4Q7MB 3PITA 2P5TB 3B5JA 5CB6A 1I4LD 3IDQA 1HT1E 4L5BA 2ODBA 1KSFX 4DZZA 2AWOA 1XU4A 4XVUA 3HYTA 3HWSA 4D4KA 3ND8A 1JQJC 3AF2A 1D2MA 4PSAA 1DAEA 4AYXA 3CX8A 2ZE7A 2LWIA 1DEKA 1JECA 1OXUA 1Z2CA 1US8A 4DEXA 2RGCA 2ZEJA 3B78A 3T12A 4CZ2A 4NMMA 1YZUA 1F60A 1E2NA 1G21E 2DYKA 3KTAB 4OQMA 3AVWA 1M6NA 3QBTA 1IN5A 3EPJA 1XTKA 3GLGA 4UJ5A 2OE2A 4BRUA 3GPLA 4Q4HA 5CYOA 3LAWA 2IWRA 2MMCA 4M0LA 3PUZA 4Q1FA 1KMHA 3QG1A 3QF7A 4US2R 4YQFA 1RKBA 1E32A 1YZGA 5DSZA 2CL0X 2HDNB 3RWMB 2ZYTX 1D5CA 3KKNA 4PZLA 3H86A 5BW8A 1G1MA 3CWQA 1SGWA 1IBRA 3SYNA 4DLYA 1M1YE 3WYFA 3GCGA 3HPRA 2IS6A 2HF9A 3DMDA 1W48A 2FOLA 4MITA 3DOEA 4GSYA 2ZSBA 5JRJA 2JLVA 1FX0A 4ON9A 1JAHA 1NBMA 2RGAA 2V7QA 3ZIAD 5GJBA 4P4TA 3TSZA 1NNEA 2ODNA 1ZINA 3NH9A 3TR5A 3A6PC 4TYPA 2EFCB 3GLHE 2GETA 2QAGB 2ODEA 4BFTA 4DT1B 5L3SA 5GADl 2W83A 1TX4B 4YMTA 2VQSA 2ZRDA 1MO6A 4QBIA 3U5ZB 3P4YA 2BMJA 4TYQA 1BO6A 2ERYA 4JLDA 3ZS9A 1VG9B 5BYJA 4ZKDA 3DPUA 4M1SA 2G77B 2QQEA 4Q00A 2P67A 1HUQA 2O8CA 2HF8A 3OE7A 5LD2B 1E9CA 3W6PA 4MDEA 1JEEA 3FHTA 3IIKA 2J1LA 3AVTA 2V1XA 2HT1A 2C98A 1CRPA 4ZDKA 4Q19A 4DLUA 1C9KA 3QJYA 4GNKA 1H8EA 1KSGA 4GMXA 2CXXA 1HV8A 4DJTA 3UPUA 2H5EA 2CNWD 2ORWA 3AGPA 3LY5A 2ZRIA 1IAQA 5EZ5A 1MABB 3TKLA 1BMFA 1G5TA 2YOFA 1BKDR 2FSGA 1OE0A 1TQ4A 4GZMA 1N0VC 3SYLA 1G6HA 3D7MA 1E0SA 1YHNA 1OJLA 5FOVA 1KK3A 2XXAB 3WY9A 2ZE6A 1XPUA 1U8AA 2DHRA 1TF2A 2DFKB 1EFHA 1P72A 1ZU5A 3SDZA 5E95A 2QMUA 3LO5A 4HAYA 2GWHA 1Q1BA 5H70A 4TLBA 1VHTA 1M7BA 4LJ5A 4LSGA 3ETLA 3WYAA 3BB1A 4AI6A 2HCBA 4AWXA 2V3CC 2DY1A 2XTNA 2LKDA 4LJ9A 4O25A 5EP4A 5FOUA 3C5HA 4PPNA 3OIUA 1II9A 4I4LA 3P26A 3KQLA 4P3YA 3X2SA 4B3FX 1E2HA 5FI1B 2AFHE 2XAUA 1LS1A 1C4OA 1U2RA 5GJVC 2D2EA 2W6ID 3DEFA 4JBYA 1IHUA 4HAVA 2IUSA 4JLKA 1KAOA 3GJ4A 2FN4A 3R7WB 1U90A 4EUNA 4PPFA 3Q5DA 3CH5A 2AXPA 5L3VA 2VF8A 3NEJA 4B3XA 1DS6A 1AN0A 5GJWC 4M1OA 4QM7A 4US0R 1XJQA 2EVWX 2ZRGA 4ABYA 5JWRA 3BH0A 1P4SA 3VNUA 1Y63A 1KDOA 2ZRHA 3K70C 4LBZA 2YOGA 4Z8XA 1D2NA 1N6KA 3THWA 3W9YA 3KQKA 1U94A 4XTCS 2CCJA 2YJTD 4KYUA 3SJZA 1UDWA 4B6FA 5DN6D 1S4QA 2WSSD 3FKQA 3W5IA 2G3YA 1Z0IA 3AVPA 3M6AA 1KDRA 5J4KA 1DADA 2WHXA 4OJQA 1LB1B 4NCNA 3PEYA 2QTHA 1ZYUA 3UXMA 2HV8A 3QEOA 5G3ZA 1G3QA 1E0JA 2AK3A 2F55A 2FGKA 3LA6A 4C0JA 4QGGA 2C5LA 4QHSA 2DBYA 4TT3A 2JJ1D 3BWDD 2XSZA 3WBJA 4P4SB 1G3UA 1RRFA 4Q01A 1GRQA 4FMDF 2QL6A 5G40A 1RVDA 3AKEA 5F98A 2RGGA 4OI0A 1OIXA 421PA 2GF0A 4Q18A 2EU8A 1P6XA 4IEIA 3QNUA 3QENA 4LOAA 3PEWA 5B2ZA 2GRJA 4Q9JA 5FOWA 2FDCA 4DB2A 3DKPA 2IYWA 4URWR 4P31A 3GEHA 4A9AA 3Q7PA 3QKRA 2QNRA 5L3SB 3L0SA 1DAIA 5SZIA 1UEIA 1X8LA 2VP0A 4JT4A 3WXMA 1AK2A 4II7A 2P6RA 2IYYA 4ERNA 1Z07A 3CNOA 2C77A 1UAAA 2Z5FA 5G53C 4US1R 3B1VA 3MG9A 4NYJQ 4U02A 4AIIA 1HURA 3THXA 1WBDA 2GEVA 4PSVA 1X1SA 4WVFA 2O8CB 3EAQA 1QHNA 4A8JC 1R5OA 2J0QA 3I5XA 5CITA 3NH6A 1II8B 4KU4A 2XZOA 1COWA 3N2EA 1SXJE 1VIYA 3SJCA 2P2LA 3OFND 4A4DA 3WYGA 2BJWA 4LJ6A 4D82A 2C78A 3ZLJA 1E2QA 1XDBA 2QPOA 3EA0A 4JL6A 1AS2A 1Z0DA 2Q3FA 2W6JD 4EPYA 5K8UA 1GSIA 3BC1A 3F8TA 4ZCLA 3WP1B 4BLQA 3QI2A 2DCUA 2H17A 4CEIB 1T3HA 1P2UA 2QA5A 4D6PA 4IEEA 3I8XA 3GLIA 3QKUA 1DG3A 2FF7A 2JASA 2WKPA 1KYIA 3EWAA 4Q1BA 5SZJA 3RAPR 2NG1A 2ZSDA 4PHHA 2A30A 3BE4A 3ADCA 2NO7A 4PPQA 3VR1A 1KO7A 1XEWX 1CJUC 1PUIA 2WIBA 1OB2A 5HZHA 4OQFA 2ZXUA 2GESA 4RJLA 3AP3A 4OK3A 3TAUA 3B6EA 2BIFA 4QJ3A 3FMOB 4IRUB 1CJMA 2F9MA 2BC9A 2XB4A 1Q0UA 4CT5A 2QROA 4DDTA 1ZIOA 2UZIR 3QBVA 1QHIA 2ZJ8A 3K70D 2QTVB 2AR7A 1KGDA 2BEJA 2Z0MA 3HR8A 1U0HC 2QORA 2QENA 1X86B 3LLUA 1WXQA 4C0QC 2DFLA 1KO8A 3WMGA 2QBYA 4V0NA 1MR3F 1KO1A 1E1QA 5AJWA 1ZU4A 1Y3AA 2RAPA 3ZZUA 4EPVA 1YE8A 4B44A 5IF9A 2WJJA 3ZZ0A 1GKYA 2FA9A 2IYXA 3KJHA 2H7VA 2RMKA 1Z63A 4PX9A 4A0FA 3I73A 3ZQJA 1S2MA 4TYYA 3K1JA 4C0KA 2FSHA 1MRSA 1W47A 2FGJA 2OBNA 2W2TA 3THWB 4MH0R 5CIQA 2O8DA 3BH6A 2B8TA 1OHHD 1XTRA 5F2EA 4MQBA 2WOOA 5AUQA 4IOMA 1S8FA 1ZW6A 2JDID 1KJZA 4Z1MD 4HLQB 2V6JA 4Q5IA 2A78A 4LZZA 3OEHD 3CB4A 1JQLB 5FR2A 3FKSD 4XVRA 2JJ2A 2A5DA 2PMDA 3GJ6A 4CEJA 4KLZA 4B35A 5H68A 4ZIRA 4A0GA 2NOAA 4QKQA 5KPJA 2YWFA 2ANCA 4TMVA 5DYGA 2BDTA 4IJMA 1IJFA 1D9ZA 3O8DA 1WF3A 1NMZA 1XXHA 4L8GA 4R7ZA 4BEJA 3MLEA 4I1UA 3CRRA 4M1MA 3WMEA 1W0KD 2VPPA 3FGNA 3B2EA 4QBHA 3H4MA 4OYHA 4WXPA 3T35A 2GXAA 2YHSA 3CZPA 5EJEA 1HT2E 4Y0AA 4M8NE 3FE2A 4YDHB 5FPSA 5IRCD 2IK8A 1N0UA 4JLMA 2C99A 4PHGA 3KKQA 4QBFA 2Z83A 5BYKA 4IDHA 2YWEA 2ZRPA 4A15A 1JXMA 3V9PA 2ZJOA 4GOJA 3BFXA 5EUQB 3OEED 4MKGA 2HXYA 1ZD8A 4Q21A 5D3MA 4ACAA 5KSZA 1ZD9A 1XMVA 2GVDC 5EXTA 5L3QA 2UZ3A 4LJAA 4HUQA 2ZI3A 3BBPA 1ETUA 3FVQA 3FOZA 4AYTA 1E9DA 2AN9A 1QBKC 3NIBA 4A8JA 4JVMA 1UKZA 1QG4A 3CUEF 4AKHA 1VG8A 3C41J 3MD0A 1T5IA 3U44B 3UIEA 4QOSA 1KY2A 4DLWA 2OCPA 4D0NA 4EFNA 3CF0A 1N6OA 1E98A 2N1BA 4OI2A 2JIZA 1G64A 2BMFA 1J8MF 1KI6B 1KOFA 1SXJD 3B85A 4LJ7A 3VHLB 2G0TA 4DXAA 3L8YA 821PA 1UEJA 4XD7A 4DLXA 2KWIA 5JHHB 2IHBA 1NMYA 1SKQA 3L2OB 3K0SA 5TB5A 4HAWA 4GBMA 2C03A 2A5YB 1KI2A 1HA3A 2O5VA 2OESA 4Q47A 4U00A 4URVR 2REXB 3QF4B 4KFRA 4FMCB 4Q03A 2J45A 2Q6TA 4LHVA 1U9IA 5FUXA 4PFSA 4DUGD 2QAGC 1UKEA 1E1RD 3TE6A 4KSCA 5GJCA 1DO0A 4DDWA 3TAHA 4OL0A 4TLAA 1GWNA 1XJ0A 1UADA 4BFXA 2QGZA 4YMWA 4G5QA 5B30A 3AKCA 2VP9A 1Z2AA 2OXRA 1YQTA 1QG2A 4WZBE 3R20A 2FSIA 1KDTA 3L82B 3W5JA 2C96A 4HZUA 4PPGA 4V0ME 1U99A 3A1TA 1KHTA 3K0CC 1O3YA 2QGNA 4PXAA 2ZI4A 5BN5A 3P32A 4BFSA 4F4CA 1JALA 1A1VA 4JKYA 4Y0VA 3UG6A 1XZQA 5KOYA 3VMFA 2YZ2A 4NE2A 2IXEA 1ZM2A 3AF4A 4V02A 2H57A 4RD4A 4TQAA 5FOSA 4CGZA 1Z28A 3TUJC 2JAQA 2EW1A 3OZXA 4TZ6A 2HLDA 4IVPA 4PHTA 3CO5A 4BFYA 4J0QA 1M7GA 1XZPA 1W5SA 4C7OA 4HATA 3IEVA 3PFIA 3SQWA 1NN0A 1LFDB 3SS8A 4NTZA 4EDHA 4B2IA 1N0WA 2FEOA 3LRPA 1W44A 4TLEA 1P9WA 1YRBA 5FTMA 2VSOA 4M1WA 4C2UA 1ODFA 1OT3A 2NPIA 3LW8A 4JBXA 1E2LA 2NPFA 3TVDA 1JI0A 2GCOA 4UKDA 5DLQC 1NKSA 3W34A 2OAQ1 4MGIR 1NLYA 1UBCA 2O0HA 1VHLA 2PZEA 2ZREA 3JVVA 3KKOA 4QGAA 3GMTA 2CBZA 4F93B 1NI3A 3A8TA 3GFTA 5DI3A 3WP0A 5DYIA 1W5TA 2PZGA 2O8FA 2PZFA 3BGWA 4Q4AB 2B7BA 1CKEA 5IHPA 1EWQA 1VCMA 4XH9B 1U0JA 1SQ5A 1XJCA 4D26A 4WZ6A 3TUIC 3X1XA 3RRYA 2XITA 2G1KA 3MCAA 3Q9LA 2ZR7A 1UM8A 5DIFA 3A1SA 1XNJA 4TTRA 4HAZA 4RCYA 1P2VA 4S2EA 1TU3A 4LYJA 4HUQB 3KJGA 4KBFA 4RZUA 2ZS7A 1Z0AA 3K0AB 2UKDA 1Q21A 4WZAE 1NJGA 1K6MA 2IYLD 5A4JA 1W2HA 4N0DA 4BLOA 5JZVA 4KFSA 3U3RA 1NIPA 2B6HA 2EWVA 4JL8A 4KODA 2XJ4A 4YC7A 3SFVA 3DMNA 3Q7QA 4UNRA 4B3BA 5AUPB 3JZMA 3FTQA 3BOSA 2FU5C 1JR3D 2V55B 5LDDC 2ZI5A 5EXXA 2F7SA 1G8FA 1OV4A 3CPJB 3EIHA 5J40A 1Z0FA 2CHGA 2GXQA 3IO3A 5BQ5A 5JSZA 2QMHA 2GDJA 3CM0A 3K9HA 3TBKA 1KMQA 4P33A 1W0JA 3TJZA 3LD9A 5DNYB 3LH5A 1G8YA 1WP9A 2EFEB 1FMLA 4CRWB 4CEHA 4BGDA 1Z29A 1R10A 5KPDA 4BQSA 1KSJA 1KK2A 2QE7A 3RC3A 4OHWA 1MO3A 3KB1A 3X1YA 3PENA 2WWWA 4MYCA 2GA8A 5KUTA 2Q9BA 2OBMA 4BECA 1AJEA 3U6KA 1BOFA 3B1XA 1P3JA 4DSOA 5KSOA 2R2AA 2PBRA 5HZKA 4HDQB 2QPAA 3I72A 2WAXA 3DZDA 1XD9A 2EFDB 1YR6A 1Q12A 1AKYA 4ZDIA 4LV5B 4M21A 1MH1A 4PC3A 4B73A 1PLLA 3QIAA 2IF2A 1KAGA 2PX3A 3WNDA 2GEUA 3K0CA 4GPTA 2AD1A 2BVNA 2ZITA 2YV5A 1Z6AA 1W46A 5ANRB 4DCUA 3SHWA 1JJ7A 2MSEB 3LQRA 1EFCA 4V0OA 4QC2A 4EAQA 4JYBA 4UJ3A 1OPXA 1XMSA 3ZD6A 3Q72A 3SBDA 3AUXA 2JA1A 2ZUCA 3NBXX 4IDQA 5EUMA 1IJEA 5CDFA 3BXZA 1WMSA 5JEEA 4C7OB 4XTRA 2O8BA 1P9RA 4OI1A 1TNDA 2DPXA 4IKEA 1E96A 4HYYA 1LNZA 1Z83A 3B7GA 3CKLA 3BORA 1G8PA 2QTFA 1X1RA 1JBKA 1ZP6A 1EFTA 1N5JA 1G41A 3RLFA 3FFBA 4ZPXA 4ZV4A 1KZGB 1IY2A 1ZC4A 2PLRA 2V9PA 2FG5A 2ODWA 3GJXC 3LBHA 3OF5A 1SHKA 2ZRKA 4BASA 4C0AC 1Z08A 3M4YA 4M1YA 1L4UA 4ZI2A 4LX0A 2Q9CA 4A2QA 2QU8A 3BD9A 4G5GA 3EZFA 4RD0A 4RZXA 4Q9IA 4XIGS 4C9BA 1Z5ZA 5KYKA 1OXTA 3GJ8A 3SNHA 2JGNA 1ZCBA 1EG7A 1G291 4NCHA 1CBUA 4IXMA 3SC3A 3A37A 3GLFE 2ASEA 1OW3B 2B92A 3QVUA 5DHFA 3CNLA 3TW4A 4LHXA 4BE7B 1VYVA 2YOHA 3CR7A 1HEIA 2KBFA 2RGNC 1S0UA 2ERXA 4RFVA 2FPMA 1OH5A 1MRNA 4EQ6B 4B6EA 1IY1A 4TTPA 1IQPA 3M0EA 3AVVA 1K8RA 1Q57A 3QPVA 4NDZA 1KI7A 4Q9LA 2H18A 1KO5A 221PA 3JZAA 3N2IA 3HYRA 1YR8A 2J0UB 3RS7A 4D2IA 4URUR 5FBQB 4Q7KA 1YZKA 2GZDA 1Z3IX 1NBMD 2IW3A 2V7QD 3EIEA 521PA 1K5GA 1RYHA 3C5CA 2R6CA 3VR6A 4AD8A 3K0FB 2ZYUX 4KBGA 4RKEA 1TF7A 2RCNA 4PZZA 5FPYA 5G3YA 1P62B 5EE5B 5CK5A 3FMFA 4RZ2A 1OFIA 4TL9A 3AGQA 3B9QA 4JLVA 4BLSA 4B71A 5FUVA 1VIAA 2ZYWX 2CCKA 3BB4A 121PA 3SE0A 2BWJA 4KHZA 2GJKA 2VHTA 2ZR0A 1YZQA 1NN3A 5CM8B 1KSHA 1QHXA 4DIDA 6Q21A 3WBKA 3TK1A 4EJSC 1T3LA 1DAFA 4QJ5A 1QVAA 4LJYA 1S9DA 2HJGA 3ZIAA 2Q21A 2NO0A 2R6GA 4URXR 4RFSB 3BK7A 1OXVA 1R5BA 4FIDA 4KYIB 4F92B 4OK6A 3L8ZA 4DWJA 1T8TA 3OE7D 4NBSA 3GJ0A 1L8QA 3PR1A 2V6IA 1HE8B 2NZ8A 2HEIA 4TLDA 2WTUA 1A5TA 5FOXA 4LJ8A 5C4GB 4CT4B 3HP1A 2XNDD 4D4MA 1XD8A 1EXMA 2GXUA 3D8BA 3LV8A 4HB4A 1BIFA 1EFRD 1SVSA 4BEBA 2GVZC 5FUWA 1PLJA 2PT7A 3PUVA 1H8HD 4DLZA 2QZ4A 3FHOA 4ARZB 3T1VA 2IA5A 1ZM7A 1G3MA 3DM5A 1N6PA 1MKYA 1S96A 4LYHA 1GL9B 4HZIA 1FFHA 2GHIA 4TLCA 2G9NA 3RWOA 1TAGA 3I8SA 1RC8A 3GD7A 4UNNA 4EKDA 4URZR 3K09C 3NBZC 4Q48A 3RNLA 1ZNZA 4Z54A 1DARA 3WNBA 2WWFA 3DOFA 2FNAA 3BB3A 4WBSA 1P60A 2ZTSA 1X8KA 1Q3TA 2V54A 1PJRA 2CNWA 2XOKD 2OT3B 2BBSA 2XTMA 1R0WA 3B13B 5E7JA 4CF7A 2HCJB 3RS2A 1RFLA 3W6NA 4RY2A 3W3ZB 1Z47A 4MUBA 2QM7A 4A2WA 3CR8A 3NXSA 1T0HB 1TUIA 4I1OA 2NQ2C 2JATA 1AKEA 3EXAA 3SU8A 2CDNA 2ONKA 1W1WA 4YMUA 4P4UA 4L9SA 1FL9A 1G19A 2GCNA 2ZRFA 2RB4A 2NO1A 1AQYA 1P7CA 4HSEA 1GDDA 3LFUA 5C46F 3C4JA 3KFVA 4YDSA 3BFVA 2Z43A 1S3GA 2G1JA 2A9KA 5JS8A 1ELOA 3FMIA 5M04A 3OIYA 4TZ0A 3CX6A 1PV4A 3PG5A 4PAQA 3EPLA 1US8B 4NCIA 2XZPA 4DLVA 5AK0A 5C1BA 2ZRJA 2CL7X 1LY1A 2QSZA 3A4NA 3QKSA 4JSTA 4L9WA 2HYIC 1VCNA 4KVGA 1G16A 4R9UC 3GLGB 2W6IA 4MYHA 1QHYA 3U3MA 2JLSA 2QP9X 2VO1A 4Q4HB 2GEDA 3RRNA 1VMAA 1E79D 3FMPB 1GNRA 1U98A 1W4BA 3H1TA 1AZSC 1T4GA 1KMHB 1CJKC 5H1YA 4W7SA 2XX3A 2VA8A 2QRNA 4TSFD 4A92A 2RGNA 2D2FA 1FUKA 1U81A 2OAP1 1MO4A 3GQBA 3IIJA 4KCGA 4D80A 5KSPA 1NG1A 4D25A 2PEZA 3C15C 4JKIA 2GZAA 4PZYA 1HYQA 4OK5A 1G7CA 4KITB 5CLQA 4O0MA 2G88A 4RKFA 1FX0B 3DKVA 1HQYE 4A36A 1OYYA 3IEUA 2DWQA 2GJAA 2VL7A 3HU3A 1I4TD 2BMEA 5CK4A 4R98A 4Q1DA 3P20A 1E4VA 1GL7A 4K8OA 3VNVA 4IXNA 1E2PA 2NMVA 4MKHA 1ZM4A 1S1CA 4DDVA 1AGRA 1N6NA 3SOPA 3JVUA 1ZUIA 1GM5A 4ASUA 1CJVC 3BFKA 1KK0A 2CK3D 2GK7A 2JJ1A 3CZQA 2BHRA 3QY0A 1IXZA 2RGEA 1HTWA 3LVRE 4NYIR 1G8GA 3SEAA 3NEYA 2F43A 4EJSA 1YVDA 1E6CA 3ASZA 3LBNA 3KXIA 1Q20A 1KZ7B 4QFMA 2VHJA 3CBQA 1KIMA 2PJZA 3RANA 1Z6TA 2IYQA 3IPXA 3IBYA 1R2QA 1Z22A 1D9XA 1UKVY 5CJ2A 3OESA 2GILA 3I4LA 4R71A 2WPDD 3CRVA 1NSTA 2NGRA 4QL3A 1NLZA 2ECKA 4V0KA 4AKIA 2VSFA 2SHKA 2WAYA 3D6TB 1AZTA 4MA4A 4NU0A 1GILA 3GLHA 1E0AA 3AVQA 2OXCA 2ZJ2A 2KE5A 1E4YA 3V00A 3NTUA 1SVWA 3NDPA 3UATA 3OFNA 3WRYC 2Z4SA 3WHKA 3K09A 5DO9A 4PQFA 3WNCA 2AWNA 2F9LA 5KDDA 3CIOA 4TL8A 3VAAA 3EZ9A 4NONA 2MMGA 1SXJC 4LV6A 3R8CA 1R8QA 3CRW1 1ZUNB 1RE0A 2QG6A 4JLNA 4LK2A 2FE4A 2D74A 2H16A 1XP8A 2X19A 4ZI3A 4HAXA 4F4IA 4DHEA 3THYA 2ZRLA 5SZHB 2ZE5A 4TWZA 4JL5A 5DI9A 4Q7LA 3CW2A 3UKDA 2FH5B 2ZSEA 2GCPA 4Q4JA 3R9IA 1S3SA 2BBTA 1J70A 1D6JA 2CCGA 2XJ9A 3Q8XB 5J4HA 2R9VA 3HU1A 3RHFA 4Q1EA 1WRBA 4B75A 2X8AA 3PVSA 2FV8A 2GJSA 2MSDB 4HLDA 2OSBA 4G5RA 2ZI9A 3V4FA 4LHWA 2IEYA 5IDVA 1GFIA 2V4ZA 2FSFA 3DVLA 3PEUA 4BPBA 4C0BA 4MRPA 3QXXA 2JLXA 3TGPA 1OXXK 1VDZA 3LDAA 3DZ8A 3TMKA 4DCSA 1CJTC 1F2UA 1SZPA 3QKSB 5AWFC 4AK9A 4MUAA 3KQNA 2AKAB 1G5PA 1LV7A 4B47A 4HI0E 2OV2A 1I4DD 4QGFA 3KQHA 4G0NA 1NJFA 1XD2A 2ZROA 1OIVA 5E7IA 3ZD7A 4I81A 1G20E 2P3SA 3VU9A 1OSNA 3KUDA 5CIWA 1OKKD 1GNPA 4XSHA 2ZR9A 2DR3A 1IONA 2JJ2D 1E2KA 1LTQA 1FZQA 5J4LA 1E9FA 4MYTA 3I61A 4MGKR 2RGDA 3ZS8A 4PO1A 4TYWA 3EZ2A 1NMXA 4D4LA 5JRZA 1NKTA 1TL7C 4O2LA 4FWTA 1JPNA 3L0PA 1DTSA 3IQWA 4Z1MA 3WRXC 4POAA 1W2GA 3IO5A 5KDLA 1NN5A 4N0EA 2AFIE 3NVAA 4LWZA 3ZYCA 1N5LA 4LHYA 2WICA 2FWRA 4AC9A 1S1MA 4GOXA 3ZVNA 3QKRB 1T91A 2ZAOA 4IVRA 3VR4A 3FPAA 4LBWA 5JCZA 4UNSA 2WVJA 4GI7A 2FZLA 4JVSB 1UBGA 3ZVRA 3U7HB 4QBGB 5EZ6B 4HLUC 4ZDJA 4P0TA 4DSUA 3IPYA 3THXB 3NBFA 4WW0A 1NY6A 4FCTA 4RSGA 4GDFA 3U4QA 1JR3E 1NVVR 3RC8A 2VP2A 1MOZA 2NTYC 2ATVA 2A2ZA 3BS4A 4KFTA 1GOTA 4MRNA 1IM2A 4XSGA 1KY3A 5TV2A 1TQDA 4NCJA 3CONA 1RJ9A 1XEXA 4Q9HA 4DDUA 2CVHA 4NZYA 4NHOA 2IC5A 5C18A 3OEEA 4LYFA 2JLYA 2XZLA 3QXHA 2EYQA 3E1SA 1E2JA 3X1ZA 2JJ8A 1ZNYA 3CRMA 5FI0B 3U3JA 3LXXA 3CNNA 2XNSA 2EWWA 4MKIA 1UDXA 1A2KC 4JVLA 1GKUB 1OFUX 3SFZA 2Z6VA 5FL7D 3GLIB 3EIQA 4BZPA 4OQXA 1GIAA 3SQXA 1AM4D 4GOKA 1RIFA 2HT6A 4H1UA 5E7MA 3WMFA 2ZJ5A 4YLGA 1UKYA 4WA7A 2BBWA 4DEYA 4NCKA 3PUXA 2QT0A 1SXJA 4XJXA 3TUZC 3U7EB 1JAIA 3E2IA 4NYMR 1CRQA 3KDSE 1J90A 5CYPA 4GZLA 1XBTA 4NP6A 4C30A 3THYB 2QEQA 2YYZA 4A82A 1F6BA 5F9HA 3NHAA 3BIFA 4DBLC 4PAOA 5JWHA 1CULC 5LD2C 4BLTA 3GJ3A 3HU2A 2Q3HA 1ZD1A 3NBYC 4XVQA 1XTQA 2DFTA 2AD5A 2W0MA 4FCWA 4DUGA 2D06A 2NO9A 4B3CA 4JZKA 1E2DA 2QBYB 3QXCA 2WV9A 1OF1A 2PLFA 3EA5A 5JS7A 4FN5A 4W5HA 4OHZA 1I2DA 4RCZA 1IXRC 1LF5A 2F1JA 2GK6A 3K9NA 4TMXA 2F1HA 3Q3JB 4GL2A 4MYUA 5FPTA 1E94E 1TADA 1DAHA 2ZJBA 5FTNA 4A0RA 3LBIA 1HE1C 2YC4C 2CHQA 3SYKA 1J2JA 2CJWA 3Q85A 3GP8A 2O8DB 1TUEA 1IN4A 5ELXA 4ESHA 4DC9A 1CR2A 4ESVA 1KK1A 1KJWA 1T8UA 3AKDA 4LYAA 4DRZA 5IT5A 2VSXA 2WWXA 3MJHA 3KZ1E 2J0SA 1IN8A 3O8CA 4ZCIA 3N5CA 5TDHA 2ZI6A 1M7HA 3KB2A 4CEJB 4JLJA 4HB3A 1QRAA 4ZIRB 2DFNA 2B8WA 3GLGE 1JJVA 3LNCA 3S1AA 1MT0A 5AUNB 3B1WA 1QHHA 2J7PD 1XXHB 3OAAA 5AJYA 1R4AA 4G1UC 3I92A 3KUCA 2BBOA 4M4SA 1B23P 1U8YA 3MMPA 1O87A 4AKGA 2ZJAA 2D7DA 2Q9AA 4M1KA 1E99A 1Z8FA 1AQUA 1C1YA 3PUYA 4URYR 1QHSA 4YXWD 3KKPA 3IUYA 3DO6A 3VR2A 5B57C 1E9BA 4W5WA 2QP3A 5BWMA 4BRWA 1DBSA 2QI9C 4KFUA 4L4UA 4LBYA 1Z0JA 2CLDX 4EPTA 2F3RA 2ZQ5A 1NBME 4D0LB 3U7GA 5D3MB 3GJ7A 3KTAA 2WMNB 1ZM3A 1DO2A 5EXPA 2KI5A 5L3QB 2ZRAA 5J5CA 1OLOA 4E03A 4DLSA 1A7JA 1R0XA 2D4HA 5JFGA 4A8JB 1ZIPA 4V03A 4TTQA 1KNXA 3ICQB 3B60A 2B7CA 3BH7A 1RJ9B 1XEXB 1NG9A 2WJIA 4FXPA 4JT2A 4HDOB 2ZPTX 3RS5A 3QPUA 2WJHA 3IGFA 1D2EA 1OIWA 4I1SA 2IS4A 2RGXA 4C0HA 5TXGA 2QM8A 5GVSA 1Q22A 4S35A 2XGJA 4LBVA 3AB3A 2Y8EA 5LBIA 3SI7A 1VCIA 4TL6A 2BV3A 2ZSFA 3RABA 3AF0A 4CW7A 1A82A 2F6RA 1DG1G 4B34A 5E3HA 2ZRMA 1RYFA 4C3ZA 5EQTA 2BM0A 4PC1A 3AM1A 1R0ZA 2QE7D 5HKKD 5JWOA 4H9GA 5UKDA 2C95A 2W0SA 2OFWA 5HTKA 1W36D 1G5RA 1VYTA 2OEPA 2QAGA 2REOA 1E2IA 3A4LA 3ADKA 5TVKA 4DT1A 4DKXA 2RHMA 4R2HA 5P21A 1UJ2A 3B82A 1XRJA 3FYHA 5B64A 5K8LA 1M8PA 1YZTA 2GJ8A 2J5XA 2XEXA 2PJRA 2GZHA 2YVUA 1CF4A 4FI3C 2F1RA 2VHUA 4Q02A 4QGHA 1L7VC 1ZM9A 5EP1A 2ZRNA 5CLLA 5CJPA 2IYSA 3QVVA 4HZUB 1DELA 3BERA 1TQ6A 2ZAMA 3CRQA 2IX3A 1LS6A 2ORVA 2VEDA 4K46A 3SR0A 1RRGA 2CL6X 1N6IA 3TNFA 3ZQ6A 2G0NA 4FWIB 3H2YA 1Z6GA 1P2SA 2WWHA 1CTQA 3T34A 2ZVPX 2YINC 2FJUA 4KV9A 4G5SA 1MABA 3AUYA 1NSFA 4TMTA 2IYZA 2ZRCA 3PV0A 4Q66C 4HDCA 5IK2A 4U5XA 2E9SA 4WAUA 2IEZA 1DE0A 1M34E 1W4RA 1FNMA 2VYFA 3P4XA 4JSYA 3A4MA 3PIRA 2ZM5A 2OBLA 3MWLA 2O8EA 4B74A 1TMKA 2P6UA 4V0MA 2FPKA 5C2JB 2E87A 1MO5A 2IF0A 1VPLA 4ZO4A 3T15A 4BFZA 1NF3A 1G8HA
chains in the Genus database with same CATH superfamily
1K9VF 4IHJA 1F8GA 2B9EA 1ZD3A 3TE7A 4TMZA 1VLMA 2XA2A 3S1AB 2QVLA 2P2CA 3QX3A 3OJLA 2X2FA 2NYRA 3H7IA 3K9WA 2X58A 5LWHA 2ID9A 3U49A 3H05A 4KP7A 2C9OA 3PXGA 2RBEA 2TRSB 1VG1A 4PANA 1RXUA 1ZFNA 4W9NC 4NX2A 1XFAA 3M83A 4Q0MA 3S6JA 1CR4A 2J9YB 3OIWA 5IVIA 1Z33A 1U5AA 1YU9A 2ATIA 2PH1A 4N18A 3MS4A 3GD5A 4EHDA 4D9KA 1ECBA 3OCYA 1J7JA 3ODPA 3IFSA 4MAMA 4CQNA 4B84A 2P40A 2O9JA 5F4ZA 3BHNA 4GWGA 2QUZA 3HMKA 4JUAA 5EG5A 5THKA 1NQAO 2ZOSA 5IS2A 2ORED 1BRMA 3CF4A 2B8JA 4JEMA 3UJAA 4AG3A 3A4YA 2VATA 3AY6A 4I1VA 1SK8A 2RHGB 4F11A 4ACBA 3IA2A 4JOQA 4BO7A 5J23A 4ILKA 4P32A 3GG9A 4GRAA 3SLKA 4YPOA 3ASVA 4P4GA 5LB2A 2QVCA 3MNFA 4PCUA 2WM2A 1I3CA 4OHXA 3WB0A 2P6NA 2HIHA 1M2OA 4KJZA 1FDUA 4OYRA 5PGMA 4A26A 4JOSA 4EWLA 1N78A 3NFYA 4TZTA 1BD4A 5K7SA 2NVOA 2YY7A 1F8YA 4RLSA 4F93B 4NAVA 4HDRA 1SUBA 5LYJA 1Y7HA 4X9XA 2F8LA 2GZ1A 3PA8A 1U3DA 1XZKA 3U7JA 2D1TA 3OHPA 1FTGA 2GPYA 1PVOA 4KNVA 1G66A 1A96A 4BMZA 2HUPA 4BQOA 3DYIA 4BNUA 4Z4FA 4FUQA 3SZGA 3DFMA 3E5NA 3UMRA 1DX6A 5JS6A 1KJIA 2HCRA 1ZS9A 4OB8A 2J87A 4P4SA 4PG7A 3R8XA 721PA 3GFOA 4KQXA 6ABPA 3TF5A 3Q3VA 4EG7A 4M22A 2HRRA 3JPYA 3U6BA 4I4TF 1NM5A 2DM6A 1BHJA 1DXHA 1OXKB 1C9NA 1H1DA 3FUWA 1NVWQ 1EUCB 4C03A 3ZDDA 4OI4A 3ZZTA 1QGED 1NN1A 3CLVA 3RS3A 1GAQA 1JJBA 2HIAA 1QV6A 2WUEA 4UM8B 5CCDA 1UMKA 5HR5A 1ZJWA 1BQEA 3I09A 3OQHA 5SZKB 4EIWA 1W36B 1BU8A 3ANYB 1MIHA 4QD3A 3T1QA 2GKSA 1H8ED 3CH6A 4L6AA 4TN1A 4GXNA 5LP6B 1GG2A 2ZUDA 3HA7A 4M54A 1DMSA 2J31A 4CETA 3OZAA 4QUDA 3FLAA 4DMKA 2HWUA 3IQHX 1GXSB 3T3PB 1PV1A 3NEPX 1SC6A 4OHVA 2ET6A 4I50F 4B2YA 1BMFD 1GT6A 4CQLA 3I5MA 3II6X 4DSNA 3FOFC 2OGSA 3NMUF 2GBGA 1EE1A 4CF4A 2XXJA 1L5GB 3ZLVA 1J00A 4KGDA 5ELMA 4UBIA 4Y7DA 3EXG2 4ZA2A 2IPXA 3S1SA 5KX5A 2GSDA 1AN9A 2Q4OA 1T1IA 1L4YA 1GUAA 1O2DA 1O96A 1TPZA 3ABIA 2X1VA 3AG6A 1B26A 4XIIA 1EUDA 4YRAA 4MHOA 1DKRA 4JA2A 4WLVA 4RKQA 5AI8A 2DWOA 2QT1A 3AIMA 1H8HA 2OCYC 3HABA 4R0NA 5EFOA 2SECE 2WHPA 3GXBA 3SZLA 2EL9A 2BKUA 3RV4A 1EFAA 5HPYB 3NHUA 5JLJA 2AZMA 4XWAA 1V1MB 1A9XA 4BY9E 4CEIA 3UG7A 3IVRA 5E4FA 4C14A 2OQ2A 4YV7A 2ZBFA 3AF1A 1CB7A 1CS0A 3TRIA 1NFFA 3AEZA 4H0CA 3DZBA 1FUIA 2JAOA 3P2JA 4HY3A 4KWCA 1G2IA 2UUAB 3RTAA 2QN6A 1DJQA 3C7KA 3A14A 4DNPA 4FGLA 3HUFA 2CFIA 3DZGA 3FSJX 4NEGA 3X1DA 1GGFA 4EGAA 4F96A 4NSNA 3B6JA 1YNSA 1NQVA 3LWNA 3HP4A 4V39A 4LRYA 3TVTA 3OOHA 1Q1EA 1C50A 3M8KA 5CB8A 2B1GA 2D2VA 4M49A 1JTVA 1VSVA 4MW6A 2ZSAA 1A0OA 1I01A 4RMJA 2YHUA 3AWDA 2QQ0A 4JLAA 1DEHA 3H11A 4BU1A 3T7KA 3ROZA 5I9IA 3PZRA 3ZQ4A 5AKIA 1PD1A 3T5TA 4EVSA 3IBGA 3P0EA 2ABWA 1N9GB 1LJ8A 3O7MA 3VYSB 2GN6A 4ZI7B 5ICSA 2CLEB 4F38A 3UMFA 5AESA 2CDCA 4PQYA 5B58C 1XN4A 2Q6OA 2X4GA 2NU6A 3KFXA 3RUDA 1QU3A 5DXAA 4RAQA 3LRTA 4FMCF 2A4KA 4NYJR 1SVIA 3HFJA 4MGHA 3V4LA 1EXDA 3OSZA 2D7CA 2NVUB 1RMQA 4FHFA 3WDMA 3V8MA 4RD1A 4TXNA 1GCIA 4K1XA 4BU0A 2OM6A 4FGJA 4CMCA 2PSJA 4YMVA 5JJLA 1UH5A 3FCXA 2HIGA 1KZ1A 1E3MA 3AOEC 4JYMA 2O3TA 1M2OB 1U0RA 3RHTA 4DC1A 4DJJA 1E79A 4HNTA 2F62A 3MGCA 2A94A 4UTNA 4DCCA 2HK7A 5ERXA 1NBAA 3VX4A 5BVHA 4MKXA 3KKLA 4HDRB 5DP2A 2Q28A 1P7VA 1CDDA 2FQQA 1NQXA 4ZEOA 1W52X 1UMDB 2PU5A 3HKCB 3OZRA 1VI6A 4XIFA 3SHOA 3DDSA 5J47A 5J3JA 1QF6A 1VSTA 1GTMA 2EX4A 1VMEA 3PE3A 1TUBB 4ZO8A 4MWOA 5J5AA 1I7QB 2PVSA 2R1VA 3DDNA 3G5UA 4TROA 4YRCA 4O2AB 4UU1A 5LQCA 3FUXA 1CEEA 2Y6VA 3CISA 1KO4A 3M82A 4MW0A 3IQZA 2JRLA 3QX8A 3GRZA 3I53A 4AUKA 4HAUA 4W7HA 5BW4A 1ZR4A 3WV4A 4WLNA 3DXXA 4JP3A 1PZHA 3H8VA 4OPMA 4ARVA 3D0QA 2O5CA 4FYVA 4FD3A 4RQTA 5KB3A 4F71A 3CF4G 1EX9A 4F2HA 1NJ8A 2WSBA 1COWD 2VDUE 2XCRB 1LBEA 3OZVA 4OJKA 3HB9A 4IG4A 2HB6A 1XTVA 3E9DA 4PE5B 4QVKA 5EERA 3VH2A 4B4KA 2RSLA 1GQRA 2C0PA 1QH1A 3ZVKA 3WG9A 2YZ7A 4R2IA 1LC0A 3ORFA 3PIDA 4W9MC 3S1LA 3RBXA 1BA2A 2OZKA 4YT2A 2FFAA 4M1EA 5H3LA 5C8YF 5LR6A 2AL7A 1VE1A 1UXOA 1A9PA 3OPNA 1E1CA 3BRWD 4HD8A 3OZFA 5C4MA 3I34X 4CQLB 5DHAA 5E6SA 4CTKA 4CM3A 4X0EA 2GPNA 2R60A 4RD3A 5JVDA 3IAS6 4YJFA 1HQCA 3WLOA 4EF6A 4ZHQB 1ORVA 1I1OA 1VE5A 1ZZGA 4GLBA 1P74A 4EF5A 4CKCA 5AKGA 2CD7A 1L8LA 3JRWA 3TQFA 2VZLA 2WWIA 3EW7A 1O96B 3FVVA 2WSYB 3KUKA 3QOYA 3QXJA 1KMCA 4KQCA 5LIRA 5A0VA 2YNMA 1Y8RA 3O47A 3TQRA 4Z4QA 4EPWA 1I33A 1PV2A 3CJRA 5ITZA 2PSEA 3AJAA 2VJLA 3M4XA 4H27A 4O5AA 1N0IA 1N33B 4NARA 1KI6A 2WHPB 3VR5A 3IKTA 2CZQA 2FWAA 4M0UA 4IP0A 3AVUA 1FFAA 2OC9A 1L4HA 1JU3A 4TLMB 2UU9B 4ZYZA 3Q6NA 2YHIA 1CY1A 4N01A 3EIFA 3UOGA 1YDWA 5JH7A 1SXHA 1M8JA 2P9BA 1L7BA 3A1UA 2DB3A 5IAEA 4CKBB 3JQEA 5A3VA 3LCCA 4WXHA 1U9IC 2HUNA 4QTZA 3RC2A 3QJ5A 4JR2A 2JVIA 4IV0A 1Z5GA 4QDTA 4RYLA 4Q3LA 1W7AA 1Q7CA 2OCAA 1QK3A 5CVEA 1AO0A 3IV9A 5HKLA 2B2NA 1ILWA 5CIYA 2JLUA 2WQZA 2HGSA 2IBTA 5GINE 1WXFA 1YVRA 4TXHA 6LDHA 3OJFA 5E1OA 1EK0A 1R6VA 2Z2YA 5DK4A 4PF1A 2A9OA 2DQ4A 4GZ5A 5JCPA 3DD1A 2R48A 5B1EA 5KCZA 3HDQA 3AIOA 3BMNB 4BCBA 5BRJA 1T8SA 1Z06A 3HI4A 1XLTC 3GB9A 5AI9A 3H11B 1VL8A 1GPJA 1JHPA 4EFMA 2O20A 4UEOA 1EAYA 1JHAA 1SD1A 2O2IA 1RQXA 5EP3A 4JIMA 3T7SA 4DB4A 2NIPA 3DONA 4LRSB 2BFCA 5EPOA 2EWMA 4QM6A 2NXWA 4M0EA 3VTKA 2F2TA 1JNXX 4C4TA 1NRWA 2I3BA 3LYLA 5CM9C 4NPHA 1EESA 3L43A 1L5QA 3QP9A 2UYQA 3W1WA 2NU6B 5JZSA 1SKYB 3AUAA 1JB1A 2KSQA 3QLJA 4F3YA 3ICEA 3R9KA 1EMDA 2ATCA 2Q50A 4JVNA 1BAPA 2YKGA 2EARA 1YZLA 1EDDA 4B8ZA 2ICAA 1D2GA 1MHPA 1Y1SA 1H2HA 4HRVA 4MIKA 5AHRA 1VKNA 1R9JA 4FQ8A 1FFXA 1PSDA 4GECA 4LDJA 4PC6A 2W90A 2YJ6A 4B4OA 3CF2A 2X0KA 1FMJA 1Y4AE 3GR6A 4ZJYA 3E7PA 1FQJA 4DPMA 1H66A 2PS0A 4R8SA 3I04A 3P52A 2TMYA 4LJSA 4Q9KA 3EPHA 3UPTA 1SB9A 2JDIA 4LOJA 1U8EA 3KB6A 3FB4A 1ISFA 4BBAA 5BVHB 2O3QA 3QG5A 3T7RA 1QLHA 1RBYA 3LHSA 4FBLA 4KAFA 2JAHA 3OEHA 1OKKA 3WIDA 1R7RA 5HQTA 2XUKA 4JHLA 5K6AA 3FVWA 1DOHA 2Q8QA 2ZRBA 2ZU6A 1Z4JA 5LBTA 1KEWA 3TW8A 5KHOC 2IXFA 4HTAA 3C3YA 4ZD6A 2R1VB 3D3QA 2DE0X 3JQ7A 1NC3A 4D4GA 2ZYHA 1PCXA 1P3Y1 5EE9A 5K6TA 4F84A 1VE6A 2ALJA 4P92A 1BYIA 1VHWA 3NWPA 1RHUA 2GD0A 2H1RA 2OD7A 2ON6A 1GPBA 1Q0HA 1XCMA 3N3BC 4U9IS 3DT9A 1HRKA 3B3FA 4X8LA 4H18A 1OMOA 4PNEA 4UTPA 1RTTA 2EFYA 4BZXA 1ZIYA 1SIBE 3R1IA 4IOJA 3G0GA 3UQZA 4CTNA 5BSVA 1QO0A 1P73A 1MTOA 4NZNA 2W2LD 3PI6A 3PJRA 1CDZA 3DB1A 3A7EA 2HKIA 2NAFA 5AI4A 4JXJA 3CPSA 5DB4A 2PZJA 3SVZA 1QH1B 2IHYA 3FLMA 2ZS9A 3FR8A 3I30X 2PV7A 2FR8A 1KNQA 4EAAA 1EVEA 4NHEA 4XIJA 3ETDA 4RL6A 5KVAA 1Z6YA 2FPWA 3VR3A 1VJDA 3IDSA 5BXQC 1KEZA 4LMAA 1PGQA 1TMYA 2W2KA 4EGFA 3DTYA 3GLHB 4AJHA 1E1CB 2OV3A 1QP0A 1L5OA 1SVLA 1F48A 2XTZA 1IHPA 2OCBA 1DAGA 1XJ5A 2VJMA 1LWNA 1XB2A 1KI3A 1OTYA 1ZAKA 3F3SA 3G89A 4UXIA 5JVDB 4DVGA 2FFBA 4ARSA 1GUDA 1SUFA 2XWSA 4IIVA 3GAFA 5U9CA 1RAFA 3LQFA 5DK6A 2FSVA 5FT9A 4CKCB 4R2JA 3O3CA 2C7PA 3ND5A 3PX2A 3A1DA 5CYFA 4Y9TA 2ZYIA 4KQWA 3LZCA 3CWZA 2W6ZA 2GI4A 2BHTA 3F7NA 1E92A 1MQ9A 4BLPA 3TTYA 4ARUA 4BKMA 4LHSA 3HR7A 4BVAA 1U7OA 4PRZA 1KYWA 2W6NA 2CLOB 1I36A 1ZC3A 4R9SA 2WYWA 1EWVA 5LL6P 3NBAA 5EYPB 5B1SA 3ZCSA 2ZUBA 5B6IA 1OI2A 1U2ZA 4FFDA 5DE3A 4NS1A 2BCGY 2WPNA 1DPFA 3RQIA 1P33A 3VPXA 3AFNA 1QLJA 3NHJA 4E5DA 3T3HA 3DAYA 4R1LA 1WDMA 5A7GA 7MHTA 1LPNA 2FSSA 1TYAE 2GK3A 2P9ZA 3E0XA 3PC6A 3ZU4A 4IIXA 4P4NA 3H9UA 2ROQA 4CF3A 3IKJA 1O0CA 1ZITA 1EP9A 3W5HA 5AVQA 2P3LA 4PWYA 1QZXA 1H4TA 2K7FA 1YI0A 1X38A 3WKEA 3A1CA 1TI7A 1CE8B 2GBLC 3AHIA 4HV4A 3SJAA 1NUSA 5EOVA 1FVHA 2BE9A 1P19A 2Y27A 4WXMA 4YRFA 4BIMA 5IFLA 3ECCA 2IYVA 1CVLA 4C04A 9LDTA 2IYRA 2HLDD 2FRVA 3K2BA 3AP2A 2WYUA 3IIMA 1CUAA 4H7DA 5DWQA 5E2AA 3T7IA 3K70B 1KARA 2AKYA 3W6OA 1JTEA 2QG9A 4LW8A 1EBUA 2BGNA 4L4RA 4II3A 2FRXA 2KHZA 4H15A 3UAYA 3L0OA 2W22A 1XD2B 3UMSA 3WGKA 3LQQA 4BZQA 3T38A 2FOXA 3D4NA 3IOBA 3JQFA 3KKEA 5FBWB 3FZQA 4ZVRA 3MJEA 4XD2A 5FEMA 1VHQA 4EY7A 3ICPA 1C7RA 4MUXA 5CGQB 2PXAA 1TU4A 2IIPA 4IF6A 4Z7NB 5A5EA 16PKA 2O2ZA 2Q4TA 1VZ3A 4GEGA 4ND1A 2MTBA 3A36A 1WDTA 2PL3A 3MRSA 1FFGA 4I5EA 4TQ9A 1FFXB 2EYUA 2YV2A 2B3TA 2FVYA 3JQRA 2IELA 4HQ6A 1DRWA 1PFYA 4NEQA 2FN8A 4NYMQ 3VPAA 1WKCA 1Y4SA 2FHPA 3FYCA 2LKCA 3HJHA 1RAIA 4HDSA 3AW9A 3CLUD 4RHEA 4ZU6X 4ANFA 4NBRA 3QEKA 1B41A 3COPA 1P4AA 1DFIA 2E4UA 2GEBA 4KE9A 3C8UA 3RVBA 1KTVA 3AV0B 4B4VA 4BNGA 3BEOA 3KQOA 4WACA 4RH0A 4YONB 1HT0A 4AKTA 5JYBA 1KAHA 1ODIA 5J63A 1ENZA 2X4LA 3NGLA 4ZVTA 3TLXA 5IZ4A 2D5IA 4MYRA 2D5LA 2OO7A 3FDZA 4W5JA 2HXSA 2WZQA 3GFSA 2AX3A 3TW8B 3G2JA 4ZHSA 3GMIA 1PNQA 1X7HA 3E03A 4L15A 4E5MA 2R25B 4EMUA 3IDZA 1USUA 2PUWA 4S0XA 3OU2A 3NATA 1ZH6A 2GD1O 5EHGA 2CVFA 1Z7GA 2N42A 3IS3A 4FDMA 3TIFA 2AC7A 2YW2A 3P9SA 3ZY6A 1JW9B 2BCEA 2BTOA 4M2LA 1G8JA 4MCAA 1QSGA 2JEOA 4YV1A 5AUOB 4B3GA 4HLUA 2NU8B 1RWQA 1P18A 4RY9A 5IC5A 3ICVA 1VGRA 4D0GA 4DNOA 4YXWA 4WBNB 3TLKA 3U4QB 5K51A 2C3OA 4YY3B 2ZSUA 1IZ7A 4E46A 3L4BA 5LXTB 3FSGD 3OMXA 1N6HA 4DIEA 2VZ9A 4CLRB 1HM5A 2J6HA 3EUFA 5J4YA 4X1IB 4HGRA 2QTCA 4MLZA 4L75A 2QVYX 4YYZA 4ZJZA 4MVJM 2AFIA 1H3EA 1VLLA 3BXHA 3R3HA 4B85A 1R6TA 1FK8A 4P54A 2UYYA 1WQ3A 1VPVA 3E48A 4RMIA 5EKSA 5A9RA 2IBMA 4FE3A 4EY6A 5IBPA 1CPYA 3LLMA 1CCWA 4UXJA 2VPIA 3EFHA 4IMRA 4YGXB 1EVYA 4GI2A 3W8RA 2B94A 5A4DA 4RF5A 3NHFA 4LZAA 1Y8QB 3I9V1 3D02A 1QWSA 5FBKA 3AP1A 2Q27A 5BN4A 5KWJA 1JHUA 1I2BA 4BHTA 5E2IA 5HFNA 3L9XA 3K0FA 3UANA 3ZNOA 5FLEX 1NBIA 1VP3A 2H92A 4G4GA 1SIOA 4BNTA 1PGJA 2LNDA 1P7WA 2ZIXA 7AT1A 4OLHA 3C43A 3HB5X 4DR5B 1RYNA 2X0IA 5AVXA 4EA6A 4LV8B 5I01A 1AKNA 1B15A 1G6OA 4YPFA 3U40A 3P2EA 1RRKA 4G8DA 2DJ5A 3AYZB 3I52A 1G3IA 1BJKA 1YVEI 1H3FA 2Q5IA 3H1PA 3P9YA 4JLOA 2QY9A 1GFWA 2DT5A 2WF5A 3CUYA 2VKQA 3OX4A 5TY0A 2P1RA 1VG0B 4KAAA 4QDXA 1PYGA 5AVRA 1DV2A 4E7PA 2WAMA 4S1OA 4G84A 5HIJA 3EGEA 4LE0A 3MWJA 4M0DA 1IE3A 1GJRA 1XU9A 1Z13A 2CLSA 2BEWA 2GZMA 3SJUA 2ZYDA 5GONA 2ZATA 4UTRA 2EFHB 2DFVA 3RS9A 1RRPA 5A3SA 3ST7A 4ZO6A 4R54A 4CN8A 5K0TA 1LVHA 4TKUB 2BYTA 3IDFA 3TX6A 1Q44A 4MRMA 5EXEA 3W78A 4OUKX 4R1UA 3QWFA 4F56A 3PP8A 3EEYA 1AV7A 1TCBA 1ZOIA 2Z5GA 4XW2A 1RHQA 4ZTBA 2OA0A 1M83A 3S68A 3SD7A 5TMEA 3NYRA 4EARA 1WXXA 4Q3EA 2M6KA 3GYGA 1WABA 2AOVA 5DM1A 3T5GA 1B42A 1HC7A 2OCKA 4WKCA 4DARA 1U1FA 3K8YA 3K6JA 3AQIA 3LC7O 3OTGA 3DWFA 1D8AA 1R8SA 1U9CA 2XXAA 1H69A 3DBOB 4OHMA 5E9JA 3QOFA 4WEQA 3R9XA 3W8NA 2CF5A 3HGQA 3K1AB 4LCBA 1HYBA 3K53A 3E3LA 3WGTA 2H1LA 4KVFA 5B37A 3OECA 2R4TA 3PPWA 1C3OB 3ZWXA 3CG0A 2PNFA 4LDZA 1GTSA 2I8CA 3H5RA 4YRSA 1SBYA 2PX6A 3MGKA 4G2TA 4RF3A 4EI8A 3C7DB 1TLFA 1GDTA 3C3CA 4F6CA 1FP7A 2PL9A 4LWPA 2J0VA 3IP6A 3PEVA 4ID9A 2AN3A 2H9YA 1YH3A 1GPYA 3FTCA 3MCZA 2WJVA 5AK6A 1YFLA 5JJKA 1RRCA 1XAIA 3C70A 3DR5A 1KJ8A 2CXTA 1HT3A 1NR5A 2JZNA 2ZBUA 2I2AA 3FFAA 4EZEA 2QRVA 1M2JA 4NQRA 1R37A 3N75A 4WRRA 3PITA 1RWMA 4OA5A 3V4PB 3KS9A 3RIHA 1I4LD 3G8CA 1HNXB 3TLAA 1XU4A 1JLMA 5CX4A 2UZ4A 1SD5A 4QODA 5K2OA 2QQGA 1VJTA 3IOCA 2PN1A 4D44A 1JYFA 1ZONA 2ZE7A 2WB4A 2EHJA 3R7SA 1PGNA 4F1WA 3CX3A 3X2FA 4QVIA 3B78A 2BGRA 4FKBA 4JBGA 4NMMA 2DYKA 5KOHA 3O93A 1L4BA 1QLWA 1I6LA 1M6NA 1CHDA 3QBTA 3VISA 1XTZA 1S8AA 1U3UA 5DCLA 2FFJA 2F8TA 5BVGA 2X9NA 3B7PA 3KWFA 3AR6A 5ARDA 4M8SA 2MMCA 4M0LA 5JXWA 1YOVB 1JHYA 4QYWA 5FA5A 3ZEAA 3ZNNA 4RTPA 4NCAA 1BH6A 1P1FA 4F8JA 1YZGA 1YDFA 3MJCA 3AOGA 2HDNB 4BNWA 2ZYTX 4YJKA 4L95C 4NNJA 4DMMA 1D5CA 1SKUA 2C84A 3JSAA 1BW9A 1J2EA 5BW8A 5KQLA 4D8UA 3CWQA 4DLYA 5BOVA 4WASA 5EGSA 4G1BA 2PGXA 1M1YE 1U8CB 4I8DA 5C1OA 1FSGA 4X7MA 3DMDA 4G86A 4H17A 5CFOA 5JZBA 5ALPA 2FOLA 5FUYA 2GFHA 5COAA 2H2DA 4JBLA 1GTG1 1WMBA 2ZXFA 3PXXA 1JBQA 1PSZA 3OCJA 4ON9A 1NBMA 2V7QA 2RGAA 3RBVA 4AQYB 1UJNA 3ZIUA 2R8XA 3RUIA 1G55A 2XUAA 4UBOA 1L9KA 4AW9A 2B25A 2MU1A 2ODNA 2QZ9A 4HWKA 3U7IA 3HLTA 4WE3A 1O1YA 2O54A 2ZIXB 1LKZA 5I7RA 3NH9A 3TR5A 1BVRA 4OMCA 1N2GA 5ECGC 2IQIA 1V9CA 4OXXA 5LLTA 5IM4A 4UC0A 6REQA 3ZUPA 4RULA 1UODA 1XLUA 3V8RA 5G0UA 4DMFA 4UVIA 3P4YA 2ECQA 5EMNA 3PC8A 2CB9A 1T24A 2G77B 1E6WA 1UBKS 2BE7A 2QQEA 4GC9A 2P67A 4MWEA 1RMYA 3GNSA 4Q7QA 1U6IA 2LGJA 1NXWA 5IYZB 4DTIA 4DJ5X 3OE7A 2ZM5A 5LD2B 4KK4A 3IUPA 3HACA 3AUTA 4FHZA 3FETA 2ZAYA 2R5FA 3A2MA 2V1XA 5JSQA 1LH0A 4I1PA 1A5SB 1UQRA 4ZDKA 1QB7A 4DLUA 3QJYA 3GX1A 1KYYA 4W63A 1JB9A 4ZQIA 3U80A 5CA0B 2CXXA 2FUCA 1OI7A 3UPUA 1U8UA 2A6PA 1HLGA 5F1YA 4PZ0A 2ADOA 4QXQA 5GOZA 2AVDA 4X7PA 5H4HA 3W2FA 4FTWA 1G6KA 4H60A 1F4VA 1BXRA 1L8XA 2QRQA 2WVHA 2YOFA 3GZTB 2GEJA 1OE0A 3PGKA 4GZMA 4B79A 4PZPA 3O8NA 3D7MA 3SYLA 1YI8A 1EWYA 3GRKA 1E0SA 2VHEA 3O38A 4GX0A 3ED1A 2AUNA 6AT1A 1W88A 2XXAB 2VNAA 3KOXA 4X7BA 1YXMA 1XPUA 1K8YB 3QKWA 5L3ZA 4AY3A 1U8AA 3C0KA 3P2OA 1I7DA 3R9XB 1PO7A 1TF2A 3RYFA 4AQDA 4ZXPA 1NX6A 4YMLA 2QMUA 3FCUB 3NT2A 4HAYA 4FSXA 2Q0XA 5T57A 5HIKA 1M7BA 4U8GA 3SLRA 1TKRA 1KXJA 2IRWA 3M3PA 4AI6A 2BDUA 1Z18A 2DY1A 2XTNA 4LJ9A 4EYGA 3BX1A 1K7XB 3EDYA 3G6WA 4O25A 3C5HA 4PV7A 2ZZKA 3NHZA 5FOUA 3W9SA 4BNJA 5J43A 1II9A 4F9TA 2RHRA 3P26A 3K20A 3LUKA 3ABOB 2A0UA 3X2SA 3DHEA 4RVOA 4P9NA 1G8KA 1N57A 1R50A 2AFHE 2L19A 5FI1B 4C89A 4CM1A 3BILA 3PQ2A 4R2XA 4UZEA 3NRBA 5COQA 5EMJA 1Z2OX 2D2EA 3DEFA 4S24A 4W9NA 5GJVC 4ZI5A 4KR9A 4DZTA 4B3MB 2FP4B 1G63A 1XVAA 3H9BA 3A9UA 2HNBA 3L01A 3HRHA 5HILA 4EUNA 4RLFA 2JCVA 2YIVX 5H16A 2IOQA 4JENA 2AXPA 3NEJA 5CNKA 3N86A 3H4VA 1IVSA 3DG9A 5IKEA 2X3YA 2NXJA 3VNBA 5KOHB 3VNUA 1Y63A 1KDOA 3UVEA 3MLBA 4LBZA 2H48A 2UZ0A 4FT4A 1U3VA 2HA6A 3K31A 3NAQA 3PQ5A 4GZ3A 1C7EA 4WUTA 4CU5A 2OBXA 3SJZA 1UDWA 4B6FA 4IIUA 3LX6A 3VPBA 1S4QA 2WSSD 1Q95A 1N75A 1AY0A 5EQFA 7ABPA 4MPTA 3W5IA 1Z0IA 2TMDA 4X60A 1KDRA 1DADA 1QYRA 1F2VA 3EOAI 4NCNA 2QTHA 4IVNA 5JC1A 2VUUA 4DV2B 2I87A 2RHWA 3QNWA 4HFMA 4QPJC 2AI1A 5JANA 2V7WA 3PQ3A 4ZO7A 3LA6A 4QFDA 2JGRA 4QHSA 2C5LA 3WAKA 1RZVA 4J2OA 3WLHA 1LLFA 3BWDD 3WBJA 3IIEA 4Q3KA 1E6MA 1ZEJA 1GUBA 2R7KA 2XHZA 3F7OA 3IT3A 3LY8A 3SPXA 3WKDA 1Z2NX 2A57A 5FAXA 5G40A 3RB8A 1DQYA 2SNIE 3F2VA 3JR7A 2V7EA 3WGHA 2PGAA 1Z2DA 5F98A 2AFRA 1DDOA 1GPH1 3T52A 1T9AA 3HBMA 3NTXA 5JE8A 2EJCA 4XARA 1EH5A 1RHRA 4MR7A 2JI4A 4FE7A 3AEUA 4B6QA 5LYYA 3ZG6A 5JXJA 3OD1A 4KN9S 2IYWA 3P8ZA 5CRIA 3RAGA 3AUFA 4QUBA 3GEHA 2WC1A 2IZOA 1IY8A 1T5BA 5SZIA 2CDAA 3BE5A 3ZWYA 4F12A 5KQSA 4R1SA 1X8LA 2HX1A 3ENKA 4PR3A 3T3EA 3CNOA 3OVMA 3LSYA 5ESDA 3VO2A 4BO3A 3MG9A 2CHEA 3WBFA 4B5KA 2AI3A 3RVMA 2GEVA 4A27A 1H6AA 2NTVA 3ZXSA 2V7TA 4PLCA 1RWWA 2W6OA 4F85A 4MWZA 2YXEA 3FTFA 3OPYA 4KN5A 3K9BA 3VNSA 4XLTA 1UIRA 3UWMA 4B6JA 1SXJE 3R7FA 3NP9A 3SJCA 2P2LA 4CQJA 4EHAA 3BZUA 4A4DA 3WYGA 2BJWA 1NZDA 1ORTA 4PYIA 1XZCA 3AL0C 3V7UA 1V8DA 3S44A 3G8YA 3M9WA 2XXBA 1YJQA 1GSIA 5DKFA 3WQBA 2DPHA 1YS7A 4ZCLA 1EFKA 5J2TF 4BLQA 4JI2B 3R44A 5F1OA 4RK5A 1WCYA 3N2YA 3HYCA 4GHWA 1GGEA 3VYVA 2BT4A 3H1GA 4LCEA 3PLRA 5DT9A 2AC4A 5BW5A 4P83A 1W88B 2WKPA 1KYIA 3V3TA 2ZSDA 4PHHA 3ADCA 3T4PA 1TZMA 3VR1A 3R0VA 4DCPA 1OZGA 3PNVA 1XEWX 3SHTA 4JITA 4JN6B 1OB2A 2E82A 3MTAA 2XWPA 4ENVA 2OHVA 5E6RA 2G7MC 1XRLA 3B6EA 2LV8A 4M76B 5KTOA 1FCJA 3IAXA 4KPYA 2EEPA 1Q0UA 1IUPA 3V55A 2AG5A 3DKRA 4K26A 5GGYA 1LBQA 1X2EA 1TC2A 4RABA 1GCOA 2F64A 2UZIR 1VPDA 5TVGA 4CHGA 5FO0A 4CMHA 2Z0MA 1KC1A 5JT1A 4YROA 3FH0A 1QF7A 1X86B 4AN4A 1KEEB 3ZXUB 5K20A 4C0QC 2DFLA 2IY7A 4BX8A 3AIIA 2KLHA 2NNLD 4B7AA 1SZDA 4WCDA 2VYNA 1H3NA 1ORIA 2C0CA 3QYJA 1KH3A 1SA0A 1SUEA 4YJ2B 3U4AA 5JDIA 3W2IA 3UJ3X 1DC3A 1ZAYA 1T26A 3KJHA 3LTEA 5CH5A 2H06A 5EZQA 4PX9A 4UU7A 1N2ZA 4A0FA 3I73A 2OG1A 2HQSA 2IGTA 1CT9A 1NNI1 4TGLA 4KWIA 1HDRA 4OLJA 3CLTC 1KVUA 2FSHA 1SQ0A 2FGJA 3UWPA 2MWMA 3HCBA 4DWWA 3NIDB 3C8ZA 1VC2A 2I78A 3BH6A 2B8TA 4N5IX 1YBAA 3QE2A 3KT0A 2XYGA 2Z1DA 3FAZA 4ZICA 1KPHA 4AO6A 3AOEA 3HN6A 2PO5A 3C85A 3G0DA 1NYTA 2AFHA 3TQTA 5LZ4A 4KXNA 5THQA 1QGYA 1RC1A 4HLQB 4I4IA 2IEIA 2Y0DA 3ENZA 3JQBC 2YMPA 5C81A 3TCNA 3CZ5A 2IZ6A 4WGFA 1X9IA 3LKDA 3A9CA 4F7DA 2XOEA 4F3NA 4DANA 3PSAA 2VZ0A 5H68A 2IPMA 2NOAA 3LQ4A 4M3NA 3S8MA 4DR3B 1Z5PA 4RTQA 2BDTA 3O0TA 1IJFA 5FWXB 2O2CA 3COVA 3RU7A 1L5MA 1XXHA 4L8GA 1R27A 2OD9A 1XQXA 3GDOA 1I4OA 1UIMA 4UZSA 4DZRA 3PNMA 1DRVA 4XQ9A 3CRRA 3C7AA 3H2ZA 3W4KA 2VPPA 3FGNA 4O8ZA 4RA6A 1T9BA 3B2EA 3ZCUA 1FNBA 4TXJA 2QQFA 3D3KA 3E61A 2YHSA 2H0RA 1PR3A 1H2FA 3QVKA 2GR9A 4NLLA 4WADA 3ZV4A 4MR7B 4Y0AA 9GPBA 3I23A 3VNAA 2OC4A 4TTJA 3DOHA 4HAOA 4YDHB 3DBIA 2WNHA 1GCUA 3CGGA 2Z8YM 2C99A 3PGA1 4JLMA 4BKPA 4C0AC 4ZT3A 3U81A 1HNNA 1KQOA 4OCZA 5CP8A 3X43A 4ZODA 5DBIA 2OK8A 3WIOA 4GOJA 5EUQB 1R1DA 1NU6A 5AKXA 4DSZA 2HXYA 2GYUA 3P2KA 3KWMA 4IWYA 5D1HA 4ZGGA 4H3KB 4Q21A 2K2QB 5SYAA 5EXTA 3RT9A 1LI4A 2FLWA 4C2BA 3QMPA 2UZ3A 4IIGA 2RD2A 3E3OA 4WK2B 3ER9A 2FPUA 1HRDA 3C5VA 3L7BA 3FVQA 4TUYB 1O9BA 3JQ9C 1E9DA 3KL2A 1QBKC 2CSUA 1Y5LA 2XKJE 1XZ8A 3F74A 3O31A 3PICA 4A91A 5AKZA 5JNWA 2NO5A 3NCHA 1HDEA 4A0SA 2XGGA 3MMXA 4BQEA 1G2PA 1VG8A 3C41J 1PK7A 1I3MA 2C5HA 2VAWA 4UPEA 2B0JA 2P0AA 3L0ZA 1P0CA 3DBHB 2H1CA 3D3NA 3AJRA 4IICA 5H81A 1GYQA 1PTJC 1KR2A 1J8VA 1BNCA 1CZOA 1NJ1A 1WWKA 2BMFA 2N1BA 3B85A 3I8OA 3KT3A 4M0KA 4NABA 1MZPA 1V5FA 2GBFA 3VHLB 3E9MA 3UYLA 1UEJA 1WUYA 3CQ9A 2KWIA 4BPRA 4DV0B 4KRFA 5G02A 3UMVA 3TZLA 1SKQA 3L2OB 1JHVA 5TB5A 2QIOA 4CMEA 4QDKA 2HU7A 2GHQA 3ABSB 4GBMA 1K4MA 1HSZA 2C03A 1HA3A 3G0BA 4FOLA 1ZSNA 4HDMB 4GVXA 4B6RA 3QF4B 4BN4A 3VC3A 2X9LA 4KFRA 1W35A 4Q03A 2CBGA 2J45A 5FUXA 1U9IA 3LCUA 4PFSA 3BRQA 1KOGA 2HK6A 2ZTUA 5CA1F 4MARA 3CY6A 4FZVA 1RCTE 3OZSA 3TE6A 1PNOA 3C3XA 3KT8A 5GJCA 3WLNA 4KWHA 1HZZC 4OL0A 4JUCA 4PYLA 3K2QA 3NTLA 3D7NA 5B1HA 4G5QA 3GP5A 5B30A 5C1DA 4PYKA 1ZCZA 1M0SA 1Z2AA 2OXRA 3OLQA 5AK5A 4LJRA 4BO4A 2ACKA 3BIOA 4WZBE 4ND4A 2FSIA 1KDTA 1RQRA 1GA1A 3B7WA 4FXOA 4BMNA 3GN1A 4D9JA 5IJWA 1V47A 2C96A 5CURA 5IAJA 4PPGA 1C3LA 2I8AA 1N2JA 3K0CC 1O3YA 3A6KA 4Z53A 3GDWA 3PRKE 4PXAA 3KWJA 3LECA 5BN5A 4BFSA 1A3CA 2OPBA 4F4CA 4JKYA 3UG6A 1XZQA 5KOYA 3VMFA 3BIWA 2YZ2A 4B09A 2IXEA 1GTJ1 4YFVA 1GPKA 3HE3A 5CT4A 4CGZA 3ORSA 2BM9A 1AXRA 1W94A 3OZXA 3THRA 4R9NA 3RS8A 4BNDA 1IFXA 2GPWA 3QFSA 4IVPA 2WT8A 4UW9A 2AZDA 2Z6UA 4L02A 4NG5A 4BFYA 1Z56C 1M7GA 1XZPA 1W5SA 3BMQB 3RI3A 4CCSA 2R7AA 4C7OA 4LNAA 4YUYA 5AKJA 4IQ8A 2IU0A 1OX5A 1V9LA 1LSOA 3EGWA 3HM2A 1QANA 2CDBA 3RU3A 5FTWA 1YC2A 4Y2UA 3UICA 3V2HA 4NTZA 4ZANA 3NOOA 1SHJA 4B2IA 5KIAA 2Q3DA 3UF0A 4WT7A 4UM9B 3LRPA 3O90A 3IBFA 4TLEA 1YRBA 1W1UA 2H8GA 3QVOA 3W0LB 5I7HA 4M1WA 1DJPA 4YJ3B 3MUOA 3GRC<