4KYIB

Crystal structure of the phospholipase vipd from legionella pneumophila in complex with the human gtpase rab5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recruitment and activation of the Legionella phospholipase VipD by the host GTPase Rab5.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding/transport protein
molecule keywords VipD
total genus 44
structure length 164
sequence length 164
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kyiB00
3AEZA 3NHBA 3RSLA 3ZD6A 2I1VB 4JVLA 1LB1B 1GP2A 3VKHA 4QBGB 2FFAA 1GVNB 1N6NA 4MGIR 1LS1A 4LUCA 4V0ME 5DSZA 5JZVA 2ZVQX 2ONJA 1PLKA 4ZO4A 1CR0A 4JVSB 2XZOA 2OHFA 2DR3A 4JLAA 2ANCA 1DAKA 4HATA 3IKJA 3N5CA 3I61A 1F6BA 2GRJA 4O2LA 4ZKDA 1F2TA 3WNDA 4BE7B 4QKQA 1JBKA 1L4UA 5CK4A 5AJVB 3N2EA 1R6BX 3S1AB 4C4PA 2J0QA 3MGCA 1KO5A 4Z8XA 4PHHA 1YZKA 1AKEA 3W3AA 1SKQA 4QFMA 4BLPA 1CJKC 2IYQA 4JLMA 3HWSA 3TH5A 1GG2A 5IF9A 2QTVB 1IN7A 1QHNA 1XB2A 5DHAA 4LHYA 3RC8A 1CKEA 2H57A 1MO6A 2P6UA 1IN4A 3OIWA 4CW7A 4HSEA 3BIFA 3JVVA 1XJ0A 3GLFE 1R0ZA 2PLFA 2PX3A 1NSFA 3W6NA 4Q66C 3CNNA 2VBCA 2WKRA 1D5CA 3CUEF 4BZPA 4JKIA 2ZM5A 3H1TA 4Q03A 5EXPA 3ADBA 5GJWC 2A9KA 2PBRA 3EA0A 4ILEA 4LWZA 5AWFC 1Z0AA 3SFZA 2F43B 3GEIA 3G5UA 4PZZA 1UBCA 5G3YA 2J87A 2QE7D 4PPFA 3MWKA 4Z8YA 1GL6A 2FN4A 1T9HA 1Q21A 5AJZA 5EP1A 4B47A 2XJ9A 3ASZA 3UMFA 1NY5A 1KSJA 2MSCB 2RGEA 4S2EA 4W5WA 3RHFA 2N42A 3NTUA 3SNHA 1Z8FA 4Q9JA 2IBMA 4LJ4A 1FOEB 2RCNA 3C5HA 4JYBA 4IDQA 2BMEA 4JBYA 1G16A 4P31A 2IWRA 3MG9A 4BLRA 3GJ4A 4DKXA 2ODNA 1DE0A 2PLRA 2CVHA 4AYXA 1MRSA 4QGFA 5IK2D 1Y63A 2AK3A 1E0AA 2BBSA 1SKYB 1NRJB 5L3RA 1ZC4A 4FXPA 1RZ3A 1D9XA 3NIBA 2JJ2D 4EQ6A 3A1TA 1Z63A 1Q57A 2IS6A 1G18A 4JSYA 2GK6A 3IPXA 4MQBA 1ZYUA 4Q4HA 4LRWA 4WVFA 5HE8A 1CJVC 1W2GA 1YRAA 5CIQA 1K8RA 1R8SA 5HKKD 3AUXA 1OIXA 2B8WA 4TMTA 1KSGA 3IQWA 3UANA 3B1YA 4IXNA 2CE7A 3JZAA 3LFUA 4G1UC 3VQTA 3KB1A 3KL4A 3TIFA 4L9SA 1N0UA 1VHTA 2ZE7A 3GLGA 3KKNA 1TF5A 4EFMA 1XTQA 1G3RA 4HAZA 4Q5IA 1XTSA 5TB5A 5A4JA 1BS1A 3PEWA 2JDIA 3U7HB 2NPFA 1KI4A 2FGJA 5C1BA 5CIWA 1QHHB 3QVUA 1GIAA 4ZI3A 1SXJE 1FL9A 2VYFA 2BV3A 1LVGA 1D8TA 1KK0A 3U3MA 1HYQA 2GZDA 2YOHA 4OJQA 1E4VA 2G1JA 4B2IA 1MABB 3FTQA 4G5OA 1NLYA 2CK3A 3OE7A 3DKPA 1W36C 2DWPA 3UWOA 4ZV4A 2RGAA 1R0WA 3PUZA 4M9SA 1RFLA 1Z29A 4QBHA 5F2EA 1FP6A 3B8HA 1Q1QA 2UZIR 1PLLA 4MRPA 3CR7A 1CBUA 4E03A 5FPKA 1N5KA 5TDHA 4LHVA 1T3LA 5DHFA 5JS7A 5C46F 2ODBA 2ZRCA 4A1FA 1G9XA 3U6BA 2ZE8A 1VG9B 2BCJQ 5FPSA 2GZAA 1N5LA 3CF0A 3AGPA 1S9DA 4G0NA 3MMPA 1FMLA 1HQYE 4KBGA 3P32A 4FN5A 4ESVA 5JHHB 1DADA 3K0CC 2IYLD 3WYAA 1TEVA 2AR7A 3NBYC 2QI9C 3VR3A 4KCGA 4Q1DA 1GRRA 1H8HA 2FSGA 1N6OA 2CNWD 4IDHA 5KSYA 2FDCA 1E2LA 1U98A 4CYMA 2JDID 1E2GA 2LWIA 4JBXA 2Z4RA 5G41A 2BDTA 3TAUA 2ZUDA 1W5SA 1F5NA 2IYVA 1KI8A 1OFUX 1Z6AA 4OHVA 4P3YA 4HUTA 4GNKA 1XRJA 3A4LA 3HYTA 4HDOB 1NMZA 3LAWA 1Z6TA 4NYIR 2G9NA 3SHWA 2X1VA 3ND9A 2FZLA 1JNYA 2HYDA 5E7IA 4BPBA 4EPRA 1DAHA 2JLRA 4DLVA 1E79A 1UPTA 1NJGA 2FG5A 4LYAA 4IVPA 3L8ZA 3OIVA 2QROA 1OXVA 4TL7A 3IBYA 2EWVA 2XTNA 3TVDA 4F93B 2EW1A 2VRWA 1KI3A 4MKHA 5KPDA 1Z06A 4BLQA 3K9NA 1U2RA 5JCZA 2F1HA 4ZCMA 2WJHA 4G5QA 2J45A 2JJ1A 1SVKA 2VHQA 2KWIA 2QP3A 3QVVA 4Z1MA 4BFVA 2EU8A 2V6IA 1JR3D 4ITRC 3ZS9A 4JJZA 3IILA 2OXRA 4HYYA 1P7CA 4PTLA 2VHUA 2ZR7A 3ZGXA 1YR9A 3B9QA 4HLCA 5IHPA 1UBFA 4GOKA 5DI9A 3AF4A 4LBYA 4KYUA 2ZR0A 3CH5A 1E2IA 3EIQA 5F3WB 5SZJA 2QPOA 4QL3A 1P73A 2V6JA 1ZNWA 3UG6A 4MYTA 4KBFA 3RWMB 3CX6A 4R9UC 3SJCA 1HY3A 3FKSA 4NCIA 5B58C 4B43A 2CL7X 4WXRA 4B33A 2PEZA 2Q21A 1GRQA 1ZNZA 3EIEA 3KKPA 4L8GA 4P4SB 2Z4SA 3QJYA 1OB5A 3P1JA 5TXGA 1E2JA 3H0KA 1W0KD 3H4MA 1EGAA 2ZI9A 1Q12A 4PAOA 5HZKA 1FP7A 2GCNA 4M1MA 3H2YA 5JMTA 3TBKA 4PANA 4ZIRB 2YVUA 3L0SA 3CZPA 5L3QB 1KGDA 1QHXA 2BIFA 1XEXB 4XD7D 4BFZA 4E07A 4K46A 2C9OA 1XD9A 1T8UA 2AFIE 3OAAA 4IVRA 2VIIA 1ZUNB 1OE0A 1ZU4A 2HYIC 4O0MA 1XTIA 4TMZA 1ZBDA 1OIVA 2WWIA 4D0GA 5EXSA 3WNBA 2ZIAA 4QGAA 1M7HA 2ZU0C 4M0LA 2GJKA 3A1VA 4XTCS 3DMNA 1F2UA 3AP3A 3FHCB 4TQ9A 5JI2E 1CRQA 5FTNA 1Q3TA 2IHYA 3GJ5A 4JVMA 2QORA 4QHYA 2C98A 3HP1A 4CEIA 1OF1A 4YXWD 1HE8B 2J41A 3BD9A 3LRPA 1N6HA 2KJQA 5E4FA 1D6JA 1KI1A 5B57C 3CPHA 2UZ3A 4RD6A 1OKKA 1MV5A 1EFHA 1WB9A 3GLHA 4LHWA 3GD7A 4II7A 4UJ5A 2IYSA 4HB4A 3U44A 5EZ5A 2AFHE 2BJVA 1E9CA 4WIAA 3H86A 4NHOA 5GJBA 1XCPA 5FOVA 3WYFA 2D2EA 3V4FA 3C15C 3EWSA 4TL6A 3R9WA 2HT1A 3V00A 4BEJA 2MSEB 1YR8A 1SVWA 1K6MA 2W0SA 4B71A 3TUJC 2J7KA 4Q4HB 1XF9A 3TSWA 4DDVA 1DOAA 3I73A 3GLGE 4IDPA 3EWAA 1NG1A 4MYUA 1DVRA 4D4LA 4BFSA 1OYWA 1CR4A 2E9SA 2R44A 3O8RA 5P21A 4CEJA 4DLYA 1E99A 1Z0IA 2XTZA 3PQCA 1UBEA 1U8ZA 1ZIPA 2F1IA 2YWEA 4TT3A 4MGYR 5BYKA 3PITA 4PC6A 1WCV1 4BQSA 2OCAA 1P4SA 1G6OA 2FSIA 2Z5FA 1D2EA 5AR1A 4PO1A 3Q9LA 3QSYA 3CBQA 1LTQA 3AVPA 3B6EA 3GJ3A 3FE2A 3PUXA 4PHFA 1DPFA 2IYUA 3HJNA 4FWTA 1NKTA 3ZVMA 3A4NA 2NIPA 1WQ1R 5FUVA 2J46A 4E09A 1EWRA 2YWFA 1M1YE 3OAAD 2FPMA 4A8JC 1KK3A 1XMIA 4HLQB 5DI3B 4O25A 2ZUCA 2OT3B 4US2R 5LB4A 5TARA 1KO1A 4HZIA 1YZNA 4Q9LA 2YINC 3M4YA 4B3GA 2QQ0A 2H1LA 3MFYA 1WBBA 4IDNA 1V43A 3OEEA 3VR2A 4B48A 4E22A 1AQYA 1VDZA 4LJAA 2IHBA 1OLOA 4M4SA 2FEOA 3DL0A 3ZLJA 4EDHA 3TW4A 1AS3A 4Q9IA 1KJZA 2JATA 2QL6A 2HJVA 2BMJA 1KDPA 3C8UA 1JJVA 1FUKA 4LJ9A 4QOSA 4F38A 2VSFA 1SKYE 1WF3A 2C9YA 3I32A 3NBZC 3QKTA 1GZSA 1US8A 1II9A 3LXXA 3ZQ6A 3DZ8A 1GM5A 2JLQA 1VTKA 4HLUC 5TVKA 4EJSC 3G0HA 2R6DA 3LBIA 1YU9A 1CIPA 5F9HA 4Q47A 1X8JA 2Q9AA 2F3RA 4JL6A 2YV5A 4ABYA 5FTKA 3NBXX 3HR8A 1OB2A 4AKIA 3BH7A 2OFOA 4S35A 1CULC 4JVNA 621PA 2BM1A 1BIFA 3QG5A 4GZMA 2IT1A 1N2CE 4D2IA 3ZZ0A 2BEJA 2X2EA 3AP2A 2QT1A 4B2PA 2VP0A 4GP6A 1COWA 2V54A 1R5BA 3QKRB 4NP6A 3TKLA 4XVRA 4B34A 4ZDIA 5CJ2A 3T5DA 4RD0A 4OHYA 1SXJB 3GQBA 4V0KA 3KJEA 1H8HD 3C5CA 1TADA 1T0JB 2FGKA 3JZMA 3SHFA 1JPJA 1I4DD 1P9NA 2C95A 2D62A 3KFXA 3QEJA 3U7EB 4A8JB 1KI6A 4RFVA 2AHOA 4US0R 4ZDWA 5C18A 2RGCA 5AK0A 4QHTA 2OBNA 3P26A 1LS6A 4JLNA 3SI7A 5B2ZA 2ZREA 5HKKA 1XCGB 2RGDA 4PC3A 2CLSA 2J0UA 3A58B 1G8GA 3LV8A 1G291 1N0VC 1P9RA 4ZPXA 3NH6A 5FOTA 3IGFA 1K5DA 2FV8A 2RGGA 3L2OB 3B82A 3MRSA 5LB2A 4RY2A 3THYB 4A9AA 3THYA 4DIDA 4GMXA 2XX3A 4PAQA 1AJEA 5FUWA 4IHQA 5DNYB 4UNSA 4EFLA 1JXMA 1R7RA 1Q22A 5CM8B 4NPHA 4DSUA 3P20A 5BN5A 2XNDD 2R6CA 3VX4A 2CK3D 1F2TB 3BH6A 4IRUB 1SVMA 1OXTA 4TSFD 3TNFA 1VKJA 4A6PA 1VYTA 4TYQA 1G64A 3M6AA 3OF5A 2ZRPA 3PEYA 2IS4A 2ZVPX 1YZLA 1KAOA 1T0HB 2ZS8A 3NKVA 1NN0A 1QF9A 5FOWA 4MUBA 2QN6A 2OLKA 1E2NA 2JCSA 3B9PA 3LW7A 5JWOA 2AWOA 5B30A 1BKDR 1WBDA 1G3QA 3HU3A 2RAPA 3I5XA 1GNQA 2P5SA 2NOAA 3BB1A 1DEKA 1E4YA 2JEOA 3TR0A 3B1XA 4QBIA 4Q1AA 2D7CA 3KTAB 5LPNA 3SZRA 2F9LA 2VF7A 2BKEA 1X86B 3U7FB 2YC4C 2Z43A 5LD2B 2F7SA 4P0TA 2GEUA 3IHLA 2V8OA 2D2FA 5DGXA 1KO4A 2UKDA 4JIMA 2FEMA 4NYMR 3EX7C 1RRCA 1VCNA 5BQ5A 3DHWC 3IEVA 2RGNC 2GK7A 2QRNA 3VKGA 2JJ2A 1XNJA 2ZRNA 1XD8A 1R5OA 4Q02A 2O8FA 3O8BA 3OEHD 5L3VA 4FWIB 4OHXA 3F3YA 2QQEA 4ZI2A 5AJYA 1M7BA 2VSOA 2A7QA 2GESA 3FPAA 5EXXA 3ZD7A 3QF7A 2A5DA 2VA8A 3LQQA 1VCOA 5GJCA 1LFDB 4FMDB 3QG1A 2XSZA 3GEEA 2OAP1 4A2PA 2GXAA 1VG8A 1JR6A 4OK6A 2C9CA 1QG2A 4LBZA 1NIPA 2HLDD 4KHZA 3TE6A 2IX3A 4Q7JB 3QUSA 2WPDD 3RRYA 1FNNA 3UK6A 4DB4A 2Z6VA 4A0HA 1ZD1A 2C78A 5FPHA 2CCGA 4IJMA 4PC7A 1N6RA 2AD1A 4TQUS 2ERYA 4DCVA 721PA 4JZKA 3MWLA 4UNQA 1S1CA 2O8CB 3B2EA 1P2UA 5FUXA 3R8FA 3LDAA 2WAXA 4Q4JA 3GJ6A 1KNQA 5K8IA 1HT2E 1X3SA 2EWWA 2XOKD 5DN6A 1IY1A 1U81A 1WP9A 3PENA 1U90A 5JI3E 2GXQA 3THXB 1EFRD 2OCYC 2KB0A 3Q85A 2NO1A 2Q6TA 1E6CA 3EG5A 3EPJA 3OFNA 4Q01A 2NZ8A 1XMJA 5KSZA 4LK2A 2A5JA 1EFTA 2YC2C 1TNDA 3IBGA 3UG7A 4CGZA 1TL7C 3QE0A 3E5HA 3CONA 1XXHA 5EE3A 5H1YA 3VU9B 1IONA 3RVBA 4LYJA 2JGNA 4DT1B 3W8NA 4TYPA 4NCNA 3U5ZB 1LV7A 4A2QA 2NG1A 2ZJ8A 3EA5A 2ZSBA 3I1FA 3IO5A 4B73A 1FFHA 4D80A 1KNXA 3FFAA 5E7MA 3LD9A 4UXIA 3TUIC 5EP3A 1XMSA 3IUYA 4Q00A 5FBRB 1BYIA 3AP1A 1SXJD 3RWOA 4JLBA 3WBJA 2QSYA 1XTKA 1G7RA 1NP6A 4M1SA 5GVSA 2VPPA 4IXMA 2WTUA 4B32A 1ZNYA 1W36D 3K8YA 1NG9A 1UADA 1N6PA 4B3BA 2IW3A 3WXMA 4A4DA 4RJLA 3SYNA 2OZEA 4XWAA 1G7CA 2ZJAA 2P3SA 5ELXA 4BASA 2WVJA 4BFYA 1S3GA 4BWYA 5DYIA 4M9QA 4AK9A 1AS2A 4QBFA 5G53C 3GFTA 2WJGA 1E98A 1GNPA 1E9EA 4Q48A 3WHKA 2QAGB 1A2KC 1X1RA 3TLXA 2P6RA 4MITA 3BK7A 4Q4AB 3K9GA 2QGNA 4IVQA 2H16A 4G01B 4CEJB 4OQXA 2G0NA 4E5UA 2JLWA 1UBGA 2DFKB 1X1SA 4H1VA 4U5XA 4JT2A 1J7KA 3GFOA 4CF7A 3K53A 3OEHA 3D8BA 3GEHA 4HEJA 5EXTA 1CF4A 1E2FA 2N46A 1JB1A 1E9DA 3KZ1E 4M1KA 3VNVA 2FX3A 3SQXA 4C0BA 2V1UA 5A5GA 3NC0C 4LC0A 4QJ3A 4F91B 1QZXA 5ANRB 1DELA 3I8XA 3OFND 2BMDA 2OSBA 5FTLA 5LBIA 3SS8A 2IYYA 4MRSA 4BFXA 1G7TA 4BRUA 2IS2A 3THWA 5FH9A 1MABA 1R5NA 4PSAA 4DC9A 5CB8A 3RRZA 3CPJB 4QRHA 3WY9A 5JWHA 2OBLA 5J4YA 2RHMA 2ZYWX 1MRNA 1N3BA 2R65A 3OESA 3ZQJA 4D6PA 2ZAOA 3EXAA 2G88A 3NXSA 3SBDA 4B2LA 1COWD 4DSNA 4C0LA 1RW4A 2VSXA 4MYHA 4A0GA 2PT5A 2IYXA 3SJBA 5JSZB 4BLTA 4ARZB 3BB3A 4U02A 5HE9A 4EFNA 1FMJA 1YR7A 2NO7A 3KFVA 1GRNA 3KB2A 1ZNXA 2C03A 4KJZA 4P33A 4YDHB 1IOZA 1RRFA 5EJEA 3CF6R 1OV4A 1M34E 1FNMA 1AZSC 1P6XA 2F1RA 4AD8A 5CITA 4UXJA 2HJGA 5J47A 3CNLA 4RFSA 1NMXA 1AA9A 5EP2A 3LLMA 1LF5A 1CJUC 1OFHA 4C0SA 3ZS8A 1YZQA 4M1WA 3PUWA 1TEXA 3VAAA 1S8FA 1T3HA 4GFDA 4MUAA 4W5JA 2QNRA 5L3QA 4EKDA 1GFIA 4LYFA 3GP8A 2REBA 4DB2A 2OEPA 1D2MA 4LCBA 3REFA 3A37A 2GWHA 4PQRA 1Z2AA 2EQBA 4Q9KA 1TF7A 3QI2A 2C77A 1IY0A 4DEXA 3GFPA 4NMMA 4Y0AA 1IHUA 3D6TB 2GHIA 3ADDA 2H18A 1DAMA 3Q5DA 2E87A 2ZYTX 4EPVA 1W0JD 2R6FA 1XPOA 4QC2A 5KDDA 1YR6A 1NVXQ 3SEAA 2ZRLA 3MD0A 2PMDA 3CRMA 1D2NA 2D7DA 1XXHE 2NZJA 3SOPA 2V9PA 4KAXA 4ERNA 2J3EA 3VKWA 4NYJQ 2PZGA 4LYHA 5UKDA 1ESMA 1TX4B 2QGZA 4UKDA 1SXJC 4Y0VA 4URXR 2IEZA 3T1TA 2XB4A 5CDFA 1M8PA 1CJMA 2W6IA 1X8LA 2PCJA 3D7MA 3BERA 3GLHB 5BXQC 2XNSA 3CKLA 5SZHB 1J90A 3B1WA 3ETLA 3RS0A 2ZPTX 1LW7A 2WJIA 1ZCAA 1CTQA 1OPXA 2BBWA 1R0XA 3OIYA 3P4YA 1FQKA 1KSHA 3AF3A 1WXQA 1OYYA 2VHCA 2FMXA 3FVQA 4QHSA 3FHTA 1C4OA 1UEIA 3L0IB 1KAGA 4JLKA 4RKEA 2IYWA 2Y8EA 3SDZA 3T1QA 2WWFA 1Z47A 3N70A 1HQCA 2AXNA 3NG1A 2ZJ5A 3X2SA 2QTHA 1A2BA 4FI3C 3FMPB 5HTKA 2BHRA 2G77B 1GTVA 1QHYA 3BE4A 3A8TA 4IOLA 3FKQA 1XPUA 3OZXA 1LF0A 3DKVA 5KNBA 1PUJA 1NLFA 3EC1A 2QMEA 3SR0A 4BFWA 1HURA 4EJSA 1XU4A 1TQ6A 3PIRA 1RE0A 2O0KA 3QOFA 4TYNA 1ZC3A 2ZI4A 2O0HA 2NMVA 2F9MA 4WOPA 3U4QA 2O8CA 1W4RA 4YMTA 1MO3A 1Q1ZA 3ZZTA 4DLTA 2ZSDA 1FQJA 5FI1B 4TYWA 2V7QA 3E2IA 3IHWA 4KFSA 3U3RA 3WYGA 4B74A 4B3FX 2WSMA 5D3MB 2O8DA 3EZ2A 4M1TA 3K70D 5C4MA 2WWHA 4Q19A 3TW8B 4IOJA 3TJZA 1P75A 2KBEA 2DFLA 2W58A 3TRFA 1DAIA 1SHZA 2J0UB 3P4XA 3NC1C 4C0AC 4KLNA 1ZUIA 1CXZA 1E1RD 3W9YA 5HCIA 3CM0A 3SJZA 3CRW1 3QNUA 1IXRC 2HXYA 2V55B 3KQUA 4RZ2A 4D82A 2RGBA 2FNAA 2WJYA 3AKEA 3FYHA 3UXMA 421PA 4F7WA 3NWJA 4C2TA 1W4CA 1NN1A 2A5GA 3NBFA 2VP9A 4D81A 3ND8A 4TQAA 1ZW6A 1WMSA 4M53A 1TUEA 4DJTA 1VECA 3FB4A 2ORVA 2PT7A 1O87A 4PQYA 1E69A 3WRYC 4DCNA 4JLJA 1KSFX 2J9RA 2JLVA 4D26A 4PQFA 3HYRA 2D3WA 2ZS9A 4NCKA 5F9FA 3AVWA 4UNRA 3K09A 3K0AA 4URZR 2X77A 4EJSB 4EPTA 1XJQA 2EFCB 5EP4A 5JCPA 1G5PA 5GVRA 3GJ0A 5FR1A 2DBYA 3CRVA 4D4JA 3I92A 2ZI6A 2ZRDA 2HCBA 4DCSA 1XJCA 2IEYA 4G5RA 4ON9A 1HTWA 4NZYA 1CEEA 4Q7LA 2AK2A 1AM4D 3DZDA 3T34A 3BJIC 2CHVA 4C0HA 3QPVA 4PC2A 3TQCA 3ADCA 3SFVA 1FZQA 2D74A 2PZEA 3VFDA 2ZTSA 4JT4A 3PEVA 5DE3A 2GETA 3CX8A 1B0UA 4B75A 2BCGY 1Q3HA 2I3BA 2QG6A 4KSBA 1EFRA 4QNMA 3KQHA 3FKSD 3UPUA 1PUIA 2C8VA 2QENA 1ZD8A 2I1QA 1NSTA 2A30A 3F0TA 2PJRA 3MUFA 1XTJA 2F43A 4AG5A 1OFIA 4TTRA 5FL3A 1OXXK 1G20E 1BO6A 1JR3E 3ASYA 2YOGA 4Q7KA 3IO3A 4X8LA 2AKAB 2JASA 1OT3A 2H7VA 4BECA 1W7AA 1Z3IX 5G40A 5M04A 1G8YA 1RVDA 4TL8A 4HI0E 3I3SR 4PFSA 4BLOA 1G8HA 1ONBA 2PCLA 1F3OA 1ZM7A 3HPQA 1TTTA 3EASA 3C14C 2PH1A 1KDTA 3W8RA 4A0FA 3AM1A 4PHGA 3EARA 1PLJA 4AKHA 1MOZA 2WIBA 4KI0A 2XNDA 4GBMA 4NCJA 3GLIE 1N6KA 2HDNB 4BGDA 1RYFA 2BWJA 1VMAA 2HV8A 1DBSA 4O3MA 4NYJR 3FMOB 1AK2A 2IYZA 2B6HA 3R9XA 3ONWA 2ZQ5A 3SYKA 3ZYCA 3UMRA 4F4IA 2ZXUA 1ODFA 3QKSA 3WMFA 3HPRA 4M9XA 1E1QA 4FMCB 1GILA 1W0KA 3VHLB 3L82B 4DLUA 1KYIA 1S9HA 4YXWA 3ZIAD 4OYHA 1NBMD 1CRPA 2WOJA 2IYTA 3CZQA 4ASUD 2CCKA 1KDRA 4RD1A 4N1AA 4F4CA 4OL0A 4PR0A 1YHNA 2GF0A 4A92A 1MR3F 1QHHA 3F5FA 2H92A 1OH5A 5FI0B 1VIAA 5BN3A 4MGKR 4YC7A 2ZJ2A 1SHKA 1LY1A 4MA4A 2Q3FA 4AC9A 1EG7A 4FCWA 1U9IC 2GTPA 3QENA 1G4AE 5SZIA 4Q1CA 2AWNA 3RS7A 5FOSA 4EPYA 1NN5A 1IN5A 2CDNA 1MO4A 3QKUA 2NTYC 3T1VA 5J4LA 1T8TA 4MKIA 1GL7A 3FWYA 1CR2A 2P65A 2AL7A 2MMCA 2UVQA 4R2HA 3BB4A 1UF9A 4URVR 3AB3A 5AJXA 4XVUA 1TAGA 3L0PA 4L16A 4KYIB 1AGPA 4V02A 5CK5A 5BW8A 4RZXA 2CL0X 3VR5A 2QU8A 4M2LA 4ZCLA 4LPKA 5AUPB 5EE5B 1OSNA 1E1RA 3T61A 4B3CA 2FZ4A 3VHXA 1P62B 4NU0A 3EC2A 2GJ9A 1IM2A 4M8NE 5EE0A 3TSZA 4DZZA 4D25A 2A3RA 3IDQA 3B1VA 4QG7A 3NH9A 3VMFA 4A15A 5FBVB 2FF7A 1OH7A 2B7CA 5HR5A 1II8A 2IXEA 1VCMA 2HLDA 1QHGA 3U2QA 2JAQA 3ZVNA 1KZGB 2WWYA 3VTKA 4KXFB 2IS1A 1G3UA 5TY0A 3TMKA 2GKSA 4ZIRA 4C0JA 3RAPR 3QXJA 1NKSA 2TMKA 4HAVA 1DG1G 2WAYA 3LBNA 1E9BA 2OG2A 5L3SB 5AUNB 3VNUA 1KTVA 3BORA 4URYR 3RSOA 1C1YA 2GCPA 1I2DA 2W2XA 3LLUA 1YQTA 4KLZA 4KV9A 4QM7A 1U0HC 3SN6A 4JLVA 2CHQA 3MAAC 1VCIA 1KOFA 1ZRHA 3U61B 4IOMA 5EQTA 1U8YA 5E95A 4NL4H 3RRNA 2MSDB 4LV5B 3QKRA 3O47A 5KPJA 1S4QA 4I1SA 3U4QB 3LW8A 1VYVA 4PXAA 4CVNA 1IJFA 4OI0A 4B6EA 2OXCA 3DO6A 4JMPA 4US1R 3GLFB 4MRRA 1WA5A 1GUAA 1XEXA 2F1JA 3B85A 4BEBA 8OHMA 2A2ZA 4NONA 4GDFA 4OQLA 3W34A 1UEJA 4V0NA 1R10A 2ZSAA 1WDTA 3CB4A 3QF4B 2IF0A 3EZ6A 3QXXA 4JSTA 4LOAA 4BFUA 3GPLA 3V4RA 2LKCA 1RJ9A 2LKDA 4NE2A 3EPLA 2VP4A 3B13B 4JS0A 3EZ7A 4YQFA 2QBYA 3K1JA 1Z5ZA 4FMBB 1KMHA 2FPKA 2JIZD 2W6ID 4LV8B 2G0TA 3BWDD 3T5GA 1IXZA 1FW6A 1W47A 2QPTA 2HT6A 3KJGA 4FCTA 2X2FA 3EIHA 3FOZA 3LVQE 3D31A 4DLWA 5FFMA 2IWHA 1KY2A 1Z07A 2CEAA 2O0JA 5JJLA 5CYOA 1UFQA 1XWIA 1XZQA 2DFTA 3AH8A 4W5HA 2FWRA 5HCNA 3EAQA 3CO5A 4GRAA 1CR1A 3K0AB 4D0LB 3NDBB 4A6XA 1II8B 5C2JB 3AVVA 2ORIA 3MWJA 2BBOA 4XVQA 2CLCX 1QDEA 4HB3A 2ZI5A 4ESHA 1CU1A 1US8B 2E1RA 4KFTA 1ZM3A 2OLJA 2ZU6A 3IPYA 5HZHA 1AQUA 3REGA 5BWMA 4XIGS 3W5JA 1KI2A 3OE7D 5KSPA 3W6PA 2VQSA 4LPSA 1HUQA 2OE2A 2J5XA 3AVUA 3PG5A 4NYIQ 4OI1A 1W48A 1IXSB 2RKOA 2WKPA 3DEFA 3PVSA 2I4IA 4ACAA 2ZAMA 1RJ9B 3SC3A 4AWXA 1E0SA 4NDZA 4Q18A 1AZTA 1AIPA 2C5LA 3SJAA 1JAIA 1JR3A 1X8KA 1E2MA 3LH5A 1OH6A 2C99A 2WM9B 4M21A 2CJWB 2WIAA 3RYTC 2YYZA 2WSSA 4ZDKA 4B76A 4PHTA 2WV9A 3CH4B 3SBEA 4A0RA 3Q7QA 1YZUA 2C96A 4TLAA 4BZXA 3EPKA 1V5WA 2XZLA 5JEEA 1M7GA 4DDUA 3RS3A 1EWQA 2KSQA 2YHSA 4LDJA 3WNCA 5CB6A 3KQLA 2EFEB 2ZJZA 2ASEA 3WHLA 4C30A 2XB2A 1XFAA 3EW9A 2G1KA 5KUTA 2O8EA 1Z6GA 3IQXA 821PA 1NJFA 4PPQA 2N1BA 4ACBA 1J2JA 1G5RA 1Z2CA 1EX6A 1YVDA 2EYUA 1OXSC 2YJTD 2OM2A 1JEDA 1DG3A 2ZYUX 2QP4A 1TUIA 2VF8A 2YWHA 5EUQB 1Z22A 3KKOA 2O5VA 1SQ5A 1GWNA 1EFUA 2P0EA 3NVAA 1EK0A 3MJRA 2AX4A 4TLBA 2ERXA 3A1WA 2ZUBA 3CRRA 4B35A 2ZANA 4H1UA 1QHSA 2G3YA 1A7JA 4OI4A 2GA8A 3DVLA 1P5ZB 1FUUA 4TMXA 2JIZA 1G41A 4I99A 4DLSA 3CLVA 2EVWX 1AKYA 4EAQA 3IIKA 1OJLA 4B44A 1BMFA 2ZE5A 4TTQA 1Z08A 1QG4A 4PSKA 5K8LA 2JJ1D 1OXUA 3KX2A 4RKFA 3BC1A 4Q4AA 4WZAE 3ZDQA 1O3YA 4D4KA 3U3KA 3I8SA 2Q0HA 4I81A 1GSIA 1HH4A 2XZPA 4MDEA 1H8EA 1SGWA 3HR7A 4XD7A 2B21A 2XJ4A 1KK2A 2QM8A 4RCZA 2J0SA 4TZ0A 2BMFA 1OIWA 1F2UB 4IFBA 4AYTA 1KIMA 4QGHA 2MMGA 2NO6A 4HAXA 1R2QA 2DY1A 2CJWA 2P5TB 3RANA 1ZUHA 3BXZA 1X6VA 4Q1BA 4WBSA 2NGRA 3MWYW 5FUYA 5FBWB 2WKQA 3THOA 4TZ6A 2P6NA 5AUQA 1QVRA 3DMDA 1CLUA 5FBLB 1A82A 2WICA 3CR8A 4V0LA 1E94E 2GF9A 1ANKA 2V7QD 4DLRA 5E3HA 2O8BA 2YWGA 4DLXA 4IOKA 3KKQA 3ICEA 4TMKA 4Z51A 1SVLA 3DM5A 4ZKEA 3TQFA 3GLIB 4LJ8A 4HB0A 3BBPA 1G3MA 3DM9B 1W46A 1ZIOA 5KHOC 4WZBE 5KYKA 1XP8A 4JL5A 1NY6A 2QAGC 5J4VA 3AVXA 3SQWA 1YKSA 4IFEA 3OEED 2XAUA 4QJ5A 2W83A 221PA 3MLEA 1DAFA 4ZDJA 2BEKA 2V4ZA 1E2HA 1U99A 2GEVA 5DH9A 3W90A 5KSOA 2ZRKA 4LJYA 1I4TD 1NMYA 4I1UA 2ZJOA 4OJKA 4PO9A 4UNPA 3RS4A 5B64A 1MH1A 3GMTA 1E2EA 3VR1A 3PCRB 5J40A 4Z54A 1J8MF 3U60B 2WZQA 2IYRA 4GMDA 5JHGB 3K0SA 2IK8A 1JJ7A 3TVTA 2H5EA 1GL9B 4FW9A 4AURA 2XOKA 2HXSA 1L8QA 2KI5A 5KU1A 5D3MA 2XXAB 1NLZA 1UJ2A 2QP9X 1AGRA 2AN9A 1NBME 4KO8A 3FGNA 4WAUA 1ZM9A 1BMFD 3Q7PA 3UWKA 1DAEA 2ATVA 2JA1A 1A1VA 3LNCA 1E2KA 2YOFA 4MKGA 2W2VA 2RMKA 2ZROA 3H84A 3GLIA 2HCJB 2ZSFA 4TT3D 2OCBA 5BN4A 5JJIA 2VHJA 5TV2A 2J0VA 1OH8A 2QBYB 1E9AA 4M9ZA 4A82A 1W0JA 2GJAA 3B1ZA 4LJ7A 2DYKA 4UQOA 2QEQA 2X8AA 1Y3AA 1KI7A 4AIIA 3ZH9B 4P4UA 2DHRA 4OBEA 4XTRA 2FU5C 2BKUA 4HLDA 2BBTA 1WRBA 1VYUA 3K70C 1S1MA 4RCYA 4QJ4A 2A5YB 4P4SA 3THWB 3A36A 4KFUA 4KVGA 4U7DA 3K0FA 2WJVA 4NBSA 1QBKC 1DARA 2SHKA 2ZRBA 3TK1A 1JPNA 1G19A 4FD2A 1NVVQ 3AQ4A 4PPGA 2GCOB 2REXB 1Q1BA 2ZRAA 3N2IA 5FTJA 1XD2B 4B3DA 2R62A 1XD2A 4HAYA 2QMOA 2PEYA 1L7VC 2FFQA 1TPZA 2D06A 1QVAA 3M0EA 4DUGD 4ZCIA 2IF2A 1JECA 1RYHA 4L5BA 3VR4A 5SZKB 2FPLA 2QA5A 2ZRMA 1SVSA 3B60A 3PV0A 5JRZA 1FX0B 1PZNA 3L43A 4UNNA 1UKZA 1T5LA 1NI3A 3KXIA 3KQKA 1RRGA 2PJZA 3LQRA 3LVRE 4WA7A 4TN1A 1E2QA 2QPAA 2BOVA 1CP2A 1RC8A 4KFRA 1F60A 1KKMA 3FMFA 3GLGB 5JWRA 3QPUA 2G83A 3C41J 3EZ9A 3JVUA 3FMIA 2RHDA 1JQJC 5LDDC 4U00A 2WMNB 1FPMA 1UKYA 4KVAA 3C4JA 4RZUA 4PSVA 2ZITA 1IN6A 3LA6A 5KDLA 1U8AA 2CHGA 2NPIA 3KXKA 3HU2A 1DO2A 2Z83A 1T5IA 1YE8A 3TUZC 1UDWA 2AXPA 3RLFA 3ZZUA 3DPUA 4CEHB 1P60A 4A2WA 5JLJA 2EYQA 5KNDA 4O2RA 2GAOA 2QT0A 4CT5A 4CDGA 2JLSA 5IRCD 1ZVQA 2QRZA 3B5JA 2VL7A 2W6JD 1XBTA 4LGMA 3O8CA 1E2PA 2CVFA 3ECCA 4J0QA 1N0WA 4JBWA 1M6NA 3T06B 2FJUA 3QXSA 4LBVA 4C2UA 5AJWA 2ZRIA 1IAQA 2ZEJA 1RPZA 4F4JA 1H65A 4PAMA 4XSHA 1DS6A 5EE9A 5JBQA 5KOYA 4AI6A 1I4LD 4C0KA 4XH9B 4GZLA 4TWZA 2QMUA 3HDTA 4C0QC 1ZP6A 1Q0UA 3NDPA 1GITA 4N3NA 2OAQ1 2QAJA 1JXOA 3C16C 3RS2A 2WWGA 3K9HA 3GJXC 3KXLA 1ETUA 2AKYA 2QTFA 2HF8A 1DAGA 1W44A 3SYLA 2O8EB 3UMSA 1RIFA 3Q3JB 3NEJA 2XSZD 2ORWA 1GKIA 2XITA 1IY2A 2EFGA 3QEOA 4NH0A 1N25A 1J70A 3NEYA 2JLYA 5TMPA 3CPEA 1PJRA 4YMWA 4FMCF 3GJ8A 3I4LA 4OQNA 3R7WA 1E79D 3GLFA 4DXAA 5BYJA 2GEDA 3ICQB 1E0KA 1L2TA 1OW3B 4LZZA 2REOA 3QIAA 2YNMA 4TTPA 4XOIA 2PX0A 4BFTA 2GBLA 4AKGA 3TGPA 3L8YA 1GNRA 3BH0A 2Q9BA 1I2MA 2EFHB 4LHXA 5GJVC 3EPHA 2DCUA 3LY5A 1RRPA 4YDSA 3UIEA 1ZCBA 2ZJYA 2IUUA 1S2MA 1DTSA 1WE2A 1SVOA 2IXGA 2Q3HA 3E70C 4XJXA 3IIJA 2GXUA 5KNCA 2R6GA 1DO0A 1KMQA 1OHHA 1P2VA 1R8QA 1UDXA 2WJJA 3V9PA 3W3ZB 3WRXC 2GZHA 3AVOA 4NYMQ 2PZFA 1W1WA 3CRQA 3QPWA 5DLQC 4LJ5A 4BUJA 5JFGA 2IUSA 2ZSEA 3MJHA 4X8OA 1M2OB 1ZJ6A 5J4KA 4QXAA 2F55A 4DVGA 1T91A 2GDJA 4JJKA 1MO5A 3LO5A 3TAHA 3I62A 1NL3A 4URWR 3A1SA 4L9WA 2FSHA 3LBHA 4AYWA 3C7KA 2JLZA 3RC3A 5DN6D 3P27A 1KJWA 3PFIA 1ZM4A 5J4HA 4RFSB 3QXCA 1A4RA 2V1XA 3PUVA 2WBLC 2ZI3A 4GSYA 4R98A 4HZUA 5EUMA 1AS0A 1M74A 2X19A 2QE7A 2VTKA 2ZRGA 3R7WB 3X1DA 4EUNA 1G5TA 5L8VA 4RVCA 2CCJA 2CMKA 3DDCA 5J5CA 3ADKA 4ARZA 5JSZA 4HB2A 4AG6A 5CLQA 1Z0DA 3L0OA 2VH5R 1UM8A 4WW0A 4B3XA 3AVTA 5JJKA 3VR6A 2GNOA 4UXHA 3Q72A 2R8RA 1P3JA 1NNEA 2FOLA 1EESA 2QMHA 4AKEA 1HV8A 1Z6XA 4V0MA 3K0FB 5JRJA 1KO8A 3CW2A 1G4UR 1G1MA 1IBRA 1U9IA 3R20A 1JI0A 1KZ7B 4DUGA 1YZGA 1K5GA 1SXJA 1TQ4A 3AKYA 3BFKA 3D3QA 2GXSA 4OQMA 5KDOA 1Q20A 4NCHA 1N6LA 1NBMA 1QRAA 1VG0B 3KDSE 1ZAKA 4Q1EA 4V0OA 5E7JA 4EPXA 1JQLB 1XCMA 4YMUA 5G3ZA 1W4BA 2ZRHA 4A8JA 4XSGA 1G21E 1XX6A 1G17A 4L15A 3LX5A 5H68A 2ODEA 2QSZA 3TR5A 1D9ZA 2OO7A 2FE4A 5AUOB 4C7OB 2GILA 1XDBA 2RGNA 4DSTA 1GOTA 1BYUA 2R9VA 5DIFA 1R4AA 1E96A 2ZS7A 2ZJBA 2J59A 4DLZA 4IDOA 4C9BA 3WP0A 4DRZA 1KMHB 1QHIA 2CLDX 4XWOA 4TMWA 4H9GA 2VP6A 4LHZA 2IUTA 1OHHD 3AKCA 4CZ2A 4A36A 3WBKA 1U0JA 5KTYA 2P2LA 2XTMA 1MT0A 2FH5B 5L3SA 2ZRFA 1BOFA 2BVNA 4OHZA 2HF9A 4POAA 4DIEA 2YZ2A 1UKEA 1GDDA 1YRBA 1W49A 1SULA 1HT1E 2C04A 2EFDB 3AKDA 4WXPA 4DBLC 1KK1A 4HDCA 4LBWA 3A4MA 2O8BB 4RD3A 2CXXA 5K8TA 1S3SA 4TMVA 2W2TA 5LD2C 1Z0KA 3X1XA 2VHTA 1JAHA 1VPLA 4JL8A 4X8HA 5JECA 4I4LA 1JEEA 4B6FA 2BC9A 1P9WA 3U3OA 4RSGA 2AD5A 3CF2A 2XXAA 1N6IA 3QBVA 4EIWA 3UATA 3UKDA 2OILA 1TQ2A 1MKYA 5F98A 2R6AA 1KO7A 2ZYVX 1Z83A 2OESA 4QGGA 4LC1A 4TLDA 2OCPA 3ZVLA 1G7SA 3KKMA 1GKYA 3BFVA 2WMOB 5DI3A 1XXHB 2GJ8A 5FL7A 3VX3A 1E9RA 4QNRA 1FTSA 4CRWB 2GAAA 1NVWQ 4MH0R 3WMGA 1GAJA 4K81B 3LWNA 3K0EA 3QY0A 1KI9A 4M1OA 3K0CA 3BAFA 3K09C 4IW3B 1UKVY 2ATXA 3AVQA 3GLHE 2GBLC 1BH2A 3BS4A 5C4GB 2FA9A 3LXRA 3U3JA 1W5TA 1OKKD 2VP5A 2PL3A 4HAUA 5DYGA 4DDWA 3NHAA 4V03A 3OIUA 3W6OA 1E9FA 2K5UA 2O52A 4BZQA 5FTMA 2W6JA 4Z1MD 1LNZA 3VU9A 4DSOA 3KTAA 2ZR9A 4AY2A 1FTNA 4IKEA 1YJ5A 4PZYA 2KE5A 3PEUA 1NIJA 2NQ2C 2OFWA 4LX0A 2QY9A 3Q8XB 2QUZA 1W4AA 3BGWA 1SZPA 4XWKA 1GKUB 4NKRA 2F6RA 4G3XA 5FPYA 2W0MA 4X8MA 4IEEA 3GCGA 2FFBA 4OK3A 4R71A 4D0NA 1XEWY 4FCVA 4W7SA 2L0XA 521PA 4OQFA 3T1OA 4JLOA 4EPWA 1HE1C 1CJTC 4RZ3A 1YZTA 4OHWA 4RD2A 3S1AA 2YKGA 1VG1A 1XPRA 1ZINA 2DFNA 2GVDC 2WWXA 3QQ5A 4IEIA 3W5IA 3U44B 1U94A 3KJIA 2VLIA 4P4TA 1NVUQ 1AN0A 3KJHA 2WSSD 2A78A 4KU4A 5HPYB 4OK5A 1U0LA 3PXGA 2Q9CA 4Q4LA 3PJRA 4EQ6B 3AF0A 3ZVRA 4DCUA 4YMVA 2NO9A 2D4HA 1XTRA 2IXFA 4Q21A 2KBFA 4CEHA 4HAWA 4HUQB 5IDVA 3AF1A 2A5FA 5H70A 1N5JA 3A1UA 3OHMA 3FFBA 5IT5A 2P67A 3BOSA 2LCFA 2QZ4A 1Z0FA 1JALA 3CIOA 3PUYA 1IN8A 2DWOA 5FL7D 2CL6X 5FOXA 5GADl 121PA 1P2TA 2ZRJA 4OKSA 1H8ED 2IC5A 1J99A 4TYYA 1ZD9A 2QM7A 3MCAA 4FINA 1G3IA 1E9SA 4LY6A 2WOOA 2ZI7A 4RD4A 5DISB 2CNWA 3LX8A 2VO1A 1KHTA 5FPTA 2C2HA 3X1YA 3X1ZA 3R8CA 1NF3A 4M1YA 3I72A 3G82C 4I1OA 2VP2A 4PZLA 2OUKA 4MRVA 3T12A 4DEYA 4DDTA 5H8WA 2XGJA 4Q7MB 5CJPA 3IEUA 3U6KA 3CX7A 3M1IA 2IA5A 4FIDA 4LSGA 2RB4A 5CDFE 3QXHA 3HU1A 4CT4B 1P72A 1ELOA 2GCOA 3CWQA 1E3MA 2FFHA 4TSFA 4UJ3A 4KITB 5D3QA 3F8TA 1TU4A 4GP7A 1HA3A 5KO2A 1KDOA 5JS8A 4CIDA 4DWJA 1NVVR 2H8KA 4D4MA 4BRWA 4MGZR 5CYPA 4GOXA 2QAGA 2WPDA 4HUQA 2B92A 2IL1A 4LV6A 1Q44A 2B8TA 1KKLA 2HUPA 2Z0MA 4LI0A 3QKSB 4GOJA 2NO0A 3T15A 1NN3A 2J7PA 4URUR 1XZPA 1XEWX 4L4UA 4MDFA 5DO9A 1W2HA 2ZE6A 1E0JA 3K70B 2JLXA 4PX9A 1S0UA 2J1LA 3KUDA 2OFXA 3U7GA 4Q4JB 4NTZA 3IIMA 1J8YF 4OI2A 4GPTA 1SVIA 3RDPA 2J7PD 1KJYA 3B78A 1E1QD 1II0A 1KI6B 1XEFA 6Q21A 3AVYA 4Q1FA 3RRMA 3AUYA 3DOEA 2H17A 4C7OA 4YONB 1E2DA 3WP1B 3SE0A 1FX0A 5CM9C 2WHXA 3DOFA 4K8OA 1W36B 4PPNA 3MSXA 2RGXA 4DCTA 3BRWD 5A0FA 1Q1EA 4R7ZA 2ANBA 5JEDA 4M22A 2GJSA 2CE2X 2JLUA 2W00A 3WMEA 1Z28A 4JKYA 4DT1A 2ECKA 3E1SA 3A6PC 3T35A 2DWQA 5CLLA 2Q3MA 4GI7A 5FR2A 4N0EA 3AGQA 4P32A 4TL9A 2OV2A 4MRNA 4W9MC 4N0DA 1T3SA 1VHLA 4CEIB 1EXMA 4I1VA 3I5YA 2PMKA 2GVZC 1HEIA 3CWZA 3EZFA 3B7GA 1ZMXA 1B23P 4WZ6A 4TLEA 4HDQB 4YMSA 3RNLA 4GT1A 2HEIA 3QBTA 3ZJYA 4PC1A 4LJ6A 3CNOA 1G6HA 3R9IA 4JLDA 4JYCA 1EX7A 1C9KA 1ZM2A 1TMKA 4BLSA 1OFTA 4HZUB 4R2IA 4KSCA 3RABA 4DHEA 4MKFA 2DPXA 1UAAA 2R2AA 2BM0A 1F48A 1P61B 1RKBA 1CS4C 1IQPA 1G8FA 4GL2A 3PR1A 4HLUA 1P2SA 4MYCA 4F92B 1S96A 2B7BA 1E32A 3SU8A 2RH5A 1T4GA 5EZ6B 2ONKA 1KY3A 2VEDA 3FDIA 4PO8A 4Q9HA 4QM6A 1TF2A 2G6BA 4JLPA 5EE1A 3FHOA 3ZIAA 1R0YA 3TSOA 4FMDF 3Q5EA 1TQDA 1TU3A 2BJWA 4G5SA 4ASUA 5FBQB 3AF2A 1EFCA 1PV4A 5IK2A 3BFXA 2ODWA 2F3TA 3AV0B 3RS5A 4C3ZA 3KUCA 1ZU5A 2O8DB 3THXA 1IJEA 2WWWA 2FSFA 2OBMA 1PVOA 2O8FB 3K9LA 1VIYA 1N5IA 2V3CC 1G8PA 2CBZA 4G5GA 4KODA 1ESNA 1Z6YA 1A5TA 1XMVA 3QF4A 4TLCA 1Z0JA 2ZETA 5FOUA 3O8DA 1L4YA 3GJ7A 3X1WA 5K8UA 1T6NA 2JJ8A 3KQNA 3J81k 2XEXA 2DB3A 4YLGA
chains in the Genus database with same CATH superfamily
4V0QA 3NHBA 2QN1A 3ZC3A 2I1VB 1USVA 4J4BA 3OU2A 3VKHA 2PSHA 2ZSIA 3ZHUA 1ULAA 2FFAA 4ALNA 2BT4A 3T1NA 4D97A 1PV2A 3BHJA 4RELA 5CHYA 1MO2A 2ZVQX 4BVJA 2VT2A 1NBHA 3OTQA 1JEOA 4YUVA 1PFKA 4KG7A 2CFRA 4W4TA 1HFWA 3AJEA 2HPZA 3N5CA 1VI5A 2PBFA 3DBOB 1PJTA 3FB1A 4L72A 1UBMS 2GPNA 3I61A 3H05A 4DYHA 2QRPA 5ALXA 4LW8A 3ZD8A 1N2GA 4QKQA 1L4UA 1A69A 1HE4A 3N2EA 2BJHA 2HSWA 4P7JA 3RVNA 3UB2A 4C6TB 3KV3O 3ENNA 4E1AA 3QUAA 4IJQA 4R9RA 4Z8XA 5CVDA 4BLPA 1P4HA 2XYGA 1PK9A 1F4LA 3A2NA 3HWSA 3PKZA 3IV9A 1VJGA 3N5KA 1IN7A 2J9ZB 2HZ7A 5DHAA 1ZITA 3SC4A 4HKTA 4QLOA 1CKEA 1MO6A 4KO1S 2ZIEA 4J7AA 3PTZA 4OTZA 1IN4A 3B3QA 4MJ3A 1WD7A 2PE5A 4GBGA 4KXVA 2GEJA 3U4MA 3JV7A 3JVVA 2CYCA 2R6JA 2PX3A 3T95A 4G0XA 3W6NA 2VBGA 4OXNA 4Q66C 2WKRA 4WXMA 1WXDA 2C4VA 2VH1A 2WFMA 3EOZA 3IP5A 4JKIA 4BZPA 3H1TA 4YPVA 1SXGA 4U2FA 3SX0A 5K9ZA 3ISTA 1YBAA 2PBRA 3EA0A 4LY3A 4ILEA 3ZNNA 3CC8A 4CM4B 1SBYA 5JOQA 2O2GA 4RY8A 1GUYA 1YB4A 1DNPA 2P9CA 4XIJA 3U31A 5JAIA 1ZNQO 2J87A 3RK1A 2AOUB 3L0DA 5B4UA 3B2QA 3EG9B 2QSJA 1QIMA 2I71A 4M0EA 4MW2A 4ARCA 1DWUA 3UMFA 2FQWA 1X9HA 2MSCB 3K4PA 3M9LA 3G8DA 1U3UA 4H59A 2ISCA 3QMPA 1L4BA 4PZAA 4W5WA 5ALNA 1DX9A 1HLGA 2XT9A 1Z8FA 2G80A 2Q1TA 1E3EA 2CJFA 5HP4A 2Z6AA 2IBMA 3CISA 1DUIA 5C7OO 4F6LA 4TXJA 4B84A 1ODTC 3FY4A 1AB5A 3GW8A 4P84A 1SUCA 2BMEA 2C7GA 1G16A 4L0MA 5K6TA 5C1OA 2B5WA 2KX7A 4AYXA 1Z4PX 5L9AA 1DQYA 1CUCA 2BFEB 1DBIA 2CW5A 2HWUA 3D6FA 4GQAA 3TOVA 2PX4A 3LUFA 1NRJB 1ZC4A 2EJWA 2PV7A 3IEKA 4FXPA 1XVIA 3UY4A 1BTOA 1DIRA 3HRKA 2GK6A 1X74A 3JSXA 3Q6IA 3IDSA 3MW8A 5A06A 1AH2A 4B4UA 5HE8A 3HSKA 1BGVA 3WTCA 1W2GA 3QHPA 1YRAA 2M1ZA 5CIQA 1U2DA 4N0MA 5F1OA 4A23A 3VPGA 4D7AA 4QODA 1OIXA 1YC2A 3IQWA 5H5JA 3REQA 1FFWA 3B1YA 4IJKA 4Y9SA 3LFUA 5TSDA 5B7QA 5IJWA 3R44A 4JY7A 2GGSA 3N2LA 3WZMA 4L9SA 2ZE7A 1VHTA 3KKNA 1TF5A 2MSLA 3IOYA 2CY0A 3JYQA 3Q6MA 4PYJA 3VO1A 4MWCA 3EVDA 3KQPA 5TB5A 1BS1A 3TTVA 2JDIA 1IPFA 2Q3BA 2J08A 2VNHA 5JMOA 4Z0NA 1UPBA 4R1NA 2FWJA 4QEDA 3DOJA 5HFJA 3EQZA 5IDWA 3V4OA 1ZGZA 2YWCA 2VYFA 2VJDA 4UMFA 2R8PA 4MJ7A 5JY6A 1AC5A 2PNFA 5IW8A 3U3MA 3UMJA 2C2YA 3ROMA 2YOHA 1PL6A 1E4VA 3N2KA 5FBZA 4ZPJA 3DLBA 2E3JA 1NLYA 3MTEA 4ZHQF 2XRFA 3JPWA 3BE8A 3OE7A 4JEUA 4ZAZA 1VZ2A 3ODPA 2W70A 2DWPA 3BTOA 3VYRB 3EVAA 5CFRA 5L3QB 3LCCA 1J4AA 1HYHA 1FP6A 3DCYA 1Q1QA 1ZGGA 1PLLA 4E03A 4KZPA 5TDHA 3EXHA 5JS7A 1Q77A 2VDVE 3D81A 3VNAA 4PAWA 4PTZA 1HBJA 1SOMA 1UFRA 2FEWB 1G9XA 3FWNA 4G97A 4ODIA 4RGBA 3WG9A 4ARUA 2ZE8A 4YRMA 2QVBA 4MUNA 4MWDA 4R0MA 2VAWA 1MFPA 1N5LA 2UU9B 1U4NA 1S9DA 1RYYA 1EHCA 2XD4A 1HQYE 4KBGA 3U0BA 2VCEA 1QIDA 1QB8A 2CKDA 4KJXA 3A4VA 4KQIA 4XPZA 3K0CC 5T67A 4TSKA 5AK4A 2WPNA 2Q1SA 3N8NA 4DV2B 2IHKA 3VR3A 4CE6A 1T5DX 5LU8A 3RC1A 5CVVA 1GRRA 2I8LA 2CNWD 4GRIA 1P74A 4IMRA 1J8VA 3QQPA 1E2LA 1LBTA 1U98A 2VRCA 4EYEA 5EWJA 2AMYA 1QIFA 3WLSA 3DNMA 4R1SA 5PNTA 2YUTA 2ECPA 1ECBA 4FSXA 4GOLD 3EXG1 4FHFA 1JU4A 2I3GA 3I30X 4CU2A 2BM8A 5KB3A 4HUTA 2XI4A 3DEIA 3W5CA 2JFZA 4IUYA 4MMZB 1P5FA 3NTXA 1UMCA 1JYFA 2HBZA 4JZYA 4W5NA 2X1VA 1JBEA 4FR2A 1U2ZA 3R41A 1T1IA 4E4RA 4KXLA 1E79A 4X7BA 4EA7A 3AK4A 3ESXA 1UPTA 1A4UA 2ZBUA 2FG5A 1RHKA 2VSNA 1MVLA 1U8CB 5JPIA 3BIOA 4G26A 2FUG6 3MAJA 3WOVA 3C3MA 3CBGA 4TL7A 2CFIA 4IY1A 4BVBA 1THGA 2XTNA 3F90A 1RQPA 1O95A 1DI0A 1ST3A 3T5BA 4B6RA 2O06A 3BRWA 5A9TA 5CVTA 2WJHA 1ZSNA 2G9VA 4G5QA 3TZEA 5CLHA 3U7JA 4CIVA 4DY4A 1PGPA 2BEVA 2VHQA 3BXGA 5FAXA 1CERA 2NSHA 4Z1MA 3U4AA 5KJ6A 2UXDB 3ZPXA 3KKLA 3AONB 2OXRA 1XRNA 4J49A 5HFAA 1JIQA 2GARA 4P7BA 1ZVMA 4N3CA 1TFUA 1DKLA 3ZDBA 1YR9A 3OOWA 4AJLA 2DT5A 4HLCA 5IHPA 1UBFA 5NLLA 4GOKA 2DLDA 4X41A 3DS8A 4LBYA 2O07A 4MA0A 4KMRA 1MX9A 5DHPA 3RO7A 5I6DA 4P93A 3CH5A 1E2IA 4MCIA 2JH8A 2QPOA 3OZRA 4QL3A 4FR5A 4O6VA 3T3IA 1P73A 3SYTA 1F8XA 1ZNWA 1QGYA 2ATCA 2FP3A 3IHTA 3ZQKA 1DBVO 3LCMA 5JQWA 5KCZA 3GA5A 5FTWA 4E7PA 1ZRNA 1QIGA 1KEUA 5EJ5A 3EY4A 4BJ3A 1S01A 2ENUA 2Q62A 4YFYA 2PEZA 1UZUA 5DK6A 1KOLA 4MI6A 1QRRA 1DBRA 1JYEA 2H08A 2OCDA 1E18A 1F14A 1GZ3A 2Z4SA 3B70A 3GG2A 3P1JA 1OB5A 3PI6A 1JGTA 3A9SA 5E4TA 1L7PA 2O0LA 2JZNA 1XHLA 5ENZA 5I3ZA 3H4MA 4W9NA 2ZYRA 5IH7A 3TXAA 3H9BA 4H4CA 1XZDA 3N6RA 1P0CA 2E6UX 2Y1LA 1M2JA 1NXTA 3H1EA 1MBZA 4G8CA 5CW1A 4H3HB 4O2AA 2YVUA 4HWGA 3TLGB 1H6AA 1CQIB 2BIFA 1H0HA 3FI9A 5CLGA 3NW9A 1DO8A 4B6GA 2V7BA 5ALLA 2FFJA 3JD4A 1T8UA 2AFIE 3OAAA 5EXDA 4IVRA 5AI6A 1SN7A 4OKNA 4OLFA 3HI4A 1OE0A 1ZU4A 1XF1A 3MWEA 4H1TA 2HYIC 4L75A 1XTIA 4O0MA 5T41A 2DFDA 4D42A 1GGHA 1P33A 1DTEA 2ON6A 2WWIA 3HEMA 4IGIA 4D0GA 1KVRA 5IM4F 1O96B 2ORYA 3OZVA 4QGAA 5T8KC 1EHIA 1M7HA 2CMFA 5DLEA 3EOBI 4L8FA 1F2UA 4TQ9A 4MULA 1XVUA 1JSLA 3PXDA 1Q3TA 1L7DA 3T94A 5KJCA 3VTAA 5H9VA 4WFQA 4PGFA 3HP1A 3WGQA 4TTVA 1OF1A 1RWBA 4YXWD 1HE8B 2GYWA 1P4AA 1E1KA 3VYWA 3VAZA 2Y99A 2DKNA 2J07A 5E4FA 1KI1A 1YOVB 3GVXA 3PJGA 4RABA 5J5VA 2JCBA 1KZ9A 1Y98A 2QF7A 1CPYA 2I7DA 2WJ3A 4RD6A 2FZKA 2YIJA 4D99A 5JC8A 2L69A 4AQDA 2NZVG 1RU3A 4ZVTA 3FYTA 4LHWA 2D0DA 2MYTA 1G38A 2MCFA 3CUYA 3NWPA 3WO1A 1N5MA 4Z99A 4CMIA 5I3CA 2BJVA 3SKYA 3DPIA 5GJBA 4NHOA 2WINI 4BO5A 1XCPA 5FOVA 1Q0SA 3WYFA 3RVOA 3RTAA 3G8BA 1RZUA 3PA8A 4I8XA 1K6JA 2HNKA 4TL6A 3ZWVA 4XYMA 5K3FB 1C8KA 4WJKB 4WUVA 1SVWA 2EATA 2ZUSA 2ZB2A 4PW0A 1GG5A 1NUTA 1P2DA 3AU8A 5TC4A 3PUKA 3I73A 4IDPA 3MGKA 2YH2A 1NG1A 1P81A 3EWAA 2IZ0A 3HB7A 1JSCA 2FZGA 1O8CA 1CR4A 2E9SA 2VK1A 3LLSA 1PZGA 4D4LA 4D8WA 2YBDA 3Q0EA 4I6GA 1LDGA 2FEXA 5P21A 4DLYA 3DYVA 3BZWA 3VI4B 4UM9D 3BTVA 2BDEA 3CEHA 1ENPA 2R8EA 1PCXA 4MGYR 4DCPA 4PC6A 1WCV1 5H81A 1P4SA 2GK4A 5AIAA 2FSIA 4ERXA 3R3WA 1D2EA 3DV0B 1KQFA 3Q9LA 1OWOA 3CBQA 3GJTA 3L0CA 2ZJFA 1RWXA 3B6EA 4DIOA 1EVQA 1AKWA 2QJRA 4XUCA 3HZZA 5A0VA 3AJ8A 3GUHA 5C52B 1DPFA 2Q7XA 2ZCUA 1OVGA 3AXTA 1NKTA 4BN0A 3A4NA 5L7TA 1WQ1R 3RT9A 3GBPA 2VF2A 2W6CX 3WRWA 5AP9A 2X2PA 2P4UA 1OQAA 2FPMA 3ZHYA 1U7WA 3L4BC 4X24A 4A8JC 4ZYUA 2B78A 2H9IA 2P9ZA 4UUNA 4YALA 2ZUCA 1FYVA 3N7UA 3BULA 1YZNA 3B36A 1KFJB 3PC6A 4KGXA 2WT4A 3SY8A 3M81A 4LCEA 4QSMA 5JZMA 4B3GA 1ORIA 2PUEA 3VPXA 1SA0A 2NZ2A 1CZRA 1IHYA 1USKA 1R6UA 4IDNA 1V43A 3G0IA 2AJLI 1L7EA 1T6BY 4NEGA 4N0PA 4E22A 1XP5A 1JQEA 1VGRA 1OLOA 4HSGA 5TJ9A 5FOQA 5L7YA 5BNWA 3ZI4A 3O1IC 1SKAA 4MTLA 3W5BA 4GX1A 1KDPA 2JIPA 4BHTA 4RJIA 3G2LA 1ZEMA 1SBNE 5JQGF 4F38A 4P82A 5BN1A 1I5RA 4GLJA 4TWJA 2VSFA 5DBIA 2EBHX 2RGUA 2QYSA 2VPYA 2XKAA 4P4LA 3W8DA 4BWVA 3ZQ6A 1TGYA 4PVDA 1O2DA 4A91A 5TVKA 3G0HA 1MAAA 2QAIA 3PKJA 3VDMA 2R6DA 2MU1A 3LBIA 1U2GA 2ZIFA 4MV3A 2HHHB 2IFTA 1PV1A 1P6UA 4QUGA 4F04A 1OZHA 2Q9AA 3FLEA 3FWZA 2HZBA 2G5CA 3L7KA 2YV5A 5FTKA 2ZTHA 3AY7A 3UFBA 2WTNA 5LLDA 5I5EA 4R69A 1EFDN 2IPXA 621PA 4TWRA 2O23A 3QG5A 1L6RA 3A3OA 3JYHA 4MRMB 3TB4A 2I65A 4D2IA 4NV0A 1X7YA 2VXCA 3OECA 5KVAA 2X2EA 2XF8A 2VP0A 4QRDA 4TKUB 1Z25A 2V54A 3QKRB 4FOSA 4HRVA 4JJAA 4NP6A 1ONOA 3LZCA 1P17A 4PZPA 4ZVLA 4RD0A 3TKLA 4E1BA 2QTRA 2QTTA 3KJEA 2FGKA 1EFVB 3JZMA 3UWMA 5FQOA 4OATA 1MB4A 3GFBA 4V3BA 4C7BA 3QEJA 3U7EB 4CM9D 4NJMA 1OR8A 1KI6A 4X1KA 2DQ4A 2YJGA 1KIAA 1JZSA 1O9BA 2UV8A 1WW3A 1EAMA 1UL1X 3UFXA 4MLDA 3RD5A 3UJ8A 5IP5A 3EG9A 3JXEA 2FQYA 4FT2A 3SI7A 3PI7A 5B2ZA 1NPTO 1DBQA 4BPBA 3EQ8A 1R9JA 1NU6A 3LQKA 4PC3A 5J2UF 2GBIA 2J0UA 3U7IA 2VJPA 4ZJUA 4YI3A 3K6SB 3BXPA 3BSYA 1G8GA 3D7SA 5AVZA 4MARA 5J9FA 4BP1A 1G291 3KVNA 4GXQA 1ZH8A 4LJKA 4YRAA 1P9RA 3O74A 3WGIA 5FOTA 3K72B 3IGFA 4BJ1A 4J16A 3UB4A 3OLVA 3DXZA 2RGGA 4BMOB 5C8XA 3ZDYB 3OQNA 1J2RA 3PXAA 3OWXA 2NP7A 1H3FA 4BXOB 5A6SB 4PAQA 2XX3A 4ENQA 3O90A 4GUDA 4IHQA 5KYYB 3PWTA 4G23A 4K6GA 4O2BB 3OQHA 1M2EA 2D1RA 3GFFA 3Q98A 4WUTA 2O1EA 1KARA 1C1XB 4L7QA 3GCZA 2CK3D 1F2TB 3BH6A 2RK3A 3EGOA 2Q9UA 2RAFA 1OXTA 4KWCA 4Y2UA 3SMQA 3TNFA 1VKJA 2AOWA 2JCVA 2X4GA 3WIBA 2EGHA 4TYQA 3M6AA 2Q7DA 4RBNA 3B6KA 1BCSB 2H1OA 2CNDA 2Q7OE 2WEKA 2C5AA 5DMHA 4WBNB 1P5RA 5LLTA 5I7OA 1KAOA 1JHMA 5CDUA 1LBHA 1SQFA 1J24A 2PQ0A 3OZIA 4REQB 1S2GA 4IIEA 3OT5A 5IEBA 1NN0A 4ZANA 1FDUA 3ZHSA 2CBXA 4MXDA 3ITDA 4CETA 4UBOA 2YJZA 4IH1A 5EQFA 3LW7A 5CT9A 1RLJA 3H8VA 4Y2PA 1BKDR 1I32A 2VTVA 3D4LA 3HU3A 3MXOA 4C5BA 2A57A 2RAPA 5K0JA 1WHTA 1E8NA 1U1CA 1H9BA 2P5SA 2P9QA 3HH8A 3QU2A 2FR8A 4GF5A 3MWEB 3PNMA 4H3SA 1M9NA 3BB1A 1DEKA 4J03A 4ZU1X 4MRMA 3K6SA 1CUHA 1QO7A 1E4YA 3TR0A 4AKSA 1NR1A 2FDRA 2J9XB 2GZ3A 4ZU3A 4JT8A 2KLBA 3SDSA 4D44A 5LWQA 3BXXA 1X86B 1PWEA 2Z43A 1I3MA 3U7FB 1JHYA 4NBUA 4P0TA 4UU1A 5EJIA 2PWBA 3LUJA 5F1KA 1TC1A 3RKRA 3S2FA 2UKDA 3ETHA 4AUEA 3G79A 4CKXA 2FEMA 4NYMR 4MR8B 3ER6A 3RFCA 3TKAA 5E6RB 1L4NA 1KYVA 1QFJA 1VZ3A 2O3JA 2QRNA 3VKGA 4C43A 4Q02A 2ZRNA 3WGLA 1R5OA 4HEQA 3OEHD 4FLFA 2A8YA 4L7VA 4NAHA 5L3VA 2B36A 2JI4A 2PMWB 3D3WB 3WQRA 1QPZA 5T5QA 1I13A 4G56A 3F6SA 1SC6A 1ZJ4A 1LK5A 1E7SA 2TECE 5G0UA 2A5DA 2VA8A 4OPMA 3NVDA 4P34A 5FFFA 1J25A 3C48A 1MGOA 1S8NA 2I1WA 2ZBRA 2XSZA 3NPAA 5AK6A 3UB3A 4BEVA 4F5EA 5AESA 1A9QA 5C8DA 4PLTA 1JR6A 4KWTA 3WAGA 5JNTA 2C9CA 3U9LA 1MHTA 4KRXA 1NIPA 4QPPA 2QD3A 3QUSA 2OTCA 5DCUA 4EB6B 5TEWA 1TFRA 1T26A 3KSZO 1T29A 1LBQA 3E23A 4OAQA 1FNNA 2ZBVA 3LUKA 1WHTB 5CNIA 5FHQA 2FVXA 3NEAA 4X64B 5EJ2A 1B41A 5FPHA 2CCGA 2VR1A 1DIAA 1EAYA 3EFBA 4W7HA 4Q3AA 4ZQEA 4LOKA 4N54A 4M0CA 2PSSA 4R51A 2P11A 2GBGA 3K2IA 4LE1A 1YONA 1LC0A 1WPXA 3EGVA 3F1KA 3MWLA 4JZKA 4UNQA 4DCVA 2PU5A 1Q74A 5EJFA 5DNUA 1P2UA 2O8CB 4JJ4A 3R8FA 3SHTA 1OXKB 1SWWA 4QUJA 2XYQA 1I5EA 1RPJA 3GJ6A 1T8SA 4FVTA 2PUGA 1TVKA 1X3SA 2HA4A 3CR3C 2Q27A 5JI3E 3AMVA 1YKGA 2GXQA 3E9QA 3Q85A 2FWMX 3MJFA 1BG6A 2Q6TA 4ENSA 2DERA 4MVJG 3DEHA 4URFA 4WERA 1LJUA 1WVIA 5AXCA 5DTRA 3RIYA 4R2XA 2PKWA 3OPYA 3IS3A 1XTTA 4CMEA 3JQ8A 3UG7A 2GEKA 1TL7C 2O2EA 2PGOA 3PKIA 1XXHA 3M5DA 3H0EA 4HDAA 1IONA 4II3A 3VU9B 3ZE8A 2P6MA 4PGAA 4LYJA 1YZVA 4ZN6A 3AILA 1TKAA 1Z37A 2IIBA 4NCNA 4RF2A 1V3UA 3U5ZB 3SFTA 2NG1A 2C9BA 5CGZA 3RHZA 3F6YA 3I1FA 5DP1A 4B73A 4D80A 4JD5A 1U6IA 1NJ5A 1EE2A 4KUHA 4UXIA 4MI9A 1XMSA 1Z68A 2QX4A 5JANA 2XMDA 4HQ0A 4ZAFA 2BP7B 1Q6ZA 1YMQA 2W8BA 3VA7A 1G7RA 4X0EA 1OILA 1BWSA 2A88A 2VPPA 3OETA 4NZNA 1KYQA 3GEPA 1FSGA 4R8MA 3LMKA 3JZDA 1TJPB 4XRRA 2HRZA 5L51A 3U4HA 1X87A 1RWWA 3WXMA 4A4DA 1YASA 4XWAA 3TNDA 2P3SA 4DTCA 1UOEA 4NHEA 2WVJA 2DHEA 4RH0A 2CKMA 1FX1A 2E4AA 3RSQA 4BJHB 4HBGA 3AHCA 4Y2JA 5BSFA 4HFRA 4YRTA 1XCBA 1DAPA 1FYXA 4GLOA 1HFKA 2DWUA 1P4JA 4W6QA 4X1OA 2ZUVA 5CVJA 3DMRA 1U6JA 2X0JA 3TLXA 4FGSA 4BCBA 4RSMA 5FO0A 4C08A 3AI3A 2LNDA 4F12A 4IGKA 4ZAGA 2NPOA 2H48A 2YMLA 1C1DB 3N2KB 2J0SA 3G3EA 2A1IA 3CS3A 3SC6A 1PR0A 4G01B 5FWXA 1SOAA 2G0NA 4OQXA 4YWHA 2J3MA 1YH3A 2OP1A 2FPIB 5CA1F 4Z4IA 3VPAA 1SCUA 4JT2A 1J7KA 1XEAA 4JI7B 2Z2KA 2JGDB 4XM0A 3OJFA 1RQRA 4EX6A 5AKGA 1ORTA 1PQYA 4UDNA 3OTHA 4EABA 3PDIA 3ZV6A 3NBAA 4QICA 2UYGA 3H2GA 5A5VA 2PXAA 3ELBA 1WB5A 2V1UA 1W5AA 3NC0C 3S1LA 2JJYA 1QZXA 2WJ4A 4KIFA 5EEGA 1SQ0A 3OPNA 1TO1E 2BMDA 3OFND 1P31A 1ORDA 2NZXA 2OSBA 3PNOA 4JUFA 1P91A 2IYYA 3SS8A 4OSEA 1G7TA 4BRUA 2IS2A 4A03A 3DMYA 1MABA 3NM6B 5CB8A 1G20A 2V7UA 4QRHA 1B8PA 5TQ0A 4ZOEA 2XUDA 5J4YA 2YWXA 3WLFA 1V7PC 2AJ8A 3OESA 3QFCA 4D6PA 3NXSA 2PZKA 2CL5A 1LQ2A 1XZBA 3FNQA 1C0PA 1QTRA 2VSXA 4MYHA 4BC1A 5D1NA 2PT5A 3ROPA 3SJBA 1RXIA 2WU8A 3HDJA 4JITA 3IP3A 5MFPA 3DYIA 2BGJA 5F7ZA 2HHAA 5HE9A 3D0KA 3H4IA 1XKXA 1PR9A 3KQSA 3GVPA 1QUEA 1XKLA 4QQ8A 3ZGVA 1ZNXA 3TZQA 2G1AA 4W8HA 4Y2RA 2RGYA 4CPDA 4GM1A 4K86A 1RHUA 4JSRA 1RRFA 4RHYA 1VPDA 1M34E 2D5BA 4IHKA 2X23A 4ZAYA 3V3KA 1N78A 2PA3A 4NPAA 1MP0A 1XDDA 3CNLA 3NASA 5A3JA 4BFLA 2CLEB 2HAEA 1OFHA 3QFSA 2V7XA 2B61A 5CLFA 1UIRA 5BUCA 3PUWA 4NICA 4J1TA 3AUSA 4EATA 1D4FA 1Z4KA 2DTDA 3K9BA 4GFDA 3HKDB 2ERCA 4EKDA 3IR6A 3AC0A 1FF9A 2ZOSA 4HH1A 5CBPA 5K3AA 5HRCA 4MKZA 4J1TC 3HKEB 3GPDG 3A37A 1RWOA 1JWAB 2BFOA 4GPD1 1Z2AA 4N7BA 3MTGA 2EQBA 4PQRA 3TL6A 4CL3A 4Q9KA 1VBNA 2AG1A 3E8SA 4Y0AA 2V7WA 2I78A 1OYVA 4Q4DA 1IHUA 4G0OA 3CCCA 3QIVA 1NZJA 1ZIDA 1GTRA 3MRXA 2DUUA 1E5VA 2FPGA 3EA4A 2OK7A 3Q5DA 4GL4A 3ONFA 1FNCA 4NK5A 4QUDA 1ID8A 1OX5A 1MJHA 5HIIA 5KDDA 2W37A 2ADFA 4WFKA 1V26A 1XU9A 2IQIA 4B3RB 4TV8B 3GYBA 1ID1A 1YS6A 4KQMA 4TTIA 4EUKA 5HQJA 3K0HA 3ZDXB 2PK3A 3I1YA 3URMA 4ERNA 2G4VA 3PCXA 4YFVA 3P2YA 4QBKA 5UKDA 1ESMA 1PKXA 1Z5WA 2AG0A 2PZBA 1SXJC 1FFXA 1UJMA 2XB4A 5CDFA 1M8PA 4F6CA 2ZIGA 1X80A 3WWEA 1IOVA 2W6IA 3V46A 1XQ9A 3G9TA 4EG8A 1KVUA 3C8HA 2ZYGA 4L6IA 2XVZA 4A0SA 1VL1A 1OGYA 2WILA 3AHJA 4N7RA 1X9GA 3WLAA 3NCHA 3R3SA 4CQJA 2EQAA 2XNSA 3AIKA 4MS3B 3IJEB 3RS0A 1G4HA 4U9UA 3NR2A 3WDKA 1C29B 3P4YA 4PTLA 5EC8A 1R0XA 4EGJA 1OYYA 1V25A 2FMXA 3ND5A 5K6AA 5IC5A 4OOFA 3RS9A 1FDVA 1KAGA 3L0IB 1C2TA 4JLKA 2BFBB 4XQGA 3HM9A 3ZTWA 1GGMA 3T1QA 3ZLTA 1BFDA 4K6HA 3UWPA 3PLAE 5A3QA 1EB8A 2HY7A 3HZOA 1L5GB 1Y0BA 3DCJA 1HQCA 3C6QA 4RKWA 3NG1A 2ZJ5A 4DS3A 2QTHA 4O4IF 3JWHA 3FMPB 4UC0A 2BHRA 5HTKA 1O94D 1QHYA 2F4NA 1XPUA 2EERA 2WTEA 3FKQA 4JC8A 3QK7A 4FJ0A 4YV0A 5IJ9A 1LF0A 3G2JA 3ZY4A 1SHTX 4FYYA 3AUAA 4RA6B 3R7FA 3SR0A 4O1MA 4P7KA 4F5WA 3DEZA 1SC1A 3KL2A 1TB4A 2C3MA 2VHVA 1MB0A 2MR5A 2O0KA 2RDMA 2F9MA 2R1VA 2V65A 4OM8A 1J1UA 1PF7E 4BO4A 1SC9A 4TXHA 3HABA 1H5NA 4P58A 2V7QA 1MW8X 4R5HA 2QIOA 2GUGA 3RYHA 4HOYA 5DBOA 2WSMA 3W79A 2BKAA 3DWIA 2O8DA 4M1TA 4Z86A 2FP4B 4G2TA 5JO0A 1W19A 4IOJA 2IXBA 2R97A 3C5WP 2A9JA 2WJWA 4M38A 1GEGA 3TRFA 3VVBA 2PFGA 1NQTA 3P4XA 4RK4A 4C0AC 3TL2A 1ZUIA 3QSGA 1T1RA 4UOQA 1CEQA 4U7PB 3RVJA 1V4NA 1WXEA 2Q50A 4FJ2A 4JJFA 3CM0A 5HCIA 3W9YA 5IC4A 3NO4A 4Y9TA 4YCNA 1SQGA 1YB6A 5IS2A 4YJDA 4DQUA 1FSZA 2Y1WA 3LNTA 2GLXA 1VHWA 3KQUA 4LYEA 2RGBA 2WJYA 2BGIA 2CXNA 1J6UA 4GWLA 5IKEA 5KQGA 1R4NB 4DW8A 3IRUA 4S04A 3OI7A 1W4CA 3V2HA 4BN4A 4P38A 2A5GA 1JPVA 4PICA 4O33A 4K26A 1U0OC 3MPOA 1U7DA 4TQAA 3WYEA 5KYYA 1VECA 3DXFA 1MGPA 1W85A 2ORVA 2PT7A 2YV3A 4FEGA 1E69A 4KXUA 4N9QA 4DCNA 5LYJF 2QX9A 2CHFA 2HNAA 1UZLA 2W11A 2BLNA 1OC2A 3RJMA 1BJKA 1I2BA 3ESYA 2Z5GA 5GP1A 3T7AA 5F9FA 1T9AA 3G89A 4MW0A 3KOOA 4RPKA 1DX6A 1HYBA 4XWTA 4LXIA 1VC2A 2EFCB 5GIPE 1CNEA 2IU6A 4KQXA 4MSUA 1T2AA 5GVRA 1FXUA 2HMWA 3DQPA 2ZI6A 1CDOA 2ZRDA 2CWDA 4DCSA 3ZVKA 1Y6QA 1E0DA 3VNSA 3NYRA 4H1HA 4ON9A 3U4IA 4DNQA 3EDRA 1DZIA 3CKKA 3T34A 1Q7CA 5C1PA 3D6MA 1YD7A 2DU8A 2GNAA 3WSWA 3BJIC 4RL6A 2I2WA 5EKSA 4E7OA 4ZTZB 1ADGA 3AB7A 3SLGA 1M2VA 1ZW1A 1FZQA 3EK2A 1LCIA 1WY5A 2PZEA 3L0YA 1J9EA 2ZTSA 1F5SA 1Q0RA 2BSXA 2QS9A 3IJRA 1HSOA 4CF4A 3CX8A 1HMPA 4DGSA 4BQIA 4ARBA 4B75A 2I3BA 2GN0A 2I99A 3DD5A 1ND6A 4IQGA 5CFQA 5IZCC 3FSRA 1Y7IA 1V47A 5DWVA 3SOZA 5ALHA 2A86A 3STHA 2HM7A 5G0TA 3UUEA 3C6KA 4JUCA 1RJGA 1EFVA 1NSTA 4Y1FA 5FYDA 4ZVRA 1CUEA 3QVGB 4ILKA 4CKWA 2PJRA 2F43A 5JARA 1X2BA 4LA4A 4MKXA 1G55A 2C9MA 1OXXK 5BT8A 1G20E 1BO6A 5JH7A 1JR3E 1OWNA 2C29D 3TGWA 4QDXA 1KETA 4PFQA 3NPMA 1QFZA 3NANA 2JASA 1OT3A 2X40A 1YCHA 3PX2A 3AHEA 1S7CA 1Z3IX 3CN9A 4PY2A 3QVJA 4K6MA 4ZXPA 3LOQA 4TL8A 3SF8A 3ZKWA 1O1YA 2XB9A 2B3DA 4RGQA 1G8HA 1ONBA 3HJGA 3C0KA 3A14A 5TQ0B 4KLCA 2QYTA 3DTVA 1MOSA 2I2BA 3W8RA 1AK1A 2BGRA 2IY7A 1LI5A 3AM1A 4FHCA 4XR4A 5C5DA 6CHYA 1LVHA 2CEKA 3EARA 3F6EX 3U80A 5B1IA 1U8EA 3E4DA 4CNQA 1MOZA 4AKHA 1P5HA 4FFDA 3GAMA 3OF2A 4GBMA 1KA9H 3GLIE 2HDNB 2JEYA 1RYFA 3E15A 1VMAA 3HWWA 3MRVA 2HV8A 4MDHA 4O3MA 1TTQB 4JA0A 4NYJR 4ZRDA 4E21A 5HF8A 2EC5A 5DTJA 2PZAA 4LVCA 2B6HA 2QRMA 2OV4A 3F7TA 3ONWA 3PIDA 2MINA 1M2WA 3PHCA 4OOEA 4R6XA 3SYKA 1HE2A 4CL0A 1KAMA 2VFAA 2VP3A 1HDRA 3OMWA 1ODFA 3R5XA 1SG0A 3UMRA 1QTIA 2VSQA 3QJ5A 1E1QA 1EI9A 4FMCB 1GILA 4OGKA 1KZ6A 4QREA 4ZYXA 3SD7A 3KNZA 4GYYA 4LZJA 2QU7A 4RDXA 1F9AA 3ZIAD 3AF5A 2I22A 3QPBA 5LR6A 4B3TB 1XDWA 3C8ZA 2P0AA 5JJ5A 4ASUD 1KDRA 1E6WA 4RD1A 3RV3A 1X1DA 2PSDA 3BMOA 3VC2A 4CFYA 4OL0A 2GF0A 4K2AA 3VYSB 5EI5A 3UHJA 3B5EA 2H92A 2Y68A 3LPMA 5FI0B 2NUBA 5KU7A 1VIAA 4GPBA 5BN3A 3WI7A 4X00A 5AM1A 4L5JA 1GTG1 3HJRA 1LDNA 1MW9X 4MA4A 5CDTA 4V0SA 1DC3A 1NRIA 3N8KA 4AC9A 3VZPA 1X7HA 5J2UA 1M73E 2QDKA 5JQGA 4MKRA 1CD5A 1IN5A 4E4TA 2NTYC 1M66A 6ADHA 1JJAA 3ZHCA 2WHQA 5EQDA 4K9PA 1U7OA 2VDWA 1JFVA 3BB4A 1UT8A 1CLEA 4NBRA 1NVKA 3OCWA 4CM7A 3FAKA 1QQ7A 1AGPA 2P4QA 4EMBA 5KOIA 1AQJA 1UPXA 2P40A 1U8UA 4M2LA 1ZX1A 5DFAA 3UV3A 3PGLA 5KTMA 2C9ZA 3E5MA 1D2CA 5EE5B 1U4OA 1E1RA 1X7WA 5GZ1A 3BMXA 3ENQA 1IZ7A 3QFTA 3T4UA 4B3CA 4EHKA 2HTEA 3PT9A 3VSEA 1FTGA 2XF2A 3VHXA 4KRYA 1PT9A 4DZZA 1S5PA 2ODTX 3IDQA 3B1VA 2C7RA 2JFHA 1JDPA 3EY9A 3MOSA 3N6VA 5T57A 3T7TA 1OH7A 4Y6GB 4WY2A 2VJMA 2IYOA 1II8A 2IXEA 1T24A 3L9WA 4F3TA 3SS7X 3HCWA 4JGIA 4PBRA 4P1ZA 3ZVNA 4C4XA 4BLVA 3OQBA 5JU6A 2ZJ6A 2G9UA 2MTBA 3VTZA 2WWYA 4YO8A 1G3UA 2QRJA 3TMKA 2GKSA 2UVPA 4BV3A 1T2FA 1YS2X 1XYYA 3OC0A 3UKOA 4ZIRA 3MBOA 3QXJA 3LHKA 4CKBB 4HAVA 4IZIA 2WAYA 4MWBA 3T7IA 1EG2A 1QH9A 4M0UA 3P0RA 5AUNB 1CUDA 3BORA 4URYR 2II6A 3ZE7A 1EXNA 2YZKA 4NZZA 1K7SN 1GQ2A 1I2DA 2W2XA 1YQTA 4QX6A 1XN1A 2QVLA 3IMCA 4QM7A 1U0HC 4R8KA 2DHDA 2ZKIA 2OHVA 5HKOA 3U61B 2I03A 2GCEA 4IOMA 5EQTA 1U8YA 2FWAA 4R3WA 1JDSA 1K4MA 3RC9A 3RRNA 4KK4A 2VPIA 1T6XA 5F4ZA 2BYTA 4MUYA 1KMNA 4E5VA 3U1TA 5BUQA 2RIPA 2GM3A 2R1VB 1X7DA 1XVVA 9LDTA 3ESAA 4QUHA 2XYRA 4FQ8A 1DKMA 5LP6A 4KQ9A 3Q3VA 4MRRA 3CF4A 1WA5A 3K16A 1GUAA 1Z6QA 4BEBA 1HT3A 2TMYA 3B85A 8OHMA 3DXYA 1CQIA 1RXUA 3HMKA 4JI2B 5HS6A 4MUIA 1XMPA 1YCGA 1R64A 4H3VA 3RVSA 4XR9A 1M5UA 3VH3A 3BGVA 4E5PA 1CZUA 1R8JA 1T13A 2JAUA 1MEEA 2W7TA 2ZSAA 5JADA 1M5TA 2IF0A 1ZN7A 4I9NA 3V4RA 1YTUA 2VYQA 2VUUA 2O6LA 3E7XA 5ER6A 2LKDA 3AEUA 4LF7B 3EISA 2J9YB 4JS0A 4OD0A 2O7RA 1PTJA 5E9QA 5IAGA 4YGXB 4FDTA 3OIFA 2BFCB 2P1ZA 3FJOA 4FW8A 3W2GA 3OURA 1BSVA 1KMHA 4TLMB 5GTDA 2BTEA 1J22A 1FP1D 1TZJA 3PFGA 3RPEA 1IXZA 4NECA 4ZOLA 1FW6A 2QPTA 4FCTA 2HT6A 3KJGA 4RWEA 5IX8A 3EIHA 2FZVA 5ABPA 4OV6B 4OHOA 5EUCA 3D31A 5FFMA 1JIXA 3K9QO 4Y6OA 2O0JA 5JJLA 2PJDA 4TTAA 1W85B 2C07A 2O4CA 1FYFA 1FFXB 1XZQA 2ZULA 3JD1A 3MJCA 3N28A 4JCOA 1YB2A 4JFRA 5D85A 3RQIA 5CEFA 3KT0A 5HCNA 2ZWPA 2F90A 4MUXA 1JDZA 2QLFA 5KYNA 1K5PA 1CR1A 1Z45A 2EW8A 2R2GA 2YV1A 3HJBA 3K0AB 3N0VA 3NX4A 3ZE0B 5CB4A 3FTFA 1Q83A 1II8B 1M0EA 2XGSA 3MWJA 4IFTA 3SEQA 5IAJA 3EXIA 3AR6A 3HZRA 4X62B 4HB3A 1CU1A 3PXEA 2ADMA 4NFYA 3TOCA 5HUQA 1HL7A