4KYWA

Restriction endonuclease dpni in complex with two dna molecules
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
254
structure length
254
Chain Sequence
MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCSEEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTPKSIIQRKPLAPTANRAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the methylation specificity of R.DpnI.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase/dna
molecule keywords Type-2 restriction enzyme DpnI
total genus 72
structure length 254
sequence length 254
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06044 DpnI Dam-replacing family
A PF17726 DpnI_C Dam-replacing HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kywA02
3.40.210.30 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 4kywA01
4IVNA 5BPIA 4MTDA 2VT2A 3W6JB 3MAJA 2DK8A 4YFNF 5E8IA 3N4MA 4HBLA 3C18A 3SXYA 1REPC 3LA7A 5ICGA 4XLNF 5DYMA 4PGHA 4RAZA 3HTSB 1U2WA 4KNYA 4CO8A 3IHUA 4MQVA 3ZN0A 2J5OA 2EV0A 2ZO4A 1O3RA 3GX4X 3Q5FA 3KE2A 4HLXA 3COAC 3ZMSA 1ZREA 3T5XA 1FYMA 1Z1DA 2ZJ2A 2O61A 1UHMA 1IN8A 4G7HF 1B6AA 1H0MA 3KP5A 4ZZLA 3K1NA 3J81Z 2NS0A 3KP2A 1P4XA 3KP6A 4PZJA 5LRSA 1YW9A 5BOXA 1LB2A 1XDUA 1BJAA 3BY6A 1U6GA 3TO9A 3QU6A 2EWNA 2MLKA 4WCGA 3B73A 2EK5A 4OU0A 2QZ8A 4NHJA 1OMIA 1G3TA 1XGMA 5J6XA 1R1TA 4IXAA 1OKRA 3DXJF 2KJBA 2JZYA 3QP5A 1S29A 2YX7A 2QUFA 4BHBA 1GVJA 2FU4A 1TTYA 3HOTA 5FFXA 1V4RA 1ZRFA 4A0XA 3O2PE 2DPDA 3WU0A 5HLIA 2JSCA 3JSPA 1U8RA 1PDNC 5F1RA 4P9FA 2MC3A 3G3ZA 3I58A 4MEXF 1W7PB 1JXSA 5TJJA 1U78A 2HFHA 5E1XA 4I2OA 2RVCA 4LK0F 2HOEA 3E5QA 2A6HF 2ETHA 4I02A 1IF1A 4ON0A 2GIVA 2XAQA 3GFIA 2HDCA 2QQ9A 3BOQA 3GXOA 3H3ZA 1FYKA 1K78B 2XUBA 2P5LC 3RKWA 4M9XA 1I6XA 5LHHA 1FC3A 4XSXF 1YTYA 1T6SA 2V6CA 1E2XA 2FNPA 4WF2A 3GVAA 1TLHB 2MH9A 3BROA 5D6EA 2BGCA 1J5YA 3P9CA 2H27A 3CUQA 3CUQB 4A5MA 4LD5A 1W5TA 5A2QZ 3WTXC 5CVVA 1TQMA 2EJRA 1B9NA 4B09A 2OQRA 4S04A 5DUKA 1F9NA 3E6DA 2WV0A 1ZH5A 5L3FA 4B8XA 3U9GA 4I0AA 5CYVA 5JFRA 4U0YA 2QQBA 4P9UA 3MZHA 5HLHA 3R61A 4AIKA 1WI9A 5HVQC 1YG2A 4G9YA 1FP2A 5D5XB 1BI3A 1YIOA 4IRHA 3WTUC 4HF2A 1BC7C 3JTHA 4WXDA 4HX4A 1SFUA 2CFXA 1AWCA 2PI0A 1LNWA 3FMSA 1FX7A 2DQRA 2VODA 1TBXA 2L02A 4I98B 1R00A 1QO0D 1IN7A 3BJ6A 4RGSA 1IRGA 3FF5A 3I5UA 1HXDA 4ESBA 5H6QA 2EFQA 3QP6A 3ECHA 1JGSA 3PQKA 3GFJA 2STWA 2C6YA 3C3WA 1XSDA 3I0TA 1XMAA 1NHAA 1ONVA 5ILUA 4WXHA 2P5KA 2L01A 1P6RA 3OOPA 4RGRA 1YLFA 1U5TA 1VTNC 3WU1B 2EFWA 3RYRA 4RAYA 2Z9OA 3F6OA 2P8TA 3K1PA 1U5TB 1UCRA 1XMKA 1P4WA 2IT0A 2ESNA 2FF4A 5DV5A 1YS7A 3CO6C 2ACJA 4U7DA 5AIQA 3TO6A 3LAJA 1BI1A 2NYXA 2COMA 4Z2YA 5BPDA 4A6DA 4U7BA 3F8BA 3I64A 1QNTA 2A68F 5D8KB 3FXQA 3HHHA 1CF7B 1G3YA 3E6BA 1KA8A 2E7WA 4BH9A 2P6TA 1ZN2A 4RB3C 1SFEA 3KZYA 4HA8A 3DV8A 3DP7A 3RKXA 1ZG1A 3R0JA 1XCVA 1XGOA 5EEGA 3P7NA 4KMFA 5E18F 1J75A 2KRFA 2DK5A 3WGIA 4LMYA 3B02A 3KLNA 3R4KA 1O3QA 2PLYA 5D5UB 1ZRCA 5HDGA 2P6SA 1PP7U 1FP1D 2DI3A 4LFUA 3WTZA 3I71A 2HQNA 2V79A 5AIPA 2MD5A 2EFNA 2DT5A 1WRJA 4AIJA 3WG9A 5K5QA 5D5WB 4ZYHA 4Q47A 1Y0UA 5D4RA 1V3FA 3P9IA 3SFZA 2MH2A 3KLOA 4CICA 1YW7A 2OU2A 2XASA 4CGZA 2PMHA 2D45A 2E1NA 3IWZA 3HRTA 3BJOA 4WXCA 4LB5A 2CG4A 2XAJA 3TGNA 3IC7A 2DFIA 3F8MA 4I7HA 3CUOA 2XAGA 5E1WA 3ERED 1DUXC 1K78A 3SZPA 4N9IA 5FLXK 3BJAA 1SD5A 3HSEA 3R60A 5HS8A 5BS6A 1QZZA 4ENMA 4OINF 4E70A 4HW0A 3HRSA 4KN7X 3CLOA 4MQ9F 3MWMA 4G94A 4QWQA 3LQRA 4HZFA 2JPBA 2EV6A 3HTUA 1FNNA 4KN4X 3C7JA 2DW4A 1EH8A 4UNOA 3KP7A 4PCQA 3K9TA 4IRIA 4ASNA 1G6NA 5HLGA 3I59B 1FWZA 4M72A 4ENJA 1WKMA 2LNBA 4HDUA 1O7FA 2QM3A 3I59A 1U5TC 3GZ6A 3W6KB 2WWYA 4P55A 6PAXA 2OD5A 3JSOA 4KA4A 4YG2F 3HSFA 5LGTA 1TW2A 5LGNA 4ESJA 1L3LA 4ESFA 2DO7A 3KETA 2XKPA 3H92A 1KGSA 1B4AA 1FY7A 2FBHA 2V9VA 4OIOF 4BQAA 1IAWA 3V7RA 1XGSA 1Z05A 1DP7P 3F6VA 2IA2A 4LK1F 4BAYA 3WGHA 5LGUA 3CO7C 4XSZF 4MGRA 2Z99A 2K4BA 2OBPA 2LDUA 5ICFA 4UVAA 1WSUA 2QYOA 4IPAA 4HX8A 4FX0A 4R1HA 2M45A 3ZMUA 1FSEA 3O3KA 3FHZA 3J80K 1RI7A 2KIMA 1FZPB 1IXSB 2BBYA 4YFXF 1F4KA 3HHGA 1S8NA 4CDGA 1ZG5A 2VBXA 1TNTA 2FNAA 3GEZA 2VT3A 3IL2A 4LLNA 5DDGA 1BIBA 4I0BA 2ISZA 1R36A 2J5PA 2R7FA 1B1BA 1ZLKA 5D5VB 2V1DA 2RNJA 5HOOA 1RUOA 3EYYA 2VONA 4PDKA 2CO5A 3R6SA 4DQ2A 4G6DA 2FMLA 5IT9Z 2CW0F 1SD4A 3E6MA 1BI2A 2HTJA 4O6JA 3EYIA 3KEOA 4AWXB 3QPTA 4HV6A 2LSOA 2K27A 2CGPA 2G7HA 4EM1A 4U0WA 4KFCA 2STTA 1A04A 2Y48A 2W25A 1LJ9A 1ZLJA 3F22A 4XRFA 1SMYF 2YX4A 2BV6A 4CHUA 3F23A 3GO5A 3E5XA 1OYWA 2HTSA 3EETA 3O6BB 1BC8C 3BPVA 1FYLA 1ZARA 2L4MA 4KYWA 1RIOH 3WTSC 4EGZA 2M87A 1QQIA 5JHUA 3SZTA 5DCMB 4HX7A 4L9TA 3J80Z 3RIRA 1HKTA 2E7XA 1I5ZA 1T38A 3IRRA 1FBQA 3QAHA 3J81K 4N9HA 2Y75A 2F5DA 5D6FA 3FZVA 3KZZA 1L0OC 4OIQF 1Z91A 2KKOA 4BHCA 1I27A 4HQMA 4G7OF 1YQAA 4S05A 1I1GA 2IRFG 1Z6RA 2G7UA 5D8LB 1S6LA 2NNNA 2O6GE 3VOEA 2O8XA 3TOBA 1HKSA 5L3BA 5ILVA 2XROA 3KP3A 2TDXA 2XAHA 5JI6A 1G3SA 3M1EA 1IN5A 5EEHA 2VBZA 3E97A 3DKWA 4A2UA 1HSTA 1PUEE 1S3JA 2UXNA 2XHKA 2H94A 5IT9K 2Z3YA 5LEKA 3FX3A 3EQLF 4HAMA 1FBUA 2HYGD 5DD4A 4Q5SF 4IHSA 4BXUA 4F7ZA 1STZA 2RN7A 3BPXA 1E17A 2DQLA 1C0WA 2IA0A 1IZ1A 4OIRF 3MCZA 2HGCA 3RDIA 5ICEA 4OMZA 4U0VA 5LBQA 3ZP5A 2ESHA 1I1SA 3WTWC 2F5FA 2GQQA 3WTVC 1EV7A 1J2XA 4KMUX 2AXLA 4IJAA 3I53A 2E1CA 2GA2A 2CSOA 1Q1HA 2M30A 1XD7A 2ZBKA 3WTYC 1IW7F 2YPRA 1IRFA 3L9FA 2A69F 2XGXA 4HDVA 1U3EM 1FBSA 5ERIA 5ED4A 1R58A 1IXRC 1LDJA 2QBYB 1ON1A 4HF1A 1T0FA 1KU7A 1JHHA 1P4AA 3TDUC 1QBJA 1LVAA 1QPMA 1WQ2A 4LJZF 2LF7A 3V8LA 2K02A 3TO7A 1BN5A 2DLLA 5AONA 2WC2A 3Q9VA 4FX4A 2A6EF 2XRNA 4KIGA 4WX9A 1Z6TA 2D1HA 1KYZA 1MJ9A 2MBFA 2VBYA 3FMQA 4KIFA 4KDPA 1YS6A 5E8GA 2FSWA 3CTAA 1XN7A 4ZH4F 4BNCA 3NQOA 5L3CA 4L18B 1LDDA 2GXBA 4L0YB 1H9GA 2IVMA 5LEJA 2OZUA 2PJPA 3L7WA 4EJVA 3K2ZA 1KQ9A 4LG0B 3JW4A 1USSA 2QVOA 4L5JA 2UXXA 1O3TA 1P92A 3R0AA 1IN4A 3ROUA 3D0SA 2OA4A 3TQNA 1HW2A 3K1MA 3LQQA 5KK1A 4K2EA 3ELKA 1MDMA 2W84A 4M74A 5LHIA 1B9MA 5DEQA 1OYYA 5FB2A 2IPQX 5DCFA 2OZ6A 3HRMA 4PGGA 2O0YA 1ZYRF 2JPCA 3KEQA 3GUDA 2F5EA 1KU3A 2M8EA 2LF8A 4YIFA 4GXOA 1T2KA 2Q0OA 2F2EA 4CXFA 2A5YB 3NRVA 3L2CA 1RUNA 1G4DA 2JRTA 1D8KA 1F1ZA 3ZMDA 5CLSA 2OQGA 3IRQA 1GXPA 4MEYF 1FLIA 2HYFA 2EA2A 3FMRA 4ETSA 1LDKB 4ZYEA 5H20A 1Z7UA 3M8EA 4UXNA 1CF7A 2FQ3A 2VE9A 4LLLA 1MJAA 3KFWX 2KIUA 2PQ8A 3M8FA 2H6CA 1XDSA 2FRHA 1O57A 1P2FA 3VFZA 3LAPA 1XCBA 1LEBA 3LA2A 1CGPA 3ZPLA 3BZ6A 3HOSA 4GYGA 2A3SA 1J9IA 1OPCA 3L00A 2K4JA 5DCMA 3FM3A 2ZNZA 3GLXA 3DPTA 4UVBA 2BEOA 2ELHA 4UV8A 2VOOA 1K7AA 2P7VB 2XIGA 4GO1A 3MFKA 3T8RA 1JE8A 3Q9SA 3E6CC 3K0LA 5FD5A 2GWRA 1OR7A 2HQRA 3LSTA 3HSRA 1HSJA 1YFHA 2W24A 3T0YA 4OOIA 3ML6A 3N97A 2VBWA 3MEXA 4EJTA 3ISPA 3ZN1A 3ZQ7A 3ABTA 1YO5C 4ZZDA 1KYWA 1LEAA 2IP2A 5K5OA 2L3DA 1KU9A 2PBIA 1W7PD 4ENNA 3BP8A 4Y15A 2K7LA 3E5UA 4IF4A 2NNYA 1XSXA 1K79A 4M71A 5DUIA 5J8CA 1GHCA 4O3MA 5BQTA 2HKOA 1TQIA 1IN6A 4DNCA 1R5GA 3FM5A 5LRRA 5ICCA 4G8XA 2UZKA 3JAMK 1J7KA 1XGNA 3MQ0A 4OMYA 1ULYA 4XBFA 3RJPA 3VEPA 5H6RA 1JHFA 1TNSA 2RV8A 3GF2A 4KIBA 3D5LA 2DPUA 2FA5A 1Z9CA 2FBKA 5CVUA 1RNLA 1HBXG 2HZTA 3M9AA 3WE3A 2VXZA 5IT3A 4JBAA 1XB4A 4R8HA 2FEZA 4M73A 1F5TA 3HRUA 2WTEA 1GXQA 2QENA 1SD7A 1EH7A 3REOA 4RS8A 3FXRA 4L9NA 2AS5F 1BBYA 1UHWA 1AOYA 2D2WA 3JAMZ 3WE2A 4OIPF 2YSRA 3NEUA 4RB2C 3MZYA 3JTGA 1K6OA 2RDPA 4D0PA 2P7CB 2GZWA 3TOAA 1BOAA 4G6QA 3EUHA 4NQWA 4YFKF 4ZYGA 2ZFWA 4L5IA 1ON2A 3PFIA 1KQ0A 1W5SA 1BM9A 4EQQA 1FSHA 3SHFA 2O03A 3CJNA 2G9WA 2A07F 3F21A 2H6BA 1MDMB 5FD6A 2D1VA 2NRAC 3J7AO 1W7PA 4RB1A 4RGUA 4M6XA 3LWFA 2B0LA 2OAZA 4AD9A 4LGWA 1XSVA 2ZCWA 3VB2A 3C1DA 3QU3A 5BMZA 1DPUA 5E1ZB 3BDDA 3BWGA 1PP8F 3U2RA 2IA1A 3K69A 1UFMA 5TRDA 1MGTA 4EJWA 3E3VA 4ENKA 4WK8F 2LKPA 2XV4S 4H0EA 1SAXA 4Y17A 2FOKA 3RTRA 2O3FA 1J0RA 1SD6A 4M9SA 3IWFA 3AAFA 4L9VA 3V8KA 1ZGJA 4Q4ZF 4HQEA 2ISYA 2DTRA 2YR2A 3TDZC 5HS9A 3KP4A 4GCVA 2FXAA 4N0BA 1YYVA 1MZBA 3H3UA 1D8JA 4L0ZB 4LLGF 2VOPA 4XLPF 1RZ4A 1R22A 4YIIA 5L3EA 2R3SA 5FGMA 2EB7A 3TKYA 2VC0A 2L4AA 2HR3A 4I09A 1OYIA 4GGGA 4JK1X 1SMTA 1FT9A 1LQ1A 2Z33A 2IW5A 2IJLA 1S7OA 2Z5UA 3SQNA 2QBYA 2MLGA 2RKHA 1ZAOA 3ABUA 4UV9A 2EV5A 5JVTA 4EJOA 5ILSA 3F8FA 3DF8A 3ZMTA 4AIHA 3I54A 5FLXZ 2VN2A 5CVIA 5DD8A 2CQKA 4P5OA 1O3SA 2PFBA 3CUQC 2XKOA 3IKVA 5K1YA 2F5CA 2V1UA 3ZMVA 3M7GA 3VODA 2V1XA 4MTEA 5L3GA 3EDPA 4UHTA 3WGGA 1B59A 3FXUA 3T1BA 1QGPA 3LA3A 3ULQB 5F64A 1DPRA 4EVIA 4BYYA 4CZZA 1R1VA 4U88A 3V4GA 1T98A 1IXCA 2HKXA 2QLZA 4BHPA 4UUVA 1H9TA 2X4HA 4A6EA 4KUMA 4HF0A 2ZMEA 2EA4A 3PQJA 4A5NA 1SFXA 4KICA 4EV0A 1R23A 3GZ5A 5CJ9A 5HDKA 1ODDA 2ZXJA 2RGVA 4AVPA 2Q2EA 5J8FA 3RI4A 3GFMA 3LFKA 5HDNA 4R79A 1TQPA 2CWEA 1EH6A 2KIFA 3RKYA 1J59A 3HUGA 3I4PA 2DU9A 1HW1A 4M9ZA 2KJCA 4IRGA 1BIAA 3KCCA 4ZYDA 2XVCA 2PEXA 2A61A 5FO5A 4EGYA 3S2WA 3G73A 3GW2A 3QOPA 3RPQA 2PMUA 2Y0MA 3F3XA 3WTTC 3GWZA 4NB5A 3P9KA 3HYIA 4A0YA 4QLCU 3DPLC 3QPHA 1ZHFA 2R7DA 5L3DA 1R7JA 2BYVE 2PG4A 1MD0A 2JTVA 2DBBA 1MJBA 5CVRA 1O7LA 2YU3A 1ZGAA 2RQPA 3HIFA 3V7SA 4EM2A 3DQVC 4O5VA 5A2QK 3DFGA 2ZKZA 2NAZA 2HWVA 4TV7A 4M6YA 4UVCA 1HQCA 2K86A 4LB6B 2FBIA 4FT8A 3RPUA 2DAOA 4HOBA 1TW3A 4A12A 5JR3A 1HW5A 1BI0A 1G3WA 2M1BA 4I01A 3RYPA 3OV8A 3FWEA 4JQFA 1ZRDA 2UWMA 2VE8A 2JT1A 2W85A 2FE3A 2ZNYA 3QRFF 1D5VA 1FPQA 2H09A 2M5WA 4LG0A 2EFOA 3V7CA 5CVJA 2QWWA 4A0ZA 4HLYA 2HS5A 4IHTA 3F72A 5LHGA 1ZG3A 3DEUA 2RC4A 1X3UA 1QZYA 1UB9A 5KVRA 2ADUA 3L09A 3V8JA 4HV5A 2QQAA 4G7ZF 3GYHX 4EM0B 1YW8A 2GA1A 3IKTA 2X0LA 1S7AA 1T39A 4MHGA 3ZMZA 2BE5F 1IUYA 2HEOA 3F8CA 2MA3A 4Y13A 2P5VA 2P4WA 3ECOA 4Q48A 1DDNA 3GFLA 2XAFA 4WWCA 5FFZA 4EJUA 1KU2A 4CYDA 2VC1A 1HKQA 4KT5C 4RGXA 5K5RA 2GXGA 5HS7A 2W57A 1WWXA 1D3YA 4HYEA 2CYYA 3CDHA 4EMSA 4MNUA 3F8NA 3WODF 2FMYA 2EFPA 1MKMA 3T8TA 1FOKA 4GYIA 2ZMEB 4RB0A 5D4SA 1W4MA 1USTA 2L54A 4P96A 2PN6A 5LLQA 1R5HA 4FHTA 2GAUA 1R1UA 4L9JA 2Q8KA 5E17F 5F6FA 1KQ8A 5E20A 3U1DA
chains in the Genus database with same CATH superfamily
3IH3A 4IVNA 5CPRB 5BPIA 1BJZA 3I9V2 4MTDA 3HOVJ 3TP0A 4MFDA 3GCMA 5J4YA 2VT2A 2Y0SA 1K4SA 3W6JB 3MAJA 4EEFG 2DK8A 4YFNF 4BQQA 5E8IA 4DBRA 2R0QC 3VPRA 3OR2C 1QVTA 3N4MA 4HBLA 3C18A 3SXYA 1MNEA 3PNYA 1REPC 1JKOC 3LA7A 4FASD 1FTTA 1XS9A 2LG4A 3NWTA 5ICGA 1SAUA 4XLNF 4FTHA 5DYMA 4E7HA 4PGHA 1MNMC 2DJNA 2WADA 3FISA 5EZHA 4RAZA 1R4NB 3HTSB 1I3QJ 3OYGA 1U2WA 4KNYA 3HEFA 3GTLJ 2WV1A 4CO8A 4C3HJ 5KCMA 3IHUA 3CCQI 5EGOB 4ZDOA 4MQVA 3ZN0A 1ETWA 2J5OA 4XIDA 2EV0A 1X1DA 2ZO4A 1O3RA 3GX4X 4F92B 5FLMJ 3Q5FA 3KE2A 2Z1DA 4HLXA 1WH5A 3COAC 3ZMSA 1E3PA 5DM6F 1ZREA 2LY9A 2BY3A 3T5XA 5CQEA 1FYMA 1Z1DA 2ZJ2A 2O61A 1UHMA 3DTKA 4IHYA 1IN8A 4G7HF 4YEJA 1B6AA 3IUOA 1H0MA 3KP5A 4YRVA 4A3LJ 4XK4A 4QIWN 2K9NA 3SDBA 4ZZLA 1BA5A 2EIMH 5EJCA 4RBOA 1IJWC 3K1NA 2HVQA 3J81Z 3J7AY 2NS0A 3KP2A 1Z77A 1P4XA 3L2UA 3KP6A 4PZJA 5LRSA 1YW9A 5BOXA 1LB2A 4BKXA 5GADJ 1XPXA 5GAEJ 2X6OA 4ZDLA 1XDUA 1JUMA 3VSKA 1JGGA 1BJAA 2R5YB 3BY6A 1U6GA 3TO9A 3QU6A 5HODA 2EWNA 1H89C 3VSLA 4M6VA 2MLKA 4WCGA 2Q10A 1Z21A 3QWLA 1S5LC 3B73A 3IAS2 1A31A 2EK5A 4OU0A 3MD2A 4CCNA 2QZ8A 4NHJA 1OMIA 4BE2A 1G3TA 1XGMA 5J6XA 5IOZA 1R1TA 4IXAA 1OKRA 3H9GA 2HXOA 3DBHB 3DXJF 2O9LA 2KJBA 5IP7J 2JZYA 3QP5A 2E5NA 1S29A 2YX7A 4FE7A 4DGWB 3HOUJ 1VQ4I 2QUFA 4BHBA 1GVJA 2FU4A 2Y31A 1TTYA 2QGUA 5FFXA 3CP8A 3HOTA 1V4RA 1ZRFA 2E5ZA 2KRHA 4A0XA 3O2PE 1TZLA 5CKTA 2DPDA 2ZSHB 1GVDA 3X2QH 3WU0A 5HLIA 1PVUA 2RQQA 4FE4A 5LFAA 2JSCA 2X48A 1N75A 3JSPA 4PJJA 4U87A 3ZQHA 5IY5H 1U8RA 1PDNC 3DKXA 5F1RA 4P9FA 2MC3A 4B43A 4YELA 4IKFA 3G3ZA 2K3FA 5FJ8J 2MW8A 3I58A 1LKXA 4MEXF 1T8IA 2D5VA 2XGEA 1W7PB 2BHYA 2ME6A 1JXSA 1YJWI 5TJJA 1RKWA 2JVGA 1UELB 1U78A 3BZCA 2VIXA 2HFHA 5E1XA 4I2OA 2MG4A 2RVCA 1B72A 3CJQB 4LK0F 2DJIA 2HOEA 3KYLA 2ZJQF 2OV7A 1MBKA 3E5QA 2A6HF 2ETHA 2E34A 1OQYA 4I02A 1IF1A 1OCRH 4ON0A 2GIVA 4XLFA 2XAQA 3GFIA 2HDCA 2MD0A 2QQ9A 3BOQA 3GBGA 3GXOA 2A6TA 3H3ZA 1K78B 1FYKA 2XC7A 2XUBA 2WAFA 2P5LC 1WGXA 3RKWA 2W1OA 4M9XA 1TWAJ 2M2EA 1I6XA 5LHHA 1FC3A 4XSXF 4XLCA 2VUMJ 1YTYA 4F55A 1IDZA 1T6SA 2V6CA 1WJBA 1E2XA 3CMYA 2JRMA 4UUSA 3ABKH 4DJAA 3CESA 2FNPA 4WF2A 3GVAA 1TLHB 2F48A 2KP6A 4E7SA 2MH9A 3BROA 4XQFA 2LFBA 3HJEA 5D6EA 2BGCA 1MBEA 1J5YA 3OYHA 3P9CA 2H27A 3CUQA 3BQZA 3CUQB 4B4CA 2DA2A 1WJ5A 3HG9A 4A5MA 1V5FA 1VQ9I 2KZGA 4LD5A 1W5TA 5A2QZ 3WTXC 5CVVA 3HPGA 1TQMA 2EJRA 3OYKA 1I3AA 3HKZA 1WI3A 1B9NA 3OWTA 4XOPA 2E2JJ 4B09A 2DT7B 2OQRA 3S1QJ 4IZZA 2X6WA 5IOYA 4S04A 4XONA 1R4MB 5DUKA 1F9NA 3E6DA 3E0JB 2WV0A 1ZH5A 4B48A 5L3FA 2OUMA 3GZNB 5EZGA 3U9GA 4B8XA 4D9JA 4I0AA 1LPQA 5CYVA 5JFRA 4LIVA 2BY2A 4OAYA 4U0YA 2QQBA 1T33A 4P9UA 3MZHA 5HLHA 3R61A 2R7TA 2WAQN 3DWLE 2K9QA 1W0UA 4AIKA 3VDXA 1WI9A 5C3EJ 5HVQC 2VPLA 1YG2A 2M3AA 2ME0A 4G9YA 1FP2A 5D5XB 1BI3A 4CCJA 1YIOA 4MFEA 2DA4A 2VXDA 4IRHA 3WTUC 2H8WA 2PVIA 4HF2A 2EIJH 3OOUA 1X3WB 1BC7C 2BXZA 3LL7A 3JTHA 4WXDA 4HX4A 1SFUA 2CFXA 3EUAA 4XN0A 4OWRB 1AWCA 2PI0A 1YI2I 1LNWA 3FMSA 3A4CA 1FX7A 4C30A 2DQRA 2K9SA 2VODA 2WAQA 1TBXA 2L02A 5GAHJ 4I98B 1R00A 1QO0D 1IN7A 3BJ6A 1OFCX 4RGSA 2X1CA 2R5ZA 3S32A 1IRGA 4Y3OA 3FF5A 3I5UA 1HXDA 4B3AA 4ESBA 5H6QA 2DOEA 2EFQA 3QP6A 3PNVA 3ECHA 4NC7A 1JGSA 2QA4I 1JJ8C 2PJRA 3PQKA 2H1LA 3GFJA 1TL8A 3QODA 2STWA 3HBLA 2C6YA 3C3WA 3CCYA 3TBIA 1XSDA 3F0CA 3I0TA 1W0TA 1FIPA 1XMAA 1NHAA 1Z0XA 1ONVA 3S16J 3CCJI 5ILUA 4WXHA 1Y8RB 2P5KA 2L01A 1P6RA 2PJRB 1X1CA 4NC8A 3P5JA 3OOPA 4RGRA 1YX3A 1YLFA 1U5TA 2KHMA 1VTNC 4ANJA 3HB9A 3WU1B 2EFWA 3BCAA 1NG6A 2QKLB 5JLXA 2R92J 3RYRA 4RAYA 1YIJI 2Z9OA 2QCOA 1MW7A 3F6OA 3L2QA 2P8TA 3K1PA 3JRAA 1U5TB 2PMZN 1ZQ3P 1UCRA 1XMKA 4XN3A 1ETOA 1P4WA 2OC6A 3QPSA 2HPMA 1V5EA 1NK2P 2IT0A 2WA0A 2ESNA 2EH3A 2FF4A 4PJLA 5DV5A 1YS7A 3CCRI 3CO6C 1YRNA 3BC8A 1PUFA 2ACJA 4U7DA 4KJZA 5AIQA 3TO6A 3LAJA 1BI1A 2NYXA 3EUHC 1SC7A 2E19A 2COMA 4Z2YA 5BPDA 4A6DA 2NVQJ 3PFYA 2JA6J 1RKTA 2UUZA 4XRMA 4M3BA 4U7BA 3F8BA 3DEWA 3I64A 1QNTA 2A68F 2K40A 2L0KA 5D8KB 1U9OA 3I55I 2Y9ZA 3S3NA 3FXQA 3HHHA 1CF7B 1G3YA 2DDAA 3E6BA 2FOWA 1RR8C 1KA8A 2E7WA 4BH9A 2P6TA 2ID6A 3OYJA 1ZN2A 3CF2A 1V5GA 2DMPA 1SFEA 4BY7J 3KZYA 4RB3C 2NOGA 4J01A 2R4GA 4HA8A 1IUFA 1LFPA 3DP7A 3DV8A 3RKXA 3AG3H 1U8BA 3ZXSA 1ZG1A 3R0JA 1XCVA 1XGOA 5EEGA 2M4KA 3SEQA 3P7NA 4E7JA 4KMFA 5J1RA 5E18F 3UKGA 3CC2I 1OCOH 1J75A 3PSIA 2Y9YA 2KRFA 3PUFA 2DK5A 1ZGWA 3WGIA 4LMYA 3B02A 4XKBA 1RRJA 2ZXWH 3KLNA 2WB1N 3R4KA 2EZLA 1O3QA 2PLYA 3CMAI 5D5UB 2Z2SB 2EZHA 1ZRCA 5HDGA 3MVPA 2P6SA 3K7AJ 1VQPI 2DTZA 1PP7U 1FP1D 1GV2A 4D5CA 2M0CA 2DI3A 3HC7A 1RR7A 3QPLA 3DBLB 4LFUA 3WTZA 3I71A 3OS1A 2HQNA 2V79A 1W36D 3A2KA 2BW3A 5AIPA 2ZB9A 2A05A 2MD5A 2TRTA 4UUTA 2W7NA 2EFNA 2DT5A 3UNGC 1WRJA 4CA0A 2DA3A 4AIJA 4BE1A 3WG9A 5K5QA 5D5WB 5JLWA 4ZYHA 4Q47A 1Y0UA 5D4RA 1TT5B 1V3FA 3P9IA 3SFZA 2MH2A 3CQZJ 3KLOA 1Y8QB 1UG2A 4CICA 1YW7A 1VQ6I 2FX0A 2OU2A 2H8RA 2R7QA 5F27A 2G0EA 1TWHJ 2XASA 4CGZA 2PMHA 2D45A 4IHVA 1D1CA 3SJMA 1WVRA 1AU7A 2E1NA 3FHNA 3IWZA 3HRTA 4IHXA 3BJOA 2MFZA 3U1KA 4WXCA 4W1UA 4KITB 4LB5A 2CG4A 2XAJA 3I4NJ 1WJFA 3JREA 3TGNA 3VWBA 2M4GA 2IS2A 4AM3A 3IC7A 2DCEA 2DFIA 5E79C 3W2WA 3S17J 3D5SC 1MBGA 2LLKA 3F8MA 2JN6A 4I7HA 3CUOA 1D0YA 4XICA 3OYIA 2BW3B 2XAGA 2O8KA 1K83J 4C2UA 4KT6A 4CSWA 2BZTA 3HOWJ 4QSHA 5E1WA 4PJ0C 3DKYA 4HNTA 4Z6YA 3ERED 5EG0A 2Y30A 4N4OB 2HDWA 2AO9A 1RPWA 2R7SA 1DUXC 1K78A 5EDNA 1RC9A 3RZDJ 1IG7A 4BBRJ 2A5WA 3SZPA 4N9IA 3F9KA 4BQNA 1YRNB 3S8PA 2RNGA 3BJAA 3BR6A 5FLXK 1SD5A 3HSEA 3R60A 5HS8A 5BS6A 1WFXA 1VZ0A 5J47A 1QZZA 4ENMA 3KIOA 2K5CA 3CLQA 4OINF 5F0HA 1UHSA 4E70A 3WHCA 4HW0A 1ZELA 3S2HJ 1K0ZA 3HRSA 4KN7X 3N05A 1ZR2A 4ABZA 3CLOA 3PM1A 4MQ9F 4XKCA 3MWMA 4G94A 1IC8A 4QWQA 3BQYA 2L7MP 3LQRA 4HZFA 1Z3XA 2JPBA 2QF7A 1M1EB 2EV6A 3HTUA 5FKOA 3DU5A 1FNNA 4KN4X 3C7JA 2ODHA 2DW4A 3WHBA 1EH8A 4BE0A 3KP7A 4UNOA 4PCQA 3K9TA 2HOSA 2ZMEC 4EATA 4IRIA 4F3QA 2X6XA 1POGA 2B63J 1I6HJ 4ASNA 4N4NB 1G6NA 5HLGA 3I59B 5HNFA 1FWZA 2F5VA 2ZXIA 4M72A 2CQNA 1QZEA 2CS3A 4BL0B 4ENJA 1WKMA 2LNBA 4HDUA 2MABA 1O7FA 2QM3A 3I59A 3A03A 2H1KA 1U5TC 3GZ6A 3W6KB 4KISA 3KPHA 1BOBA 3H35A 2WWYA 2L9SA 3LSMA 4P55A 6PAXA 2OD5A 3JSOA 4KA4A 2Z16A 4YG2F 3HSFA 5GPCA 5LGTA 3MKZA 1TW2A 5LGNA 1H88C 4ESJA 2E2IJ 1L3LA 1DQUA 3OIOA 2IXSA 4ESFA 2DO7A 4CCOA 3KETA 2KDOA 1NH3A 4NQWB 2KQRA 3ONQA 4II2A 2XKPA 3H92A 1KGSA 1B4AA 3IP4B 1FY7A 2FBHA 2V9VA 4OIOF 4BQAA 3LOCA 4GDFA 3LSPA 1IAWA 4RDUA 3H36A 3V7RA 1GUUA 1DGRM 1XGSA 1Z05A 4BU2A 1JKQC 1JJ6C 1DP7P 3FXLA 4HSTA 3F6VA 2IA2A 4LK1F 4AYBA 1T08B 1TWGJ 4BAYA 3WGHA 3K6GA 2L7KA 3K4JA 2LH9A 4G6TB 5LGUA 1MNDA 3CO7C 4IQJA 4XSZF 4MGRA 3JRIA 3FKIJ 2XGDA 1N25A 2DDBA 2Z99A 3DPUA 2K4BA 3DLAA 4V19K 2OBPA 2LDUA 5ICFA 2DYRH 4QPQA 4UVAA 3Q3SA 1WSUA 5FRNA 4XOTA 1EA3A 1T95A 1XTAA 2QYOA 4DIQA 3FIWA 4IPAA 4HX8A 3ZQLA 4FX0A 2R7ZJ 1GDTA 4R1HA 2M45A 3ZMUA 1QVUA 2I8DA 3BR1A 4XL9A 2VQHA 4X0GA 3HOXJ 5IYDJ 1FSEA 3O3KA 3FHZA 3J80K 1RI7A 2KIMA 1FZPB 5GAGJ 3HOYJ 1SEUA 1G8XA 1IXSB 2BBYA 4YFXF 4XKWA 1MMGA 1F4KA 3HHGA 1S8NA 3BCBA 2LREA 4CDGA 2WAEA 1ZG5A 2VBXA 1TNTA 1JTYA 3QOEA 4XM3A 2ICWG 2M7AA 2FNAA 4RMNA 2DA5A 1BL0A 3GEZA 2VT3A 1UJ8A 3IL2A 4LLNA 5DDGA 1BIBA 4CYCA 4CYCB 4I0BA 2X51A 2ISZA 1R36A 2J5PA 2R7FA 1DGWY 1B1BA 2W00A 2F4OB 4A3MJ 5D5VB 1ZLKA 2CUFA 2V1DA 2RNJA 2M9HA 5HOOA 3OIPA 3OYCA 1RUOA 2LP0A 2DMTA 3EYYA 2LR8A 2XSDC 2VONA 4PSWA 1BR2A 4PDKA 2ID3A 2CO5A 3R6SA 2M7BA 4DQ2A 2N8GA 4QPOA 4G6DA 2FMLA 5IT9Z 2CW0F 1SD4A 1JTXA 3E6MA 4M3EA 1BI2A 2BY0A 1E3OC 2DA1A 1XMXA 5FLVA 1OJLA 2HTJA 4O6JA 2R7VA 2R7XA 3EYIA 1WJDA 2WBMA 3KEOA 3QPTA 4AWXB 4HV6A 2F4IA 3E1SA 2LSOA 3FXKA 1DU6A 2FJ1A 2K27A 2CGPA 4II3A 2G7HA 1FOYA 4EM1A 4U0WA 4KFCA 2STTA 5C4XJ 1A04A 2Y48A 1K61A 1ETXA 2W25A 1I39A 1LJ9A 1ZLJA 1UZCA 3F22A 3LSJA 4XRFA 1MH4A 1SMYF 3MZ8A 2WY7Q 2YX4A 2BV6A 4CHUA 3F23A 3GO5A 1B72B 2XPVA 3E5XA 1OYWA 2HNHA 5GP9A 1X4PA 2V9PA 1O4XA 2HTSA 3EETA 3O6BB 1WH7A 3U21A 1BC8C 3BPVA 2P0WA 2L9VA 1FYLA 1ZARA 2L4MA 4KYWA 2NS8A 1RIOH 3BG5A 3WTSC 4HEA2 4NUBA 1SANA 3G1LA 4EGZA 2M87A 2OTJI 1QQIA 5JHUA 3SZTA 3JR9A 1SVLA 2CUJA 5DCMB 2L7ZA 4HX7A 4L9TA 5EEAA 3J80Z 3RIRA 3G2BA 1HKTA 2L9RA 2E7XA 1I5ZA 2VJ4A 2CMPA 3IRRA 2R5YA 1T38A 1FBQA 3QAHA 4C9YA 3TW6A 3J81K 4N9HA 3LSHA 2Y75A 1YX5A 2F5DA 5D6FA 3IMBA 5K7ZA 3Q0WA 1KZHA 3FZVA 1VQLI 3KZZA 2NVTJ 1L0OC 1X1AA 2F6CA 4OIQF 1Z3YA 1Z91A 2KKOA 4BHCA 1I27A 2IGKA 4HQMA 4G7OF 1YQAA 4S05A 2HQAA 1I1GA 2IRFG 1Z6RA 2G7UA 5D8LB 2LVSA 4B3XA 4E4HA 1RETA 1DU0A 1S6LA 2XRLA 1HDPA 2NNNA 2O6GE 3VOEA 2O8XA 2OCCH 2XPWA 3LSKA 3TOBA 3D1NI 1HKSA 2CJJA 3HUGB 1GV5A 2IGOA 1SVMA 5L3BA 5ILVA 3BG9A 2XROA 3KP3A 2TDXA 4C3IJ 1T56A 1W5CC 2MYSA 1A5JA 1IRXA 2XDVA 2XAHA 2DMQA 4E7LA 3BG3A 5JI6A 2CH0A 2VPRA 3Q0VA 1G3SA 3EUKL 2GLOA 3M1EA 1IN5A 3IH2A 1GLNA 1OISA 4A3BJ 5EEHA 2F4MB 2VBZA 3E97A 3DKWA 4A2UA 1ETVA 3G1MA 2HU9A 4JX5A 1IV8A 1HSTA 1PUEE 3M8JA 1S3JA 2UXNA 2JK3A 2ZXHA 1JT6A 2W48A 4UUSB 2XHKA 1FJLA 3MKLA 2H94A 3OL4A 4E6KG 5CQGA 2M0MA 3PO3J 5IT9K 2Z3YA 2OAAA 5LEKA 3ERMA 3FX3A 3NAUA 3EQLF 4HAMA 1FBUA 1QRYA 2HYGD 2NVYJ 4D7NA 5DD4A 4Q5SF 4F52A 4BXUA 4F7ZA 4IHSA 1D0ZA 1STZA 2BOLA 2LY2A 2RN7A 4JOMA 1Z67A 4D5FA 4YIRX 3JRCA 3G71I 3BPXA 1E17A 2DQLA 3KYCB 1C0WA 1TWCJ 1P7JA 2NVUB 2BVLA 2CV1A 2IA0A 1IZ1A 2VKEA 4OIRF 1BW5A 2EIKH 3BR3A 3MCZA 2XF5A 3OSGA 4BEHA 2HGCA 2BHZA 2LYCA 3PJRA 3RDIA 5ICEA 5E3OA 4OMZA 4U0VA 5F1JA 5LBQA 4CCLA 2ESHA 3ZP5A 4A3EJ 1I1SA 4A3CJ 2X9DA 3WTWC 3GTJJ 2DYSH 1ITYA 3S14J 2W82A 2HQ5A 2F5FA 4BUPA 1ZR4A 2GQQA 2BXYA 3WTVC 2KPMA 1SFOJ 1EV7A 1Y6IA 4ZDPA 4A3KJ 5F08A 1J2XA 4KMUX 1ORKA 3S1NJ 2AXLA 1D1BA 3ASOH 3O8GA 1P9QC 4IJAA 2MSYA 2CW8A 3I53A 5K7FA 4JX4A 1HLVA 2E1CA 2GA2A 2CSOA 1JUPA 1Q1HA 2HXIA 2M30A 1E0EA 2JA2A 1XD7A 2EQRA 5M3MJ 2R7RA 2LD5A 5IP6A 4MO7A 5TISC 2ZBKA 1X58A 3WTYC 1IW7F 2RAEA 3DTIA 2YPRA 2IEKA 1Y0NA 1IRFA 3AG4H 3L9FA 4ZC3A 2A69F 2OCEA 5KNLA 5EGOA 2XGXA 4HDVA 1U3EM 1FBSA 2AQFA 5ERIA 5ED4A 1R58A 1LFUP 2VQCA 2Y2ZA 1IXRC 1Y1VJ 1LDJA 3G1OA 2QBYB 1ACIA 2EBIA 1ON1A 4AU7A 4HF1A 1T0FA 1KU7A 1JHHA 3W3CA 1PVIA 4A3DJ 1P4AA 3TDUC 4BJTA 1LVAA 2EZIA 1QBJA 2DFHA 1XC5A 1ETYA 1QPMA 1WQ2A 3ZQGA 4LJZF 4D7MA 2LF7A 2AQEA 2E1OA 4PK4A 1S7EA 3V8LA 2K02A 3BT9A 2IGNA 3TO7A 1BN5A 9ANTA 1F0OA 2DLLA 5AONA 2CW7A 3Q0UA 4S0HB 5GTHC 1UG0A 2KT0A 2WC2A 3K4BA 2A6EF 3Q9VA 4IQ4A 4FX4A 1U0JA 2XRNA 4KIGA 1AKHA 2K85A 2CRGA 4WX9A 1Z6TA 3G6EI 1CQTA 3A02A 2D1HA 1KYZA 1MJ9A 2MBFA 2VBYA 3FMQA 4KIFA 4BXFA 3RKQA 3K4LA 2BVMA 4KDPA 3SDGA 1YS6A 2IGMA 2KL4A 5E8GA 2FSWA 3CTAA 1OR7C 1XN7A 3K10A 4ZH4F 4XLAA 2HOTA 4BNCA 3NQOA 5L3CA 4L18B 1NG7A 1LDDA 3A01B 1YJ9I 1APLC 3CZ6A 1TT0A 4L0YB 2GXBA 1EF4A 1H9GA 3OL3A 2IVMA 5LEJA 2OZUA 3L2RA 2DFFA 3L7WA 1MBJA 4EJVA 2PJPA 1HOMA 3GTKJ 3CD6I 3K2ZA 1K6YA 3CCMI 1KQ9A 3OSFA 4LG0B 3JW4A 1QHGA 1USSA 2QVOA 2VQGA 5M5XJ 4L5JA 2JQ7A 4DOZA 3PIOF 2UXXA 2QSFX 1O3TA 1BW6A 2FQ4A 1VQOI 3BTIA 1P92A 4RLFA 5FRMA 3K4NA 3R0AA 1IN4A 4ZTJA 4FQGA 3ROUA 3CJRB 3D0SA 2OA4A 3TQNA 3A0HC 2LBFA 4PJNA 1HW2A 1AKHB 2COBA 3K1MA 2QKMB 3LQQA 5KK1A 2OJED 4Y4RA 4K2EA 3ELKA 3ZQFA 1MDMA 3FK6A 2W84A 4M74A 3OY9A 3ABLH 5LHIA 2LBFB 2DOFA 3BR5A 4LIUA 3RPUD 1B9MA 5DEQA 4XRSG 1VQKI 1OYYA 2DMUA 5FB2A 3CCUI 3H3VK 1VFCA 1WJEA 3KX2A 2IPQX 3RQ4A 1OCPA 5DCFA 3WU2C 2OZ6A 3HRMA 4PGGA 5BNGA 1MMSA 3FBNB 4D1QA 1SFKA 2O0YA 1ZYRF 2ECCA 3W6VA 4B44A 1MMDA 2JPCA 3I56I 1D1AA 3KEQA 3GUDA 2F5EA 3E7LA 1KU3A 4PSXA 4UB6C 2M8EA 2LF8A 4YIFA 5JHFA 1YHQI 3GTPJ 4GXOA 5FROA 2V1NA 4JX6A 1T2KA 4F93B 2Q0OA 1MBHA 3OYBA 2F2EA 4CXFA 2A5YB 2JJ7A 2XAUA 3CMMA 3FKJA 3NRVA 3L2CA 2UV1A 3B6AA 1RUNA 1G4DA 2MC4A 2VL8A 4CCMA 1WPKA 1D8KA 2JRTA 5IYCJ 1F1ZA 3ZMDA 5JVGF 1IO2A 3K2AA 5CLSA 1TP4A 2Q1ZB 2OQGA 2VJIA 3IRQA 1GXPA 4MEYF 1FLIA 3H0DA 3BR2A 1F43A 5FKMA 3TL4X 4AIDA 2HYFA 2EA2A 3FMRA 2V4JC 1TC3C 4ETSA 1LDKB 3NWSA 4I76A 4ZYEA 5H20A 1Z7UA 3M8EA 4CH7A 3AFHA 4UXNA 2XF6A 3H9JA 4PJMA 1CF7A 2VB6A 3CJTB 2FQ3A 2JMWA 2VE9A 4LLLA 1MJAA 2HOAA 3AL0C 3PVIA 3FDYA 2HZDA 3K4MA 1YITI 2CQ7A 3IH4A 2VKDA 3KFWX 2XB5A 2KIUA 5E3MA 3HZJA 2PQ8A 3GTGJ 2JUCA 1RESA 3M8FA 2H6CA 1XDSA 2L7FP 2FRHA 3TEDA 3RCOA 2KISA 4B47A 1O57A 1P2FA 3VFZA 3LAPA 2ZSIB 1XCBA 1LEBA 3OS0A 3LA2A 5B5EC 1CGPA 3ZPLA 2R7UA 3S3OA 3BZ6A 3HOSA 4GYGA 2A3SA 1J9IA 1OPCA 3L00A 1R49A 4XLEA 4ITVA 3ZRGA 2K4JA 1P7IA 5DCMA 3K70D 3FM3A 2ZNZA 3GLXA 3DPTA 4UVBA 1DP3A 2BEOA 3I4MJ 2ELHA 5DS9A 4UV8A 2QSGX 1PUFB 3K70C 4B1RA 1MSFC 2VOOA 1R5ID 1K7AA 2P7VB 1PJRA 3BG6A 4GFBA 2XIGA 4GO1A 3MFKA 3T8RA 1WZ2A 1JE8A 3Q9SA 3E6CC 1A6QA 3K0LA 5FD5A 2GWRA 2ZC2A 1OR7A 1FTZA 2MGQA 2KZVA 3MMYB 1XG1A 2HQRA 5EF6A 1PYVA 2VKHA 1UAAA 1LUJB 3LSTA 3H5NA 3M07A 3ZCOA 3HSRA 1HSJA 5B1BH 1YFHA 2W24A 3T0YA 3OYDA 4OOIA 1H8AC 3ML6A 3N97A 2VBWA 3S15J 2K9LA 2LMDA 3MEXA 3W2AA 4EJTA 2CU7A 3ISPA 3J7ZI 2DN0A 3ZN1A 3ZQ7A 2V6EA 2NXNB 4RLQA 3ABTA 1YO5C 4ZZDA 2CQQA 5DM7F 1S9HA 1KYWA 1LEAA 2IP2A 5K5OA 1NTCA 1FMVA 1R6RA 4DYQA 2L3DA 1KU9A 2GBYA 2PBIA 2GOMA 4IEJA 1FOXA 1W7PD 4M3DA 4ENNA 3OR1C 3BP8A 2E2HJ 4Y15A 2K7LA 2VJJA 3E5UA 4IF4A 1LFBA 5C44J 1EYUA 4AYBN 4FETA 2QQ8A 3PSFA 1Q1VA 3DTEA 2NNYA 1K4TA 1XSXA 1K79A 4M71A 3SZGA 4IOCF 1ETKA 1X1BA 2AHQA 1IDYA 2ZJPF 5DUIA 5J8CA 1GHCA 4O3MA 5BQTA 4BJ5C 4LG3A 2IAIA 2HKOA 1TQIA 1VF9A 5KAIC 1IN6A 1BR1A 3HOZJ 4DNCA 1R5GA 2NS7A 2Y0SN 3FM5A 5LRRA 4Y33A 3LSGA 1JT0A 5ICCA 2Y69H 4A3FJ 4G8XA 2UZKA 1VQNI 1Y39A 4DYRA 4XR6A 5LD2C 4Y7NJ 4FISA 3JAMK 4MLOA 1J7KA 1IGNA 1XGNA 3MQ0A 5F04A 1ULYA 4OMYA 4Y52J 4XBFA 3RJPA 5K7HA 3VEPA 3GTQJ 1NI0A 2I10A 5H6RA 1VI0A 1JHFA 1TNSA 2HI3A 2RV8A 3GF2A 4AVZA 1AHDP 4KIBA 3D5LA 4I99C 2DPUA 3FXMA 3TW7A 2FA5A 1Z9CA 2OPTA 4CCKA 2FBKA 2YU9J 5CVUA 1RNLA 4BBSJ 1HBXG 2HZTA 4RAFA 3GMEA 3M9AA 3IAM2 2YUSA 3WE3A 2VXZA 5IT3A 4JBAA 2R5ZB 1XB4A 4R8HA 1W1WE 2FEZA 4M73A 3H1CA 2GOXB 4ZTFA 1KONA 1F5TA 3HRUA 4E7IA 2WTEA 1GXQA 2QENA 1SD7A 2HVRA 2Q2EB 1EH7A 1FOWA 3REOA 2DMNA 4RS8A 2OA9A 2DODA 3JRFA 3FXRA 4L9NA 2AS5F 1BBYA 1UHWA 2B7EA 4IOAF 1AOYA 2BY1A 1GT0C 2D2WA 3JAMZ 3WE2A 4OIPF 2VJ5A 2YSRA 3NEUA 4RB2C 3H5AA 3MZYA 3JTGA 3OS2A 1K6OA 1VQ5I 2RDPA 3NARA 4D0PA 2P7CB 2GZWA 3TOAA 1BOAA 3KYDB 4G6QA 2E60A 1YJNI 3EUHA 4NQWA 1OLTA 4YFKF 1QHHD 4ZYGA 2ZFWA 3S93A 5B1AH 1HC8A 4JP0A 5DTDA 2ELKA 4L5IA 3H5RA 1ON2A 3PFIA 4BXXJ 2QSHX 1A6IA 1KQ0A 2KLOA 3EPZA 1W5SA 1BM9A 4P1WA 3A1YA 3PNTA 4EQQA 1FSHA 3SHFA 2O03A 3CJNA 1F36A 2G9WA 2A07F 3F21A 2H6BA 1MDMB 1HF0A 5FD6A 2D1VA 4H4KC 5IYBJ 3OIQA 2WB1A 2NRAC 1WJCA 3LSIA 3CCLI 3J7AO 1W7PA 4RB1A 4RGUA 3TP3A 4M6XA 2LRDA 4J19A 1VQMI 3LWFA 1E3HA 3ABMH 2X6YA 4UY8I 2X85A 2B0LA 2OAZA 4PFPA 3PIPF 3JRBA 3SYTA 4AD9A 3L2VA 1A36A 3FBIB 1XSVA 2ZCWA 4LGWA 3VB2A 3FK7A 3C1DA 2IS1A 1X19A 1ETQA 3QU3A 5BMZA 1DPUA 5E1ZB 3BDDA 3BWGA 2DOAA 3PO2J 1PP8F 4DZPA 3CDLA 4MIMA 3U2RA 2IA1A 2E36A 3K69A 3J7YJ 1UFMA 1FMWA 5TRDA 1MGTA 1G59A 4EJWA 3JCUC 1QU3A 4X6AJ 3E3VA 4ENKA 4ZYAA 2CFOA 4WK8F 1JI8A 1V54H 2LKPA 2XV4S 2JWTA 4A69C 4RM3A 4H0EA 4F91B 4Y17A 3CF5F 2E1MB 1SAXA 2FOKA 3BR0A 4DYCA 1WHUA 1A35A 3RTRA 2HVSA 2O3FA 1J0RA 1SD6A 4M9SA 3IWFA 2X1EA 2GIZA 3AAFA 1MIJA 4L9VA 3V8KA 3C2BA 1ZGJA 4Q4ZF 5M5YJ 3OYFA 4HRIA 4DW6A 3ESWB 4HQEA 2ISYA 2GXAA 2DTRA 4PFOA 4V2GA 2YR2A 3TDZC 4E7KA 5HS9A 1HA8A 2V7FA 3KP4A 4GCVA 5J4VA 2FXAA 4N0BA 1YYVA 2LTPA 4BACA 1J09A 1MZBA 4XNFA 3H3UA 1D8JA 4L0ZB 4LLGF 3AKZA 5IP9J 3QYFA 2XB0X 1X3ZB 2PX9A 2VOPA 4XMYA 4XLPF 1RZ4A 1R22A 4YIIA 1IV6A 5L3EA 2R3SA 3FXJA 5FGMA 2EB7A 3B6CA 4HSRA 3TKYA 2P81A 1VQ8I 2VC0A 2L4AA 2L5QA 3GLLA 3O8HA 1W36C 1QPIA 2R7WA 3OYEA 1FIAA 2O7OA 1MMNA 2HR3A 4I09A 3CCSI 1WCMJ 4CUGA 1OYIA 3HXLA 3RZOJ 4GGGA 4JK1X 1SMTA 1FT9A 1LQ1A 2Z33A 2IW5A 2IJLA 1S7OA 2Z5UA 3SQNA 2CUZA 5HNHA 1X2MA 3DBRB 2QBYA 2MLGA 2DT6A 2JSPA 2RKHA 1ZAOA 3ABUA 4UV9A 2EV5A 5JVTA 3JRDA 2IS6A 2B9SA 4EJOA 5ILSA 3F8FA 4DZJA 3DU6A 2FD5A 3DF8A 2KRCA 3ZMTA 4AIHA 1B8IB 3I54A 5FLXZ 2VN2A 5CVIA 3HPHA 5EYRA 3H9QA 5DD8A 2VLAA 2CQKA 4P5OA 1X4OA 4C2MJ 1O3SA 2PFBA 3K4CA 3CUQC 2XKOA 3IKVA 5K1YA 2M8GX 2F5CA 2V1UA 2DA7A 3ZMVA 3HGGA 4LITA 5TGTA 2XF7A 4BDZA 3M7GA 3VODA 3CDIA 5B66C 2V1XA 4M3GA 4MTEA 5J1YA 5L3GA 3ZQCA 2LC2A 3EDPA 4UHTA 1B59A 3WGGA 3FXUA 4AC0A 2JVHA 4JYKA 3T1BA 3JRHA 3VYUB 2FUG2 1QGPA 3LA3A 3ULQB 3BTCA 5F64A 3BTLA 3D5RC 1DPRA 3DCFA 4EVIA 4BYYA 3ZQQA 3HGYA 4CZZA 4XORA 1G2HA 1R1VA 4U88A 5FKLA 3V4GA 5C4JJ 1D0XA 3LSRA 1T98A 1IXCA 2HKXA 2QLZA 4BHPA 3OYLA 4BEHB 4UUVA 1H9TA 1N77A 2X4HA 4A6EA 2V9KA 4KUMA 4HF0A 2ZMEA 3S2DJ 3M1CA 2EA4A 2ELJA 5F0CA 5M5WJ 2ZJRF 1ENHA 5J40A 3ZOBA 3PQJA 4NNJA 3WG7H 4CZCA 2WY8Q 4A5NA 1SFXA 4XKVA 4KICA 4A3JJ 4EV0A 4RA2A 2GM4A 3CC7I 5GTIC 1R23A 2KIQA 2YS9A 3SEZA 1MBFA 3GZ5A 5CJ9A 4A3GJ 1AA7A 5HDKA 5KHDA 1MMAA 2ECBA 1ODDA 2ZXJA 2DA6A 5HLTA 2RGVA 2E35A 3CP2A 4AVPA 2KMUA 3A0BC 2Q2EA 5J8FA 1LE8A 3LNQA 3ZGKA 3MKWB 1H56A 3RI4A 3GFMA 3LFKA 5HDNA 4C3JJ 4R79A 2R7OA 1TQPA 1EH6A 2CWEA 1OCZH 3RQIA 3ASNH 2KIFA 3RKYA 1J59A 3HUGA 2CUEA 1MH3A 3I4PA 2DU9A 1HW1A 4M9ZA 2IBDA 2KJCA 4IRGA 3S3MA 5FKKA 2EPFA 2X1DA 1BIAA 3KCCA 4ZYDA 4J00A 1VQ7I 1YE9A 2E71A 2XVCA 2PEXA 2A61A 2VQLA 4X1EA 3HL2A 1U9NA 5FO5A 2JA5J 3KZIC 2E1MC 3ZQIA 2K3PA 4BJ6C 4FCYA 4EGYA 2OF7A 3S2WA 3QQAA 5J3LA 1MSEC 3G73A 3GW2A 3QOPA 3RPQA 4C2TA 2PMUA 2Y0MA 2OTLI 1R71A 3F3XA 2NOJB 4GRIA 3WTTC 3C2HA 3GWZA 4NB5A 1I50J 2O5RA 3LFUA 3P9KA 3HYIA 4A0YA 4QLCU 3DPLC 5E3NA 3BG7A 3QYBA 5H2FC 1YOVB 3QPHA 1ZHFA 2R7DA 2HDDA 5L3DA 4G12A 2L2OA 1ZTRA 1T0FC 1R7JA 2BYVE 2PG4A 2ODIA 1R9TJ 1MD0A 1TWFJ 2JTVA 3CCEI 4IX7A 1NK3P 2DBBA 1BR4A 1HCRA 5FKNA 1PVEA 3SFIA 4QTRA 1MJBA 2TCTA 5CVRA 1O7LA 2YU3A 3CMEI 1ZGAA 3GTMJ 2RQPA 3HIFA 3V7SA 4EM2A 3DLLF 3DQVC 4O5VA 1FEXA 1EJ9A 4XLHA 4HG2A 3DFGA 2ZKZA 5A2QK 2IS4A 2NAZA 2HWVA 4TV7A 4M6YA 3GTOJ 2LY1A 4UVCA 3PL8A 1HQCA 4NDLA 2K86A 4HNVA 5GPAA 3S1RJ 3TMOA 4RAGA 4LB6B 2FBIA 4FT8A 3RPUA 2DAOA 4HOBA 1TW3A 2XSJC 4BGDA 4A12A 1VNDA 4A3IJ 5JR3A 1HW5A 2NVXJ 3QYEA 1BI0A 1G3WA 4ZJZA 2M1BA 3C2GA 2LK2A 4I01A 3RSNA 2LKXA 1UMQA 4UB8C 3RYPA 2XGCA 3OV8A 3HKZN 4DBQA 3OYAA 3UR3C 5J1UA 3FWEA 4L5EA 1SVOA 4JQFA 3L2WA 3G4SI 3KEYA 1HDDC 4BS9A 1ZRDA 3HM5A 3VYSB 2UWMA 2VE8A 2R93J 4IO9F 4E7ZA 5M3FJ 2JT1A 2W85A 3VYTB 2DXIA 2V26A 2FE3A 2ZNYA 3IV5A 3CCVI 3QRFF 2JA7J 1D5VA 3LMMA 1FPQA 3DEEA 2H09A 4IL6C 2M5WA 4LG0A 2EFOA 3V7CA 2VASA 5CVJA 2QWWA 3AG2H 2VKVA 4A0ZA 5B3SH 3W2VA 2DFEA 2W4SA 4HLYA 2HS5A 3M4OJ 2LOOA 1XX5A 2K9MA 4IHTA 3F72A 4HPQA 1LE8B 5LHGA 1ZG3A 3DEUA 2RC4A 1X3UA 1LVKA 1QZYA 4HNUA 1UB9A 5KVRA 3BZKA 3S1MJ 2ADUA 3L09A 3V8JA 2RREA 3OYNA 4HV5A 1Y56A 4NBQA 2EINH 1ERDA 2QQAA 4I6ZA 4G7ZF 3H0GJ 3GYHX 4EM0B 1YW8A 2GA1A 2KFDA 3IKTA 5KAFC 3K4KA 2KDZA 1JKPC 2X0LA 1S7AA 1WJAA 1T39A 1JUSA 4MHGA 2M34A 3AG1H 1V55H 3ZMZA 4XRSA 2BE5F 3VYRB 1IUYA 2XPUA 2HEOA 2LKSA 3F8CA 2PMZA 2HPIA 3I3LA 2MA3A 4Y13A 2P5VA 3ECOA 2P4WA 4Q48A 3BTJA 3MKYB 1X1PA 1DDNA 1ZKGA 3GFLA 3OMYA 3FXOA 3M3YJ 2XAFA 4WWCA 2ZFUA 3L1PA 5FFZA 1OCCH 4EJUA 1Z7LA 1KU2A 4CYDA 1B8IA 3V42A 2VC1A 3JRGA 5E3LA 2CV2A 2QEXI 4W97A 1HKQA 4KT5C 4RGXA 5K5RA 5EG0B 4AUXA 3MN2A 1JKRC 4BY1J 4V2FA 3BLYA 2GXGA 5HS7A 2HYJA 2W57A 1WWXA 4RM2A 1D3YA 1IRZA 4HYEA 2CYYA 2CQXA 2EZKA 5F0FA 3CDHA 4EMSA 4MNUA 2L9NA 3F8NA 3WODF 2FMYA 4A93J 2I5UA 4BQOA 2EILH 3OYMA 2EFPA 1MKMA 3T8TA 1S72I 1FOKA 4GYIA 4M3FA 2ZMEB 4RB0A 5D4SA 5IPAA 1W4MA 1USTA 2L54A 4LOCA 3CC4I 4P96A 4BDYA 2PN6A 2JUGA 5LLQA 1R5HA 1OCTC 3HDDA 1D5YA 2CV0A 1X2NA 2GAUA 4FHTA 3A01A 1R1UA 1ZK8A 2JA8J 4L9JA 1QA6A 4IHWA 2Q8KA 2AXTC 3AL0B 4NC6A 3ZR8X 1Y1WJ 1EKEA 3PUBA 1N78A 5E17F 5F6FA 2VI6A 4OAZA 4PUSA 1KQ8A 5E20A 3U1DA
chains in the Genus database with same CATH topology
4IVNA 5BPIA 4MTDA 2VT2A 3W6JB 3MAJA 2DK8A 4YFNF 5E8IA 3N4MA 4HBLA 3C18A 3SXYA 1REPC 3LA7A 5ICGA 4XLNF 5DYMA 4PGHA 4RAZA 3HTSB 1U2WA 4KNYA 4CO8A 3IHUA 4MQVA 3ZN0A 2J5OA 2EV0A 2ZO4A 1O3RA 3GX4X 3Q5FA 3KE2A 4HLXA 3COAC 3ZMSA 1ZREA 3T5XA 1FYMA 1Z1DA 2ZJ2A 2O61A 1UHMA 1IN8A 4G7HF 1B6AA 1H0MA 3KP5A 4ZZLA 3K1NA 3J81Z 2NS0A 3KP2A 1P4XA 3KP6A 4PZJA 5LRSA 1YW9A 5BOXA 1LB2A 1XDUA 1BJAA 3BY6A 1U6GA 3TO9A 3QU6A 2EWNA 2MLKA 4WCGA 2Q10A 3B73A 2EK5A 4OU0A 2QZ8A 4NHJA 1OMIA 1G3TA 1XGMA 5J6XA 1R1TA 4IXAA 1OKRA 3DXJF 2KJBA 2JZYA 3QP5A 1S29A 2YX7A 2QUFA 4BHBA 1GVJA 2FU4A 1TTYA 3HOTA 5FFXA 1V4RA 1ZRFA 4A0XA 3O2PE 2DPDA 3WU0A 5HLIA 2JSCA 3JSPA 1U8RA 1PDNC 5F1RA 4P9FA 2MC3A 3G3ZA 3I58A 4MEXF 1W7PB 1JXSA 5TJJA 1U78A 2HFHA 5E1XA 4I2OA 2RVCA 4LK0F 2HOEA 3E5QA 2A6HF 2ETHA 4I02A 1IF1A 4ON0A 2GIVA 2XAQA 3GFIA 2HDCA 2QQ9A 3BOQA 3GXOA 3H3ZA 1FYKA 1K78B 2XUBA 2P5LC 3RKWA 4M9XA 1I6XA 5LHHA 1FC3A 4XSXF 1YTYA 1T6SA 2V6CA 1E2XA 2FNPA 4WF2A 3GVAA 1TLHB 2MH9A 3BROA 5D6EA 2BGCA 1J5YA 3P9CA 2H27A 3CUQA 3CUQB 4A5MA 4LD5A 1W5TA 5A2QZ 3WTXC 5CVVA 1TQMA 2EJRA 1B9NA 4B09A 2OQRA 4S04A 5DUKA 1F9NA 3E6DA 2WV0A 1ZH5A 5L3FA 4B8XA 3U9GA 4I0AA 5CYVA 5JFRA 4U0YA 2QQBA 4P9UA 3MZHA 5HLHA 3R61A 4AIKA 1WI9A 5HVQC 1YG2A 4G9YA 1FP2A 5D5XB 1BI3A 1YIOA 4IRHA 3WTUC 4HF2A 1BC7C 3JTHA 4WXDA 4HX4A 1SFUA 2CFXA 1AWCA 2PI0A 1LNWA 3FMSA 1FX7A 2DQRA 2VODA 1TBXA 2L02A 4I98B 1R00A 1QO0D 1IN7A 3BJ6A 4RGSA 1IRGA 3FF5A 3I5UA 1HXDA 4ESBA 5H6QA 2EFQA 3QP6A 3ECHA 1JGSA 3PQKA 3GFJA 2STWA 2C6YA 3C3WA 1XSDA 3I0TA 1XMAA 1NHAA 1ONVA 5ILUA 4WXHA 2P5KA 2L01A 1P6RA 3OOPA 4RGRA 1YLFA 1U5TA 1VTNC 3WU1B 2EFWA 3RYRA 4RAYA 2Z9OA 3F6OA 2P8TA 3K1PA 1U5TB 1UCRA 1XMKA 1P4WA 2IT0A 2ESNA 2FF4A 5DV5A 1YS7A 3CO6C 2ACJA 4U7DA 5AIQA 3TO6A 3LAJA 1BI1A 2NYXA 2COMA 4Z2YA 5BPDA 4A6DA 4U7BA 3F8BA 3I64A 1QNTA 2A68F 5D8KB 3FXQA 3HHHA 1CF7B 1G3YA 3E6BA 1KA8A 2E7WA 4BH9A 2P6TA 1ZN2A 4RB3C 1SFEA 3KZYA 4HA8A 3DV8A 3DP7A 3RKXA 1ZG1A 3R0JA 1XCVA 1XGOA 5EEGA 3P7NA 4KMFA 5E18F 1J75A 2KRFA 2DK5A 3WGIA 4LMYA 3B02A 3KLNA 3R4KA 1O3QA 2PLYA 5D5UB 1ZRCA 5HDGA 2P6SA 1PP7U 1FP1D 2DI3A 4LFUA 3WTZA 3I71A 2HQNA 2V79A 5AIPA 2MD5A 2EFNA 2DT5A 1WRJA 4AIJA 3WG9A 5K5QA 5D5WB 4ZYHA 4Q47A 1Y0UA 5D4RA 1V3FA 3P9IA 3SFZA 2MH2A 3KLOA 4CICA 1YW7A 2OU2A 2XASA 4CGZA 2PMHA 2D45A 2E1NA 3IWZA 3HRTA 3BJOA 4WXCA 4LB5A 2CG4A 2XAJA 3TGNA 3IC7A 2DFIA 3F8MA 4I7HA 3CUOA 2XAGA 5E1WA 3ERED 1DUXC 1K78A 3SZPA 4N9IA 5FLXK 3BJAA 1SD5A 3HSEA 3R60A 5HS8A 5BS6A 1QZZA 4ENMA 4OINF 4E70A 4HW0A 3HRSA 4KN7X 3CLOA 4MQ9F 3MWMA 4G94A 4QWQA 3LQRA 4HZFA 2JPBA 2EV6A 3HTUA 1FNNA 4KN4X 3C7JA 2ODHA 2DW4A 1EH8A 4UNOA 3KP7A 4PCQA 3K9TA 4IRIA 4ASNA 1G6NA 5HLGA 3I59B 1FWZA 4M72A 4ENJA 1WKMA 2LNBA 4HDUA 1O7FA 2QM3A 3I59A 1U5TC 3GZ6A 3W6KB 2WWYA 4P55A 6PAXA 2OD5A 3JSOA 4KA4A 4YG2F 3HSFA 5LGTA 1TW2A 5LGNA 4ESJA 1L3LA 4ESFA 2DO7A 3KETA 2XKPA 3H92A 1KGSA 1B4AA 1FY7A 2FBHA 2V9VA 4OIOF 4BQAA 1IAWA 3V7RA 1XGSA 1Z05A 1DP7P 3F6VA 2IA2A 4LK1F 4BAYA 3WGHA 5LGUA 3CO7C 4XSZF 4MGRA 2Z99A 2K4BA 2OBPA 2LDUA 5ICFA 4UVAA 1WSUA 2QYOA 4IPAA 4HX8A 4FX0A 4R1HA 2M45A 3ZMUA 1FSEA 3O3KA 3FHZA 3J80K 1RI7A 2KIMA 1FZPB 1IXSB 2BBYA 4YFXF 1F4KA 3HHGA 1S8NA 4CDGA 1ZG5A 2VBXA 1TNTA 2FNAA 3GEZA 2VT3A 3IL2A 4LLNA 5DDGA 1BIBA 4I0BA 2ISZA 1R36A 2J5PA 2R7FA 1B1BA 1ZLKA 5D5VB 2V1DA 2RNJA 5HOOA 1RUOA 3EYYA 2VONA 4PDKA 2CO5A 3R6SA 4DQ2A 4G6DA 2FMLA 5IT9Z 2CW0F 1SD4A 3E6MA 1BI2A 2HTJA 4O6JA 3EYIA 3KEOA 4AWXB 3QPTA 4HV6A 2LSOA 2K27A 2CGPA 2G7HA 4EM1A 4U0WA 4KFCA 2STTA 1A04A 2Y48A 2W25A 1LJ9A 1ZLJA 3F22A 4XRFA 1SMYF 2YX4A 2BV6A 4CHUA 3F23A 3GO5A 3E5XA 1OYWA 2HTSA 3EETA 3O6BB 1BC8C 3BPVA 1FYLA 1ZARA 2L4MA 4KYWA 1RIOH 3WTSC 4EGZA 2M87A 1QQIA 5JHUA 3SZTA 5DCMB 4HX7A 4L9TA 3J80Z 3RIRA 1HKTA 2E7XA 1I5ZA 1T38A 3IRRA 1FBQA 3QAHA 3J81K 4N9HA 2Y75A 2F5DA 5D6FA 3IMBA 3FZVA 3KZZA 1L0OC 4OIQF 1Z91A 2KKOA 4BHCA 1I27A 4HQMA 4G7OF 1YQAA 4S05A 1I1GA 2IRFG 1Z6RA 2G7UA 5D8LB 1S6LA 2NNNA 2O6GE 3VOEA 2O8XA 3TOBA 1HKSA 5L3BA 5ILVA 2XROA 3KP3A 2TDXA 2XAHA 5JI6A 1G3SA 3M1EA 1IN5A 5EEHA 2VBZA 3E97A 3DKWA 4A2UA 1HSTA 1PUEE 1S3JA 2UXNA 2XHKA 2H94A 5IT9K 2OAAA 2Z3YA 5LEKA 3FX3A 3EQLF 4HAMA 1FBUA 2HYGD 5DD4A 4Q5SF 4IHSA 4BXUA 4F7ZA 1STZA 2RN7A 3BPXA 1E17A 2DQLA 1C0WA 2IA0A 1IZ1A 4OIRF 3MCZA 2HGCA 3RDIA 5ICEA 4OMZA 4U0VA 5LBQA 3ZP5A 2ESHA 1I1SA 3WTWC 2F5FA 2GQQA 3WTVC 1EV7A 1J2XA 4KMUX 2AXLA 4IJAA 3I53A 2E1CA 2GA2A 2CSOA 1Q1HA 2M30A 1XD7A 2ZBKA 3WTYC 1IW7F 2YPRA 1IRFA 3L9FA 2A69F 2XGXA 4HDVA 1U3EM 1FBSA 5ERIA 5ED4A 1R58A 1IXRC 1LDJA 2QBYB 1ON1A 4HF1A 1T0FA 1KU7A 1JHHA 1P4AA 3TDUC 1QBJA 1LVAA 1QPMA 1WQ2A 4LJZF 2LF7A 3V8LA 2K02A 3TO7A 1BN5A 2DLLA 5AONA 2WC2A 3Q9VA 4FX4A 2A6EF 2XRNA 4KIGA 4WX9A 1Z6TA 2D1HA 1KYZA 1MJ9A 2MBFA 2VBYA 3FMQA 4KIFA 4KDPA 1YS6A 5E8GA 2FSWA 3CTAA 1XN7A 4ZH4F 4BNCA 3NQOA 5L3CA 4L18B 1LDDA 2GXBA 4L0YB 1H9GA 2IVMA 5LEJA 2OZUA 2PJPA 3L7WA 4EJVA 3K2ZA 1KQ9A 4LG0B 3JW4A 1USSA 2QVOA 4L5JA 2UXXA 1O3TA 1P92A 3R0AA 1IN4A 3ROUA 3D0SA 2OA4A 3TQNA 1HW2A 3K1MA 3LQQA 5KK1A 4K2EA 3ELKA 1MDMA 2W84A 4M74A 5LHIA 1B9MA 5DEQA 1OYYA 5FB2A 2IPQX 5DCFA 2OZ6A 3HRMA 4PGGA 2O0YA 1ZYRF 2JPCA 3KEQA 3GUDA 2F5EA 1KU3A 2M8EA 2LF8A 4YIFA 4GXOA 1T2KA 2Q0OA 2F2EA 4CXFA 2A5YB 3NRVA 3L2CA 1RUNA 1G4DA 2JRTA 1D8KA 1F1ZA 3ZMDA 5CLSA 2OQGA 3IRQA 1GXPA 4MEYF 1FLIA 2HYFA 2EA2A 3FMRA 4ETSA 1LDKB 4ZYEA 5H20A 1Z7UA 3M8EA 4UXNA 1CF7A 2FQ3A 2VE9A 4LLLA 1MJAA 3KFWX 2KIUA 2PQ8A 3M8FA 2H6CA 1XDSA 2FRHA 1O57A 1P2FA 3VFZA 3LAPA 1XCBA 1LEBA 3LA2A 1CGPA 3ZPLA 3BZ6A 3HOSA 4GYGA 2A3SA 1J9IA 1OPCA 3L00A 2K4JA 5DCMA 3FM3A 2ZNZA 3GLXA 3DPTA 4UVBA 2BEOA 2ELHA 4UV8A 2VOOA 1K7AA 2P7VB 2XIGA 4GO1A 3MFKA 3T8RA 1JE8A 3Q9SA 3E6CC 3K0LA 5FD5A 2GWRA 1OR7A 2HQRA 3LSTA 3HSRA 1HSJA 1YFHA 2W24A 3T0YA 4OOIA 3ML6A 3N97A 2VBWA 3MEXA 4EJTA 3ISPA 3ZN1A 3ZQ7A 3ABTA 1YO5C 4ZZDA 1KYWA 1LEAA 2IP2A 5K5OA 2L3DA 1KU9A 2PBIA 1W7PD 4ENNA 3BP8A 4Y15A 2K7LA 3E5UA 4IF4A 2NNYA 1XSXA 1K79A 4M71A 5DUIA 5J8CA 1GHCA 4O3MA 5BQTA 2HKOA 1TQIA 1IN6A 4DNCA 1R5GA 3FM5A 5LRRA 5ICCA 4G8XA 2UZKA 3JAMK 1J7KA 1XGNA 3MQ0A 4OMYA 1ULYA 4XBFA 3RJPA 3VEPA 5H6RA 1JHFA 1TNSA 2RV8A 3GF2A 4KIBA 3D5LA 2DPUA 2FA5A 1Z9CA 2FBKA 5CVUA 1RNLA 1HBXG 2HZTA 3M9AA 3WE3A 2VXZA 5IT3A 4JBAA 1XB4A 4R8HA 2FEZA 4M73A 1F5TA 3HRUA 2WTEA 1GXQA 2QENA 1SD7A 1EH7A 3REOA 4RS8A 2OA9A 3FXRA 4L9NA 2AS5F 1BBYA 1UHWA 1AOYA 2D2WA 3JAMZ 3WE2A 4OIPF 2YSRA 3NEUA 4RB2C 3MZYA 3JTGA 1K6OA 2RDPA 4D0PA 2P7CB 2GZWA 3TOAA 1BOAA 4G6QA 3EUHA 4NQWA 4YFKF 4ZYGA 2ZFWA 4L5IA 1ON2A 3PFIA 1KQ0A 1W5SA 1BM9A 4EQQA 1FSHA 3SHFA 2O03A 3CJNA 2G9WA 2A07F 3F21A 2H6BA 1MDMB 5FD6A 2D1VA 2NRAC 3J7AO 1W7PA 4RB1A 4RGUA 4M6XA 3LWFA 2B0LA 2OAZA 4AD9A 4LGWA 1XSVA 2ZCWA 3VB2A 3C1DA 3QU3A 5BMZA 1DPUA 5E1ZB 3BDDA 3BWGA 1PP8F 3U2RA 2IA1A 3K69A 1UFMA 5TRDA 1MGTA 4EJWA 3E3VA 4ENKA 4WK8F 2LKPA 2XV4S 4H0EA 1SAXA 4Y17A 2FOKA 3RTRA 2O3FA 1J0RA 1SD6A 4M9SA 3IWFA 3AAFA 4L9VA 3V8KA 1ZGJA 4Q4ZF 4HQEA 2ISYA 2DTRA 2YR2A 3TDZC 5HS9A 3KP4A 4GCVA 2FXAA 4N0BA 1YYVA 1MZBA 3H3UA 1D8JA 4L0ZB 4LLGF 2VOPA 4XLPF 1RZ4A 1R22A 4YIIA 5L3EA 2R3SA 5FGMA 2EB7A 3TKYA 2VC0A 2L4AA 2HR3A 4I09A 1OYIA 4GGGA 4JK1X 1SMTA 1FT9A 1LQ1A 2Z33A 2IW5A 2IJLA 1S7OA 2Z5UA 3SQNA 2QBYA 2MLGA 2RKHA 1ZAOA 3ABUA 4UV9A 2EV5A 5JVTA 4EJOA 5ILSA 3F8FA 3DF8A 3ZMTA 4AIHA 3I54A 5FLXZ 2VN2A 5CVIA 5DD8A 2CQKA 4P5OA 1O3SA 2PFBA 3CUQC 2XKOA 3IKVA 5K1YA 2F5CA 2V1UA 3ZMVA 3M7GA 3VODA 2V1XA 4MTEA 5L3GA 3EDPA 4UHTA 3WGGA 1B59A 3FXUA 3T1BA 1QGPA 3LA3A 3ULQB 5F64A 1DPRA 4EVIA 4BYYA 4CZZA 1R1VA 4U88A 3V4GA 1T98A 1IXCA 2HKXA 2QLZA 4BHPA 4UUVA 1H9TA 2X4HA 4A6EA 4KUMA 4HF0A 2ZMEA 2EA4A 3PQJA 4A5NA 1SFXA 4KICA 4EV0A 1R23A 3GZ5A 5CJ9A 5HDKA 1ODDA 2ZXJA 2RGVA 4AVPA 2Q2EA 5J8FA 3RI4A 3GFMA 3LFKA 5HDNA 4R79A 1TQPA 2CWEA 1EH6A 2KIFA 3RKYA 1J59A 3HUGA 3I4PA 2DU9A 1HW1A 4M9ZA 2KJCA 4IRGA 1BIAA 3KCCA 4ZYDA 2XVCA 2PEXA 2A61A 5FO5A 4EGYA 3S2WA 3G73A 3GW2A 3QOPA 3RPQA 2PMUA 2Y0MA 3F3XA 3WTTC 3GWZA 4NB5A 3P9KA 3HYIA 4A0YA 4QLCU 3DPLC 3QPHA 1ZHFA 2R7DA 5L3DA 1R7JA 2BYVE 2PG4A 2ODIA 1MD0A 2JTVA 2DBBA 1MJBA 5CVRA 1O7LA 2YU3A 1ZGAA 2RQPA 3HIFA 3V7SA 4EM2A 3DQVC 4O5VA 5A2QK 3DFGA 2ZKZA 2NAZA 2HWVA 4TV7A 4M6YA 4UVCA 1HQCA 2K86A 4LB6B 2FBIA 4FT8A 3RPUA 2DAOA 4HOBA 1TW3A 4A12A 5JR3A 1HW5A 1BI0A 1G3WA 2M1BA 4I01A 3RYPA 3OV8A 3FWEA 4JQFA 1ZRDA 2UWMA 2VE8A 2JT1A 2W85A 2FE3A 2ZNYA 3QRFF 1D5VA 1FPQA 2H09A 2M5WA 4LG0A 2EFOA 3V7CA 5CVJA 2QWWA 4A0ZA 4HLYA 2HS5A 4IHTA 3F72A 5LHGA 1ZG3A 3DEUA 2RC4A 1X3UA 1QZYA 1UB9A 5KVRA 2ADUA 3L09A 3V8JA 4HV5A 2QQAA 4G7ZF 3GYHX 4EM0B 1YW8A 2GA1A 3IKTA 2X0LA 1S7AA 1T39A 4MHGA 3ZMZA 2BE5F 1IUYA 2HEOA 3F8CA 2MA3A 4Y13A 2P5VA 2P4WA 3ECOA 4Q48A 1DDNA 3GFLA 2XAFA 4WWCA 5FFZA 4EJUA 1KU2A 4CYDA 2VC1A 1HKQA 4KT5C 4RGXA 5K5RA 2GXGA 5HS7A 2W57A 1WWXA 1D3YA 4HYEA 2CYYA 3CDHA 4EMSA 4MNUA 3F8NA 3WODF 2FMYA 2EFPA 1MKMA 3T8TA 1FOKA 4GYIA 2ZMEB 4RB0A 5D4SA 1W4MA 1USTA 2L54A 4P96A 2PN6A 5LLQA 1R5HA 4FHTA 2GAUA 1R1UA 4L9JA 2Q8KA 5E17F 5F6FA 1KQ8A 5E20A 3U1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVN A;  5BPI A;  4MTD A;  2VT2 A;  3W6J B;  3MAJ A;  2DK8 A;  4YFN F;  5E8I A;  3N4M A;  4HBL A;  3C18 A;  3SXY A;  1REP C;  3LA7 A;  5ICG A;  4XLN F;  5DYM A;  4PGH A;  4RAZ A;  3HTS B;  1U2W A;  4KNY A;  4CO8 A;  3IHU A;  4MQV A;  3ZN0 A;  2J5O A;  2EV0 A;  2ZO4 A;  1O3R A;  3GX4 X;  3Q5F A;  3KE2 A;  4HLX A;  3COA C;  3ZMS A;  1ZRE A;  3T5X A;  1FYM A;  1Z1D A;  2ZJ2 A;  2O61 A;  1UHM A;  1IN8 A;  4G7H F;  1B6A A;  1H0M A;  3KP5 A;  4ZZL A;  3K1N A;  3J81 Z;  2NS0 A;  3KP2 A;  1P4X A;  3KP6 A;  4PZJ A;  5LRS A;  1YW9 A;  5BOX A;  1LB2 A;  1XDU A;  1BJA A;  3BY6 A;  1U6G A;  3TO9 A;  3QU6 A;  2EWN A;  2MLK A;  4WCG A;  3B73 A;  2EK5 A;  4OU0 A;  2QZ8 A;  4NHJ A;  1OMI A;  1G3T A;  1XGM A;  5J6X A;  1R1T A;  4IXA A;  1OKR A;  3DXJ F;  2KJB A;  2JZY A;  3QP5 A;  1S29 A;  2YX7 A;  2QUF A;  4BHB A;  1GVJ A;  2FU4 A;  1TTY A;  3HOT A;  5FFX A;  1V4R A;  1ZRF A;  4A0X A;  3O2P E;  2DPD A;  3WU0 A;  5HLI A;  2JSC A;  3JSP A;  1U8R A;  1PDN C;  5F1R A;  4P9F A;  2MC3 A;  3G3Z A;  3I58 A;  4MEX F;  1W7P B;  1JXS A;  5TJJ A;  1U78 A;  2HFH A;  5E1X A;  4I2O A;  2RVC A;  4LK0 F;  2HOE A;  3E5Q A;  2A6H F;  2ETH A;  4I02 A;  1IF1 A;  4ON0 A;  2GIV A;  2XAQ A;  3GFI A;  2HDC A;  2QQ9 A;  3BOQ A;  3GXO A;  3H3Z A;  1FYK A;  1K78 B;  2XUB A;  2P5L C;  3RKW A;  4M9X A;  1I6X A;  5LHH A;  1FC3 A;  4XSX F;  1YTY A;  1T6S A;  2V6C A;  1E2X A;  2FNP A;  4WF2 A;  3GVA A;  1TLH B;  2MH9 A;  3BRO A;  5D6E A;  2BGC A;  1J5Y A;  3P9C A;  2H27 A;  3CUQ A;  3CUQ B;  4A5M A;  4LD5 A;  1W5T A;  5A2Q Z;  3WTX C;  5CVV A;  1TQM A;  2EJR A;  1B9N A;  4B09 A;  2OQR A;  4S04 A;  5DUK A;  1F9N A;  3E6D A;  2WV0 A;  1ZH5 A;  5L3F A;  4B8X A;  3U9G A;  4I0A A;  5CYV A;  5JFR A;  4U0Y A;  2QQB A;  4P9U A;  3MZH A;  5HLH A;  3R61 A;  4AIK A;  1WI9 A;  5HVQ C;  1YG2 A;  4G9Y A;  1FP2 A;  5D5X B;  1BI3 A;  1YIO A;  4IRH A;  3WTU C;  4HF2 A;  1BC7 C;  3JTH A;  4WXD A;  4HX4 A;  1SFU A;  2CFX A;  1AWC A;  2PI0 A;  1LNW A;  3FMS A;  1FX7 A;  2DQR A;  2VOD A;  1TBX A;  2L02 A;  4I98 B;  1R00 A;  1QO0 D;  1IN7 A;  3BJ6 A;  4RGS A;  1IRG A;  3FF5 A;  3I5U A;  1HXD A;  4ESB A;  5H6Q A;  2EFQ A;  3QP6 A;  3ECH A;  1JGS A;  3PQK A;  3GFJ A;  2STW A;  2C6Y A;  3C3W A;  1XSD A;  3I0T A;  1XMA A;  1NHA A;  1ONV A;  5ILU A;  4WXH A;  2P5K A;  2L01 A;  1P6R A;  3OOP A;  4RGR A;  1YLF A;  1U5T A;  1VTN C;  3WU1 B;  2EFW A;  3RYR A;  4RAY A;  2Z9O A;  3F6O A;  2P8T A;  3K1P A;  1U5T B;  1UCR A;  1XMK A;  1P4W A;  2IT0 A;  2ESN A;  2FF4 A;  5DV5 A;  1YS7 A;  3CO6 C;  2ACJ A;  4U7D A;  5AIQ A;  3TO6 A;  3LAJ A;  1BI1 A;  2NYX A;  2COM A;  4Z2Y A;  5BPD A;  4A6D A;  4U7B A;  3F8B A;  3I64 A;  1QNT A;  2A68 F;  5D8K B;  3FXQ A;  3HHH A;  1CF7 B;  1G3Y A;  3E6B A;  1KA8 A;  2E7W A;  4BH9 A;  2P6T A;  1ZN2 A;  4RB3 C;  1SFE A;  3KZY A;  4HA8 A;  3DV8 A;  3DP7 A;  3RKX A;  1ZG1 A;  3R0J A;  1XCV A;  1XGO A;  5EEG A;  3P7N A;  4KMF A;  5E18 F;  1J75 A;  2KRF A;  2DK5 A;  3WGI A;  4LMY A;  3B02 A;  3KLN A;  3R4K A;  1O3Q A;  2PLY A;  5D5U B;  1ZRC A;  5HDG A;  2P6S A;  1PP7 U;  1FP1 D;  2DI3 A;  4LFU A;  3WTZ A;  3I71 A;  2HQN A;  2V79 A;  5AIP A;  2MD5 A;  2EFN A;  2DT5 A;  1WRJ A;  4AIJ A;  3WG9 A;  5K5Q A;  5D5W B;  4ZYH A;  4Q47 A;  1Y0U A;  5D4R A;  1V3F A;  3P9I A;  3SFZ A;  2MH2 A;  3KLO A;  4CIC A;  1YW7 A;  2OU2 A;  2XAS A;  4CGZ A;  2PMH A;  2D45 A;  2E1N A;  3IWZ A;  3HRT A;  3BJO A;  4WXC A;  4LB5 A;  2CG4 A;  2XAJ A;  3TGN A;  3IC7 A;  2DFI A;  3F8M A;  4I7H A;  3CUO A;  2XAG A;  5E1W A;  3ERE D;  1DUX C;  1K78 A;  3SZP A;  4N9I A;  5FLX K;  3BJA A;  1SD5 A;  3HSE A;  3R60 A;  5HS8 A;  5BS6 A;  1QZZ A;  4ENM A;  4OIN F;  4E70 A;  4HW0 A;  3HRS A;  4KN7 X;  3CLO A;  4MQ9 F;  3MWM A;  4G94 A;  4QWQ A;  3LQR A;  4HZF A;  2JPB A;  2EV6 A;  3HTU A;  1FNN A;  4KN4 X;  3C7J A;  2DW4 A;  1EH8 A;  4UNO A;  3KP7 A;  4PCQ A;  3K9T A;  4IRI A;  4ASN A;  1G6N A;  5HLG A;  3I59 B;  1FWZ A;  4M72 A;  4ENJ A;  1WKM A;  2LNB A;  4HDU A;  1O7F A;  2QM3 A;  3I59 A;  1U5T C;  3GZ6 A;  3W6K B;  2WWY A;  4P55 A;  6PAX A;  2OD5 A;  3JSO A;  4KA4 A;  4YG2 F;  3HSF A;  5LGT A;  1TW2 A;  5LGN A;  4ESJ A;  1L3L A;  4ESF A;  2DO7 A;  3KET A;  2XKP A;  3H92 A;  1KGS A;  1B4A A;  1FY7 A;  2FBH A;  2V9V A;  4OIO F;  4BQA A;  1IAW A;  3V7R A;  1XGS A;  1Z05 A;  1DP7 P;  3F6V A;  2IA2 A;  4LK1 F;  4BAY A;  3WGH A;  5LGU A;  3CO7 C;  4XSZ F;  4MGR A;  2Z99 A;  2K4B A;  2OBP A;  2LDU A;  5ICF A;  4UVA A;  1WSU A;  2QYO A;  4IPA A;  4HX8 A;  4FX0 A;  4R1H A;  2M45 A;  3ZMU A;  1FSE A;  3O3K A;  3FHZ A;  3J80 K;  1RI7 A;  2KIM A;  1FZP B;  1IXS B;  2BBY A;  4YFX F;  1F4K A;  3HHG A;  1S8N A;  4CDG A;  1ZG5 A;  2VBX A;  1TNT A;  2FNA A;  3GEZ A;  2VT3 A;  3IL2 A;  4LLN A;  5DDG A;  1BIB A;  4I0B A;  2ISZ A;  1R36 A;  2J5P A;  2R7F A;  1B1B A;  1ZLK A;  5D5V B;  2V1D A;  2RNJ A;  5HOO A;  1RUO A;  3EYY A;  2VON A;  4PDK A;  2CO5 A;  3R6S A;  4DQ2 A;  4G6D A;  2FML A;  5IT9 Z;  2CW0 F;  1SD4 A;  3E6M A;  1BI2 A;  2HTJ A;  4O6J A;  3EYI A;  3KEO A;  4AWX B;  3QPT A;  4HV6 A;  2LSO A;  2K27 A;  2CGP A;  2G7H A;  4EM1 A;  4U0W A;  4KFC A;  2STT A;  1A04 A;  2Y48 A;  2W25 A;  1LJ9 A;  1ZLJ A;  3F22 A;  4XRF A;  1SMY F;  2YX4 A;  2BV6 A;  4CHU A;  3F23 A;  3GO5 A;  3E5X A;  1OYW A;  2HTS A;  3EET A;  3O6B B;  1BC8 C;  3BPV A;  1FYL A;  1ZAR A;  2L4M A;  4KYW A;  1RIO H;  3WTS C;  4EGZ A;  2M87 A;  1QQI A;  5JHU A;  3SZT A;  5DCM B;  4HX7 A;  4L9T A;  3J80 Z;  3RIR A;  1HKT A;  2E7X A;  1I5Z A;  1T38 A;  3IRR A;  1FBQ A;  3QAH A;  3J81 K;  4N9H A;  2Y75 A;  2F5D A;  5D6F A;  3FZV A;  3KZZ A;  1L0O C;  4OIQ F;  1Z91 A;  2KKO A;  4BHC A;  1I27 A;  4HQM A;  4G7O F;  1YQA A;  4S05 A;  1I1G A;  2IRF G;  1Z6R A;  2G7U A;  5D8L B;  1S6L A;  2NNN A;  2O6G E;  3VOE A;  2O8X A;  3TOB A;  1HKS A;  5L3B A;  5ILV A;  2XRO A;  3KP3 A;  2TDX A;  2XAH A;  5JI6 A;  1G3S A;  3M1E A;  1IN5 A;  5EEH A;  2VBZ A;  3E97 A;  3DKW A;  4A2U A;  1HST A;  1PUE E;  1S3J A;  2UXN A;  2XHK A;  2H94 A;  5IT9 K;  2Z3Y A;  5LEK A;  3FX3 A;  3EQL F;  4HAM A;  1FBU A;  2HYG D;  5DD4 A;  4Q5S F;  4IHS A;  4BXU A;  4F7Z A;  1STZ A;  2RN7 A;  3BPX A;  1E17 A;  2DQL A;  1C0W A;  2IA0 A;  1IZ1 A;  4OIR F;  3MCZ A;  2HGC A;  3RDI A;  5ICE A;  4OMZ A;  4U0V A;  5LBQ A;  3ZP5 A;  2ESH A;  1I1S A;  3WTW C;  2F5F A;  2GQQ A;  3WTV C;  1EV7 A;  1J2X A;  4KMU X;  2AXL A;  4IJA A;  3I53 A;  2E1C A;  2GA2 A;  2CSO A;  1Q1H A;  2M30 A;  1XD7 A;  2ZBK A;  3WTY C;  1IW7 F;  2YPR A;  1IRF A;  3L9F A;  2A69 F;  2XGX A;  4HDV A;  1U3E M;  1FBS A;  5ERI A;  5ED4 A;  1R58 A;  1IXR C;  1LDJ A;  2QBY B;  1ON1 A;  4HF1 A;  1T0F A;  1KU7 A;  1JHH A;  1P4A A;  3TDU C;  1QBJ A;  1LVA A;  1QPM A;  1WQ2 A;  4LJZ F;  2LF7 A;  3V8L A;  2K02 A;  3TO7 A;  1BN5 A;  2DLL A;  5AON A;  2WC2 A;  3Q9V A;  4FX4 A;  2A6E F;  2XRN A;  4KIG A;  4WX9 A;  1Z6T A;  2D1H A;  1KYZ A;  1MJ9 A;  2MBF A;  2VBY A;  3FMQ A;  4KIF A;  4KDP A;  1YS6 A;  5E8G A;  2FSW A;  3CTA A;  1XN7 A;  4ZH4 F;  4BNC A;  3NQO A;  5L3C A;  4L18 B;  1LDD A;  2GXB A;  4L0Y B;  1H9G A;  2IVM A;  5LEJ A;  2OZU A;  2PJP A;  3L7W A;  4EJV A;  3K2Z A;  1KQ9 A;  4LG0 B;  3JW4 A;  1USS A;  2QVO A;  4L5J A;  2UXX A;  1O3T A;  1P92 A;  3R0A A;  1IN4 A;  3ROU A;  3D0S A;  2OA4 A;  3TQN A;  1HW2 A;  3K1M A;  3LQQ A;  5KK1 A;  4K2E A;  3ELK A;  1MDM A;  2W84 A;  4M74 A;  5LHI A;  1B9M A;  5DEQ A;  1OYY A;  5FB2 A;  2IPQ X;  5DCF A;  2OZ6 A;  3HRM A;  4PGG A;  2O0Y A;  1ZYR F;  2JPC A;  3KEQ A;  3GUD A;  2F5E A;  1KU3 A;  2M8E A;  2LF8 A;  4YIF A;  4GXO A;  1T2K A;  2Q0O A;  2F2E A;  4CXF A;  2A5Y B;  3NRV A;  3L2C A;  1RUN A;  1G4D A;  2JRT A;  1D8K A;  1F1Z A;  3ZMD A;  5CLS A;  2OQG A;  3IRQ A;  1GXP A;  4MEY F;  1FLI A;  2HYF A;  2EA2 A;  3FMR A;  4ETS A;  1LDK B;  4ZYE A;  5H20 A;  1Z7U A;  3M8E A;  4UXN A;  1CF7 A;  2FQ3 A;  2VE9 A;  4LLL A;  1MJA A;  3KFW X;  2KIU A;  2PQ8 A;  3M8F A;  2H6C A;  1XDS A;  2FRH A;  1O57 A;  1P2F A;  3VFZ A;  3LAP A;  1XCB A;  1LEB A;  3LA2 A;  1CGP A;  3ZPL A;  3BZ6 A;  3HOS A;  4GYG A;  2A3S A;  1J9I A;  1OPC A;  3L00 A;  2K4J A;  5DCM A;  3FM3 A;  2ZNZ A;  3GLX A;  3DPT A;  4UVB A;  2BEO A;  2ELH A;  4UV8 A;  2VOO A;  1K7A A;  2P7V B;  2XIG A;  4GO1 A;  3MFK A;  3T8R A;  1JE8 A;  3Q9S A;  3E6C C;  3K0L A;  5FD5 A;  2GWR A;  1OR7 A;  2HQR A;  3LST A;  3HSR A;  1HSJ A;  1YFH A;  2W24 A;  3T0Y A;  4OOI A;  3ML6 A;  3N97 A;  2VBW A;  3MEX A;  4EJT A;  3ISP A;  3ZN1 A;  3ZQ7 A;  3ABT A;  1YO5 C;  4ZZD A;  1KYW A;  1LEA A;  2IP2 A;  5K5O A;  2L3D A;  1KU9 A;  2PBI A;  1W7P D;  4ENN A;  3BP8 A;  4Y15 A;  2K7L A;  3E5U A;  4IF4 A;  2NNY A;  1XSX A;  1K79 A;  4M71 A;  5DUI A;  5J8C A;  1GHC A;  4O3M A;  5BQT A;  2HKO A;  1TQI A;  1IN6 A;  4DNC A;  1R5G A;  3FM5 A;  5LRR A;  5ICC A;  4G8X A;  2UZK A;  3JAM K;  1J7K A;  1XGN A;  3MQ0 A;  4OMY A;  1ULY A;  4XBF A;  3RJP A;  3VEP A;  5H6R A;  1JHF A;  1TNS A;  2RV8 A;  3GF2 A;  4KIB A;  3D5L A;  2DPU A;  2FA5 A;  1Z9C A;  2FBK A;  5CVU A;  1RNL A;  1HBX G;  2HZT A;  3M9A A;  3WE3 A;  2VXZ A;  5IT3 A;  4JBA A;  1XB4 A;  4R8H A;  2FEZ A;  4M73 A;  1F5T A;  3HRU A;  2WTE A;  1GXQ A;  2QEN A;  1SD7 A;  1EH7 A;  3REO A;  4RS8 A;  3FXR A;  4L9N A;  2AS5 F;  1BBY A;  1UHW A;  1AOY A;  2D2W A;  3JAM Z;  3WE2 A;  4OIP F;  2YSR A;  3NEU A;  4RB2 C;  3MZY A;  3JTG A;  1K6O A;  2RDP A;  4D0P A;  2P7C B;  2GZW A;  3TOA A;  1BOA A;  4G6Q A;  3EUH A;  4NQW A;  4YFK F;  4ZYG A;  2ZFW A;  4L5I A;  1ON2 A;  3PFI A;  1KQ0 A;  1W5S A;  1BM9 A;  4EQQ A;  1FSH A;  3SHF A;  2O03 A;  3CJN A;  2G9W A;  2A07 F;  3F21 A;  2H6B A;  1MDM B;  5FD6 A;  2D1V A;  2NRA C;  3J7A O;  1W7P A;  4RB1 A;  4RGU A;  4M6X A;  3LWF A;  2B0L A;  2OAZ A;  4AD9 A;  4LGW A;  1XSV A;  2ZCW A;  3VB2 A;  3C1D A;  3QU3 A;  5BMZ A;  1DPU A;  5E1Z B;  3BDD A;  3BWG A;  1PP8 F;  3U2R A;  2IA1 A;  3K69 A;  1UFM A;  5TRD A;  1MGT A;  4EJW A;  3E3V A;  4ENK A;  4WK8 F;  2LKP A;  2XV4 S;  4H0E A;  1SAX A;  4Y17 A;  2FOK A;  3RTR A;  2O3F A;  1J0R A;  1SD6 A;  4M9S A;  3IWF A;  3AAF A;  4L9V A;  3V8K A;  1ZGJ A;  4Q4Z F;  4HQE A;  2ISY A;  2DTR A;  2YR2 A;  3TDZ C;  5HS9 A;  3KP4 A;  4GCV A;  2FXA A;  4N0B A;  1YYV A;  1MZB A;  3H3U A;  1D8J A;  4L0Z B;  4LLG F;  2VOP A;  4XLP F;  1RZ4 A;  1R22 A;  4YII A;  5L3E A;  2R3S A;  5FGM A;  2EB7 A;  3TKY A;  2VC0 A;  2L4A A;  2HR3 A;  4I09 A;  1OYI A;  4GGG A;  4JK1 X;  1SMT A;  1FT9 A;  1LQ1 A;  2Z33 A;  2IW5 A;  2IJL A;  1S7O A;  2Z5U A;  3SQN A;  2QBY A;  2MLG A;  2RKH A;  1ZAO A;  3ABU A;  4UV9 A;  2EV5 A;  5JVT A;  4EJO A;  5ILS A;  3F8F A;  3DF8 A;  3ZMT A;  4AIH A;  3I54 A;  5FLX Z;  2VN2 A;  5CVI A;  5DD8 A;  2CQK A;  4P5O A;  1O3S A;  2PFB A;  3CUQ C;  2XKO A;  3IKV A;  5K1Y A;  2F5C A;  2V1U A;  3ZMV A;  3M7G A;  3VOD A;  2V1X A;  4MTE A;  5L3G A;  3EDP A;  4UHT A;  3WGG A;  1B59 A;  3FXU A;  3T1B A;  1QGP A;  3LA3 A;  3ULQ B;  5F64 A;  1DPR A;  4EVI A;  4BYY A;  4CZZ A;  1R1V A;  4U88 A;  3V4G A;  1T98 A;  1IXC A;  2HKX A;  2QLZ A;  4BHP A;  4UUV A;  1H9T A;  2X4H A;  4A6E A;  4KUM A;  4HF0 A;  2ZME A;  2EA4 A;  3PQJ A;  4A5N A;  1SFX A;  4KIC A;  4EV0 A;  1R23 A;  3GZ5 A;  5CJ9 A;  5HDK A;  1ODD A;  2ZXJ A;  2RGV A;  4AVP A;  2Q2E A;  5J8F A;  3RI4 A;  3GFM A;  3LFK A;  5HDN A;  4R79 A;  1TQP A;  2CWE A;  1EH6 A;  2KIF A;  3RKY A;  1J59 A;  3HUG A;  3I4P A;  2DU9 A;  1HW1 A;  4M9Z A;  2KJC A;  4IRG A;  1BIA A;  3KCC A;  4ZYD A;  2XVC A;  2PEX A;  2A61 A;  5FO5 A;  4EGY A;  3S2W A;  3G73 A;  3GW2 A;  3QOP A;  3RPQ A;  2PMU A;  2Y0M A;  3F3X A;  3WTT C;  3GWZ A;  4NB5 A;  3P9K A;  3HYI A;  4A0Y A;  4QLC U;  3DPL C;  3QPH A;  1ZHF A;  2R7D A;  5L3D A;  1R7J A;  2BYV E;  2PG4 A;  1MD0 A;  2JTV A;  2DBB A;  1MJB A;  5CVR A;  1O7L A;  2YU3 A;  1ZGA A;  2RQP A;  3HIF A;  3V7S A;  4EM2 A;  3DQV C;  4O5V A;  5A2Q K;  3DFG A;  2ZKZ A;  2NAZ A;  2HWV A;  4TV7 A;  4M6Y A;  4UVC A;  1HQC A;  2K86 A;  4LB6 B;  2FBI A;  4FT8 A;  3RPU A;  2DAO A;  4HOB A;  1TW3 A;  4A12 A;  5JR3 A;  1HW5 A;  1BI0 A;  1G3W A;  2M1B A;  4I01 A;  3RYP A;  3OV8 A;  3FWE A;  4JQF A;  1ZRD A;  2UWM A;  2VE8 A;  2JT1 A;  2W85 A;  2FE3 A;  2ZNY A;  3QRF F;  1D5V A;  1FPQ A;  2H09 A;  2M5W A;  4LG0 A;  2EFO A;  3V7C A;  5CVJ A;  2QWW A;  4A0Z A;  4HLY A;  2HS5 A;  4IHT A;  3F72 A;  5LHG A;  1ZG3 A;  3DEU A;  2RC4 A;  1X3U A;  1QZY A;  1UB9 A;  5KVR A;  2ADU A;  3L09 A;  3V8J A;  4HV5 A;  2QQA A;  4G7Z F;  3GYH X;  4EM0 B;  1YW8 A;  2GA1 A;  3IKT A;  2X0L A;  1S7A A;  1T39 A;  4MHG A;  3ZMZ A;  2BE5 F;  1IUY A;  2HEO A;  3F8C A;  2MA3 A;  4Y13 A;  2P5V A;  2P4W A;  3ECO A;  4Q48 A;  1DDN A;  3GFL A;  2XAF A;  4WWC A;  5FFZ A;  4EJU A;  1KU2 A;  4CYD A;  2VC1 A;  1HKQ A;  4KT5 C;  4RGX A;  5K5R A;  2GXG A;  5HS7 A;  2W57 A;  1WWX A;  1D3Y A;  4HYE A;  2CYY A;  3CDH A;  4EMS A;  4MNU A;  3F8N A;  3WOD F;  2FMY A;  2EFP A;  1MKM A;  3T8T A;  1FOK A;  4GYI A;  2ZME B;  4RB0 A;  5D4S A;  1W4M A;  1UST A;  2L54 A;  4P96 A;  2PN6 A;  5LLQ A;  1R5H A;  4FHT A;  2GAU A;  1R1U A;  4L9J A;  2Q8K A;  5E17 F;  5F6F A;  1KQ8 A;  5E20 A;  3U1D A; 
#chains in the Genus database with same CATH topology
 3IH3 A;  4IVN A;  5CPR B;  5BPI A;  1BJZ A;  3I9V 2;  4MTD A;  3HOV J;  3TP0 A;  4MFD A;  3GCM A;  5J4Y A;  2VT2 A;  2Y0S A;  1K4S A;  3W6J B;  3MAJ A;  4EEF G;  2DK8 A;  4YFN F;  4BQQ A;  5E8I A;  4DBR A;  2R0Q C;  3VPR A;  3OR2 C;  1QVT A;  3N4M A;  4HBL A;  3C18 A;  3SXY A;  1MNE A;  3PNY A;  1REP C;  1JKO C;  3LA7 A;  4FAS D;  1FTT A;  1XS9 A;  2LG4 A;  3NWT A;  5ICG A;  1SAU A;  4XLN F;  4FTH A;  5DYM A;  4E7H A;  4PGH A;  1MNM C;  2DJN A;  2WAD A;  3FIS A;  5EZH A;  4RAZ A;  1R4N B;  3HTS B;  1I3Q J;  3OYG A;  1U2W A;  4KNY A;  3HEF A;  3GTL J;  2WV1 A;  4CO8 A;  4C3H J;  5KCM A;  3IHU A;  3CCQ I;  5EGO B;  4ZDO A;  4MQV A;  3ZN0 A;  1ETW A;  2J5O A;  4XID A;  2EV0 A;  1X1D A;  2ZO4 A;  1O3R A;  3GX4 X;  4F92 B;  5FLM J;  3Q5F A;  3KE2 A;  2Z1D A;  4HLX A;  1WH5 A;  3COA C;  3ZMS A;  1E3P A;  5DM6 F;  1ZRE A;  2LY9 A;  2BY3 A;  3T5X A;  5CQE A;  1FYM A;  1Z1D A;  2ZJ2 A;  2O61 A;  1UHM A;  3DTK A;  4IHY A;  1IN8 A;  4G7H F;  4YEJ A;  1B6A A;  3IUO A;  1H0M A;  3KP5 A;  4YRV A;  4A3L J;  4XK4 A;  4QIW N;  2K9N A;  3SDB A;  4ZZL A;  1BA5 A;  2EIM H;  5EJC A;  4RBO A;  1IJW C;  3K1N A;  2HVQ A;  3J81 Z;  3J7A Y;  2NS0 A;  3KP2 A;  1Z77 A;  1P4X A;  3L2U A;  3KP6 A;  4PZJ A;  5LRS A;  1YW9 A;  5BOX A;  1LB2 A;  4BKX A;  5GAD J;  1XPX A;  5GAE J;  2X6O A;  4ZDL A;  1XDU A;  1JUM A;  3VSK A;  1JGG A;  1BJA A;  2R5Y B;  3BY6 A;  1U6G A;  3TO9 A;  3QU6 A;  5HOD A;  2EWN A;  1H89 C;  3VSL A;  4M6V A;  2MLK A;  4WCG A;  2Q10 A;  1Z21 A;  3QWL A;  1S5L C;  3B73 A;  3IAS 2;  1A31 A;  2EK5 A;  4OU0 A;  3MD2 A;  4CCN A;  2QZ8 A;  4NHJ A;  1OMI A;  4BE2 A;  1G3T A;  1XGM A;  5J6X A;  5IOZ A;  1R1T A;  4IXA A;  1OKR A;  3H9G A;  2HXO A;  3DBH B;  3DXJ F;  2O9L A;  2KJB A;  5IP7 J;  2JZY A;  3QP5 A;  2E5N A;  1S29 A;  2YX7 A;  4FE7 A;  4DGW B;  3HOU J;  1VQ4 I;  2QUF A;  4BHB A;  1GVJ A;  2FU4 A;  2Y31 A;  1TTY A;  2QGU A;  5FFX A;  3CP8 A;  3HOT A;  1V4R A;  1ZRF A;  2E5Z A;  2KRH A;  4A0X A;  3O2P E;  1TZL A;  5CKT A;  2DPD A;  2ZSH B;  1GVD A;  3X2Q H;  3WU0 A;  5HLI A;  1PVU A;  2RQQ A;  4FE4 A;  5LFA A;  2JSC A;  2X48 A;  1N75 A;  3JSP A;  4PJJ A;  4U87 A;  3ZQH A;  5IY5 H;  1U8R A;  1PDN C;  3DKX A;  5F1R A;  4P9F A;  2MC3 A;  4B43 A;  4YEL A;  4IKF A;  3G3Z A;  2K3F A;  5FJ8 J;  2MW8 A;  3I58 A;  1LKX A;  4MEX F;  1T8I A;  2D5V A;  2XGE A;  1W7P B;  2BHY A;  2ME6 A;  1JXS A;  1YJW I;  5TJJ A;  1RKW A;  2JVG A;  1UEL B;  1U78 A;  3BZC A;  2VIX A;  2HFH A;  5E1X A;  4I2O A;  2MG4 A;  2RVC A;  1B72 A;  3CJQ B;  4LK0 F;  2DJI A;  2HOE A;  3KYL A;  2ZJQ F;  2OV7 A;  1MBK A;  3E5Q A;  2A6H F;  2ETH A;  2E34 A;  1OQY A;  4I02 A;  1IF1 A;  1OCR H;  4ON0 A;  2GIV A;  4XLF A;  2XAQ A;  3GFI A;  2HDC A;  2MD0 A;  2QQ9 A;  3BOQ A;  3GBG A;  3GXO A;  2A6T A;  3H3Z A;  1K78 B;  1FYK A;  2XC7 A;  2XUB A;  2WAF A;  2P5L C;  1WGX A;  3RKW A;  2W1O A;  4M9X A;  1TWA J;  2M2E A;  1I6X A;  5LHH A;  1FC3 A;  4XSX F;  4XLC A;  2VUM J;  1YTY A;  4F55 A;  1IDZ A;  1T6S A;  2V6C A;  1WJB A;  1E2X A;  3CMY A;  2JRM A;  4UUS A;  3ABK H;  4DJA A;  3CES A;  2FNP A;  4WF2 A;  3GVA A;  1TLH B;  2F48 A;  2KP6 A;  4E7S A;  2MH9 A;  3BRO A;  4XQF A;  2LFB A;  3HJE A;  5D6E A;  2BGC A;  1MBE A;  1J5Y A;  3OYH A;  3P9C A;  2H27 A;  3CUQ A;  3BQZ A;  3CUQ B;  4B4C A;  2DA2 A;  1WJ5 A;  3HG9 A;  4A5M A;  1V5F A;  1VQ9 I;  2KZG A;  4LD5 A;  1W5T A;  5A2Q Z;  3WTX C;  5CVV A;  3HPG A;  1TQM A;  2EJR A;  3OYK A;  1I3A A;  3HKZ A;  1WI3 A;  1B9N A;  3OWT A;  4XOP A;  2E2J J;  4B09 A;  2DT7 B;  2OQR A;  3S1Q J;  4IZZ A;  2X6W A;  5IOY A;  4S04 A;  4XON A;  1R4M B;  5DUK A;  1F9N A;  3E6D A;  3E0J B;  2WV0 A;  1ZH5 A;  4B48 A;  5L3F A;  2OUM A;  3GZN B;  5EZG A;  3U9G A;  4B8X A;  4D9J A;  4I0A A;  1LPQ A;  5CYV A;  5JFR A;  4LIV A;  2BY2 A;  4OAY A;  4U0Y A;  2QQB A;  1T33 A;  4P9U A;  3MZH A;  5HLH A;  3R61 A;  2R7T A;  2WAQ N;  3DWL E;  2K9Q A;  1W0U A;  4AIK A;  3VDX A;  1WI9 A;  5C3E J;  5HVQ C;  2VPL A;  1YG2 A;  2M3A A;  2ME0 A;  4G9Y A;  1FP2 A;  5D5X B;  1BI3 A;  4CCJ A;  1YIO A;  4MFE A;  2DA4 A;  2VXD A;  4IRH A;  3WTU C;  2H8W A;  2PVI A;  4HF2 A;  2EIJ H;  3OOU A;  1X3W B;  1BC7 C;  2BXZ A;  3LL7 A;  3JTH A;  4WXD A;  4HX4 A;  1SFU A;  2CFX A;  3EUA A;  4XN0 A;  4OWR B;  1AWC A;  2PI0 A;  1YI2 I;  1LNW A;  3FMS A;  3A4C A;  1FX7 A;  4C30 A;  2DQR A;  2K9S A;  2VOD A;  2WAQ A;  1TBX A;  2L02 A;  5GAH J;  4I98 B;  1R00 A;  1QO0 D;  1IN7 A;  3BJ6 A;  1OFC X;  4RGS A;  2X1C A;  2R5Z A;  3S32 A;  1IRG A;  4Y3O A;  3FF5 A;  3I5U A;  1HXD A;  4B3A A;  4ESB A;  5H6Q A;  2DOE A;  2EFQ A;  3QP6 A;  3PNV A;  3ECH A;  4NC7 A;  1JGS A;  2QA4 I;  1JJ8 C;  2PJR A;  3PQK A;  2H1L A;  3GFJ A;  1TL8 A;  3QOD A;  2STW A;  3HBL A;  2C6Y A;  3C3W A;  3CCY A;  3TBI A;  1XSD A;  3F0C A;  3I0T A;  1W0T A;  1FIP A;  1XMA A;  1NHA A;  1Z0X A;  1ONV A;  3S16 J;  3CCJ I;  5ILU A;  4WXH A;  1Y8R B;  2P5K A;  2L01 A;  1P6R A;  2PJR B;  1X1C A;  4NC8 A;  3P5J A;  3OOP A;  4RGR A;  1YX3 A;  1YLF A;  1U5T A;  2KHM A;  1VTN C;  4ANJ A;  3HB9 A;  3WU1 B;  2EFW A;  3BCA A;  1NG6 A;  2QKL B;  5JLX A;  2R92 J;  3RYR A;  4RAY A;  1YIJ I;  2Z9O A;  2QCO A;  1MW7 A;  3F6O A;  3L2Q A;  2P8T A;  3K1P A;  3JRA A;  1U5T B;  2PMZ N;  1ZQ3 P;  1UCR A;  1XMK A;  4XN3 A;  1ETO A;  1P4W A;  2OC6 A;  3QPS A;  2HPM A;  1V5E A;  1NK2 P;  2IT0 A;  2WA0 A;  2ESN A;  2EH3 A;  2FF4 A;  4PJL A;  5DV5 A;  1YS7 A;  3CCR I;  3CO6 C;  1YRN A;  3BC8 A;  1PUF A;  2ACJ A;  4U7D A;  4KJZ A;  5AIQ A;  3TO6 A;  3LAJ A;  1BI1 A;  2NYX A;  3EUH C;  1SC7 A;  2E19 A;  2COM A;  4Z2Y A;  5BPD A;  4A6D A;  2NVQ J;  3PFY A;  2JA6 J;  1RKT A;  2UUZ A;  4XRM A;  4M3B A;  4U7B A;  3F8B A;  3DEW A;  3I64 A;  1QNT A;  2A68 F;  2K40 A;  2L0K A;  5D8K B;  1U9O A;  3I55 I;  2Y9Z A;  3S3N A;  3FXQ A;  3HHH A;  1CF7 B;  1G3Y A;  2DDA A;  3E6B A;  2FOW A;  1RR8 C;  1KA8 A;  2E7W A;  4BH9 A;  2P6T A;  2ID6 A;  3OYJ A;  1ZN2 A;  3CF2 A;  1V5G A;  2DMP A;  1SFE A;  4BY7 J;  3KZY A;  4RB3 C;  2NOG A;  4J01 A;  2R4G A;  4HA8 A;  1IUF A;  1LFP A;  3DP7 A;  3DV8 A;  3RKX A;  3AG3 H;  1U8B A;  3ZXS A;  1ZG1 A;  3R0J A;  1XCV A;  1XGO A;  5EEG A;  2M4K A;  3SEQ A;  3P7N A;  4E7J A;  4KMF A;  5J1R A;  5E18 F;  3UKG A;  3CC2 I;  1OCO H;  1J75 A;  3PSI A;  2Y9Y A;  2KRF A;  3PUF A;  2DK5 A;  1ZGW A;  3WGI A;  4LMY A;  3B02 A;  4XKB A;  1RRJ A;  2ZXW H;  3KLN A;  2WB1 N;  3R4K A;  2EZL A;  1O3Q A;  2PLY A;  3CMA I;  5D5U B;  2Z2S B;  2EZH A;  1ZRC A;  5HDG A;  3MVP A;  2P6S A;  3K7A J;  1VQP I;  2DTZ A;  1PP7 U;  1FP1 D;  1GV2 A;  4D5C A;  2M0C A;  2DI3 A;  3HC7 A;  1RR7 A;  3QPL A;  3DBL B;  4LFU A;  3WTZ A;  3I71 A;  3OS1 A;  2HQN A;  2V79 A;  1W36 D;  3A2K A;  2BW3 A;  5AIP A;  2ZB9 A;  2A05 A;  2MD5 A;  2TRT A;  4UUT A;  2W7N A;  2EFN A;  2DT5 A;  3UNG C;  1WRJ A;  4CA0 A;  2DA3 A;  4AIJ A;  4BE1 A;  3WG9 A;  5K5Q A;  5D5W B;  5JLW A;  4ZYH A;  4Q47 A;  1Y0U A;  5D4R A;  1TT5 B;  1V3F A;  3P9I A;  3SFZ A;  2MH2 A;  3CQZ J;  3KLO A;  1Y8Q B;  1UG2 A;  4CIC A;  1YW7 A;  1VQ6 I;  2FX0 A;  2OU2 A;  2H8R A;  2R7Q A;  5F27 A;  2G0E A;  1TWH J;  2XAS A;  4CGZ A;  2PMH A;  2D45 A;  4IHV A;  1D1C A;  3SJM A;  1WVR A;  1AU7 A;  2E1N A;  3FHN A;  3IWZ A;  3HRT A;  4IHX A;  3BJO A;  2MFZ A;  3U1K A;  4WXC A;  4W1U A;  4KIT B;  4LB5 A;  2CG4 A;  2XAJ A;  3I4N J;  1WJF A;  3JRE A;  3TGN A;  3VWB A;  2M4G A;  2IS2 A;  4AM3 A;  3IC7 A;  2DCE A;  2DFI A;  5E79 C;  3W2W A;  3S17 J;  3D5S C;  1MBG A;  2LLK A;  3F8M A;  2JN6 A;  4I7H A;  3CUO A;  1D0Y A;  4XIC A;  3OYI A;  2BW3 B;  2XAG A;  2O8K A;  1K83 J;  4C2U A;  4KT6 A;  4CSW A;  2BZT A;  3HOW J;  4QSH A;  5E1W A;  4PJ0 C;  3DKY A;  4HNT A;  4Z6Y A;  3ERE D;  5EG0 A;  2Y30 A;  4N4O B;  2HDW A;  2AO9 A;  1RPW A;  2R7S A;  1DUX C;  1K78 A;  5EDN A;  1RC9 A;  3RZD J;  1IG7 A;  4BBR J;  2A5W A;  3SZP A;  4N9I A;  3F9K A;  4BQN A;  1YRN B;  3S8P A;  2RNG A;  3BJA A;  3BR6 A;  5FLX K;  1SD5 A;  3HSE A;  3R60 A;  5HS8 A;  5BS6 A;  1WFX A;  1VZ0 A;  5J47 A;  1QZZ A;  4ENM A;  3KIO A;  2K5C A;  3CLQ A;  4OIN F;  5F0H A;  1UHS A;  4E70 A;  3WHC A;  4HW0 A;  1ZEL A;  3S2H J;  1K0Z A;  3HRS A;  4KN7 X;  3N05 A;  1ZR2 A;  4ABZ A;  3CLO A;  3PM1 A;  4MQ9 F;  4XKC A;  3MWM A;  4G94 A;  1IC8 A;  4QWQ A;  3BQY A;  2L7M P;  3LQR A;  4HZF A;  1Z3X A;  2JPB A;  2QF7 A;  1M1E B;  2EV6 A;  3HTU A;  5FKO A;  3DU5 A;  1FNN A;  4KN4 X;  3C7J A;  2ODH A;  2DW4 A;  3WHB A;  1EH8 A;  4BE0 A;  3KP7 A;  4UNO A;  4PCQ A;  3K9T A;  2HOS A;  2ZME C;  4EAT A;  4IRI A;  4F3Q A;  2X6X A;  1POG A;  2B63 J;  1I6H J;  4ASN A;  4N4N B;  1G6N A;  5HLG A;  3I59 B;  5HNF A;  1FWZ A;  2F5V A;  2ZXI A;  4M72 A;  2CQN A;  1QZE A;  2CS3 A;  4BL0 B;  4ENJ A;  1WKM A;  2LNB A;  4HDU A;  2MAB A;  1O7F A;  2QM3 A;  3I59 A;  3A03 A;  2H1K A;  1U5T C;  3GZ6 A;  3W6K B;  4KIS A;  3KPH A;  1BOB A;  3H35 A;  2WWY A;  2L9S A;  3LSM A;  4P55 A;  6PAX A;  2OD5 A;  3JSO A;  4KA4 A;  2Z16 A;  4YG2 F;  3HSF A;  5GPC A;  5LGT A;  3MKZ A;  1TW2 A;  5LGN A;  1H88 C;  4ESJ A;  2E2I J;  1L3L A;  1DQU A;  3OIO A;  2IXS A;  4ESF A;  2DO7 A;  4CCO A;  3KET A;  2KDO A;  1NH3 A;  4NQW B;  2KQR A;  3ONQ A;  4II2 A;  2XKP A;  3H92 A;  1KGS A;  1B4A A;  3IP4 B;  1FY7 A;  2FBH A;  2V9V A;  4OIO F;  4BQA A;  3LOC A;  4GDF A;  3LSP A;  1IAW A;  4RDU A;  3H36 A;  3V7R A;  1GUU A;  1DGR M;  1XGS A;  1Z05 A;  4BU2 A;  1JKQ C;  1JJ6 C;  1DP7 P;  3FXL A;  4HST A;  3F6V A;  2IA2 A;  4LK1 F;  4AYB A;  1T08 B;  1TWG J;  4BAY A;  3WGH A;  3K6G A;  2L7K A;  3K4J A;  2LH9 A;  4G6T B;  5LGU A;  1MND A;  3CO7 C;  4IQJ A;  4XSZ F;  4MGR A;  3JRI A;  3FKI J;  2XGD A;  1N25 A;  2DDB A;  2Z99 A;  3DPU A;  2K4B A;  3DLA A;  4V19 K;  2OBP A;  2LDU A;  5ICF A;  2DYR H;  4QPQ A;  4UVA A;  3Q3S A;  1WSU A;  5FRN A;  4XOT A;  1EA3 A;  1T95 A;  1XTA A;  2QYO A;  4DIQ A;  3FIW A;  4IPA A;  4HX8 A;  3ZQL A;  4FX0 A;  2R7Z J;  1GDT A;  4R1H A;  2M45 A;  3ZMU A;  1QVU A;  2I8D A;  3BR1 A;  4XL9 A;  2VQH A;  4X0G A;  3HOX J;  5IYD J;  1FSE A;  3O3K A;  3FHZ A;  3J80 K;  1RI7 A;  2KIM A;  1FZP B;  5GAG J;  3HOY J;  1SEU A;  1G8X A;  1IXS B;  2BBY A;  4YFX F;  4XKW A;  1MMG A;  1F4K A;  3HHG A;  1S8N A;  3BCB A;  2LRE A;  4CDG A;  2WAE A;  1ZG5 A;  2VBX A;  1TNT A;  1JTY A;  3QOE A;  4XM3 A;  2ICW G;  2M7A A;  2FNA A;  4RMN A;  2DA5 A;  1BL0 A;  3GEZ A;  2VT3 A;  1UJ8 A;  3IL2 A;  4LLN A;  5DDG A;  1BIB A;  4CYC A;  4CYC B;  4I0B A;  2X51 A;  2ISZ A;  1R36 A;  2J5P A;  2R7F A;  1DGW Y;  1B1B A;  2W00 A;  2F4O B;  4A3M J;  5D5V B;  1ZLK A;  2CUF A;  2V1D A;  2RNJ A;  2M9H A;  5HOO A;  3OIP A;  3OYC A;  1RUO A;  2LP0 A;  2DMT A;  3EYY A;  2LR8 A;  2XSD C;  2VON A;  4PSW A;  1BR2 A;  4PDK A;  2ID3 A;  2CO5 A;  3R6S A;  2M7B A;  4DQ2 A;  2N8G A;  4QPO A;  4G6D A;  2FML A;  5IT9 Z;  2CW0 F;  1SD4 A;  1JTX A;  3E6M A;  4M3E A;  1BI2 A;  2BY0 A;  1E3O C;  2DA1 A;  1XMX A;  5FLV A;  1OJL A;  2HTJ A;  4O6J A;  2R7V A;  2R7X A;  3EYI A;  1WJD A;  2WBM A;  3KEO A;  3QPT A;  4AWX B;  4HV6 A;  2F4I A;  3E1S A;  2LSO A;  3FXK A;  1DU6 A;  2FJ1 A;  2K27 A;  2CGP A;  4II3 A;  2G7H A;  1FOY A;  4EM1 A;  4U0W A;  4KFC A;  2STT A;  5C4X J;  1A04 A;  2Y48 A;  1K61 A;  1ETX A;  2W25 A;  1I39 A;  1LJ9 A;  1ZLJ A;  1UZC A;  3F22 A;  3LSJ A;  4XRF A;  1MH4 A;  1SMY F;  3MZ8 A;  2WY7 Q;  2YX4 A;  2BV6 A;  4CHU A;  3F23 A;  3GO5 A;  1B72 B;  2XPV A;  3E5X A;  1OYW A;  2HNH A;  5GP9 A;  1X4P A;  2V9P A;  1O4X A;  2HTS A;  3EET A;  3O6B B;  1WH7 A;  3U21 A;  1BC8 C;  3BPV A;  2P0W A;  2L9V A;  1FYL A;  1ZAR A;  2L4M A;  4KYW A;  2NS8 A;  1RIO H;  3BG5 A;  3WTS C;  4HEA 2;  4NUB A;  1SAN A;  3G1L A;  4EGZ A;  2M87 A;  2OTJ I;  1QQI A;  5JHU A;  3SZT A;  3JR9 A;  1SVL A;  2CUJ A;  5DCM B;  2L7Z A;  4HX7 A;  4L9T A;  5EEA A;  3J80 Z;  3RIR A;  3G2B A;  1HKT A;  2L9R A;  2E7X A;  1I5Z A;  2VJ4 A;  2CMP A;  3IRR A;  2R5Y A;  1T38 A;  1FBQ A;  3QAH A;  4C9Y A;  3TW6 A;  3J81 K;  4N9H A;  3LSH A;  2Y75 A;  1YX5 A;  2F5D A;  5D6F A;  3IMB A;  5K7Z A;  3Q0W A;  1KZH A;  3FZV A;  1VQL I;  3KZZ A;  2NVT J;  1L0O C;  1X1A A;  2F6C A;  4OIQ F;  1Z3Y A;  1Z91 A;  2KKO A;  4BHC A;  1I27 A;  2IGK A;  4HQM A;  4G7O F;  1YQA A;  4S05 A;  2HQA A;  1I1G A;  2IRF G;  1Z6R A;  2G7U A;  5D8L B;  2LVS A;  4B3X A;  4E4H A;  1RET A;  1DU0 A;  1S6L A;  2XRL A;  1HDP A;  2NNN A;  2O6G E;  3VOE A;  2O8X A;  2OCC H;  2XPW A;  3LSK A;  3TOB A;  3D1N I;  1HKS A;  2CJJ A;  3HUG B;  1GV5 A;  2IGO A;  1SVM A;  5L3B A;  5ILV A;  3BG9 A;  2XRO A;  3KP3 A;  2TDX A;  4C3I J;  1T56 A;  1W5C C;  2MYS A;  1A5J A;  1IRX A;  2XDV A;  2XAH A;  2DMQ A;  4E7L A;  3BG3 A;  5JI6 A;  2CH0 A;  2VPR A;  3Q0V A;  1G3S A;  3EUK L;  2GLO A;  3M1E A;  1IN5 A;  3IH2 A;  1GLN A;  1OIS A;  4A3B J;  5EEH A;  2F4M B;  2VBZ A;  3E97 A;  3DKW A;  4A2U A;  1ETV A;  3G1M A;  2HU9 A;  4JX5 A;  1IV8 A;  1HST A;  1PUE E;  3M8J A;  1S3J A;  2UXN A;  2JK3 A;  2ZXH A;  1JT6 A;  2W48 A;  4UUS B;  2XHK A;  1FJL A;  3MKL A;  2H94 A;  3OL4 A;  4E6K G;  5CQG A;  2M0M A;  3PO3 J;  5IT9 K;  2Z3Y A;  2OAA A;  5LEK A;  3ERM A;  3FX3 A;  3NAU A;  3EQL F;  4HAM A;  1FBU A;  1QRY A;  2HYG D;  2NVY J;  4D7N A;  5DD4 A;  4Q5S F;  4F52 A;  4BXU A;  4F7Z A;  4IHS A;  1D0Z A;  1STZ A;  2BOL A;  2LY2 A;  2RN7 A;  4JOM A;  1Z67 A;  4D5F A;  4YIR X;  3JRC A;  3G71 I;  3BPX A;  1E17 A;  2DQL A;  3KYC B;  1C0W A;  1TWC J;  1P7J A;  2NVU B;  2BVL A;  2CV1 A;  2IA0 A;  1IZ1 A;  2VKE A;  4OIR F;  1BW5 A;  2EIK H;  3BR3 A;  3MCZ A;  2XF5 A;  3OSG A;  4BEH A;  2HGC A;  2BHZ A;  2LYC A;  3PJR A;  3RDI A;  5ICE A;  5E3O A;  4OMZ A;  4U0V A;  5F1J A;  5LBQ A;  4CCL A;  2ESH A;  3ZP5 A;  4A3E J;  1I1S A;  4A3C J;  2X9D A;  3WTW C;  3GTJ J;  2DYS H;  1ITY A;  3S14 J;  2W82 A;  2HQ5 A;  2F5F A;  4BUP A;  1ZR4 A;  2GQQ A;  2BXY A;  3WTV C;  2KPM A;  1SFO J;  1EV7 A;  1Y6I A;  4ZDP A;  4A3K J;  5F08 A;  1J2X A;  4KMU X;  1ORK A;  3S1N J;  2AXL A;  1D1B A;  3ASO H;  3O8G A;  1P9Q C;  4IJA A;  2MSY A;  2CW8 A;  3I53 A;  5K7F A;  4JX4 A;  1HLV A;  2E1C A;  2GA2 A;  2CSO A;  1JUP A;  1Q1H A;  2HXI A;  2M30 A;  1E0E A;  2JA2 A;  1XD7 A;  2EQR A;  5M3M J;  2R7R A;  2LD5 A;  5IP6 A;  4MO7 A;  5TIS C;  2ZBK A;  1X58 A;  3WTY C;  1IW7 F;  2RAE A;  3DTI A;  2YPR A;  2IEK A;  1Y0N A;  1IRF A;  3AG4 H;  3L9F A;  4ZC3 A;  2A69 F;  2OCE A;  5KNL A;  5EGO A;  2XGX A;  4HDV A;  1U3E M;  1FBS A;  2AQF A;  5ERI A;  5ED4 A;  1R58 A;  1LFU P;  2VQC A;  2Y2Z A;  1IXR C;  1Y1V J;  1LDJ A;  3G1O A;  2QBY B;  1ACI A;  2EBI A;  1ON1 A;  4AU7 A;  4HF1 A;  1T0F A;  1KU7 A;  1JHH A;  3W3C A;  1PVI A;  4A3D J;  1P4A A;  3TDU C;  4BJT A;  1LVA A;  2EZI A;  1QBJ A;  2DFH A;  1XC5 A;  1ETY A;  1QPM A;  1WQ2 A;  3ZQG A;  4LJZ F;  4D7M A;  2LF7 A;  2AQE A;  2E1O A;  4PK4 A;  1S7E A;  3V8L A;  2K02 A;  3BT9 A;  2IGN A;  3TO7 A;  1BN5 A;  9ANT A;  1F0O A;  2DLL A;  5AON A;  2CW7 A;  3Q0U A;  4S0H B;  5GTH C;  1UG0 A;  2KT0 A;  2WC2 A;  3K4B A;  2A6E F;  3Q9V A;  4IQ4 A;  4FX4 A;  1U0J A;  2XRN A;  4KIG A;  1AKH A;  2K85 A;  2CRG A;  4WX9 A;  1Z6T A;  3G6E I;  1CQT A;  3A02 A;  2D1H A;  1KYZ A;  1MJ9 A;  2MBF A;  2VBY A;  3FMQ A;  4KIF A;  4BXF A;  3RKQ A;  3K4L A;  2BVM A;  4KDP A;  3SDG A;  1YS6 A;  2IGM A;  2KL4 A;  5E8G A;  2FSW A;  3CTA A;  1OR7 C;  1XN7 A;  3K10 A;  4ZH4 F;  4XLA A;  2HOT A;  4BNC A;  3NQO A;  5L3C A;  4L18 B;  1NG7 A;  1LDD A;  3A01 B;  1YJ9 I;  1APL C;  3CZ6 A;  1TT0 A;  4L0Y B;  2GXB A;  1EF4 A;  1H9G A;  3OL3 A;  2IVM A;  5LEJ A;  2OZU A;  3L2R A;  2DFF A;  3L7W A;  1MBJ A;  4EJV A;  2PJP A;  1HOM A;  3GTK J;  3CD6 I;  3K2Z A;  1K6Y A;  3CCM I;  1KQ9 A;  3OSF A;  4LG0 B;  3JW4 A;  1QHG A;  1USS A;  2QVO A;  2VQG A;  5M5X J;  4L5J A;  2JQ7 A;  4DOZ A;  3PIO F;  2UXX A;  2QSF X;  1O3T A;  1BW6 A;  2FQ4 A;  1VQO I;  3BTI A;  1P92 A;  4RLF A;  5FRM A;  3K4N A;  3R0A A;  1IN4 A;  4ZTJ A;  4FQG A;  3ROU A;  3CJR B;  3D0S A;  2OA4 A;  3TQN A;  3A0H C;  2LBF A;  4PJN A;  1HW2 A;  1AKH B;  2COB A;  3K1M A;  2QKM B;  3LQQ A;  5KK1 A;  2OJE D;  4Y4R A;  4K2E A;  3ELK A;  3ZQF A;  1MDM A;  3FK6 A;  2W84 A;  4M74 A;  3OY9 A;  3ABL H;  5LHI A;  2LBF B;  2DOF A;  3BR5 A;  4LIU A;  3RPU D;  1B9M A;  5DEQ A;  4XRS G;  1VQK I;  1OYY A;  2DMU A;  5FB2 A;  3CCU I;  3H3V K;  1VFC A;  1WJE A;  3KX2 A;  2IPQ X;  3RQ4 A;  1OCP A;  5DCF A;  3WU2 C;  2OZ6 A;  3HRM A;  4PGG A;  5BNG A;  1MMS A;  3FBN B;  4D1Q A;  1SFK A;  2O0Y A;  1ZYR F;  2ECC A;  3W6V A;  4B44 A;  1MMD A;  2JPC A;  3I56 I;  1D1A A;  3KEQ A;  3GUD A;  2F5E A;  3E7L A;  1KU3 A;  4PSX A;  4UB6 C;  2M8E A;  2LF8 A;  4YIF A;  5JHF A;  1YHQ I;  3GTP J;  4GXO A;  5FRO A;  2V1N A;  4JX6 A;  1T2K A;  4F93 B;  2Q0O A;  1MBH A;  3OYB A;  2F2E A;  4CXF A;  2A5Y B;  2JJ7 A;  2XAU A;  3CMM A;  3FKJ A;  3NRV A;  3L2C A;  2UV1 A;  3B6A A;  1RUN A;  1G4D A;  2MC4 A;  2VL8 A;  4CCM A;  1WPK A;  1D8K A;  2JRT A;  5IYC J;  1F1Z A;  3ZMD A;  5JVG F;  1IO2 A;  3K2A A;  5CLS A;  1TP4 A;  2Q1Z B;  2OQG A;  2VJI A;  3IRQ A;  1GXP A;  4MEY F;  1FLI A;  3H0D A;  3BR2 A;  1F43 A;  5FKM A;  3TL4 X;  4AID A;  2HYF A;  2EA2 A;  3FMR A;  2V4J C;  1TC3 C;  4ETS A;  1LDK B;  3NWS A;  4I76 A;  4ZYE A;  5H20 A;  1Z7U A;  3M8E A;  4CH7 A;  3AFH A;  4UXN A;  2XF6 A;  3H9J A;  4PJM A;  1CF7 A;  2VB6 A;  3CJT B;  2FQ3 A;  2JMW A;  2VE9 A;  4LLL A;  1MJA A;  2HOA A;  3AL0 C;  3PVI A;  3FDY A;  2HZD A;  3K4M A;  1YIT I;  2CQ7 A;  3IH4 A;  2VKD A;  3KFW X;  2XB5 A;  2KIU A;  5E3M A;  3HZJ A;  2PQ8 A;  3GTG J;  2JUC A;  1RES A;  3M8F A;  2H6C A;  1XDS A;  2L7F P;  2FRH A;  3TED A;  3RCO A;  2KIS A;  4B47 A;  1O57 A;  1P2F A;  3VFZ A;  3LAP A;  2ZSI B;  1XCB A;  1LEB A;  3OS0 A;  3LA2 A;  5B5E C;  1CGP A;  3ZPL A;  2R7U A;  3S3O A;  3BZ6 A;  3HOS A;  4GYG A;  2A3S A;  1J9I A;  1OPC A;  3L00 A;  1R49 A;  4XLE A;  4ITV A;  3ZRG A;  2K4J A;  1P7I A;  5DCM A;  3K70 D;  3FM3 A;  2ZNZ A;  3GLX A;  3DPT A;  4UVB A;  1DP3 A;  2BEO A;  3I4M J;  2ELH A;  5DS9 A;  4UV8 A;  2QSG X;  1PUF B;  3K70 C;  4B1R A;  1MSF C;  2VOO A;  1R5I D;  1K7A A;  2P7V B;  1PJR A;  3BG6 A;  4GFB A;  2XIG A;  4GO1 A;  3MFK A;  3T8R A;  1WZ2 A;  1JE8 A;  3Q9S A;  3E6C C;  1A6Q A;  3K0L A;  5FD5 A;  2GWR A;  2ZC2 A;  1OR7 A;  1FTZ A;  2MGQ A;  2KZV A;  3MMY B;  1XG1 A;  2HQR A;  5EF6 A;  1PYV A;  2VKH A;  1UAA A;  1LUJ B;  3LST A;  3H5N A;  3M07 A;  3ZCO A;  3HSR A;  1HSJ A;  5B1B H;  1YFH A;  2W24 A;  3T0Y A;  3OYD A;  4OOI A;  1H8A C;  3ML6 A;  3N97 A;  2VBW A;  3S15 J;  2K9L A;  2LMD A;  3MEX A;  3W2A A;  4EJT A;  2CU7 A;  3ISP A;  3J7Z I;  2DN0 A;  3ZN1 A;  3ZQ7 A;  2V6E A;  2NXN B;  4RLQ A;  3ABT A;  1YO5 C;  4ZZD A;  2CQQ A;  5DM7 F;  1S9H A;  1KYW A;  1LEA A;  2IP2 A;  5K5O A;  1NTC A;  1FMV A;  1R6R A;  4DYQ A;  2L3D A;  1KU9 A;  2GBY A;  2PBI A;  2GOM A;  4IEJ A;  1FOX A;  1W7P D;  4M3D A;  4ENN A;  3OR1 C;  3BP8 A;  2E2H J;  4Y15 A;  2K7L A;  2VJJ A;  3E5U A;  4IF4 A;  1LFB A;  5C44 J;  1EYU A;  4AYB N;  4FET A;  2QQ8 A;  3PSF A;  1Q1V A;  3DTE A;  2NNY A;  1K4T A;  1XSX A;  1K79 A;  4M71 A;  3SZG A;  4IOC F;  1ETK A;  1X1B A;  2AHQ A;  1IDY A;  2ZJP F;  5DUI A;  5J8C A;  1GHC A;  4O3M A;  5BQT A;  4BJ5 C;  4LG3 A;  2IAI A;  2HKO A;  1TQI A;  1VF9 A;  5KAI C;  1IN6 A;  1BR1 A;  3HOZ J;  4DNC A;  1R5G A;  2NS7 A;  2Y0S N;  3FM5 A;  5LRR A;  4Y33 A;  3LSG A;  1JT0 A;  5ICC A;  2Y69 H;  4A3F J;  4G8X A;  2UZK A;  1VQN I;  1Y39 A;  4DYR A;  4XR6 A;  5LD2 C;  4Y7N J;  4FIS A;  3JAM K;  4MLO A;  1J7K A;  1IGN A;  1XGN A;  3MQ0 A;  5F04 A;  1ULY A;  4OMY A;  4Y52 J;  4XBF A;  3RJP A;  5K7H A;  3VEP A;  3GTQ J;  1NI0 A;  2I10 A;  5H6R A;  1VI0 A;  1JHF A;  1TNS A;  2HI3 A;  2RV8 A;  3GF2 A;  4AVZ A;  1AHD P;  4KIB A;  3D5L A;  4I99 C;  2DPU A;  3FXM A;  3TW7 A;  2FA5 A;  1Z9C A;  2OPT A;  4CCK A;  2FBK A;  2YU9 J;  5CVU A;  1RNL A;  4BBS J;  1HBX G;  2HZT A;  4RAF A;  3GME A;  3M9A A;  3IAM 2;  2YUS A;  3WE3 A;  2VXZ A;  5IT3 A;  4JBA A;  2R5Z B;  1XB4 A;  4R8H A;  1W1W E;  2FEZ A;  4M73 A;  3H1C A;  2GOX B;  4ZTF A;  1KON A;  1F5T A;  3HRU A;  4E7I A;  2WTE A;  1GXQ A;  2QEN A;  1SD7 A;  2HVR A;  2Q2E B;  1EH7 A;  1FOW A;  3REO A;  2DMN A;  4RS8 A;  2OA9 A;  2DOD A;  3JRF A;  3FXR A;  4L9N A;  2AS5 F;  1BBY A;  1UHW A;  2B7E A;  4IOA F;  1AOY A;  2BY1 A;  1GT0 C;  2D2W A;  3JAM Z;  3WE2 A;  4OIP F;  2VJ5 A;  2YSR A;  3NEU A;  4RB2 C;  3H5A A;  3MZY A;  3JTG A;  3OS2 A;  1K6O A;  1VQ5 I;  2RDP A;  3NAR A;  4D0P A;  2P7C B;  2GZW A;  3TOA A;  1BOA A;  3KYD B;  4G6Q A;  2E60 A;  1YJN I;  3EUH A;  4NQW A;  1OLT A;  4YFK F;  1QHH D;  4ZYG A;  2ZFW A;  3S93 A;  5B1A H;  1HC8 A;  4JP0 A;  5DTD A;  2ELK A;  4L5I A;  3H5R A;  1ON2 A;  3PFI A;  4BXX J;  2QSH X;  1A6I A;  1KQ0 A;  2KLO A;  3EPZ A;  1W5S A;  1BM9 A;  4P1W A;  3A1Y A;  3PNT A;  4EQQ A;  1FSH A;  3SHF A;  2O03 A;  3CJN A;  1F36 A;  2G9W A;  2A07 F;  3F21 A;  2H6B A;  1MDM B;  1HF0 A;  5FD6 A;  2D1V A;  4H4K C;  5IYB J;  3OIQ A;  2WB1 A;  2NRA C;  1WJC A;  3LSI A;  3CCL I;  3J7A O;  1W7P A;  4RB1 A;  4RGU A;  3TP3 A;  4M6X A;  2LRD A;  4J19 A;  1VQM I;  3LWF A;  1E3H A;  3ABM H;  2X6Y A;  4UY8 I;  2X85 A;  2B0L A;  2OAZ A;  4PFP A;  3PIP F;  3JRB A;  3SYT A;  4AD9 A;  3L2V A;  1A36 A;  3FBI B;  1XSV A;  2ZCW A;  4LGW A;  3VB2 A;  3FK7 A;  3C1D A;  2IS1 A;  1X19 A;  1ETQ A;  3QU3 A;  5BMZ A;  1DPU A;  5E1Z B;  3BDD A;  3BWG A;  2DOA A;  3PO2 J;  1PP8 F;  4DZP A;  3CDL A;  4MIM A;  3U2R A;  2IA1 A;  2E36 A;  3K69 A;  3J7Y J;  1UFM A;  1FMW A;  5TRD A;  1MGT A;  1G59 A;  4EJW A;  3JCU C;  1QU3 A;  4X6A J;  3E3V A;  4ENK A;  4ZYA A;  2CFO A;  4WK8 F;  1JI8 A;  1V54 H;  2LKP A;  2XV4 S;  2JWT A;  4A69 C;  4RM3 A;  4H0E A;  4F91 B;  4Y17 A;  3CF5 F;  2E1M B;  1SAX A;  2FOK A;  3BR0 A;  4DYC A;  1WHU A;  1A35 A;  3RTR A;  2HVS A;  2O3F A;  1J0R A;  1SD6 A;  4M9S A;  3IWF A;  2X1E A;  2GIZ A;  3AAF A;  1MIJ A;  4L9V A;  3V8K A;  3C2B A;  1ZGJ A;  4Q4Z F;  5M5Y J;  3OYF A;  4HRI A;  4DW6 A;  3ESW B;  4HQE A;  2ISY A;  2GXA A;  2DTR A;  4PFO A;  4V2G A;  2YR2 A;  3TDZ C;  4E7K A;  5HS9 A;  1HA8 A;  2V7F A;  3KP4 A;  4GCV A;  5J4V A;  2FXA A;  4N0B A;  1YYV A;  2LTP A;  4BAC A;  1J09 A;  1MZB A;  4XNF A;  3H3U A;  1D8J A;  4L0Z B;  4LLG F;  3AKZ A;  5IP9 J;  3QYF A;  2XB0 X;  1X3Z B;  2PX9 A;  2VOP A;  4XMY A;  4XLP F;  1RZ4 A;  1R22 A;  4YII A;  1IV6 A;  5L3E A;  2R3S A;  3FXJ A;  5FGM A;  2EB7 A;  3B6C A;  4HSR A;  3TKY A;  2P81 A;  1VQ8 I;  2VC0 A;  2L4A A;  2L5Q A;  3GLL A;  3O8H A;  1W36 C;  1QPI A;  2R7W A;  3OYE A;  1FIA A;  2O7O A;  1MMN A;  2HR3 A;  4I09 A;  3CCS I;  1WCM J;  4CUG A;  1OYI A;  3HXL A;  3RZO J;  4GGG A;  4JK1 X;  1SMT A;  1FT9 A;  1LQ1 A;  2Z33 A;  2IW5 A;  2IJL A;  1S7O A;  2Z5U A;  3SQN A;  2CUZ A;  5HNH A;  1X2M A;  3DBR B;  2QBY A;  2MLG A;  2DT6 A;  2JSP A;  2RKH A;  1ZAO A;  3ABU A;  4UV9 A;  2EV5 A;  5JVT A;  3JRD A;  2IS6 A;  2B9S A;  4EJO A;  5ILS A;  3F8F A;  4DZJ A;  3DU6 A;  2FD5 A;  3DF8 A;  2KRC A;  3ZMT A;  4AIH A;  1B8I B;  3I54 A;  5FLX Z;  2VN2 A;  5CVI A;  3HPH A;  5EYR A;  3H9Q A;  5DD8 A;  2VLA A;  2CQK A;  4P5O A;  1X4O A;  4C2M J;  1O3S A;  2PFB A;  3K4C A;  3CUQ C;  2XKO A;  3IKV A;  5K1Y A;  2M8G X;  2F5C A;  2V1U A;  2DA7 A;  3ZMV A;  3HGG A;  4LIT A;  5TGT A;  2XF7 A;  4BDZ A;  3M7G A;  3VOD A;  3CDI A;  5B66 C;  2V1X A;  4M3G A;  4MTE A;  5J1Y A;  5L3G A;  3ZQC A;  2LC2 A;  3EDP A;  4UHT A;  1B59 A;  3WGG A;  3FXU A;  4AC0 A;  2JVH A;  4JYK A;  3T1B A;  3JRH A;  3VYU B;  2FUG 2;  1QGP A;  3LA3 A;  3ULQ B;  3BTC A;  5F64 A;  3BTL A;  3D5R C;  1DPR A;  3DCF A;  4EVI A;  4BYY A;  3ZQQ A;  3HGY A;  4CZZ A;  4XOR A;  1G2H A;  1R1V A;  4U88 A;  5FKL A;  3V4G A;  5C4J J;  1D0X A;  3LSR A;  1T98 A;  1IXC A;  2HKX A;  2QLZ A;  4BHP A;  3OYL A;  4BEH B;  4UUV A;  1H9T A;  1N77 A;  2X4H A;  4A6E A;  2V9K A;  4KUM A;  4HF0 A;  2ZME A;  3S2D J;  3M1C A;  2EA4 A;  2ELJ A;  5F0C A;  5M5W J;  2ZJR F;  1ENH A;  5J40 A;  3ZOB A;  3PQJ A;  4NNJ A;  3WG7 H;  4CZC A;  2WY8 Q;  4A5N A;  1SFX A;  4XKV A;  4KIC A;  4A3J J;  4EV0 A;  4RA2 A;  2GM4 A;  3CC7 I;  5GTI C;  1R23 A;  2KIQ A;  2YS9 A;  3SEZ A;  1MBF A;  3GZ5 A;  5CJ9 A;  4A3G J;  1AA7 A;  5HDK A;  5KHD A;  1MMA A;  2ECB A;  1ODD A;  2ZXJ A;  2DA6 A;  5HLT A;  2RGV A;  2E35 A;  3CP2 A;  4AVP A;  2KMU A;  3A0B C;  2Q2E A;  5J8F A;  1LE8 A;  3LNQ A;  3ZGK A;  3MKW B;  1H56 A;  3RI4 A;  3GFM A;  3LFK A;  5HDN A;  4C3J J;  4R79 A;  2R7O A;  1TQP A;  1EH6 A;  2CWE A;  1OCZ H;  3RQI A;  3ASN H;  2KIF A;  3RKY A;  1J59 A;  3HUG A;  2CUE A;  1MH3 A;  3I4P A;  2DU9 A;  1HW1 A;  4M9Z A;  2IBD A;  2KJC A;  4IRG A;  3S3M A;  5FKK A;  2EPF A;  2X1D A;  1BIA A;  3KCC A;  4ZYD A;  4J00 A;  1VQ7 I;  1YE9 A;  2E71 A;  2XVC A;  2PEX A;  2A61 A;  2VQL A;  4X1E A;  3HL2 A;  1U9N A;  5FO5 A;  2JA5 J;  3KZI C;  2E1M C;  3ZQI A;  2K3P A;  4BJ6 C;  4FCY A;  4EGY A;  2OF7 A;  3S2W A;  3QQA A;  5J3L A;  1MSE C;  3G73 A;  3GW2 A;  3QOP A;  3RPQ A;  4C2T A;  2PMU A;  2Y0M A;  2OTL I;  1R71 A;  3F3X A;  2NOJ B;  4GRI A;  3WTT C;  3C2H A;  3GWZ A;  4NB5 A;  1I50 J;  2O5R A;  3LFU A;  3P9K A;  3HYI A;  4A0Y A;  4QLC U;  3DPL C;  5E3N A;  3BG7 A;  3QYB A;  5H2F C;  1YOV B;  3QPH A;  1ZHF A;  2R7D A;  2HDD A;  5L3D A;  4G12 A;  2L2O A;  1ZTR A;  1T0F C;  1R7J A;  2BYV E;  2PG4 A;  2ODI A;  1R9T J;  1MD0 A;  1TWF J;  2JTV A;  3CCE I;  4IX7 A;  1NK3 P;  2DBB A;  1BR4 A;  1HCR A;  5FKN A;  1PVE A;  3SFI A;  4QTR A;  1MJB A;  2TCT A;  5CVR A;  1O7L A;  2YU3 A;  3CME I;  1ZGA A;  3GTM J;  2RQP A;  3HIF A;  3V7S A;  4EM2 A;  3DLL F;  3DQV C;  4O5V A;  1FEX A;  1EJ9 A;  4XLH A;  4HG2 A;  3DFG A;  2ZKZ A;  5A2Q K;  2IS4 A;  2NAZ A;  2HWV A;  4TV7 A;  4M6Y A;  3GTO J;  2LY1 A;  4UVC A;  3PL8 A;  1HQC A;  4NDL A;  2K86 A;  4HNV A;  5GPA A;  3S1R J;  3TMO A;  4RAG A;  4LB6 B;  2FBI A;  4FT8 A;  3RPU A;  2DAO A;  4HOB A;  1TW3 A;  2XSJ C;  4BGD A;  4A12 A;  1VND A;  4A3I J;  5JR3 A;  1HW5 A;  2NVX J;  3QYE A;  1BI0 A;  1G3W A;  4ZJZ A;  2M1B A;  3C2G A;  2LK2 A;  4I01 A;  3RSN A;  2LKX A;  1UMQ A;  4UB8 C;  3RYP A;  2XGC A;  3OV8 A;  3HKZ N;  4DBQ A;  3OYA A;  3UR3 C;  5J1U A;  3FWE A;  4L5E A;  1SVO A;  4JQF A;  3L2W A;  3G4S I;  3KEY A;  1HDD C;  4BS9 A;  1ZRD A;  3HM5 A;  3VYS B;  2UWM A;  2VE8 A;  2R93 J;  4IO9 F;  4E7Z A;  5M3F J;  2JT1 A;  2W85 A;  3VYT B;  2DXI A;  2V26 A;  2FE3 A;  2ZNY A;  3IV5 A;  3CCV I;  3QRF F;  2JA7 J;  1D5V A;  3LMM A;  1FPQ A;  3DEE A;  2H09 A;  4IL6 C;  2M5W A;  4LG0 A;  2EFO A;  3V7C A;  2VAS A;  5CVJ A;  2QWW A;  3AG2 H;  2VKV A;  4A0Z A;  5B3S H;  3W2V A;  2DFE A;  2W4S A;  4HLY A;  2HS5 A;  3M4O J;  2LOO A;  1XX5 A;  2K9M A;  4IHT A;  3F72 A;  4HPQ A;  1LE8 B;  5LHG A;  1ZG3 A;  3DEU A;  2RC4 A;  1X3U A;  1LVK A;  1QZY A;  4HNU A;  1UB9 A;  5KVR A;  3BZK A;  3S1M J;  2ADU A;  3L09 A;  3V8J A;  2RRE A;  3OYN A;  4HV5 A;  1Y56 A;  4NBQ A;  2EIN H;  1ERD A;  2QQA A;  4I6Z A;  4G7Z F;  3H0G J;  3GYH X;  4EM0 B;  1YW8 A;  2GA1 A;  2KFD A;  3IKT A;  5KAF C;  3K4K A;  2KDZ A;  1JKP C;  2X0L A;  1S7A A;  1WJA A;  1T39 A;  1JUS A;  4MHG A;  2M34 A;  3AG1 H;  1V55 H;  3ZMZ A;  4XRS A;  2BE5 F;  3VYR B;  1IUY A;  2XPU A;  2HEO A;  2LKS A;  3F8C A;  2PMZ A;  2HPI A;  3I3L A;  2MA3 A;  4Y13 A;  2P5V A;  3ECO A;  2P4W A;  4Q48 A;  3BTJ A;  3MKY B;  1X1P A;  1DDN A;  1ZKG A;  3GFL A;  3OMY A;  3FXO A;  3M3Y J;  2XAF A;  4WWC A;  2ZFU A;  3L1P A;  5FFZ A;  1OCC H;  4EJU A;  1Z7L A;  1KU2 A;  4CYD A;  1B8I A;  3V42 A;  2VC1 A;  3JRG A;  5E3L A;  2CV2 A;  2QEX I;  4W97 A;  1HKQ A;  4KT5 C;  4RGX A;  5K5R A;  5EG0 B;  4AUX A;  3MN2 A;  1JKR C;  4BY1 J;  4V2F A;  3BLY A;  2GXG A;  5HS7 A;  2HYJ A;  2W57 A;  1WWX A;  4RM2 A;  1D3Y A;  1IRZ A;  4HYE A;  2CYY A;  2CQX A;  2EZK A;  5F0F A;  3CDH A;  4EMS A;  4MNU A;  2L9N A;  3F8N A;  3WOD F;  2FMY A;  4A93 J;  2I5U A;  4BQO A;  2EIL H;  3OYM A;  2EFP A;  1MKM A;  3T8T A;  1S72 I;  1FOK A;  4GYI A;  4M3F A;  2ZME B;  4RB0 A;  5D4S A;  5IPA A;  1W4M A;  1UST A;  2L54 A;  4LOC A;  3CC4 I;  4P96 A;  4BDY A;  2PN6 A;  2JUG A;  5LLQ A;  1R5H A;  1OCT C;  3HDD A;  1D5Y A;  2CV0 A;  1X2N A;  2GAU A;  4FHT A;  3A01 A;  1R1U A;  1ZK8 A;  2JA8 J;  4L9J A;  1QA6 A;  4IHW A;  2Q8K A;  2AXT C;  3AL0 B;  4NC6 A;  3ZR8 X;  1Y1W J;  1EKE A;  3PUB A;  1N78 A;  5E17 F;  5F6F A;  2VI6 A;  4OAZ A;  4PUS A;  1KQ8 A;  5E20 A;  3U1D A; 
#chains in the Genus database with same CATH homology
 4IVN A;  5BPI A;  4MTD A;  2VT2 A;  3W6J B;  3MAJ A;  2DK8 A;  4YFN F;  5E8I A;  3N4M A;  4HBL A;  3C18 A;  3SXY A;  1REP C;  3LA7 A;  5ICG A;  4XLN F;  5DYM A;  4PGH A;  4RAZ A;  3HTS B;  1U2W A;  4KNY A;  4CO8 A;  3IHU A;  4MQV A;  3ZN0 A;  2J5O A;  2EV0 A;  2ZO4 A;  1O3R A;  3GX4 X;  3Q5F A;  3KE2 A;  4HLX A;  3COA C;  3ZMS A;  1ZRE A;  3T5X A;  1FYM A;  1Z1D A;  2ZJ2 A;  2O61 A;  1UHM A;  1IN8 A;  4G7H F;  1B6A A;  1H0M A;  3KP5 A;  4ZZL A;  3K1N A;  3J81 Z;  2NS0 A;  3KP2 A;  1P4X A;  3KP6 A;  4PZJ A;  5LRS A;  1YW9 A;  5BOX A;  1LB2 A;  1XDU A;  1BJA A;  3BY6 A;  1U6G A;  3TO9 A;  3QU6 A;  2EWN A;  2MLK A;  4WCG A;  2Q10 A;  3B73 A;  2EK5 A;  4OU0 A;  2QZ8 A;  4NHJ A;  1OMI A;  1G3T A;  1XGM A;  5J6X A;  1R1T A;  4IXA A;  1OKR A;  3DXJ F;  2KJB A;  2JZY A;  3QP5 A;  1S29 A;  2YX7 A;  2QUF A;  4BHB A;  1GVJ A;  2FU4 A;  1TTY A;  3HOT A;  5FFX A;  1V4R A;  1ZRF A;  4A0X A;  3O2P E;  2DPD A;  3WU0 A;  5HLI A;  2JSC A;  3JSP A;  1U8R A;  1PDN C;  5F1R A;  4P9F A;  2MC3 A;  3G3Z A;  3I58 A;  4MEX F;  1W7P B;  1JXS A;  5TJJ A;  1U78 A;  2HFH A;  5E1X A;  4I2O A;  2RVC A;  4LK0 F;  2HOE A;  3E5Q A;  2A6H F;  2ETH A;  4I02 A;  1IF1 A;  4ON0 A;  2GIV A;  2XAQ A;  3GFI A;  2HDC A;  2QQ9 A;  3BOQ A;  3GXO A;  3H3Z A;  1FYK A;  1K78 B;  2XUB A;  2P5L C;  3RKW A;  4M9X A;  1I6X A;  5LHH A;  1FC3 A;  4XSX F;  1YTY A;  1T6S A;  2V6C A;  1E2X A;  2FNP A;  4WF2 A;  3GVA A;  1TLH B;  2MH9 A;  3BRO A;  5D6E A;  2BGC A;  1J5Y A;  3P9C A;  2H27 A;  3CUQ A;  3CUQ B;  4A5M A;  4LD5 A;  1W5T A;  5A2Q Z;  3WTX C;  5CVV A;  1TQM A;  2EJR A;  1B9N A;  4B09 A;  2OQR A;  4S04 A;  5DUK A;  1F9N A;  3E6D A;  2WV0 A;  1ZH5 A;  5L3F A;  4B8X A;  3U9G A;  4I0A A;  5CYV A;  5JFR A;  4U0Y A;  2QQB A;  4P9U A;  3MZH A;  5HLH A;  3R61 A;  4AIK A;  1WI9 A;  5HVQ C;  1YG2 A;  4G9Y A;  1FP2 A;  5D5X B;  1BI3 A;  1YIO A;  4IRH A;  3WTU C;  4HF2 A;  1BC7 C;  3JTH A;  4WXD A;  4HX4 A;  1SFU A;  2CFX A;  1AWC A;  2PI0 A;  1LNW A;  3FMS A;  1FX7 A;  2DQR A;  2VOD A;  1TBX A;  2L02 A;  4I98 B;  1R00 A;  1QO0 D;  1IN7 A;  3BJ6 A;  4RGS A;  1IRG A;  3FF5 A;  3I5U A;  1HXD A;  4ESB A;  5H6Q A;  2EFQ A;  3QP6 A;  3ECH A;  1JGS A;  3PQK A;  3GFJ A;  2STW A;  2C6Y A;  3C3W A;  1XSD A;  3I0T A;  1XMA A;  1NHA A;  1ONV A;  5ILU A;  4WXH A;  2P5K A;  2L01 A;  1P6R A;  3OOP A;  4RGR A;  1YLF A;  1U5T A;  1VTN C;  3WU1 B;  2EFW A;  3RYR A;  4RAY A;  2Z9O A;  3F6O A;  2P8T A;  3K1P A;  1U5T B;  1UCR A;  1XMK A;  1P4W A;  2IT0 A;  2ESN A;  2FF4 A;  5DV5 A;  1YS7 A;  3CO6 C;  2ACJ A;  4U7D A;  5AIQ A;  3TO6 A;  3LAJ A;  1BI1 A;  2NYX A;  2COM A;  4Z2Y A;  5BPD A;  4A6D A;  4U7B A;  3F8B A;  3I64 A;  1QNT A;  2A68 F;  5D8K B;  3FXQ A;  3HHH A;  1CF7 B;  1G3Y A;  3E6B A;  1KA8 A;  2E7W A;  4BH9 A;  2P6T A;  1ZN2 A;  4RB3 C;  1SFE A;  3KZY A;  4HA8 A;  3DV8 A;  3DP7 A;  3RKX A;  1ZG1 A;  3R0J A;  1XCV A;  1XGO A;  5EEG A;  3P7N A;  4KMF A;  5E18 F;  1J75 A;  2KRF A;  2DK5 A;  3WGI A;  4LMY A;  3B02 A;  3KLN A;  3R4K A;  1O3Q A;  2PLY A;  5D5U B;  1ZRC A;  5HDG A;  2P6S A;  1PP7 U;  1FP1 D;  2DI3 A;  4LFU A;  3WTZ A;  3I71 A;  2HQN A;  2V79 A;  5AIP A;  2MD5 A;  2EFN A;  2DT5 A;  1WRJ A;  4AIJ A;  3WG9 A;  5K5Q A;  5D5W B;  4ZYH A;  4Q47 A;  1Y0U A;  5D4R A;  1V3F A;  3P9I A;  3SFZ A;  2MH2 A;  3KLO A;  4CIC A;  1YW7 A;  2OU2 A;  2XAS A;  4CGZ A;  2PMH A;  2D45 A;  2E1N A;  3IWZ A;  3HRT A;  3BJO A;  4WXC A;  4LB5 A;  2CG4 A;  2XAJ A;  3TGN A;  3IC7 A;  2DFI A;  3F8M A;  4I7H A;  3CUO A;  2XAG A;  5E1W A;  3ERE D;  1DUX C;  1K78 A;  3SZP A;  4N9I A;  5FLX K;  3BJA A;  1SD5 A;  3HSE A;  3R60 A;  5HS8 A;  5BS6 A;  1QZZ A;  4ENM A;  4OIN F;  4E70 A;  4HW0 A;  3HRS A;  4KN7 X;  3CLO A;  4MQ9 F;  3MWM A;  4G94 A;  4QWQ A;  3LQR A;  4HZF A;  2JPB A;  2EV6 A;  3HTU A;  1FNN A;  4KN4 X;  3C7J A;  2ODH A;  2DW4 A;  1EH8 A;  4UNO A;  3KP7 A;  4PCQ A;  3K9T A;  4IRI A;  4ASN A;  1G6N A;  5HLG A;  3I59 B;  1FWZ A;  4M72 A;  4ENJ A;  1WKM A;  2LNB A;  4HDU A;  1O7F A;  2QM3 A;  3I59 A;  1U5T C;  3GZ6 A;  3W6K B;  2WWY A;  4P55 A;  6PAX A;  2OD5 A;  3JSO A;  4KA4 A;  4YG2 F;  3HSF A;  5LGT A;  1TW2 A;  5LGN A;  4ESJ A;  1L3L A;  4ESF A;  2DO7 A;  3KET A;  2XKP A;  3H92 A;  1KGS A;  1B4A A;  1FY7 A;  2FBH A;  2V9V A;  4OIO F;  4BQA A;  1IAW A;  3V7R A;  1XGS A;  1Z05 A;  1DP7 P;  3F6V A;  2IA2 A;  4LK1 F;  4BAY A;  3WGH A;  5LGU A;  3CO7 C;  4XSZ F;  4MGR A;  2Z99 A;  2K4B A;  2OBP A;  2LDU A;  5ICF A;  4UVA A;  1WSU A;  2QYO A;  4IPA A;  4HX8 A;  4FX0 A;  4R1H A;  2M45 A;  3ZMU A;  1FSE A;  3O3K A;  3FHZ A;  3J80 K;  1RI7 A;  2KIM A;  1FZP B;  1IXS B;  2BBY A;  4YFX F;  1F4K A;  3HHG A;  1S8N A;  4CDG A;  1ZG5 A;  2VBX A;  1TNT A;  2FNA A;  3GEZ A;  2VT3 A;  3IL2 A;  4LLN A;  5DDG A;  1BIB A;  4I0B A;  2ISZ A;  1R36 A;  2J5P A;  2R7F A;  1B1B A;  1ZLK A;  5D5V B;  2V1D A;  2RNJ A;  5HOO A;  1RUO A;  3EYY A;  2VON A;  4PDK A;  2CO5 A;  3R6S A;  4DQ2 A;  4G6D A;  2FML A;  5IT9 Z;  2CW0 F;  1SD4 A;  3E6M A;  1BI2 A;  2HTJ A;  4O6J A;  3EYI A;  3KEO A;  4AWX B;  3QPT A;  4HV6 A;  2LSO A;  2K27 A;  2CGP A;  2G7H A;  4EM1 A;  4U0W A;  4KFC A;  2STT A;  1A04 A;  2Y48 A;  2W25 A;  1LJ9 A;  1ZLJ A;  3F22 A;  4XRF A;  1SMY F;  2YX4 A;  2BV6 A;  4CHU A;  3F23 A;  3GO5 A;  3E5X A;  1OYW A;  2HTS A;  3EET A;  3O6B B;  1BC8 C;  3BPV A;  1FYL A;  1ZAR A;  2L4M A;  4KYW A;  1RIO H;  3WTS C;  4EGZ A;  2M87 A;  1QQI A;  5JHU A;  3SZT A;  5DCM B;  4HX7 A;  4L9T A;  3J80 Z;  3RIR A;  1HKT A;  2E7X A;  1I5Z A;  1T38 A;  3IRR A;  1FBQ A;  3QAH A;  3J81 K;  4N9H A;  2Y75 A;  2F5D A;  5D6F A;  3IMB A;  3FZV A;  3KZZ A;  1L0O C;  4OIQ F;  1Z91 A;  2KKO A;  4BHC A;  1I27 A;  4HQM A;  4G7O F;  1YQA A;  4S05 A;  1I1G A;  2IRF G;  1Z6R A;  2G7U A;  5D8L B;  1S6L A;  2NNN A;  2O6G E;  3VOE A;  2O8X A;  3TOB A;  1HKS A;  5L3B A;  5ILV A;  2XRO A;  3KP3 A;  2TDX A;  2XAH A;  5JI6 A;  1G3S A;  3M1E A;  1IN5 A;  5EEH A;  2VBZ A;  3E97 A;  3DKW A;  4A2U A;  1HST A;  1PUE E;  1S3J A;  2UXN A;  2XHK A;  2H94 A;  5IT9 K;  2OAA A;  2Z3Y A;  5LEK A;  3FX3 A;  3EQL F;  4HAM A;  1FBU A;  2HYG D;  5DD4 A;  4Q5S F;  4IHS A;  4BXU A;  4F7Z A;  1STZ A;  2RN7 A;  3BPX A;  1E17 A;  2DQL A;  1C0W A;  2IA0 A;  1IZ1 A;  4OIR F;  3MCZ A;  2HGC A;  3RDI A;  5ICE A;  4OMZ A;  4U0V A;  5LBQ A;  3ZP5 A;  2ESH A;  1I1S A;  3WTW C;  2F5F A;  2GQQ A;  3WTV C;  1EV7 A;  1J2X A;  4KMU X;  2AXL A;  4IJA A;  3I53 A;  2E1C A;  2GA2 A;  2CSO A;  1Q1H A;  2M30 A;  1XD7 A;  2ZBK A;  3WTY C;  1IW7 F;  2YPR A;  1IRF A;  3L9F A;  2A69 F;  2XGX A;  4HDV A;  1U3E M;  1FBS A;  5ERI A;  5ED4 A;  1R58 A;  1IXR C;  1LDJ A;  2QBY B;  1ON1 A;  4HF1 A;  1T0F A;  1KU7 A;  1JHH A;  1P4A A;  3TDU C;  1QBJ A;  1LVA A;  1QPM A;  1WQ2 A;  4LJZ F;  2LF7 A;  3V8L A;  2K02 A;  3TO7 A;  1BN5 A;  2DLL A;  5AON A;  2WC2 A;  3Q9V A;  4FX4 A;  2A6E F;  2XRN A;  4KIG A;  4WX9 A;  1Z6T A;  2D1H A;  1KYZ A;  1MJ9 A;  2MBF A;  2VBY A;  3FMQ A;  4KIF A;  4KDP A;  1YS6 A;  5E8G A;  2FSW A;  3CTA A;  1XN7 A;  4ZH4 F;  4BNC A;  3NQO A;  5L3C A;  4L18 B;  1LDD A;  2GXB A;  4L0Y B;  1H9G A;  2IVM A;  5LEJ A;  2OZU A;  2PJP A;  3L7W A;  4EJV A;  3K2Z A;  1KQ9 A;  4LG0 B;  3JW4 A;  1USS A;  2QVO A;  4L5J A;  2UXX A;  1O3T A;  1P92 A;  3R0A A;  1IN4 A;  3ROU A;  3D0S A;  2OA4 A;  3TQN A;  1HW2 A;  3K1M A;  3LQQ A;  5KK1 A;  4K2E A;  3ELK A;  1MDM A;  2W84 A;  4M74 A;  5LHI A;  1B9M A;  5DEQ A;  1OYY A;  5FB2 A;  2IPQ X;  5DCF A;  2OZ6 A;  3HRM A;  4PGG A;  2O0Y A;  1ZYR F;  2JPC A;  3KEQ A;  3GUD A;  2F5E A;  1KU3 A;  2M8E A;  2LF8 A;  4YIF A;  4GXO A;  1T2K A;  2Q0O A;  2F2E A;  4CXF A;  2A5Y B;  3NRV A;  3L2C A;  1RUN A;  1G4D A;  2JRT A;  1D8K A;  1F1Z A;  3ZMD A;  5CLS A;  2OQG A;  3IRQ A;  1GXP A;  4MEY F;  1FLI A;  2HYF A;  2EA2 A;  3FMR A;  4ETS A;  1LDK B;  4ZYE A;  5H20 A;  1Z7U A;  3M8E A;  4UXN A;  1CF7 A;  2FQ3 A;  2VE9 A;  4LLL A;  1MJA A;  3KFW X;  2KIU A;  2PQ8 A;  3M8F A;  2H6C A;  1XDS A;  2FRH A;  1O57 A;  1P2F A;  3VFZ A;  3LAP A;  1XCB A;  1LEB A;  3LA2 A;  1CGP A;  3ZPL A;  3BZ6 A;  3HOS A;  4GYG A;  2A3S A;  1J9I A;  1OPC A;  3L00 A;  2K4J A;  5DCM A;  3FM3 A;  2ZNZ A;  3GLX A;  3DPT A;  4UVB A;  2BEO A;  2ELH A;  4UV8 A;  2VOO A;  1K7A A;  2P7V B;  2XIG A;  4GO1 A;  3MFK A;  3T8R A;  1JE8 A;  3Q9S A;  3E6C C;  3K0L A;  5FD5 A;  2GWR A;  1OR7 A;  2HQR A;  3LST A;  3HSR A;  1HSJ A;  1YFH A;  2W24 A;  3T0Y A;  4OOI A;  3ML6 A;  3N97 A;  2VBW A;  3MEX A;  4EJT A;  3ISP A;  3ZN1 A;  3ZQ7 A;  3ABT A;  1YO5 C;  4ZZD A;  1KYW A;  1LEA A;  2IP2 A;  5K5O A;  2L3D A;  1KU9 A;  2PBI A;  1W7P D;  4ENN A;  3BP8 A;  4Y15 A;  2K7L A;  3E5U A;  4IF4 A;  2NNY A;  1XSX A;  1K79 A;  4M71 A;  5DUI A;  5J8C A;  1GHC A;  4O3M A;  5BQT A;  2HKO A;  1TQI A;  1IN6 A;  4DNC A;  1R5G A;  3FM5 A;  5LRR A;  5ICC A;  4G8X A;  2UZK A;  3JAM K;  1J7K A;  1XGN A;  3MQ0 A;  4OMY A;  1ULY A;  4XBF A;  3RJP A;  3VEP A;  5H6R A;  1JHF A;  1TNS A;  2RV8 A;  3GF2 A;  4KIB A;  3D5L A;  2DPU A;  2FA5 A;  1Z9C A;  2FBK A;  5CVU A;  1RNL A;  1HBX G;  2HZT A;  3M9A A;  3WE3 A;  2VXZ A;  5IT3 A;  4JBA A;  1XB4 A;  4R8H A;  2FEZ A;  4M73 A;  1F5T A;  3HRU A;  2WTE A;  1GXQ A;  2QEN A;  1SD7 A;  1EH7 A;  3REO A;  4RS8 A;  2OA9 A;  3FXR A;  4L9N A;  2AS5 F;  1BBY A;  1UHW A;  1AOY A;  2D2W A;  3JAM Z;  3WE2 A;  4OIP F;  2YSR A;  3NEU A;  4RB2 C;  3MZY A;  3JTG A;  1K6O A;  2RDP A;  4D0P A;  2P7C B;  2GZW A;  3TOA A;  1BOA A;  4G6Q A;  3EUH A;  4NQW A;  4YFK F;  4ZYG A;  2ZFW A;  4L5I A;  1ON2 A;  3PFI A;  1KQ0 A;  1W5S A;  1BM9 A;  4EQQ A;  1FSH A;  3SHF A;  2O03 A;  3CJN A;  2G9W A;  2A07 F;  3F21 A;  2H6B A;  1MDM B;  5FD6 A;  2D1V A;  2NRA C;  3J7A O;  1W7P A;  4RB1 A;  4RGU A;  4M6X A;  3LWF A;  2B0L A;  2OAZ A;  4AD9 A;  4LGW A;  1XSV A;  2ZCW A;  3VB2 A;  3C1D A;  3QU3 A;  5BMZ A;  1DPU A;  5E1Z B;  3BDD A;  3BWG A;  1PP8 F;  3U2R A;  2IA1 A;  3K69 A;  1UFM A;  5TRD A;  1MGT A;  4EJW A;  3E3V A;  4ENK A;  4WK8 F;  2LKP A;  2XV4 S;  4H0E A;  1SAX A;  4Y17 A;  2FOK A;  3RTR A;  2O3F A;  1J0R A;  1SD6 A;  4M9S A;  3IWF A;  3AAF A;  4L9V A;  3V8K A;  1ZGJ A;  4Q4Z F;  4HQE A;  2ISY A;  2DTR A;  2YR2 A;  3TDZ C;  5HS9 A;  3KP4 A;  4GCV A;  2FXA A;  4N0B A;  1YYV A;  1MZB A;  3H3U A;  1D8J A;  4L0Z B;  4LLG F;  2VOP A;  4XLP F;  1RZ4 A;  1R22 A;  4YII A;  5L3E A;  2R3S A;  5FGM A;  2EB7 A;  3TKY A;  2VC0 A;  2L4A A;  2HR3 A;  4I09 A;  1OYI A;  4GGG A;  4JK1 X;  1SMT A;  1FT9 A;  1LQ1 A;  2Z33 A;  2IW5 A;  2IJL A;  1S7O A;  2Z5U A;  3SQN A;  2QBY A;  2MLG A;  2RKH A;  1ZAO A;  3ABU A;  4UV9 A;  2EV5 A;  5JVT A;  4EJO A;  5ILS A;  3F8F A;  3DF8 A;  3ZMT A;  4AIH A;  3I54 A;  5FLX Z;  2VN2 A;  5CVI A;  5DD8 A;  2CQK A;  4P5O A;  1O3S A;  2PFB A;  3CUQ C;  2XKO A;  3IKV A;  5K1Y A;  2F5C A;  2V1U A;  3ZMV A;  3M7G A;  3VOD A;  2V1X A;  4MTE A;  5L3G A;  3EDP A;  4UHT A;  3WGG A;  1B59 A;  3FXU A;  3T1B A;  1QGP A;  3LA3 A;  3ULQ B;  5F64 A;  1DPR A;  4EVI A;  4BYY A;  4CZZ A;  1R1V A;  4U88 A;  3V4G A;  1T98 A;  1IXC A;  2HKX A;  2QLZ A;  4BHP A;  4UUV A;  1H9T A;  2X4H A;  4A6E A;  4KUM A;  4HF0 A;  2ZME A;  2EA4 A;  3PQJ A;  4A5N A;  1SFX A;  4KIC A;  4EV0 A;  1R23 A;  3GZ5 A;  5CJ9 A;  5HDK A;  1ODD A;  2ZXJ A;  2RGV A;  4AVP A;  2Q2E A;  5J8F A;  3RI4 A;  3GFM A;  3LFK A;  5HDN A;  4R79 A;  1TQP A;  2CWE A;  1EH6 A;  2KIF A;  3RKY A;  1J59 A;  3HUG A;  3I4P A;  2DU9 A;  1HW1 A;  4M9Z A;  2KJC A;  4IRG A;  1BIA A;  3KCC A;  4ZYD A;  2XVC A;  2PEX A;  2A61 A;  5FO5 A;  4EGY A;  3S2W A;  3G73 A;  3GW2 A;  3QOP A;  3RPQ A;  2PMU A;  2Y0M A;  3F3X A;  3WTT C;  3GWZ A;  4NB5 A;  3P9K A;  3HYI A;  4A0Y A;  4QLC U;  3DPL C;  3QPH A;  1ZHF A;  2R7D A;  5L3D A;  1R7J A;  2BYV E;  2PG4 A;  2ODI A;  1MD0 A;  2JTV A;  2DBB A;  1MJB A;  5CVR A;  1O7L A;  2YU3 A;  1ZGA A;  2RQP A;  3HIF A;  3V7S A;  4EM2 A;  3DQV C;  4O5V A;  5A2Q K;  3DFG A;  2ZKZ A;  2NAZ A;  2HWV A;  4TV7 A;  4M6Y A;  4UVC A;  1HQC A;  2K86 A;  4LB6 B;  2FBI A;  4FT8 A;  3RPU A;  2DAO A;  4HOB A;  1TW3 A;  4A12 A;  5JR3 A;  1HW5 A;  1BI0 A;  1G3W A;  2M1B A;  4I01 A;  3RYP A;  3OV8 A;  3FWE A;  4JQF A;  1ZRD A;  2UWM A;  2VE8 A;  2JT1 A;  2W85 A;  2FE3 A;  2ZNY A;  3QRF F;  1D5V A;  1FPQ A;  2H09 A;  2M5W A;  4LG0 A;  2EFO A;  3V7C A;  5CVJ A;  2QWW A;  4A0Z A;  4HLY A;  2HS5 A;  4IHT A;  3F72 A;  5LHG A;  1ZG3 A;  3DEU A;  2RC4 A;  1X3U A;  1QZY A;  1UB9 A;  5KVR A;  2ADU A;  3L09 A;  3V8J A;  4HV5 A;  2QQA A;  4G7Z F;  3GYH X;  4EM0 B;  1YW8 A;  2GA1 A;  3IKT A;  2X0L A;  1S7A A;  1T39 A;  4MHG A;  3ZMZ A;  2BE5 F;  1IUY A;  2HEO A;  3F8C A;  2MA3 A;  4Y13 A;  2P5V A;  2P4W A;  3ECO A;  4Q48 A;  1DDN A;  3GFL A;  2XAF A;  4WWC A;  5FFZ A;  4EJU A;  1KU2 A;  4CYD A;  2VC1 A;  1HKQ A;  4KT5 C;  4RGX A;  5K5R A;  2GXG A;  5HS7 A;  2W57 A;  1WWX A;  1D3Y A;  4HYE A;  2CYY A;  3CDH A;  4EMS A;  4MNU A;  3F8N A;  3WOD F;  2FMY A;  2EFP A;  1MKM A;  3T8T A;  1FOK A;  4GYI A;  2ZME B;  4RB0 A;  5D4S A;  1W4M A;  1UST A;  2L54 A;  4P96 A;  2PN6 A;  5LLQ A;  1R5H A;  4FHT A;  2GAU A;  1R1U A;  4L9J A;  2Q8K A;  5E17 F;  5F6F A;  1KQ8 A;  5E20 A;  3U1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...