4KYWA

Restriction endonuclease dpni in complex with two dna molecules
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
254
structure length
254
Chain Sequence
MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCSEEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTPKSIIQRKPLAPTANRAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type-2 restriction enzyme DpnI
publication title Structural basis of the methylation specificity of R.DpnI.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase/dna
total genus 72
structure length 254
sequence length 254
ec nomenclature ec 3.1.21.4: Type II site-specific deoxyribonuclease.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06044 DpnI Dam-replacing family
A PF17726 DpnI_C Dam-replacing HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kywA02
3.40.210.30 Alpha Beta 3-Layer(aba) Sandwich PvuII Endonuclease; Chain A PvuII Endonuclease; Chain A 4kywA01
5E20A 2BE5F 2V9VA 1O7FA 1ZG5A 5LBQA 3DQVC 1BC7C 3E5UA 2IA1A 2JSCA 3F23A 5HLHA 1SD5A 1OKRA 1XMKA 2YPRA 2EJRA 2FU4A 4MGRA 1IUYA 2RDPA 1FYKA 2DTRA 3HRMA 3R60A 1KYWA 2CG4A 1IXCA 4EVIA 3MAJA 1NHAA 4K2EA 3WTZA 3KZYA 2HYFA 4G6DA 5CYVA 3HIFA 5L3CA 3HOSA 5A2QK 3KP5A 2D2WA 1HBXG 2V1DA 4OIPF 1G3WA 3ZN1A 1K78B 5D4SA 4I0AA 5D5UB 1P4AA 4GGGA 4MNUA 3Q9SA 2PFBA 4B09A 1FBSA 2F5FA 1QZYA 2HQNA 1JHHA 2VOPA 3L00A 3RYRA 4IRHA 3IRQA 5K5RA 4ENKA 1BI0A 1ZLJA 2HZTA 1HXDA 2GWRA 2P6TA 1J9IA 1DDNA 3NRVA 4BQAA 3GEZA 1FNNA 1QO0D 2QLZA 1J0RA 1XCVA 2G7UA 1O3RA 1W7PB 2ZO4A 4MTDA 3HSFA 3QP5A 5JFRA 1F1ZA 1GXPA 2RC4A 2XGXA 2XRNA 3BPXA 4HF2A 1U6GA 1IN4A 1R00A 2XASA 3P9IA 4WWCA 1HSJA 2HWVA 2KKOA 3O2PE 2DO7A 1YW7A 1OYIA 3IHUA 5ILVA 3J81K 4LB6B 1G3TA 2G7HA 3TDZC 4O6JA 4HF1A 2M45A 1ZYRF 1OMIA 2GZWA 5AONA 3D0SA 2FQ3A 2B0LA 3V4GA 3FXRA 1ZG1A 2DFIA 2PLYA 4OIOF 2ZBKA 1H9TA 2DBBA 1H0MA 3PQJA 4PCQA 3TOBA 3C7JA 3R6SA 2XUBA 3F22A 3REOA 3H3ZA 1B9NA 4XSXF 4M9ZA 4EMSA 1KGSA 3B02A 4HOBA 1B4AA 4ESFA 4ENMA 2QBYA 4OMYA 3WTWC 2ZNZA 2HOEA 2CFXA 2W85A 3I5UA 4IHSA 2K02A 3F3XA 1HW5A 3WGHA 2Q8KA 3OV8A 3RKXA 4CZZA 4LG0A 5LHHA 4UNOA 4G9YA 1RIOH 3U1DA 1PP7U 5CVVA 4RB1A 4EM1A 1AOYA 2XAHA 4F7ZA 5LLQA 3I54A 5E1XA 5DUIA 1F4KA 2VBYA 2PMUA 3DP7A 2L54A 1L3LA 3VOEA 3FX3A 3KP7A 4ESJA 2NS0A 4UVBA 1ZRCA 4XLNF 1B9MA 1O3SA 5BPIA 1Q1HA 1UFMA 2FBKA 1T38A 3GW2A 4RGUA 4ON0A 2QM3A 4CYDA 4AWXB 2FOKA 5H20A 2DPDA 2EA2A 2AXLA 1QZZA 1BJAA 4PDKA 4LFUA 3K69A 3BOQA 1CF7A 1Z6TA 4JBAA 2JZYA 3WTSC 1IN7A 2E7XA 3D5LA 1HKQA 3RTRA 1FYLA 4RB0A 2XKOA 1CGPA 2KIFA 5J8CA 5FFXA 4HQMA 3MFKA 3L7WA 1L0OC 4M9XA 3KZZA 1IZ1A 4P9UA 2VE9A 2OU2A 3RKWA 1LB2A 3N97A 1WWXA 5L3DA 1EH8A 2P4WA 1UCRA 1XD7A 2ZXJA 4EV0A 2LSOA 1J5YA 1E2XA 3GZ5A 4YFNF 1BI1A 3RPQA 4KFCA 5HLIA 4M9SA 1TLHB 2OQGA 2K27A 1TBXA 2V1UA 4M6XA 3CTAA 4KN4X 3ECHA 1XGMA 3BP8A 3QRFF 1YS6A 4IXAA 4RAZA 5E18F 1Y0UA 3E5QA 1LNWA 3V8JA 3FM3A 2VODA 3MCZA 1T98A 3U9GA 4XBFA 3I0TA 1Z05A 5IT9Z 2J5OA 3VB2A 3R61A 2WC2A 4P5OA 1HKTA 1U5TB 4EGYA 1BM9A 2ESNA 5DCMB 2ZKZA 4D0PA 2OZ6A 1GHCA 3FMQA 5TRDA 1MGTA 2Z3YA 1IXSB 3K2ZA 4PZJA 5CVUA 3DFGA 1R5GA 4I09A 4Y13A 4EGZA 1JGSA 4FX4A 1LDDA 3QPTA 4KT5C 2TDXA 3FF5A 1XGOA 2UXNA 1O57A 3M8FA 2HS5A 2L4MA 2ZCWA 4G8XA 4MEYF 4Q4ZF 3K1MA 3QP6A 1ZRDA 6PAXA 4QWQA 3LA7A 2ISZA 1VTNC 2W84A 2VBZA 5D6FA 2CW0F 1W7PD 4EJUA 3JAMK 1FYMA 4BH9A 2MC3A 1YW8A 3HHGA 3GWZA 3E6CC 1DUXC 1ZHFA 3GUDA 1ZAOA 2MLKA 1MDMB 3EYIA 1I27A 3VFZA 3SQNA 2KIMA 4I02A 4A2UA 1TQPA 2QQBA 1JHFA 3P9KA 2DK8A 2PG4A 4G7ZF 3HOTA 4AIHA 3Q5FA 1KU9A 1R1TA 4HA8A 3E5XA 3F21A 1X3UA 4O3MA 2HFHA 2QYOA 4ZYGA 3NQOA 4OINF 2GA1A 1FY7A 3CDHA 1ZGAA 1TW3A 2IPQX 3TKYA 4I0BA 1BN5A 1JE8A 2EV0A 1XGNA 1GXQA 4QLCU 3KETA 1UB9A 4I98B 2OZUA 2L4AA 4CGZA 2FE3A 1MZBA 1B1BA 2D45A 5A2QZ 1Z91A 4L9VA 1BC8C 2XHKA 5DEQA 2XAQA 2JPCA 2JRTA 3I58A 2F5CA 1R58A 4LLNA 5CVJA 3K9TA 4YG2F 4RAYA 3ZMSA 1ZRFA 3TO9A 3HUGA 4YFXF 1STZA 2DPUA 3T0YA 1UHMA 5E1WA 4P9FA 1IXRC 3S2WA 2AS5F 4A0YA 1KYZA 1DP7P 2A68F 1HW1A 2HTJA 2CO5A 3HRSA 3F6OA 2EWNA 4HV6A 4ZZLA 3HSRA 1XSDA 1XN7A 4A5MA 1OYYA 1HQCA 1PP8F 2HTSA 1SMTA 2F5DA 3EYYA 3L09A 2EB7A 4Y15A 2FF4A 5IT3A 1I1SA 2IRFG 4A0XA 1Z1DA 4UVAA 4MTEA 2KJCA 3DV8A 3G3ZA 1T2KA 1ZN2A 5K5QA 1BI3A 2XIGA 2IVMA 1ODDA 5EEHA 1C0WA 4OIRF 3HRTA 3J7AO 1J75A 3W6JB 4U7DA 5D8KB 3COAC 2ZMEB 5DD8A 2H09A 4TV7A 1QPMA 4RGSA 1Z9CA 3GFMA 4HBLA 1XSXA 2QQ9A 5HS8A 2L02A 3IWFA 5ILSA 4FX0A 4L5JA 2LKPA 3LSTA 1FX7A 5L3GA 2RVCA 4ZYEA 4U7BA 3M7GA 2A61A 4HX7A 4UHTA 4H0EA 3ISPA 4HDVA 1ZGJA 2A69F 2YX7A 2YX4A 4M71A 4ENNA 2LNBA 3TO7A 1HKSA 4HV5A 2P5LC 4M74A 4BAYA 2C6YA 5CVRA 1ON1A 3TQNA 1D5VA 4WXHA 4G7OF 1TW2A 5F64A 3GFIA 3CUQA 2EFNA 5ED4A 4A6EA 4I2OA 2H6BA 2HQRA 2IA2A 5DD4A 4KIFA 1BOAA 1LDJA 4GYGA 2VN2A 3RIRA 3EDPA 2P8TA 1YW9A 4U88A 5DCMA 1G4DA 3GLXA 3QAHA 5D5VB 4GO1A 2A07F 4CO8A 1RZ4A 4G94A 3TDUC 2COMA 1V3FA 3U2RA 5ICFA 1TNSA 1LEAA 3KP2A 3JSOA 1OYWA 1WI9A 3I59B 4HAMA 3SHFA 3BJOA 3LA3A 2WV0A 3RDIA 4AIJA 2UWMA 1B59A 1R22A 3WTVC 2DK5A 3OOPA 4M6YA 2NNYA 2O61A 4L9JA 3BDDA 2HDCA 5D5XB 5LGUA 2ZFWA 4P55A 2P6SA 5LRRA 1B6AA 1MJBA 1BIBA 3CO7C 3FXQA 3CUQC 1YYVA 1QNTA 4EM0B 1USSA 1K79A 2FBHA 2UZKA 4Y17A 1HSTA 4WX9A 1K7AA 1MDMA 2PN6A 3C1DA 3QPHA 3QU6A 3EETA 4Q5SF 4KMUX 2GAUA 4G7HF 1W5TA 4A6DA 2O0YA 4L0YB 2FMLA 4M72A 4N0BA 1LEBA 3MZYA 1W5SA 2XV4S 2W57A 2Y75A 4HDUA 5LEKA 1I5ZA 2D1VA 1TQMA 5FD6A 1ZG3A 4LD5A 5D5WB 4L9NA 3V8LA 5FFZA 1WQ2A 2Y0MA 4WCGA 4FT8A 1FLIA 1SFUA 3K0LA 3L2CA 2HGCA 1LVAA 4O5VA 1KQ0A 5BQTA 2EFPA 2GIVA 2PJPA 3F8CA 3J80K 4GXOA 3KP4A 1SFEA 1EH7A 5D4RA 1RUNA 2CQKA 2FEZA 5HDNA 3K1NA 2EV6A 3T8RA 3N4MA 2RKHA 5FLXZ 5HVQC 4BHBA 1T0FA 2EFQA 3FMRA 1REPC 2PI0A 3CUOA 4YIFA 2JPBA 2LF7A 3GVAA 2DLLA 4WXCA 3WE2A 2FNAA 3WTXC 4HQEA 5ICGA 3I71A 4L9TA 3IKTA 1SMYF 2BYVE 1KA8A 3BY6A 2JTVA 4ESBA 2FMYA 1LQ1A 2P5KA 2BBYA 2XAJA 2GXGA 1W4MA 2A3SA 2YR2A 1RUOA 4KA4A 1YQAA 3IWZA 2QUFA 4CHUA 4EJOA 1IN8A 2V1XA 2VT2A 5LGNA 4EQQA 1XCBA 1OR7A 3BROA 3GO5A 3RKYA 3KEOA 2CGPA 1P92A 2NRAC 2P7VB 3K1PA 3SFZA 2WWYA 5LEJA 3R0AA 4GYIA 1JXSA 1LJ9A 1D8KA 2HR3A 2Q2EA 2R7FA 3FXUA 3KLOA 2O6GE 1WRJA 4LG0B 2Q0OA 2GQQA 4IPAA 1YS7A 2ELHA 4ZH4F 3IL2A 4B8XA 3F8MA 3BJ6A 4KYWA 3JSPA 1K78A 1J2XA 5DCFA 2PEXA 2V6CA 3CO6C 2VE8A 3JTGA 4KIGA 3FWEA 4BXUA 4HZFA 2IA0A 2IP2A 1R7JA 3FHZA 2NYXA 2PBIA 3ULQB 3IKVA 4HW0A 4CXFA 5E8GA 1KU3A 4L18B 3WGIA 3R4KA 5H6RA 1FSHA 4M73A 1FWZA 2PQ8A 3TOAA 1A04A 1W7PA 1YIOA 2H94A 5FD5A 2O8XA 4LJZF 2K4BA 2QQAA 1YTYA 2MBFA 2RV8A 2YSRA 2L3DA 2ETHA 4RB3C 2RQPA 4ZYDA 2JT1A 1DPUA 3V7SA 4DNCA 2L01A 5HS9A 2NAZA 3LAPA 1FP1D 2RN7A 1U2WA 2ESHA 5FGMA 3ZP5A 3T1BA 5LGTA 3F8FA 3WODF 2BV6A 3B73A 4RS8A 1S8NA 2Y48A 2ZNYA 3ZMUA 1T39A 4ETSA 4G6QA 3BPVA 2M1BA 4OIQF 4RB2C 1KQ8A 3FM5A 4NQWA 4ASNA 1HW2A 5BPDA 4OU0A 3TGNA 2V79A 3JW4A 3R0JA 3J81Z 2IJLA 3E6DA 1FOKA 3H3UA 4LB5A 1E17A 5F6FA 5JR3A 4LK0F 5L3FA 2EK5A 1R23A 5FB2A 2XAGA 2Z99A 4P96A 1O7LA 1IF1A 2MH9A 4RGXA 1P2FA 2A5YB 5DUKA 4N9IA 2KRFA 4RGRA 2GXBA 2HKXA 3MEXA 3G73A 5HOOA 1WKMA 1AWCA 4UV8A 4U0VA 1SD4A 4XRFA 1XDUA 3LQRA 3KFWX 3C3WA 4R79A 3DXJF 3HRUA 4HX8A 2WTEA 2X0LA 1TQIA 4BYYA 1USTA 1FP2A 1S3JA 1J59A 4KMFA 2IW5A 4UV9A 1XB4A 2HKOA 3MQ0A 3ABUA 1RI7A 3E97A 5H6QA 2FSWA 3ZMZA 1SD6A 3GX4X 5J6XA 3ZMDA 3WGGA 3F8BA 2ZJ2A 1O3QA 1FC3A 3GFLA 2BGCA 1ZREA 2XAFA 3FZVA 1Z6RA 2F5EA 2K7LA 4I7HA 4PGHA 2QENA 4UVCA 5E17F 5JI6A 5CVIA 1IRGA 4IHTA 2UXXA 2YU3A 4YFKF 3WE3A 5TJJA 3WU0A 2VOOA 4Q48A 4BNCA 2R7DA 3VODA 4I01A 1FBUA 4NHJA 4HYEA 3M1EA 5F1RA 3WTTC 2H6CA 1R1VA 1U5TA 3J80Z 3HTUA 4AIKA 1MJAA 1YO5C 2OAZA 2MD5A 2MLGA 2DQRA 3T5XA 5DDGA 2DW4A 2FBIA 1QBJA 4MEXF 3P9CA 2VONA 2VXZA 4EJVA 1XDSA 1Z7UA 2W25A 5DYMA 3ABTA 3V7CA 4EJWA 2BEOA 2PMHA 1R36A 1FT9A 3O3KA 5ERIA 3HTSB 1IAWA 5D8LB 3DPLC 3ZQ7A 2ACJA 1U78A 1UHWA 5FO5A 1SFXA 3F8NA 3KE2A 1G3YA 4A5NA 4IRGA 2OBPA 3PFIA 4PGGA 3WTYC 1TNTA 3C18A 2K4JA 3HYIA 5HS7A 3LWFA 4L5IA 2F2EA 3V8KA 5L3BA 2VC0A 3QOPA 2R3SA 3IRRA 1P4XA 4XSZF 2FA5A 3BZ6A 4WXDA 5KK1A 4HF0A 3DPTA 3H92A 4CICA 2EA4A 3ERED 4OMZA 2K86A 4HLXA 1BBYA 3ELKA 2RNJA 2Z9OA 1F9NA 3F72A 3SZTA 5L3EA 3LAJA 4BHPA 1U5TC 4FHTA 5LHIA 3LQQA 4A0ZA 2DT5A 4E70A 4KNYA 1R5HA 5CJ9A 1FPQA 4GCVA 1IW7F 3T8TA 2ISYA 3DKWA 1PDNC 4KDPA 3GZ6A 3HSEA 3JAMZ 1YLFA 3AAFA 1DPRA 3SZPA 1S6LA 1GVJA 5BOXA 2M30A 3ZN0A 2KIUA 2OD5A 4N9HA 5EEGA 4L0ZB 2EFWA 1TTYA 2VC1A 3KCCA 2DQLA 2VBXA 1KU2A 1RNLA 4S05A 1XMAA 4CDGA 5BMZA 3ROUA 1P6RA 3E6BA 2DU9A 1V4RA 5LHGA 2STWA 5K5OA 4R8HA 2EFOA 3Q9VA 2RGVA 1ULYA 2FRHA 1BI2A 2OA4A 1MKMA 3CLOA 1IN6A 4NB5A 3DEUA 2E7WA 1SAXA 2EV5A 1IN5A 1R1UA 4S04A 4UXNA 2FXAA 5CLSA 5D6EA 4AVPA 4WF2A 1PUEE 1D8JA 5K1YA 1SD7A 3QU3A 2FNPA 4JK1X 3CUQB 2LDUA 1MD0A 3GXOA 1G6NA 1ONVA 2HYGD 2MA3A 3F6VA 3GFJA 4OOIA 2STTA 3JTHA 5J8FA 1BIAA 3E3VA 1ZH5A 4HLYA 3ZMTA 3GYHX 3I64A 3WTUC 4DQ2A 2CYYA 5KVRA 1FSEA 2QWWA 2VT3A 2OQRA 2XKPA 2MH2A 4A12A 3KLNA 1WSUA 5ICEA 1IRFA 4BHCA 3EQLF 2D1HA 1T6SA 4MQVA 4ENJA 4U0WA 4IRIA 2XROA 4MHGA 3SXYA 2IT0A 1S29A 4YIIA 3RPUA 2QBYB 4IVNA 2W24A 2ZMEA 4EM2A 1XSVA 3PQKA 1KQ9A 3EUHA 3I4PA 5DV5A 3RYPA 2H27A 5LRSA 2DI3A 2QVOA 2O3FA 1P4WA 3IC7A 1QQIA 3FMSA 2Z33A 3MZHA 2A6HF 3P7NA 2ADUA 2A6EF 4R1HA 3ZPLA 3LA2A 5HLGA 3NEUA 4MQ9F 5ILUA 2HEOA 3DF8A 5E1ZB 1LDKB 2X4HA 5HDGA 2M5WA 3LFKA 4KIBA 3KEQA 2QZ8A 3ECOA 1I1GA 1QGPA 4AD9A 3RJPA 4U0YA 4ZZDA 3KP3A 3W6KB 3KP6A 4HX4A 5FLXK 1D3YA 1S7AA 3M9AA 1YFHA 5AIPA 1CF7B 2VBWA 1H9GA 4WK8F 1F5TA 4Z2YA 5HDKA 4XLPF 2G9WA 4Q47A 3E6MA 3WG9A 4LGWA 1OPCA 4LMYA 3ZMVA 2M87A 4KN7X 5IT9K 3I53A 1S7OA 2XVCA 5E8IA 2NNNA 3TO6A 4EJTA 2J5PA 1EH6A 4KICA 3V7RA 3CJNA 2GA2A 3BWGA 4IJAA 5ICCA 1FZPB 1O3TA 2LF8A 1MJ9A 1J7KA 1U3EM 1EV7A 2O03A 2E1CA 4KUMA 4IF4A 3ML6A 4LLLA 3I59A 1KU7A 1FBQA 1XGSA 1YG2A 2P7CB 5JHUA 2P5VA 3M8EA 5BS6A 2E1NA 1G3SA 2CWEA 2Z5UA 2DAOA 1K6OA 1ZARA 4LLGF 3L9FA 3BJAA 1ZLKA 1U8RA 4UUVA 2KJBA 1ON2A 3VEPA 3WU1B 3RI4A 5JVTA 3O6BB 2M8EA 4LK1F 3GF2A 4ZYHA 4JQFA 3HHHA 2CSOA 5AIQA 3MWMA 1I6XA
chains in the Genus database with same CATH superfamily
1UMQA 5E20A 2BE5F 2LY2A 2YU9J 3BTJA 1SFKA 4NDLA 2V9VA 1WHUA 1O7FA 1ZG5A 4AC0A 5LBQA 3DQVC 1BC7C 4AYBN 3E5UA 4MO7A 2H1KA 5J4YA 4ITVA 2IA1A 2JSCA 3F23A 5HLHA 2MABA 1YRNA 1SD5A 1OKRA 2QKMB 3LSKA 2ZJRF 1MBHA 1XMKA 2EJRA 2YPRA 3CLQA 3HKZA 2E2JJ 3MN2A 2X6YA 2WAQN 3UKGA 1EJ9A 2KP6A 2FU4A 4MGRA 1IUYA 2RDPA 5F0CA 3SEZA 1FYKA 2DTRA 4ZJZA 3HRMA 3R60A 4F55A 5IP9J 2EZIA 2P0WA 1KYWA 2CG4A 1IXCA 4II3A 4EVIA 3H5RA 3MAJA 1I6HJ 1T33A 3W2VA 1NHAA 4K2EA 3WTZA 2YS9A 4JYKA 4BJ6C 2EIKH 4BDYA 3KZYA 2HYFA 4G6DA 4BY1J 5CYVA 3HIFA 5L3CA 2Z16A 5FKOA 3HOSA 5A2QK 2JQ7A 2NVQJ 3KP5A 2D2WA 3G2BA 2E35A 2RQQA 1HBXG 2V1DA 1Z67A 4OIPF 2O8KA 2OPTA 1G3WA 3ZN1A 1K78B 2KDOA 2N8GA 5D4SA 2M34A 4I0AA 5D5UB 1P4AA 4GGGA 1JJ8C 2CH0A 1D0YA 4MNUA 2V26A 2PFBA 3Q9SA 1ZR4A 4B09A 1FBSA 2F5FA 2B9SA 1IDZA 1QZYA 2VLAA 2HQNA 2LYCA 1JHHA 2VOPA 3L00A 3ESWB 3RYRA 4IRHA 2JSPA 1Y8RB 3CMAI 3IRQA 5K5RA 1WJCA 4ENKA 1BI0A 1R49A 1ZLJA 4X0GA 2HZTA 1HXDA 2GWRA 2P6TA 4D7MA 1J9IA 1FMWA 3SFIA 1DDNA 2VJ5A 3NRVA 4BQAA 3GEZA 1FNNA 1ZTRA 1QO0D 4C3JJ 2DOFA 2X1DA 4A3FJ 2QLZA 1J0RA 1Z21A 3BTIA 2CV1A 1E3PA 3CMMA 3I56I 1XCVA 2G7UA 1O3RA 1W7PB 2ZO4A 2NVTJ 1K61A 4MTDA 5K7FA 2NS8A 3HSFA 3QP5A 5JFRA 1F1ZA 1GXPA 2RC4A 2F4MB 2XGXA 2XRNA 3JRDA 4Y33A 3BPXA 4HF2A 2K9SA 3A01A 1U6GA 1IN4A 1R00A 2XASA 3P9IA 3BZCA 4WWCA 4J01A 1HSJA 2HWVA 2G0EA 1RKWA 5IYCJ 5JLWA 4NNJA 2KKOA 1PVIA 4F3QA 1QPIA 3O2PE 2DO7A 1YW7A 4PJ0C 3ZQFA 3CC4I 1OYIA 2H1LA 3IHUA 1MH4A 2JWTA 2ME6A 2R7RA 5ILVA 3CZ6A 2LH9A 3BR0A 3HZJA 3J81K 4LB6B 1G3TA 2G7HA 3TDZC 4LITA 4O6JA 4HF1A 1D0XA 2M45A 3RCOA 1HLVA 1ZYRF 1OMIA 1V5FA 2GZWA 5AONA 3S3MA 4B4CA 3D0SA 2FQ3A 2B0LA 3V4GA 4CSWA 5TISC 3FXRA 1ZG1A 1K6YA 2XB5A 2DFIA 4PSXA 1D1AA 4M3DA 1ETYA 2PLYA 4OIOF 2ZBKA 2NOJB 4V2GA 2A6TA 1H9TA 2DBBA 4BE2A 1H0MA 1RR7A 4ZDLA 2V6EA 3PQJA 1W1WE 4PCQA 3TOBA 3ZGKA 3C7JA 3R6SA 5M3MJ 4IKFA 2XUBA 3F22A 3REOA 3H3VK 3H3ZA 4RLFA 1B9NA 4XSXF 4M9ZA 3K2AA 4EMSA 5J1UA 1KGSA 1K83J 3B02A 4HOBA 4NC8A 1B4AA 1WGXA 3FKIJ 4NQWB 4ESFA 4BEHB 4ENMA 2QBYA 3BR5A 3JRIA 1DQUA 1OJLA 4OMYA 3WTWC 1PVEA 1R9TJ 4J00A 2ZNZA 2HOEA 2CFXA 2K9MA 2W85A 3GBGA 3I5UA 4IHSA 1A35A 2ZFUA 2K02A 3F3XA 3ZOBA 1HW5A 3WGHA 2Q8KA 1QHGA 3IH3A 1EYUA 1MSFC 3BG3A 3OV8A 3RKXA 4CZZA 4LG0A 3C2GA 3LSJA 5LHHA 4UNOA 4G9YA 4KJZA 1RIOH 3ABMH 3U1DA 4DBRA 1PP7U 5KNLA 5HNFA 1HCRA 4PJNA 3OL3A 5CVVA 4RB1A 4EM1A 3S1QJ 1AOYA 2XAHA 2BY2A 4DZJA 4F7ZA 5LLQA 2A5WA 3I54A 2X48A 3KX2A 5E1XA 4PUSA 5DUIA 1F4KA 2VBYA 1WFXA 1VQLI 2PMUA 3DP7A 1BR1A 2DJNA 2L54A 2H8WA 1BW6A 4AYBA 1L3LA 3VOEA 3FX3A 3KP7A 4ESJA 2NS0A 4UVBA 1ZRCA 3VYUB 2BZTA 4XLNF 1NK3P 1B9MA 3ZQLA 2BOLA 2R5YB 2A05A 3OYCA 3RKQA 3ZXSA 5BPIA 1O3SA 1UJ8A 2IS1A 3F9KA 4Y4RA 5M5WJ 2KQRA 5E79C 3PM1A 4A3DJ 3CCEI 1WJBA 4XKVA 1Q1HA 1UFMA 5CQEA 2LKXA 3CCRI 1MBEA 2FBKA 1NG6A 2DA2A 3VSKA 1X1BA 1T38A 2XF7A 2R5ZA 3E1SA 3PVIA 3GW2A 4RGUA 4ON0A 2QM3A 3ABKH 2DXIA 1VQNI 3RQIA 4CYDA 2IGKA 4AWXB 2FOKA 5H20A 2DPDA 5F0FA 2WBMA 2EA2A 2HDWA 3A0BC 2AXLA 1QZZA 3PIOF 3ZR8X 1BJAA 4PDKA 4LFUA 4C9YA 2DMTA 3BOQA 3K69A 1Z6TA 1CF7A 1FOWA 4BS9A 4JBAA 2ZJPF 2JZYA 3P5JA 3VSLA 3WTSC 3CP2A 1IN7A 1S9HA 2E7XA 1VFCA 3D5LA 3OIQA 5F1JA 1HKQA 4XRSA 2E5ZA 5IP6A 2HPMA 3RTRA 2ZSHB 2Z2SB 4RB0A 1FYLA 2XKOA 1CGPA 2KIFA 3A1YA 5J8CA 5J1YA 2MSYA 3S1MJ 2K85A 5FFXA 1ETWA 4HQMA 3MFKA 3L7WA 3HDDA 2DT6A 1L0OC 4M9XA 3KZZA 2HQ5A 2HNHA 1IZ1A 4P9UA 2VE9A 4IZZA 2OU2A 3CCUI 4BY7J 3RKWA 3BLYA 5BNGA 1LB2A 5GP9A 5EZHA 3N97A 1WWXA 5L3DA 2CQNA 2LC2A 4HNTA 4BDZA 1EH8A 2HOAA 2KRCA 3FIWA 1YJWI 3I55I 2P4WA 1UCRA 2PJRB 1XD7A 5GTIC 2ZXJA 4EV0A 2LSOA 4A3EJ 1J5YA 3QYFA 4RDUA 4XLCA 1E2XA 3GZ5A 4XRMA 1PJRA 2LY9A 4RLQA 4YFNF 1BI1A 3RPQA 4KFCA 5HLIA 4M9SA 1TLHB 3HB9A 5M5XJ 2OQGA 2K27A 3IV5A 2BHZA 2DYRH 1TBXA 3O8GA 4UUSB 2V1UA 4M6XA 3CTAA 2E2IJ 2L7KA 4KN4X 2W7NA 3BR3A 3ECHA 1XGMA 3BP8A 3CCLI 1MSEC 1XPXA 1FEXA 3QRFF 3O8HA 1YS6A 4IXAA 4JP0A 4RAZA 5DTDA 5E18F 3CMYA 1N75A 3RZOJ 2F6CA 2FX0A 2DMUA 4RAGA 1LFBA 2BW3B 3OYDA 1Y0UA 3ZCOA 5F08A 1I3QJ 1Y56A 3E5QA 1IC8A 4PSWA 1LNWA 3OR2C 3V8JA 3FM3A 2EPFA 1BJZA 2VODA 2CFOA 3MCZA 1T98A 3U9GA 2HVQA 2M3AA 4XBFA 2Q10A 2K3FA 3GTOJ 3I0TA 3S17J 1Z05A 5IT9Z 2J5OA 3VB2A 3R61A 2WC2A 4P5OA 1HKTA 1U5TB 1V5GA 1BM9A 2HXIA 4EGYA 2ESNA 5DCMB 2CW8A 2ZKZA 4D0PA 2OZ6A 1ETOA 1GHCA 3FMQA 5TRDA 3OYFA 2R92J 1MGTA 2Z3YA 1IXSB 3K2ZA 2QCOA 2JVGA 4PZJA 5CVUA 3DFGA 1R5GA 3K7AJ 3CF5F 4I09A 4Y13A 4EGZA 1JGSA 4FX4A 1LDDA 3EUAA 3DCFA 3QPTA 4GRIA 2LTPA 2JA2A 4KT5C 4UB8C 5IY5H 2TDXA 3FF5A 1XGOA 2UXNA 1O57A 3M8FA 1ETQA 2HS5A 3SDGA 1Z7LA 1Y8QB 2L4MA 2ZCWA 2OTLI 1TWGJ 4D7NA 4XKBA 4G8XA 4MEYF 4Q4ZF 2F48A 3AFHA 3K1MA 3QP6A 1ZRDA 6PAXA 3IH4A 1CQTA 4QWQA 2VPLA 5J40A 3LA7A 4E6KG 2ISZA 3HGYA 2GLOA 4DYQA 1VTNC 2W84A 1MMDA 4II2A 2LP0A 4XR6A 2VBZA 5D6FA 4EATA 3M8JA 2DMQA 1W0TA 2CW0F 2VB6A 1W7PD 3L2VA 3FXKA 3H36A 4KISA 3HOXJ 3OIPA 4EJUA 1MH3A 3JAMK 1FYMA 4BH9A 1FOYA 2MC3A 3K10A 1YW8A 3HHGA 3GWZA 3E6CC 2OUMA 1DUXC 1ZHFA 3GUDA 1ZAOA 4DYRA 3J7AY 1ETKA 2MLKA 1H89C 3FXJA 1MDMB 3EYIA 1I27A 3VFZA 3SQNA 2XDVA 3JRFA 2R7TA 2KIMA 1ERDA 4I02A 4A2UA 2LG4A 1TQPA 2QQBA 1D1CA 1JHFA 3P9KA 2DK8A 2PG4A 2AQEA 1WH5A 4G7ZF 3KYLA 4UY8I 2IGNA 3VDXA 3HOTA 4AIHA 3PUBA 3Q5FA 2MC4A 1KU9A 3G1MA 4ZC3A 2UUZA 1R1TA 2W82A 4HA8A 3E5XA 3Q0VA 3F21A 4IX7A 2VQCA 1X3UA 4O3MA 2HFHA 2QYOA 4QSHA 2PMZA 4ZDOA 4C2UA 4ZYGA 3NQOA 1T56A 4OINF 2GA1A 1FY7A 3CDHA 1ZGAA 2P81A 1QRYA 1TW3A 2ZXIA 4B3AA 2IPQX 4CUGA 4B1RA 1OCPA 3TKYA 3K4JA 5FKMA 2V4JC 4I0BA 4AM3A 2CW7A 1BN5A 1JE8A 2EV0A 1XGNA 1GXQA 2EZLA 2LLKA 4QLCU 3OYMA 1O4XA 5EZGA 3CCVI 3KETA 4M3GA 2Y9YA 1UB9A 4I98B 2JN6A 2OZUA 2L4AA 4CGZA 2ZMEC 1HOMA 2FE3A 1MZBA 1B1BA 3BTCA 2D45A 5A2QZ 3J7ZI 1Z91A 4L9VA 4EEFG 1E3OC 1BC8C 2OTJI 2L9RA 3EUHC 2XHKA 5DEQA 4HEA2 2XAQA 2JPCA 2JRTA 1QHHD 2DA6A 2LOOA 3I58A 2RAEA 1UHSA 3VYSB 3RZDJ 2JVHA 2XGEA 2F5CA 2E1MB 1HA8A 2EIJH 1R58A 4LLNA 4KITB 5CVJA 3K9TA 4YG2F 2JRMA 1UZCA 4RAYA 2AQFA 1XMXA 2ODHA 5KCMA 3BG6A 3VYTB 3ZMSA 3TL4X 1B72B 1ZRFA 2VUMJ 4HSRA 3CD6I 3TO9A 2OF7A 3HUGA 4YFXF 2ZB9A 3HC7A 1D1BA 1STZA 1QVTA 2DPUA 2V9KA 3VPRA 2L2OA 4BQQA 3T0YA 1TL8A 1UHMA 2GXAA 2LRDA 5E1WA 1F36A 4E7JA 1X1DA 3FXOA 1BR2A 4MFDA 3W2WA 3DLLF 4LG3A 4P9FA 1IXRC 3S2WA 1MNMC 3OYHA 2AS5F 4N4NB 4A0YA 1HDDC 3I9V2 1KYZA 1DP7P 2A68F 1HW1A 1GVDA 2M9HA 2HTJA 3OY9A 1Q1VA 2CO5A 3HRSA 3CCJI 3F6OA 5EF6A 1X1CA 2EWNA 1X3WB 3GZNB 3FKJA 3K4BA 4HV6A 4BJTA 4ZZLA 2R93J 3HSRA 1XSDA 1XN7A 2X51A 4A5MA 1OYYA 1HQCA 1JI8A 1PP8F 5JLXA 1ZELA 2HTSA 3U1KA 4E7ZA 1SMTA 2F5DA 4ANJA 3EYYA 4B3XA 3L09A 5FKKA 1MMGA 4PJMA 2EB7A 4Y15A 2WAFA 3QODA 2CQXA 2VXDA 2FF4A 5IT3A 4E7KA 1I1SA 4D9JA 1X2NA 2IRFG 4A0XA 1Z1DA 4UVAA 3TMOA 4MTEA 2KJCA 3DV8A 3G3ZA 3MKZA 1T2KA 3TW7A 4KT6A 2VQHA 1ZN2A 5K5QA 2HU9A 1BI3A 2DA3A 4XORA 2XIGA 5LFAA 2IVMA 3MKWB 3H9GA 3H5NA 1ODDA 5EEHA 4M3EA 1C0WA 4OIRF 2R5YA 3HRTA 3DEWA 3J7AO 2FOWA 3BR2A 1J75A 3W6JB 4U7DA 3ZQGA 3GTKJ 5IOYA 5C44J 5D8KB 1U8BA 3COAC 2ZMEB 4HNUA 2OJED 2ZSIB 1WJEA 5DD8A 2H09A 1NK2P 5B1AH 4TV7A 1QPMA 4IEJA 2IAIA 2NVYJ 2ZJQF 3N05A 2Q2EB 4RGSA 1Z9CA 3GFMA 4HBLA 4A3CJ 1XSXA 4BXXJ 4A3JJ 2QQ9A 3K70C 5HS8A 3OYEA 2L02A 1T8IA 1VI0A 3IWFA 5ILSA 4FX0A 4L5JA 2LKPA 2LBFA 4IL6C 5B3SH 3LSTA 1JKOC 1FX7A 5L3GA 2H8RA 2RVCA 4ZYEA 2E36A 1IRXA 3U21A 4W97A 4U7BA 3M7GA 2A61A 2R7QA 1ORKA 3FK7A 4IO9F 3GTGJ 2M7BA 3HOVJ 1MBGA 4HX7A 4UHTA 3D5RC 1G2HA 3LL7A 4H0EA 1X1PA 3ISPA 3DEEA 2Y9ZA 1NI0A 4HDVA 1ZGJA 2A69F 1IUFA 2VQGA 2PJRA 1QVUA 2YX7A 2YX4A 4M71A 4ENNA 2LNBA 3CCMI 3TO7A 2AO9A 1HKSA 2HYJA 4HV5A 2P5LC 4M74A 4BAYA 2C6YA 2VJ4A 5CVRA 4OAYA 1YI2I 1ON1A 3TQNA 1D5VA 4WXHA 3W3CA 3H9JA 2K9NA 3BG7A 2VKDA 4G7OF 3M07A 1TW2A 2V9PA 5F64A 2WADA 3QPLA 4XLEA 4UUSA 3GFIA 3S2HJ 3CUQA 3DBRB 4PJLA 3AG3H 2EFNA 5ED4A 3V42A 4A6EA 4I2OA 1JT6A 2H6BA 2HQRA 1LE8B 2KMUA 2IA2A 4Y52J 2JJ7A 3QYEA 5DD4A 3NAUA 2CQ7A 1JTXA 4KIFA 1BOAA 1LDJA 2M4KA 4GYGA 1X1AA 2JA8J 2CUFA 2LD5A 2VN2A 1JGGA 1EA3A 3OIOA 3RIRA 3EDPA 1AU7A 3CCYA 2P8TA 1YW9A 3OYNA 3S15J 4U88A 4IHXA 5DCMA 3GMEA 3OYLA 1G4DA 1LUJB 4A3IJ 3GLXA 3QAHA 5D5VB 4GO1A 2A07F 2RNGA 4CO8A 3LOCA 3FHNA 1RETA 1RZ4A 1J09A 4G94A 5GAHJ 3Q0UA 3TDUC 1U9NA 2COMA 3KYDB 1A6IA 1V3FA 4C2MJ 3IUOA 3U2RA 5ICFA 2R7VA 4RMNA 1TNSA 3CC2I 1LEAA 3HG9A 3KP2A 3JSOA 1QZEA 1OYWA 1K4TA 1WI9A 1ZR2A 3I59B 4HAMA 4QPOA 4E4HA 3SHFA 3BJOA 2HDDA 2DA4A 3LA3A 2WV0A 4HG2A 4ZTJA 1K0ZA 3RDIA 4AIJA 2UWMA 3FDYA 1B59A 1R22A 4E7IA 3PNYA 3WTVC 2DK5A 4D1QA 4NC6A 1ZKGA 1P7IA 1NTCA 1H56A 5IYDJ 2VPRA 3OOPA 4M6YA 2FJ1A 2NNYA 2O61A 4L9JA 1Y6IA 2XGDA 3G6EI 3BDDA 2HDCA 5D5XB 5FKNA 1W36D 5LGUA 3S16J 2ZFWA 4P55A 2P6SA 5LRRA 9ANTA 1B6AA 1MJBA 2DOAA 4BBRJ 1D5YA 3DTKA 3NWSA 1BIBA 3DWLE 3ABLH 3CO7C 3FXQA 1HDPA 2YUSA 3CUQC 3NWTA 1YYVA 1QNTA 3BZKA 4EM0B 3H1CA 3CMEI 1USSA 2JK3A 1HC8A 1K79A 5GAGJ 2EH3A 2FBHA 4RA2A 1WJ5A 2UZKA 4Y17A 1YIJI 1HSTA 4WX9A 4NC7A 1K7AA 5IOZA 1MDMA 4X6AJ 2PN6A 3SDBA 3DU5A 3C1DA 3QPHA 3QU6A 4CYCB 4PJJA 3EETA 4Q5SF 4KMUX 2GAUA 4G7HF 3C2HA 1W5TA 4A6DA 2O0YA 2IS2A 2KPMA 4L0YB 2FMLA 4M72A 4N0BA 2VJJA 1LEBA 2TRTA 4QIWN 3MZYA 4QTRA 1W5SA 5B66C 2CUZA 2XV4S 5FLVA 2W57A 2Y75A 3PNVA 4HDUA 5CKTA 1I5ZA 2PMZN 5LEKA 5J3LA 2D1VA 4A3BJ 1TQMA 3FXLA 3IP4B 1RRJA 5FD6A 4CCNA 1ZG3A 4LD5A 4XMYA 1GV2A 2XB0X 5D5WB 3CP8A 4L9NA 2IXSA 1E0EA 3HGGA 3V8LA 5FFZA 3S93A 1XG1A 1WQ2A 2FUG2 2Y0MA 4WCGA 2PVIA 3M3YJ 2VKHA 4FT8A 2X6XA 2GBYA 2Y30A 1FLIA 1EF4A 1VQOI 1SFUA 3MKYB 3K0LA 3L2CA 2HGCA 1LVAA 1S72I 3OWTA 1RPWA 4O5VA 1KQ0A 2XC7A 4CCLA 5BQTA 1JKRC 4ABZA 2EFPA 2GIVA 3A0HC 1G59A 1FJLA 3F8CA 3J80K 2PJPA 4F92B 1IV8A 3I4MJ 4GXOA 4UB6C 3AG4H 3KP4A 1Y0NA 3DLAA 1SFEA 1EH7A 5D4RA 1RUNA 2CQKA 5HODA 2FEZA 4FTHA 5HDNA 3K1NA 3F0CA 2Y2ZA 2EV6A 3T8RA 3N4MA 1H88C 2RKHA 1VQPI 5FLXZ 5HVQC 1WZ2A 4BHBA 3SJMA 4XNFA 4F93B 3HOWJ 1T0FA 2XSDC 1XS9A 3CJQB 1I39A 2EFQA 3FMRA 5F0HA 4U87A 1REPC 1VNDA 2PI0A 3CUOA 5GPAA 4YIFA 5KAFC 1T08B 2JPBA 2LF7A 1V54H 3GVAA 3PFYA 2DLLA 2ECBA 4WXCA 3LMMA 3WE2A 4CCKA 4AIDA 2EZHA 2FNAA 4B47A 2K40A 2KLOA 3WTXC 4D5CA 2FD5A 4HQEA 2KZGA 2Z1DA 2OCCH 1VF9A 2TCTA 2CRGA 3S3NA 5ICGA 3I71A 3A01B 2X6OA 4L9TA 3IKTA 4BXFA 3D5SC 2M2EA 3E0JB 3H0DA 2F4OB 1SMYF 2BYVE 4H4KC 2L5QA 1KA8A 3BY6A 3GTMJ 2JTVA 3K4KA 3CESA 4ESBA 2FMYA 3WHCA 3SYTA 1LQ1A 1V5EA 2P5KA 2BBYA 2LY1A 2XAJA 2GXGA 1W4MA 2A3SA 1X58A 4N4OB 2YR2A 1RUOA 4KA4A 1YQAA 3IWZA 5C4XJ 2QUFA 1TT5B 1LPQA 4XM3A 3QPSA 2NXNB 4I76A 3L2UA 4CHUA 3AL0C 4EJOA 1IN8A 2V1XA 2BY0A 1FMVA 2VT2A 4DBQA 3ERMA 5LGNA 3LSMA 3K4LA 2E5NA 4EQQA 5HLTA 1JTYA 3H0GJ 3A03A 1XCBA 1OR7A 1IDYA 3BROA 2I5UA 3GO5A 3RKYA 5LD2C 3KEOA 2CGPA 2I10A 1P92A 1LFUP 2P7VB 2NRAC 3ONQA 1VQ7I 3K1PA 5EG0B 4E7SA 4IOAF 3IAM2 5C4JJ 5E3LA 3SFZA 2WWYA 3KPHA 5LEJA 3G4SI 1DU0A 1E3HA 3G1LA 5F27A 3R0AA 4GYIA 3IH2A 1JXSA 1LJ9A 4BQOA 2IS4A 5FRNA 1D8KA 4A93J 3RSNA 3D1NI 2HR3A 1P7JA 1I3AA 2Q2EA 2QKLB 4AUXA 2R7FA 1UG2A 3FXUA 3KLOA 2O6GE 1WRJA 1YOVB 1PUFB 4DYCA 4LG0B 4ZYAA 3BR6A 2Q0OA 2W4SA 2BHYA 2ELJA 5EYRA 2GQQA 2WY7Q 4IPAA 1YS7A 3WU2C 2VL8A 1Z3YA 2ELHA 4S0HB 3HL2A 5DS9A 4ZH4F 2XF6A 2CUJA 3IL2A 4B8XA 3F8MA 2R7SA 3BJ6A 3QQAA 2XRLA 4KYWA 3JSPA 1SEUA 1YITI 3GTJJ 4JOMA 3TEDA 1K78A 4GDFA 4BQNA 1J2XA 4LIVA 3MD2A 5H2FC 2L9NA 2MGQA 2PEXA 5DCFA 5HNHA 2V6CA 3CO6C 1X4OA 2EBIA 2VE8A 1B8IB 2VQLA 3JTGA 4KIGA 3FWEA 4BXUA 4NBQA 2I8DA 2DFHA 4M3FA 4HZFA 1X4PA 2IA0A 1R7JA 2IP2A 3FHZA 2NYXA 2PBIA 2CU7A 1MNDA 1YX3A 1N77A 3ULQB 3IKVA 5KAIC 3HJEA 4HW0A 4CXFA 1F43A 1SANA 2VKVA 5E8GA 1KU3A 4L18B 3WGIA 2JUCA 2HQAA 2JUGA 3A2KA 3R4KA 5H6RA 5E3MA 1FSHA 1N78A 4M73A 3GCMA 2HOSA 3HPHA 1FWZA 3IMBA 2PQ8A 3TOAA 2R5ZB 1A04A 1W7PA 1YIOA 5FROA 2H94A 1Y1WJ 2DFFA 5FD5A 4J19A 1JKQC 5EGOB 1W5CC 5M3FJ 2R7UA 1OR7C 2O8XA 4LJZF 2K4BA 2QQAA 1YTYA 1ETVA 3PL8A 2ID3A 2MBFA 1WJAA 2RV8A 2M8GX 4UUTA 1TWAJ 1TT0A 2YSRA 3G1OA 2L3DA 1X3ZB 1MBJA 2DMNA 2ETHA 4RB3C 1LE8A 3B6CA 2RQPA 4ZYDA 2IGOA 2JT1A 4C3HJ 1DPUA 3V7SA 3PO3J 3L2WA 2E60A 1WPKA 2V1NA 4DNCA 4DZPA 1LVKA 1ZQ3P 2L01A 5HS9A 2NAZA 3AG2H 4Y7NJ 2QA4I 3LSRA 3LAPA 3M4OJ 1AKHB 1FP1D 2QQ8A 2RN7A 3E7LA 1VQ6I 5K7ZA 1U2WA 2ESHA 5FGMA 1WI3A 4XOPA 3T1BA 3ZP5A 5LGTA 3F8FA 2CS3A 3WODF 2BV6A 3B73A 4RS8A 1S8NA 3QOEA 2HVRA 3ASNH 2Y48A 2ZNYA 3CQZJ 1SAUA 3ZMUA 2LREA 1T39A 3BQYA 3HM5A 1TWHJ 5IP7J 1TWFJ 2E2HJ 4ETSA 4G6QA 4BU2A 1IJWC 3BPVA 1VZ0A 1MMNA 2M1BA 4OIQF 3DKXA 4RB2C 4FE7A 4LOCA 2WY8Q 1KQ8A 3ZQHA 3FM5A 4NQWA 4BEHA 3S8PA 1X2MA 3DBHB 3KIOA 1Y1VJ 4ASNA 1YHQI 1HW2A 3H35A 4GFBA 5BPDA 3PNTA 4OU0A 2JA6J 3TGNA 2V79A 4HSTA 3JW4A 1R4NB 3R0JA 1MBFA 4JX5A 2OC6A 3J81Z 2O7OA 2IJLA 3E6DA 1FOKA 3H3UA 1ZK8A 4LB5A 1E17A 2DDBA 5DM6F 1ACIA 5F6FA 1IO2A 5JR3A 2R7ZJ 4LK0F 5L3FA 2EK5A 1TP4A 1R23A 3L2RA 2ZC2A 5FB2A 3DU6A 5J1RA 2XAGA 2Z99A 2CJJA 4P96A 1VQ9I 1U0JA 2AXTC 1R5ID 1O7LA 4C3IJ 1WJDA 1IF1A 2MH9A 2XPWA 4RGXA 3B6AA 4CCJA 3WHBA 4DOZA 3DKYA 1P2FA 3UNGC 2A5YB 4XL9A 5DUKA 1LKXA 4N9IA 2DA1A 1DGRM 2KRFA 3DBLB 4RGRA 2GXBA 2HKXA 3MEXA 5FJ8J 3G73A 4CYCA 3TW6A 5HOOA 1WKMA 1AWCA 4UV8A 4U0VA 3VWBA 1SD4A 4HPQA 2VI6A 2BY1A 4XRFA 1VQMI 1XDUA 4P1WA 1LFPA 3W2AA 3LQRA 3KFWX 3C3WA 4R79A 3DXJF 2IEKA 3HRUA 4HX8A 2WTEA 2X0LA 1TQIA 1IGNA 4BYYA 3UR3C 1USTA 2IGMA 1S3JA 1FP2A 1J59A 3GTQJ 2E71A 1X19A 4KMFA 1BOBA 5M5YJ 2IW5A 3JRHA 1FOXA 4UV9A 1XB4A 2LKSA 2DJIA 2HKOA 1DP3A 1G8XA 3MQ0A 3ABUA 3JREA 1UG0A 1RI7A 1KONA 3E97A 3AG1H 5H6QA 3JR9A 1POGA 2FSWA 5J47A 3ZMZA 3ZRGA 2DYSH 2MFZA 4A3GJ 1SVMA 1SD6A 1SVLA 2R7OA 2DFEA 3GX4X 1Z77A 3DTIA 4FETA 3OOUA 3G71I 2BXYA 5J6XA 3H5AA 3ZMDA 2R4GA 4MLOA 3WGGA 3F8BA 4BL0B 1A6QA 2ZJ2A 1OCZH 1O3QA 1FTZA 2DA7A 1FC3A 3A02A 3GFLA 2BGCA 1AA7A 2QSHX 1ZREA 2XAFA 3FZVA 1Z6RA 2F5EA 2K7LA 2XSJC 4I7HA 4PGHA 2QENA 3OYGA 4UVCA 2ME0A 3S1RJ 3M1CA 2NOGA 5E17F 5JI6A 2M4GA 2OCEA 1R6RA 2L7MP 3FK6A 5CVIA 3LSGA 3K4NA 1IV6A 4IHVA 1GDTA 1IRGA 3BQZA 4IHTA 3OMYA 2UXXA 2YU3A 4JX4A 4YFKF 1VQKI 2L0KA 3WE3A 5B5EC 5TJJA 3WU0A 2VOOA 4Q48A 2EINH 4BNCA 1S7EA 2VKEA 1U9OA 2V7FA 2R7DA 3JRGA 1OQYA 1YE9A 2BW3A 5GADJ 3VODA 4I01A 2KIQA 3BR1A 3GTPJ 1FBUA 2E34A 4NHJA 4HYEA 4XRSG 3M1EA 1ITYA 5F1RA 2E1OA 3WTTC 3JCUC 2H6CA 1RESA 3AKZA 3CCQI 1R1VA 4OWRB 1U5TA 3J80Z 1TZLA 3HTUA 1GT0C 4AIKA 1MJAA 1R71A 5EJCA 1YO5C 2OAZA 2MD5A 2MLGA 2DQRA 1XX5A 3T5XA 2CQQA 5DDGA 4MFEA 2DW4A 1UAAA 2KHMA 2X9DA 2FBIA 1D0ZA 1QBJA 4MEXF 3P9CA 2VONA 2VXZA 1GLNA 4EJVA 1DGWY 1OCRH 1XDSA 1Z7UA 2W25A 2ZXHA 3LSIA 4LIUA 5DYMA 3ABTA 3V7CA 2IS6A 4EJWA 1APLC 2COBA 4W1UA 2BEOA 4A3LJ 3SZGA 2ECCA 3HOZJ 4B48A 2MG4A 3HUGB 2PMHA 3QYBA 4FISA 1R36A 1WH7A 4B44A 2ZXWH 1FT9A 3ZQQA 3DPUA 3O3KA 5ERIA 3TBIA 3HTSB 2L9SA 1MMAA 3OS0A 1IAWA 1WVRA 3DPLC 5D8LB 2HXOA 3BG5A 3PSFA 3ZQ7A 2ACJA 1U78A 3CDLA 1UHWA 5FO5A 1SFXA 3F8NA 2NVXJ 5EG0A 1W0UA 3KE2A 4DW6A 1G3YA 4A5NA 4DGWB 1JKPC 1Z0XA 1SC7A 1OFCX 4IRGA 2OBPA 3OYIA 3PFIA 1K4SA 2CV2A 1XC5A 4PGGA 3WTYC 3PUFA 1RR8C 1TNTA 4A3MJ 1NG7A 3C18A 2K4JA 3HYIA 5HS7A 2BXZA 3LWFA 1DU6A 2X6WA 2W00A 3HXLA 4L5IA 2F2EA 1R4MB 3V8KA 5L3BA 2WA0A 2VC0A 2HI3A 2KDZA 1PUFA 1OCOH 2AHQA 3QOPA 2QF7A 4YEJA 2R3SA 3IRRA 4OAZA 1P4XA 4XSZF 2FA5A 3BZ6A 1JUMA 4WXDA 3H9QA 5KK1A 4XQFA 3J7YJ 4AU7A 2K5CA 3BCAA 4HF0A 2GIZA 3DPTA 3H92A 3L1PA 4BE1A 4CICA 2EQRA 2EA4A 3ERED 4OMZA 2K86A 4YELA 1ETXA 2M0MA 2DT7B 1BBYA 4HLXA 3OSGA 4C30A 3VYRB 3ELKA 3CCSI 2RNJA 2Z9OA 3OYKA 1F9NA 5EEAA 2Y0SN 1OISA 3F72A 3I3LA 3OL4A 3SZTA 4BGDA 5L3EA 3LAJA 3K4MA 2BVLA 3OR1C 1M1EB 1U5TC 4BHPA 4FHTA 1MW7A 2KT0A 5LHIA 1B8IA 1FIAA 3LQQA 4A0ZA 2XF5A 2DT5A 2R7WA 4E70A 2O9LA 1R5HA 4KNYA 4IQ4A 5CJ9A 1FTTA 1FPQA 1RC9A 2M7AA 4GCVA 2PX9A 1IW7F 4RBOA 1YRNB 3T8TA 1IRZA 2ISYA 3DKWA 2CUEA 2WAQA 1PDNC 3DTEA 5F04A 1GV5A 5B1BH 4KDPA 3BT9A 4XIDA 3GZ6A 3QWLA 3Q3SA 2JA5J 3HSEA 4B43A 3JAMZ 1YLFA 3AAFA 1DPRA 3ZQCA 3SZPA 3FISA 5EGOA 2LFBA 4PFPA 1S6LA 1KZHA 3S32A 4AVZA 2WB1N 1GVJA 5BOXA 2XPUA 2M30A 3ZN0A 2KIUA 2OD5A 4IHWA 3SEQA 4N9HA 4F91B 5EEGA 4L0ZB 2EFWA 3W6VA 1TTYA 3IAS2 2E19A 2VC1A 1JT0A 3KCCA 2LBFB 2DQLA 1QA6A 2VBXA 1MMSA 2VIXA 3OSFA 4FE4A 1KU2A 1RNLA 4S05A 4A3KJ 2QSGX 1XMAA 4CDGA 5BMZA 1HF0A 3ROUA 3S2DJ 1P6RA 1MBKA 4HNVA 3E6BA 2DU9A 1WJFA 2HVSA 4D5FA 1V4RA 5LHGA 2STWA 2VJIA 5K5OA 2MD0A 3HBLA 4XOTA 3KEYA 2XPVA 4R8HA 2EFOA 3Q9VA 1AKHA 2RGVA 4CZCA 1B72A 4A69C 4X1EA 3MVPA 1UELB 1ULYA 2FRHA 2MW8A 1BI2A 2OA4A 1MKMA 2NVUB 2W1OA 3CLOA 4JX6A 1IN6A 5K7HA 3FBNB 4NB5A 3DEUA 3K6GA 2E7WA 3HOYJ 2Y31A 1YX5A 1SAXA 2EV5A 1IN5A 1R1UA 4C2TA 4S04A 1BR4A 4UXNA 2FXAA 3PJRA 5CLSA 2OA9A 4XK4A 2RREA 3BG9A 5D6EA 2ICWG 4AVPA 1JUSA 1JUPA 3RPUD 4WF2A 1PUEE 3OS1A 1D8JA 5K1YA 1SD7A 3QU3A 2FNPA 4JK1X 3CUQB 2FQ4A 2DTZA 2LDUA 1MD0A 3GXOA 1G6NA 4BKXA 1ONVA 2HYGD 2IBDA 3GLLA 2XGCA 1BW5A 5FRMA 2MA3A 3PIPF 2ELKA 3LNQA 3F6VA 3GFJA 1A5JA 1W36C 4OOIA 2STTA 3JTHA 2F4IA 2Q1ZB 1BIAA 3E3VA 5J8FA 4HLYA 1ZH5A 3ZMTA 4DJAA 2HZDA 2B7EA 3GYHX 3I64A 5CPRB 5FLMJ 3WTUC 4DQ2A 4XN3A 2CYYA 5KVRA 1FSEA 3PSIA 2QWWA 2VT3A 2OQRA 3BCBA 2XKPA 2MH2A 2OAAA 4Y3OA 3LSPA 4A12A 3KLNA 1WSUA 1VQ8I 2KZVA 5ICEA 4V2FA 2EILH 1IRFA 4CCMA 4RM3A 1VQ5I 3S14J 2EIMH 4BHCA 2L7FP 3EQLF 4XLHA 3MMYB 2ID6A 2D1HA 2O5RA 1T6SA 2GOMA 3PO2J 2M0CA 4MQVA 4ENJA 4PFOA 4U0WA 1SVOA 4IRIA 2LMDA 2XROA 1I50J 1PYVA 4MHGA 1XTAA 3SXYA 2IT0A 1S29A 1V55H 4YIIA 2E1MC 4V19K 4G6TB 3JRAA 3OYJA 3S1NJ 3RPUA 2F5VA 5FKLA 1F0OA 1TC3C 2QBYB 5CQGA 1MIJA 4IVNA 4XICA 2DMPA 2W24A 2ZMEA 1XSVA 4EM2A 3PQKA 1T95A 1A31A 3KZIC 2KFDA 3BC8A 4XN0A 1T0FC 4XONA 2L9VA 3OS2A 4M3BA 5DM7F 1KQ9A 4CA0A 2ODIA 4XLFA 3EUHA 4PK4A 3I4PA 5DV5A 3RYPA 4I6ZA 2H27A 5LRSA 4F52A 3HKZN 3HPGA 2DI3A 2QVOA 2O3FA 4E7HA 3WG7H 1P4WA 3IC7A 4RAFA 2X85A 4E7LA 3MKLA 1QQIA 3HEFA 1ENHA 3FMSA 2Z33A 4XKCA 3MZHA 2CV0A 1RKTA 2A6HF 1OLTA 2WAEA 1BL0A 3P7NA 3FBIB 2Y0SA 2ADUA 3CC7I 1Z3XA 2DCEA 2A6EF 4R1HA 5GPCA 2DODA 3CJRB 3ZPLA 3LA2A 3Q0WA 2GM4A 3EPZA 5HLGA 3NEUA 3KYCB 4MQ9F 5IYBJ 5ILUA 2K9QA 2HEOA 4BJ5C 3DF8A 2DN0A 2BY3A 2KL4A 5E1ZB 1A36A 1LDKB 3EUKL 2X4HA 5HDGA 2M5WA 3LFKA 4KIBA 3JRCA 3KEQA 2QZ8A 3LFUA 4XKWA 3ECOA 1I1GA 1QGPA 4AD9A 2CMPA 3RJPA 5E3NA 4U0YA 3I4NJ 4IQJA 2DDAA 3LSHA 4ZZDA 4NUBA 1QU3A 2JMWA 2XAUA 1S5LC 2WB1A 3KP3A 3W6KB 3X2QH 3KP6A 1EKEA 4HX4A 4IOCF 1FIPA 2R0QC 5FLXK 1D3YA 3FXMA 1S7AA 3M9AA 1YFHA 5AIPA 2GOXB 3C2BA 4IHYA 3ZQIA 1CF7B 2VBWA 4CH7A 1ZGWA 3RQ4A 1H9GA 4FQGA 3K70D 4DIQA 3NARA 4WK8F 2QEXI 2K3PA 4M6VA 1F5TA 4Z2YA 1YJ9I 2UV1A 5GTHC 3A4CA 5HDKA 3AL0B 4QPQA 4XLPF 2G9WA 4Q47A 4XLAA 5JHFA 3E6MA 3WG9A 1AHDP 1Y39A 1BA5A 4LGWA 1OPCA 3S3OA 4LMYA 3ZMVA 4ZTFA 2M87A 4KN7X 5IT9K 3K4CA 3I53A 1S7OA 2L7ZA 2OV7A 3BTLA 2XVCA 3MZ8A 1WCMJ 5E8IA 4BACA 1GUUA 2HOTA 2NNNA 2HPIA 3TO6A 2KRHA 4EJTA 2J5PA 5C3EJ 1EH6A 4KICA 2K9LA 4ZDPA 5EDNA 3V7RA 3CJNA 4HRIA 2X1CA 3HOUJ 2QSFX 2GA2A 1YJNI 2X1EA 3BWGA 4IJAA 5ICCA 1H8AC 1N25A 1FZPB 5GAEJ 2LF8A 1O3TA 1MJ9A 1J7KA 4RM2A 1U3EM 1EV7A 2O03A 2VASA 2E1CA 4KUMA 3OYAA 5KHDA 4IF4A 3ML6A 3JRBA 4LLLA 3I59A 2QGUA 4YRVA 4MIMA 1KU7A 1FBQA 2LR8A 1XGSA 1TWCJ 1NH3A 2LK2A 3CF2A 2MYSA 2R7XA 1YG2A 2P7CB 2B63J 4Z6YA 4BE0A 5JHUA 2P5VA 1MNEA 3M8EA 4YIRX 2WV1A 5BS6A 2E1NA 1P9QC 4G12A 1OCCH 3CJTB 1G3SA 2CWEA 2Z5UA 3TP3A 3OYBA 2DAOA 1K6OA 1SFOJ 3L2QA 1ZARA 2JA7J 1OCTC 2DA5A 2D5VA 2NS7A 2KISA 4LLGF 3L9FA 3CDIA 4I99C 3BJAA 1ZLKA 1U8RA 4L5EA 3TP0A 2W48A 2EZKA 4FASD 4UUVA 2KJBA 1ON2A 3VEPA 3ASOH 3WU1B 3RI4A 4BBSJ 2DOEA 5JVTA 5TGTA 4FCYA 1PVUA 3GTLJ 3O6BB 2M8EA 2Y69H 4LK1F 3GF2A 4ZYHA 1JJ6C 5JVGF 2LVSA 5J4VA 4JQFA 1IG7A 3HHHA 4CCOA 2CSOA 4BUPA 5AIQA 2BVMA 5IPAA 1VQ4I 3MWMA 1I6XA 5E3OA
chains in the Genus database with same CATH topology
5E20A 2BE5F 2V9VA 1O7FA 1ZG5A 5LBQA 3DQVC 1BC7C 3E5UA 2IA1A 2JSCA 3F23A 5HLHA 1SD5A 1OKRA 1XMKA 2YPRA 2EJRA 2FU4A 4MGRA 1IUYA 2RDPA 1FYKA 2DTRA 3HRMA 3R60A 1KYWA 2CG4A 1IXCA 4EVIA 3MAJA 1NHAA 4K2EA 3WTZA 3KZYA 2HYFA 4G6DA 5CYVA 3HIFA 5L3CA 3HOSA 5A2QK 3KP5A 2D2WA 1HBXG 2V1DA 4OIPF 1G3WA 3ZN1A 1K78B 5D4SA 4I0AA 5D5UB 1P4AA 4GGGA 4MNUA 3Q9SA 2PFBA 4B09A 1FBSA 2F5FA 1QZYA 2HQNA 1JHHA 2VOPA 3L00A 3RYRA 4IRHA 3IRQA 5K5RA 4ENKA 1BI0A 1ZLJA 2HZTA 1HXDA 2GWRA 2P6TA 1J9IA 1DDNA 3NRVA 4BQAA 3GEZA 1FNNA 1QO0D 2QLZA 1J0RA 1XCVA 2G7UA 1O3RA 1W7PB 2ZO4A 4MTDA 3HSFA 3QP5A 5JFRA 1F1ZA 1GXPA 2RC4A 2XGXA 2XRNA 3BPXA 4HF2A 1U6GA 1IN4A 1R00A 2XASA 3P9IA 4WWCA 1HSJA 2HWVA 2KKOA 3O2PE 2DO7A 1YW7A 1OYIA 3IHUA 5ILVA 3J81K 4LB6B 1G3TA 2G7HA 3TDZC 4O6JA 4HF1A 2M45A 1ZYRF 1OMIA 2GZWA 5AONA 3D0SA 2FQ3A 2B0LA 3V4GA 3FXRA 1ZG1A 2DFIA 2PLYA 4OIOF 2ZBKA 1H9TA 2DBBA 1H0MA 3PQJA 4PCQA 3TOBA 3C7JA 3R6SA 2XUBA 3F22A 3REOA 3H3ZA 1B9NA 4XSXF 4M9ZA 4EMSA 1KGSA 3B02A 4HOBA 1B4AA 4ESFA 4ENMA 2QBYA 4OMYA 3WTWC 2ZNZA 2HOEA 2CFXA 2W85A 3I5UA 4IHSA 2K02A 3F3XA 1HW5A 3WGHA 2Q8KA 3OV8A 3RKXA 4CZZA 4LG0A 5LHHA 4UNOA 4G9YA 1RIOH 3U1DA 1PP7U 5CVVA 4RB1A 4EM1A 1AOYA 2XAHA 4F7ZA 5LLQA 3I54A 5E1XA 5DUIA 1F4KA 2VBYA 2PMUA 3DP7A 2L54A 1L3LA 3VOEA 3FX3A 3KP7A 4ESJA 2NS0A 4UVBA 1ZRCA 4XLNF 1B9MA 1O3SA 5BPIA 1Q1HA 1UFMA 2FBKA 1T38A 3GW2A 4RGUA 4ON0A 2QM3A 4CYDA 4AWXB 2FOKA 5H20A 2DPDA 2EA2A 2AXLA 1QZZA 1BJAA 4PDKA 4LFUA 3K69A 3BOQA 1CF7A 1Z6TA 4JBAA 2JZYA 3WTSC 1IN7A 2E7XA 3D5LA 1HKQA 3RTRA 1FYLA 4RB0A 2XKOA 1CGPA 2KIFA 5J8CA 5FFXA 4HQMA 3MFKA 3L7WA 1L0OC 4M9XA 3KZZA 1IZ1A 4P9UA 2VE9A 2OU2A 3RKWA 1LB2A 3N97A 1WWXA 5L3DA 1EH8A 2P4WA 1UCRA 1XD7A 2ZXJA 4EV0A 2LSOA 1J5YA 1E2XA 3GZ5A 4YFNF 1BI1A 3RPQA 4KFCA 5HLIA 4M9SA 1TLHB 2OQGA 2K27A 1TBXA 2V1UA 4M6XA 3CTAA 4KN4X 3ECHA 1XGMA 3BP8A 3QRFF 1YS6A 4IXAA 4RAZA 5E18F 1Y0UA 3E5QA 1LNWA 3V8JA 3FM3A 2VODA 3MCZA 1T98A 3U9GA 4XBFA 2Q10A 3I0TA 1Z05A 5IT9Z 2J5OA 3VB2A 3R61A 2WC2A 4P5OA 1HKTA 1U5TB 4EGYA 1BM9A 2ESNA 5DCMB 2ZKZA 4D0PA 2OZ6A 1GHCA 3FMQA 5TRDA 1MGTA 2Z3YA 1IXSB 3K2ZA 4PZJA 5CVUA 3DFGA 1R5GA 4I09A 4Y13A 4EGZA 1JGSA 4FX4A 1LDDA 3QPTA 4KT5C 2TDXA 3FF5A 1XGOA 2UXNA 1O57A 3M8FA 2HS5A 2L4MA 2ZCWA 4G8XA 4MEYF 4Q4ZF 3K1MA 3QP6A 1ZRDA 6PAXA 4QWQA 3LA7A 2ISZA 1VTNC 2W84A 2VBZA 5D6FA 2CW0F 1W7PD 4EJUA 3JAMK 1FYMA 4BH9A 2MC3A 1YW8A 3HHGA 3GWZA 3E6CC 1DUXC 1ZHFA 3GUDA 1ZAOA 2MLKA 1MDMB 3EYIA 1I27A 3VFZA 3SQNA 2KIMA 4I02A 4A2UA 1TQPA 2QQBA 1JHFA 3P9KA 2DK8A 2PG4A 4G7ZF 3HOTA 4AIHA 3Q5FA 1KU9A 1R1TA 4HA8A 3E5XA 3F21A 1X3UA 4O3MA 2HFHA 2QYOA 4ZYGA 3NQOA 4OINF 2GA1A 1FY7A 3CDHA 1ZGAA 1TW3A 2IPQX 3TKYA 4I0BA 1BN5A 1JE8A 2EV0A 1XGNA 1GXQA 4QLCU 3KETA 1UB9A 4I98B 2OZUA 2L4AA 4CGZA 2FE3A 1MZBA 1B1BA 2D45A 5A2QZ 1Z91A 4L9VA 1BC8C 2XHKA 5DEQA 2XAQA 2JPCA 2JRTA 3I58A 2F5CA 1R58A 4LLNA 5CVJA 3K9TA 4YG2F 4RAYA 2ODHA 3ZMSA 1ZRFA 3TO9A 3HUGA 4YFXF 1STZA 2DPUA 3T0YA 1UHMA 5E1WA 4P9FA 1IXRC 3S2WA 2AS5F 4A0YA 1KYZA 1DP7P 2A68F 1HW1A 2HTJA 2CO5A 3HRSA 3F6OA 2EWNA 4HV6A 4ZZLA 3HSRA 1XSDA 1XN7A 4A5MA 1OYYA 1HQCA 1PP8F 2HTSA 1SMTA 2F5DA 3EYYA 3L09A 2EB7A 4Y15A 2FF4A 5IT3A 1I1SA 2IRFG 4A0XA 1Z1DA 4UVAA 4MTEA 2KJCA 3DV8A 3G3ZA 1T2KA 1ZN2A 5K5QA 1BI3A 2XIGA 2IVMA 1ODDA 5EEHA 1C0WA 4OIRF 3HRTA 3J7AO 1J75A 3W6JB 4U7DA 5D8KB 3COAC 2ZMEB 5DD8A 2H09A 4TV7A 1QPMA 4RGSA 1Z9CA 3GFMA 4HBLA 1XSXA 2QQ9A 5HS8A 2L02A 3IWFA 5ILSA 4FX0A 4L5JA 2LKPA 3LSTA 1FX7A 5L3GA 2RVCA 4ZYEA 4U7BA 3M7GA 2A61A 4HX7A 4UHTA 4H0EA 3ISPA 4HDVA 1ZGJA 2A69F 2YX7A 2YX4A 4M71A 4ENNA 2LNBA 3TO7A 1HKSA 4HV5A 2P5LC 4M74A 4BAYA 2C6YA 5CVRA 1ON1A 3TQNA 1D5VA 4WXHA 4G7OF 1TW2A 5F64A 3GFIA 3CUQA 2EFNA 5ED4A 4A6EA 4I2OA 2H6BA 2HQRA 2IA2A 5DD4A 4KIFA 1BOAA 1LDJA 4GYGA 2VN2A 3RIRA 3EDPA 2P8TA 1YW9A 4U88A 5DCMA 1G4DA 3GLXA 3QAHA 5D5VB 4GO1A 2A07F 4CO8A 1RZ4A 4G94A 3TDUC 2COMA 1V3FA 3U2RA 5ICFA 1TNSA 1LEAA 3KP2A 3JSOA 1OYWA 1WI9A 3I59B 4HAMA 3SHFA 3BJOA 3LA3A 2WV0A 3RDIA 4AIJA 2UWMA 1B59A 1R22A 3WTVC 2DK5A 3OOPA 4M6YA 2NNYA 2O61A 4L9JA 3BDDA 2HDCA 5D5XB 5LGUA 2ZFWA 4P55A 2P6SA 5LRRA 1B6AA 1MJBA 1BIBA 3CO7C 3FXQA 3CUQC 1YYVA 1QNTA 4EM0B 1USSA 1K79A 2FBHA 2UZKA 4Y17A 1HSTA 4WX9A 1K7AA 1MDMA 2PN6A 3C1DA 3QPHA 3QU6A 3EETA 4Q5SF 4KMUX 2GAUA 4G7HF 1W5TA 4A6DA 2O0YA 4L0YB 2FMLA 4M72A 4N0BA 1LEBA 3MZYA 1W5SA 2XV4S 2W57A 2Y75A 4HDUA 5LEKA 1I5ZA 2D1VA 1TQMA 5FD6A 1ZG3A 4LD5A 5D5WB 4L9NA 3V8LA 5FFZA 1WQ2A 2Y0MA 4WCGA 4FT8A 1FLIA 1SFUA 3K0LA 3L2CA 2HGCA 1LVAA 4O5VA 1KQ0A 5BQTA 2EFPA 2GIVA 2PJPA 3F8CA 3J80K 4GXOA 3KP4A 1SFEA 1EH7A 5D4RA 1RUNA 2CQKA 2FEZA 5HDNA 3K1NA 2EV6A 3T8RA 3N4MA 2RKHA 5FLXZ 5HVQC 4BHBA 1T0FA 2EFQA 3FMRA 1REPC 2PI0A 3CUOA 4YIFA 2JPBA 2LF7A 3GVAA 2DLLA 4WXCA 3WE2A 2FNAA 3WTXC 4HQEA 5ICGA 3I71A 4L9TA 3IKTA 1SMYF 2BYVE 1KA8A 3BY6A 2JTVA 4ESBA 2FMYA 1LQ1A 2P5KA 2BBYA 2XAJA 2GXGA 1W4MA 2A3SA 2YR2A 1RUOA 4KA4A 1YQAA 3IWZA 2QUFA 4CHUA 4EJOA 1IN8A 2V1XA 2VT2A 5LGNA 4EQQA 1XCBA 1OR7A 3BROA 3GO5A 3RKYA 3KEOA 2CGPA 1P92A 2NRAC 2P7VB 3K1PA 3SFZA 2WWYA 5LEJA 3R0AA 4GYIA 1JXSA 1LJ9A 1D8KA 2HR3A 2Q2EA 2R7FA 3FXUA 3KLOA 2O6GE 1WRJA 4LG0B 2Q0OA 2GQQA 4IPAA 1YS7A 2ELHA 4ZH4F 3IL2A 4B8XA 3F8MA 3BJ6A 4KYWA 3JSPA 1K78A 1J2XA 5DCFA 2PEXA 2V6CA 3CO6C 2VE8A 3JTGA 4KIGA 3FWEA 4BXUA 4HZFA 2IA0A 2IP2A 1R7JA 3FHZA 2NYXA 2PBIA 3ULQB 3IKVA 4HW0A 4CXFA 5E8GA 1KU3A 4L18B 3WGIA 3R4KA 5H6RA 1FSHA 4M73A 1FWZA 3IMBA 2PQ8A 3TOAA 1A04A 1W7PA 1YIOA 2H94A 5FD5A 2O8XA 4LJZF 2K4BA 2QQAA 1YTYA 2MBFA 2RV8A 2YSRA 2L3DA 2ETHA 4RB3C 2RQPA 4ZYDA 2JT1A 1DPUA 3V7SA 4DNCA 2L01A 5HS9A 2NAZA 3LAPA 1FP1D 2RN7A 1U2WA 2ESHA 5FGMA 3ZP5A 3T1BA 5LGTA 3F8FA 3WODF 2BV6A 3B73A 4RS8A 1S8NA 2Y48A 2ZNYA 3ZMUA 1T39A 4ETSA 4G6QA 3BPVA 2M1BA 4OIQF 4RB2C 1KQ8A 3FM5A 4NQWA 4ASNA 1HW2A 5BPDA 4OU0A 3TGNA 2V79A 3JW4A 3R0JA 3J81Z 2IJLA 3E6DA 1FOKA 3H3UA 4LB5A 1E17A 5F6FA 5JR3A 4LK0F 5L3FA 2EK5A 1R23A 5FB2A 2XAGA 2Z99A 4P96A 1O7LA 1IF1A 2MH9A 4RGXA 1P2FA 2A5YB 5DUKA 4N9IA 2KRFA 4RGRA 2GXBA 2HKXA 3MEXA 3G73A 5HOOA 1WKMA 1AWCA 4UV8A 4U0VA 1SD4A 4XRFA 1XDUA 3LQRA 3KFWX 3C3WA 4R79A 3DXJF 3HRUA 4HX8A 2WTEA 2X0LA 1TQIA 4BYYA 1USTA 1FP2A 1S3JA 1J59A 4KMFA 2IW5A 4UV9A 1XB4A 2HKOA 3MQ0A 3ABUA 1RI7A 3E97A 5H6QA 2FSWA 3ZMZA 1SD6A 3GX4X 5J6XA 3ZMDA 3WGGA 3F8BA 2ZJ2A 1O3QA 1FC3A 3GFLA 2BGCA 1ZREA 2XAFA 3FZVA 1Z6RA 2F5EA 2K7LA 4I7HA 4PGHA 2QENA 4UVCA 5E17F 5JI6A 5CVIA 1IRGA 4IHTA 2UXXA 2YU3A 4YFKF 3WE3A 5TJJA 3WU0A 2VOOA 4Q48A 4BNCA 2R7DA 3VODA 4I01A 1FBUA 4NHJA 4HYEA 3M1EA 5F1RA 3WTTC 2H6CA 1R1VA 1U5TA 3J80Z 3HTUA 4AIKA 1MJAA 1YO5C 2OAZA 2MD5A 2MLGA 2DQRA 3T5XA 5DDGA 2DW4A 2FBIA 1QBJA 4MEXF 3P9CA 2VONA 2VXZA 4EJVA 1XDSA 1Z7UA 2W25A 5DYMA 3ABTA 3V7CA 4EJWA 2BEOA 2PMHA 1R36A 1FT9A 3O3KA 5ERIA 3HTSB 1IAWA 5D8LB 3DPLC 3ZQ7A 2ACJA 1U78A 1UHWA 5FO5A 1SFXA 3F8NA 3KE2A 1G3YA 4A5NA 4IRGA 2OBPA 3PFIA 4PGGA 3WTYC 1TNTA 3C18A 2K4JA 3HYIA 5HS7A 3LWFA 4L5IA 2F2EA 3V8KA 5L3BA 2VC0A 3QOPA 2R3SA 3IRRA 1P4XA 4XSZF 2FA5A 3BZ6A 4WXDA 5KK1A 4HF0A 3DPTA 3H92A 4CICA 2EA4A 3ERED 4OMZA 2K86A 4HLXA 1BBYA 3ELKA 2RNJA 2Z9OA 1F9NA 3F72A 3SZTA 5L3EA 3LAJA 4BHPA 1U5TC 4FHTA 5LHIA 3LQQA 4A0ZA 2DT5A 4E70A 4KNYA 1R5HA 5CJ9A 1FPQA 4GCVA 1IW7F 3T8TA 2ISYA 3DKWA 1PDNC 4KDPA 3GZ6A 3HSEA 3JAMZ 1YLFA 3AAFA 1DPRA 3SZPA 1S6LA 1GVJA 5BOXA 2M30A 3ZN0A 2KIUA 2OD5A 4N9HA 5EEGA 4L0ZB 2EFWA 1TTYA 2VC1A 3KCCA 2DQLA 2VBXA 1KU2A 1RNLA 4S05A 1XMAA 4CDGA 5BMZA 3ROUA 1P6RA 3E6BA 2DU9A 1V4RA 5LHGA 2STWA 5K5OA 4R8HA 2EFOA 3Q9VA 2RGVA 1ULYA 2FRHA 1BI2A 2OA4A 1MKMA 3CLOA 1IN6A 4NB5A 3DEUA 2E7WA 1SAXA 2EV5A 1IN5A 1R1UA 4S04A 4UXNA 2FXAA 5CLSA 2OA9A 5D6EA 4AVPA 4WF2A 1PUEE 1D8JA 5K1YA 1SD7A 3QU3A 2FNPA 4JK1X 3CUQB 2LDUA 1MD0A 3GXOA 1G6NA 1ONVA 2HYGD 2MA3A 3F6VA 3GFJA 4OOIA 2STTA 3JTHA 5J8FA 1BIAA 3E3VA 1ZH5A 4HLYA 3ZMTA 3GYHX 3I64A 3WTUC 4DQ2A 2CYYA 5KVRA 1FSEA 2QWWA 2VT3A 2OQRA 2XKPA 2MH2A 2OAAA 4A12A 3KLNA 1WSUA 5ICEA 1IRFA 4BHCA 3EQLF 2D1HA 1T6SA 4MQVA 4ENJA 4U0WA 4IRIA 2XROA 4MHGA 3SXYA 2IT0A 1S29A 4YIIA 3RPUA 2QBYB 4IVNA 2W24A 2ZMEA 4EM2A 1XSVA 3PQKA 1KQ9A 2ODIA 3EUHA 3I4PA 5DV5A 3RYPA 2H27A 5LRSA 2DI3A 2QVOA 2O3FA 1P4WA 3IC7A 1QQIA 3FMSA 2Z33A 3MZHA 2A6HF 3P7NA 2ADUA 2A6EF 4R1HA 3ZPLA 3LA2A 5HLGA 3NEUA 4MQ9F 5ILUA 2HEOA 3DF8A 5E1ZB 1LDKB 2X4HA 5HDGA 2M5WA 3LFKA 4KIBA 3KEQA 2QZ8A 3ECOA 1I1GA 1QGPA 4AD9A 3RJPA 4U0YA 4ZZDA 3KP3A 3W6KB 3KP6A 4HX4A 5FLXK 1D3YA 1S7AA 3M9AA 1YFHA 5AIPA 1CF7B 2VBWA 1H9GA 4WK8F 1F5TA 4Z2YA 5HDKA 4XLPF 2G9WA 4Q47A 3E6MA 3WG9A 4LGWA 1OPCA 4LMYA 3ZMVA 2M87A 4KN7X 5IT9K 3I53A 1S7OA 2XVCA 5E8IA 2NNNA 3TO6A 4EJTA 2J5PA 1EH6A 4KICA 3V7RA 3CJNA 2GA2A 3BWGA 4IJAA 5ICCA 1FZPB 1O3TA 2LF8A 1MJ9A 1J7KA 1U3EM 1EV7A 2O03A 2E1CA 4KUMA 4IF4A 3ML6A 4LLLA 3I59A 1KU7A 1FBQA 1XGSA 1YG2A 2P7CB 5JHUA 2P5VA 3M8EA 5BS6A 2E1NA 1G3SA 2CWEA 2Z5UA 2DAOA 1K6OA 1ZARA 4LLGF 3L9FA 3BJAA 1ZLKA 1U8RA 4UUVA 2KJBA 1ON2A 3VEPA 3WU1B 3RI4A 5JVTA 3O6BB 2M8EA 4LK1F 3GF2A 4ZYHA 4JQFA 3HHHA 2CSOA 5AIQA 3MWMA 1I6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E20 A;  2BE5 F;  2V9V A;  1O7F A;  1ZG5 A;  5LBQ A;  3DQV C;  1BC7 C;  3E5U A;  2IA1 A;  2JSC A;  3F23 A;  5HLH A;  1SD5 A;  1OKR A;  1XMK A;  2YPR A;  2EJR A;  2FU4 A;  4MGR A;  1IUY A;  2RDP A;  1FYK A;  2DTR A;  3HRM A;  3R60 A;  1KYW A;  2CG4 A;  1IXC A;  4EVI A;  3MAJ A;  1NHA A;  4K2E A;  3WTZ A;  3KZY A;  2HYF A;  4G6D A;  5CYV A;  3HIF A;  5L3C A;  3HOS A;  5A2Q K;  3KP5 A;  2D2W A;  1HBX G;  2V1D A;  4OIP F;  1G3W A;  3ZN1 A;  1K78 B;  5D4S A;  4I0A A;  5D5U B;  1P4A A;  4GGG A;  4MNU A;  3Q9S A;  2PFB A;  4B09 A;  1FBS A;  2F5F A;  1QZY A;  2HQN A;  1JHH A;  2VOP A;  3L00 A;  3RYR A;  4IRH A;  3IRQ A;  5K5R A;  4ENK A;  1BI0 A;  1ZLJ A;  2HZT A;  1HXD A;  2GWR A;  2P6T A;  1J9I A;  1DDN A;  3NRV A;  4BQA A;  3GEZ A;  1FNN A;  1QO0 D;  2QLZ A;  1J0R A;  1XCV A;  2G7U A;  1O3R A;  1W7P B;  2ZO4 A;  4MTD A;  3HSF A;  3QP5 A;  5JFR A;  1F1Z A;  1GXP A;  2RC4 A;  2XGX A;  2XRN A;  3BPX A;  4HF2 A;  1U6G A;  1IN4 A;  1R00 A;  2XAS A;  3P9I A;  4WWC A;  1HSJ A;  2HWV A;  2KKO A;  3O2P E;  2DO7 A;  1YW7 A;  1OYI A;  3IHU A;  5ILV A;  3J81 K;  4LB6 B;  1G3T A;  2G7H A;  3TDZ C;  4O6J A;  4HF1 A;  2M45 A;  1ZYR F;  1OMI A;  2GZW A;  5AON A;  3D0S A;  2FQ3 A;  2B0L A;  3V4G A;  3FXR A;  1ZG1 A;  2DFI A;  2PLY A;  4OIO F;  2ZBK A;  1H9T A;  2DBB A;  1H0M A;  3PQJ A;  4PCQ A;  3TOB A;  3C7J A;  3R6S A;  2XUB A;  3F22 A;  3REO A;  3H3Z A;  1B9N A;  4XSX F;  4M9Z A;  4EMS A;  1KGS A;  3B02 A;  4HOB A;  1B4A A;  4ESF A;  4ENM A;  2QBY A;  4OMY A;  3WTW C;  2ZNZ A;  2HOE A;  2CFX A;  2W85 A;  3I5U A;  4IHS A;  2K02 A;  3F3X A;  1HW5 A;  3WGH A;  2Q8K A;  3OV8 A;  3RKX A;  4CZZ A;  4LG0 A;  5LHH A;  4UNO A;  4G9Y A;  1RIO H;  3U1D A;  1PP7 U;  5CVV A;  4RB1 A;  4EM1 A;  1AOY A;  2XAH A;  4F7Z A;  5LLQ A;  3I54 A;  5E1X A;  5DUI A;  1F4K A;  2VBY A;  2PMU A;  3DP7 A;  2L54 A;  1L3L A;  3VOE A;  3FX3 A;  3KP7 A;  4ESJ A;  2NS0 A;  4UVB A;  1ZRC A;  4XLN F;  1B9M A;  1O3S A;  5BPI A;  1Q1H A;  1UFM A;  2FBK A;  1T38 A;  3GW2 A;  4RGU A;  4ON0 A;  2QM3 A;  4CYD A;  4AWX B;  2FOK A;  5H20 A;  2DPD A;  2EA2 A;  2AXL A;  1QZZ A;  1BJA A;  4PDK A;  4LFU A;  3K69 A;  3BOQ A;  1CF7 A;  1Z6T A;  4JBA A;  2JZY A;  3WTS C;  1IN7 A;  2E7X A;  3D5L A;  1HKQ A;  3RTR A;  1FYL A;  4RB0 A;  2XKO A;  1CGP A;  2KIF A;  5J8C A;  5FFX A;  4HQM A;  3MFK A;  3L7W A;  1L0O C;  4M9X A;  3KZZ A;  1IZ1 A;  4P9U A;  2VE9 A;  2OU2 A;  3RKW A;  1LB2 A;  3N97 A;  1WWX A;  5L3D A;  1EH8 A;  2P4W A;  1UCR A;  1XD7 A;  2ZXJ A;  4EV0 A;  2LSO A;  1J5Y A;  1E2X A;  3GZ5 A;  4YFN F;  1BI1 A;  3RPQ A;  4KFC A;  5HLI A;  4M9S A;  1TLH B;  2OQG A;  2K27 A;  1TBX A;  2V1U A;  4M6X A;  3CTA A;  4KN4 X;  3ECH A;  1XGM A;  3BP8 A;  3QRF F;  1YS6 A;  4IXA A;  4RAZ A;  5E18 F;  1Y0U A;  3E5Q A;  1LNW A;  3V8J A;  3FM3 A;  2VOD A;  3MCZ A;  1T98 A;  3U9G A;  4XBF A;  3I0T A;  1Z05 A;  5IT9 Z;  2J5O A;  3VB2 A;  3R61 A;  2WC2 A;  4P5O A;  1HKT A;  1U5T B;  4EGY A;  1BM9 A;  2ESN A;  5DCM B;  2ZKZ A;  4D0P A;  2OZ6 A;  1GHC A;  3FMQ A;  5TRD A;  1MGT A;  2Z3Y A;  1IXS B;  3K2Z A;  4PZJ A;  5CVU A;  3DFG A;  1R5G A;  4I09 A;  4Y13 A;  4EGZ A;  1JGS A;  4FX4 A;  1LDD A;  3QPT A;  4KT5 C;  2TDX A;  3FF5 A;  1XGO A;  2UXN A;  1O57 A;  3M8F A;  2HS5 A;  2L4M A;  2ZCW A;  4G8X A;  4MEY F;  4Q4Z F;  3K1M A;  3QP6 A;  1ZRD A;  6PAX A;  4QWQ A;  3LA7 A;  2ISZ A;  1VTN C;  2W84 A;  2VBZ A;  5D6F A;  2CW0 F;  1W7P D;  4EJU A;  3JAM K;  1FYM A;  4BH9 A;  2MC3 A;  1YW8 A;  3HHG A;  3GWZ A;  3E6C C;  1DUX C;  1ZHF A;  3GUD A;  1ZAO A;  2MLK A;  1MDM B;  3EYI A;  1I27 A;  3VFZ A;  3SQN A;  2KIM A;  4I02 A;  4A2U A;  1TQP A;  2QQB A;  1JHF A;  3P9K A;  2DK8 A;  2PG4 A;  4G7Z F;  3HOT A;  4AIH A;  3Q5F A;  1KU9 A;  1R1T A;  4HA8 A;  3E5X A;  3F21 A;  1X3U A;  4O3M A;  2HFH A;  2QYO A;  4ZYG A;  3NQO A;  4OIN F;  2GA1 A;  1FY7 A;  3CDH A;  1ZGA A;  1TW3 A;  2IPQ X;  3TKY A;  4I0B A;  1BN5 A;  1JE8 A;  2EV0 A;  1XGN A;  1GXQ A;  4QLC U;  3KET A;  1UB9 A;  4I98 B;  2OZU A;  2L4A A;  4CGZ A;  2FE3 A;  1MZB A;  1B1B A;  2D45 A;  5A2Q Z;  1Z91 A;  4L9V A;  1BC8 C;  2XHK A;  5DEQ A;  2XAQ A;  2JPC A;  2JRT A;  3I58 A;  2F5C A;  1R58 A;  4LLN A;  5CVJ A;  3K9T A;  4YG2 F;  4RAY A;  3ZMS A;  1ZRF A;  3TO9 A;  3HUG A;  4YFX F;  1STZ A;  2DPU A;  3T0Y A;  1UHM A;  5E1W A;  4P9F A;  1IXR C;  3S2W A;  2AS5 F;  4A0Y A;  1KYZ A;  1DP7 P;  2A68 F;  1HW1 A;  2HTJ A;  2CO5 A;  3HRS A;  3F6O A;  2EWN A;  4HV6 A;  4ZZL A;  3HSR A;  1XSD A;  1XN7 A;  4A5M A;  1OYY A;  1HQC A;  1PP8 F;  2HTS A;  1SMT A;  2F5D A;  3EYY A;  3L09 A;  2EB7 A;  4Y15 A;  2FF4 A;  5IT3 A;  1I1S A;  2IRF G;  4A0X A;  1Z1D A;  4UVA A;  4MTE A;  2KJC A;  3DV8 A;  3G3Z A;  1T2K A;  1ZN2 A;  5K5Q A;  1BI3 A;  2XIG A;  2IVM A;  1ODD A;  5EEH A;  1C0W A;  4OIR F;  3HRT A;  3J7A O;  1J75 A;  3W6J B;  4U7D A;  5D8K B;  3COA C;  2ZME B;  5DD8 A;  2H09 A;  4TV7 A;  1QPM A;  4RGS A;  1Z9C A;  3GFM A;  4HBL A;  1XSX A;  2QQ9 A;  5HS8 A;  2L02 A;  3IWF A;  5ILS A;  4FX0 A;  4L5J A;  2LKP A;  3LST A;  1FX7 A;  5L3G A;  2RVC A;  4ZYE A;  4U7B A;  3M7G A;  2A61 A;  4HX7 A;  4UHT A;  4H0E A;  3ISP A;  4HDV A;  1ZGJ A;  2A69 F;  2YX7 A;  2YX4 A;  4M71 A;  4ENN A;  2LNB A;  3TO7 A;  1HKS A;  4HV5 A;  2P5L C;  4M74 A;  4BAY A;  2C6Y A;  5CVR A;  1ON1 A;  3TQN A;  1D5V A;  4WXH A;  4G7O F;  1TW2 A;  5F64 A;  3GFI A;  3CUQ A;  2EFN A;  5ED4 A;  4A6E A;  4I2O A;  2H6B A;  2HQR A;  2IA2 A;  5DD4 A;  4KIF A;  1BOA A;  1LDJ A;  4GYG A;  2VN2 A;  3RIR A;  3EDP A;  2P8T A;  1YW9 A;  4U88 A;  5DCM A;  1G4D A;  3GLX A;  3QAH A;  5D5V B;  4GO1 A;  2A07 F;  4CO8 A;  1RZ4 A;  4G94 A;  3TDU C;  2COM A;  1V3F A;  3U2R A;  5ICF A;  1TNS A;  1LEA A;  3KP2 A;  3JSO A;  1OYW A;  1WI9 A;  3I59 B;  4HAM A;  3SHF A;  3BJO A;  3LA3 A;  2WV0 A;  3RDI A;  4AIJ A;  2UWM A;  1B59 A;  1R22 A;  3WTV C;  2DK5 A;  3OOP A;  4M6Y A;  2NNY A;  2O61 A;  4L9J A;  3BDD A;  2HDC A;  5D5X B;  5LGU A;  2ZFW A;  4P55 A;  2P6S A;  5LRR A;  1B6A A;  1MJB A;  1BIB A;  3CO7 C;  3FXQ A;  3CUQ C;  1YYV A;  1QNT A;  4EM0 B;  1USS A;  1K79 A;  2FBH A;  2UZK A;  4Y17 A;  1HST A;  4WX9 A;  1K7A A;  1MDM A;  2PN6 A;  3C1D A;  3QPH A;  3QU6 A;  3EET A;  4Q5S F;  4KMU X;  2GAU A;  4G7H F;  1W5T A;  4A6D A;  2O0Y A;  4L0Y B;  2FML A;  4M72 A;  4N0B A;  1LEB A;  3MZY A;  1W5S A;  2XV4 S;  2W57 A;  2Y75 A;  4HDU A;  5LEK A;  1I5Z A;  2D1V A;  1TQM A;  5FD6 A;  1ZG3 A;  4LD5 A;  5D5W B;  4L9N A;  3V8L A;  5FFZ A;  1WQ2 A;  2Y0M A;  4WCG A;  4FT8 A;  1FLI A;  1SFU A;  3K0L A;  3L2C A;  2HGC A;  1LVA A;  4O5V A;  1KQ0 A;  5BQT A;  2EFP A;  2GIV A;  2PJP A;  3F8C A;  3J80 K;  4GXO A;  3KP4 A;  1SFE A;  1EH7 A;  5D4R A;  1RUN A;  2CQK A;  2FEZ A;  5HDN A;  3K1N A;  2EV6 A;  3T8R A;  3N4M A;  2RKH A;  5FLX Z;  5HVQ C;  4BHB A;  1T0F A;  2EFQ A;  3FMR A;  1REP C;  2PI0 A;  3CUO A;  4YIF A;  2JPB A;  2LF7 A;  3GVA A;  2DLL A;  4WXC A;  3WE2 A;  2FNA A;  3WTX C;  4HQE A;  5ICG A;  3I71 A;  4L9T A;  3IKT A;  1SMY F;  2BYV E;  1KA8 A;  3BY6 A;  2JTV A;  4ESB A;  2FMY A;  1LQ1 A;  2P5K A;  2BBY A;  2XAJ A;  2GXG A;  1W4M A;  2A3S A;  2YR2 A;  1RUO A;  4KA4 A;  1YQA A;  3IWZ A;  2QUF A;  4CHU A;  4EJO A;  1IN8 A;  2V1X A;  2VT2 A;  5LGN A;  4EQQ A;  1XCB A;  1OR7 A;  3BRO A;  3GO5 A;  3RKY A;  3KEO A;  2CGP A;  1P92 A;  2NRA C;  2P7V B;  3K1P A;  3SFZ A;  2WWY A;  5LEJ A;  3R0A A;  4GYI A;  1JXS A;  1LJ9 A;  1D8K A;  2HR3 A;  2Q2E A;  2R7F A;  3FXU A;  3KLO A;  2O6G E;  1WRJ A;  4LG0 B;  2Q0O A;  2GQQ A;  4IPA A;  1YS7 A;  2ELH A;  4ZH4 F;  3IL2 A;  4B8X A;  3F8M A;  3BJ6 A;  4KYW A;  3JSP A;  1K78 A;  1J2X A;  5DCF A;  2PEX A;  2V6C A;  3CO6 C;  2VE8 A;  3JTG A;  4KIG A;  3FWE A;  4BXU A;  4HZF A;  2IA0 A;  2IP2 A;  1R7J A;  3FHZ A;  2NYX A;  2PBI A;  3ULQ B;  3IKV A;  4HW0 A;  4CXF A;  5E8G A;  1KU3 A;  4L18 B;  3WGI A;  3R4K A;  5H6R A;  1FSH A;  4M73 A;  1FWZ A;  2PQ8 A;  3TOA A;  1A04 A;  1W7P A;  1YIO A;  2H94 A;  5FD5 A;  2O8X A;  4LJZ F;  2K4B A;  2QQA A;  1YTY A;  2MBF A;  2RV8 A;  2YSR A;  2L3D A;  2ETH A;  4RB3 C;  2RQP A;  4ZYD A;  2JT1 A;  1DPU A;  3V7S A;  4DNC A;  2L01 A;  5HS9 A;  2NAZ A;  3LAP A;  1FP1 D;  2RN7 A;  1U2W A;  2ESH A;  5FGM A;  3ZP5 A;  3T1B A;  5LGT A;  3F8F A;  3WOD F;  2BV6 A;  3B73 A;  4RS8 A;  1S8N A;  2Y48 A;  2ZNY A;  3ZMU A;  1T39 A;  4ETS A;  4G6Q A;  3BPV A;  2M1B A;  4OIQ F;  4RB2 C;  1KQ8 A;  3FM5 A;  4NQW A;  4ASN A;  1HW2 A;  5BPD A;  4OU0 A;  3TGN A;  2V79 A;  3JW4 A;  3R0J A;  3J81 Z;  2IJL A;  3E6D A;  1FOK A;  3H3U A;  4LB5 A;  1E17 A;  5F6F A;  5JR3 A;  4LK0 F;  5L3F A;  2EK5 A;  1R23 A;  5FB2 A;  2XAG A;  2Z99 A;  4P96 A;  1O7L A;  1IF1 A;  2MH9 A;  4RGX A;  1P2F A;  2A5Y B;  5DUK A;  4N9I A;  2KRF A;  4RGR A;  2GXB A;  2HKX A;  3MEX A;  3G73 A;  5HOO A;  1WKM A;  1AWC A;  4UV8 A;  4U0V A;  1SD4 A;  4XRF A;  1XDU A;  3LQR A;  3KFW X;  3C3W A;  4R79 A;  3DXJ F;  3HRU A;  4HX8 A;  2WTE A;  2X0L A;  1TQI A;  4BYY A;  1UST A;  1FP2 A;  1S3J A;  1J59 A;  4KMF A;  2IW5 A;  4UV9 A;  1XB4 A;  2HKO A;  3MQ0 A;  3ABU A;  1RI7 A;  3E97 A;  5H6Q A;  2FSW A;  3ZMZ A;  1SD6 A;  3GX4 X;  5J6X A;  3ZMD A;  3WGG A;  3F8B A;  2ZJ2 A;  1O3Q A;  1FC3 A;  3GFL A;  2BGC A;  1ZRE A;  2XAF A;  3FZV A;  1Z6R A;  2F5E A;  2K7L A;  4I7H A;  4PGH A;  2QEN A;  4UVC A;  5E17 F;  5JI6 A;  5CVI A;  1IRG A;  4IHT A;  2UXX A;  2YU3 A;  4YFK F;  3WE3 A;  5TJJ A;  3WU0 A;  2VOO A;  4Q48 A;  4BNC A;  2R7D A;  3VOD A;  4I01 A;  1FBU A;  4NHJ A;  4HYE A;  3M1E A;  5F1R A;  3WTT C;  2H6C A;  1R1V A;  1U5T A;  3J80 Z;  3HTU A;  4AIK A;  1MJA A;  1YO5 C;  2OAZ A;  2MD5 A;  2MLG A;  2DQR A;  3T5X A;  5DDG A;  2DW4 A;  2FBI A;  1QBJ A;  4MEX F;  3P9C A;  2VON A;  2VXZ A;  4EJV A;  1XDS A;  1Z7U A;  2W25 A;  5DYM A;  3ABT A;  3V7C A;  4EJW A;  2BEO A;  2PMH A;  1R36 A;  1FT9 A;  3O3K A;  5ERI A;  3HTS B;  1IAW A;  5D8L B;  3DPL C;  3ZQ7 A;  2ACJ A;  1U78 A;  1UHW A;  5FO5 A;  1SFX A;  3F8N A;  3KE2 A;  1G3Y A;  4A5N A;  4IRG A;  2OBP A;  3PFI A;  4PGG A;  3WTY C;  1TNT A;  3C18 A;  2K4J A;  3HYI A;  5HS7 A;  3LWF A;  4L5I A;  2F2E A;  3V8K A;  5L3B A;  2VC0 A;  3QOP A;  2R3S A;  3IRR A;  1P4X A;  4XSZ F;  2FA5 A;  3BZ6 A;  4WXD A;  5KK1 A;  4HF0 A;  3DPT A;  3H92 A;  4CIC A;  2EA4 A;  3ERE D;  4OMZ A;  2K86 A;  4HLX A;  1BBY A;  3ELK A;  2RNJ A;  2Z9O A;  1F9N A;  3F72 A;  3SZT A;  5L3E A;  3LAJ A;  4BHP A;  1U5T C;  4FHT A;  5LHI A;  3LQQ A;  4A0Z A;  2DT5 A;  4E70 A;  4KNY A;  1R5H A;  5CJ9 A;  1FPQ A;  4GCV A;  1IW7 F;  3T8T A;  2ISY A;  3DKW A;  1PDN C;  4KDP A;  3GZ6 A;  3HSE A;  3JAM Z;  1YLF A;  3AAF A;  1DPR A;  3SZP A;  1S6L A;  1GVJ A;  5BOX A;  2M30 A;  3ZN0 A;  2KIU A;  2OD5 A;  4N9H A;  5EEG A;  4L0Z B;  2EFW A;  1TTY A;  2VC1 A;  3KCC A;  2DQL A;  2VBX A;  1KU2 A;  1RNL A;  4S05 A;  1XMA A;  4CDG A;  5BMZ A;  3ROU A;  1P6R A;  3E6B A;  2DU9 A;  1V4R A;  5LHG A;  2STW A;  5K5O A;  4R8H A;  2EFO A;  3Q9V A;  2RGV A;  1ULY A;  2FRH A;  1BI2 A;  2OA4 A;  1MKM A;  3CLO A;  1IN6 A;  4NB5 A;  3DEU A;  2E7W A;  1SAX A;  2EV5 A;  1IN5 A;  1R1U A;  4S04 A;  4UXN A;  2FXA A;  5CLS A;  5D6E A;  4AVP A;  4WF2 A;  1PUE E;  1D8J A;  5K1Y A;  1SD7 A;  3QU3 A;  2FNP A;  4JK1 X;  3CUQ B;  2LDU A;  1MD0 A;  3GXO A;  1G6N A;  1ONV A;  2HYG D;  2MA3 A;  3F6V A;  3GFJ A;  4OOI A;  2STT A;  3JTH A;  5J8F A;  1BIA A;  3E3V A;  1ZH5 A;  4HLY A;  3ZMT A;  3GYH X;  3I64 A;  3WTU C;  4DQ2 A;  2CYY A;  5KVR A;  1FSE A;  2QWW A;  2VT3 A;  2OQR A;  2XKP A;  2MH2 A;  4A12 A;  3KLN A;  1WSU A;  5ICE A;  1IRF A;  4BHC A;  3EQL F;  2D1H A;  1T6S A;  4MQV A;  4ENJ A;  4U0W A;  4IRI A;  2XRO A;  4MHG A;  3SXY A;  2IT0 A;  1S29 A;  4YII A;  3RPU A;  2QBY B;  4IVN A;  2W24 A;  2ZME A;  4EM2 A;  1XSV A;  3PQK A;  1KQ9 A;  3EUH A;  3I4P A;  5DV5 A;  3RYP A;  2H27 A;  5LRS A;  2DI3 A;  2QVO A;  2O3F A;  1P4W A;  3IC7 A;  1QQI A;  3FMS A;  2Z33 A;  3MZH A;  2A6H F;  3P7N A;  2ADU A;  2A6E F;  4R1H A;  3ZPL A;  3LA2 A;  5HLG A;  3NEU A;  4MQ9 F;  5ILU A;  2HEO A;  3DF8 A;  5E1Z B;  1LDK B;  2X4H A;  5HDG A;  2M5W A;  3LFK A;  4KIB A;  3KEQ A;  2QZ8 A;  3ECO A;  1I1G A;  1QGP A;  4AD9 A;  3RJP A;  4U0Y A;  4ZZD A;  3KP3 A;  3W6K B;  3KP6 A;  4HX4 A;  5FLX K;  1D3Y A;  1S7A A;  3M9A A;  1YFH A;  5AIP A;  1CF7 B;  2VBW A;  1H9G A;  4WK8 F;  1F5T A;  4Z2Y A;  5HDK A;  4XLP F;  2G9W A;  4Q47 A;  3E6M A;  3WG9 A;  4LGW A;  1OPC A;  4LMY A;  3ZMV A;  2M87 A;  4KN7 X;  5IT9 K;  3I53 A;  1S7O A;  2XVC A;  5E8I A;  2NNN A;  3TO6 A;  4EJT A;  2J5P A;  1EH6 A;  4KIC A;  3V7R A;  3CJN A;  2GA2 A;  3BWG A;  4IJA A;  5ICC A;  1FZP B;  1O3T A;  2LF8 A;  1MJ9 A;  1J7K A;  1U3E M;  1EV7 A;  2O03 A;  2E1C A;  4KUM A;  4IF4 A;  3ML6 A;  4LLL A;  3I59 A;  1KU7 A;  1FBQ A;  1XGS A;  1YG2 A;  2P7C B;  5JHU A;  2P5V A;  3M8E A;  5BS6 A;  2E1N A;  1G3S A;  2CWE A;  2Z5U A;  2DAO A;  1K6O A;  1ZAR A;  4LLG F;  3L9F A;  3BJA A;  1ZLK A;  1U8R A;  4UUV A;  2KJB A;  1ON2 A;  3VEP A;  3WU1 B;  3RI4 A;  5JVT A;  3O6B B;  2M8E A;  4LK1 F;  3GF2 A;  4ZYH A;  4JQF A;  3HHH A;  2CSO A;  5AIQ A;  3MWM A;  1I6X A; 
#chains in the Genus database with same CATH topology
 1UMQ A;  5E20 A;  2BE5 F;  2LY2 A;  2YU9 J;  3BTJ A;  1SFK A;  4NDL A;  2V9V A;  1WHU A;  1O7F A;  1ZG5 A;  4AC0 A;  5LBQ A;  3DQV C;  1BC7 C;  4AYB N;  3E5U A;  4MO7 A;  2H1K A;  5J4Y A;  4ITV A;  2IA1 A;  2JSC A;  3F23 A;  5HLH A;  2MAB A;  1YRN A;  1SD5 A;  1OKR A;  2QKM B;  3LSK A;  2ZJR F;  1MBH A;  1XMK A;  2EJR A;  2YPR A;  3CLQ A;  3HKZ A;  2E2J J;  3MN2 A;  2X6Y A;  2WAQ N;  3UKG A;  1EJ9 A;  2KP6 A;  2FU4 A;  4MGR A;  1IUY A;  2RDP A;  5F0C A;  3SEZ A;  1FYK A;  2DTR A;  4ZJZ A;  3HRM A;  3R60 A;  4F55 A;  5IP9 J;  2EZI A;  2P0W A;  1KYW A;  2CG4 A;  1IXC A;  4II3 A;  4EVI A;  3H5R A;  3MAJ A;  1I6H J;  1T33 A;  3W2V A;  1NHA A;  4K2E A;  3WTZ A;  2YS9 A;  4JYK A;  4BJ6 C;  2EIK H;  4BDY A;  3KZY A;  2HYF A;  4G6D A;  4BY1 J;  5CYV A;  3HIF A;  5L3C A;  2Z16 A;  5FKO A;  3HOS A;  5A2Q K;  2JQ7 A;  2NVQ J;  3KP5 A;  2D2W A;  3G2B A;  2E35 A;  2RQQ A;  1HBX G;  2V1D A;  1Z67 A;  4OIP F;  2O8K A;  2OPT A;  1G3W A;  3ZN1 A;  1K78 B;  2KDO A;  2N8G A;  5D4S A;  2M34 A;  4I0A A;  5D5U B;  1P4A A;  4GGG A;  1JJ8 C;  2CH0 A;  1D0Y A;  4MNU A;  2V26 A;  2PFB A;  3Q9S A;  1ZR4 A;  4B09 A;  1FBS A;  2F5F A;  2B9S A;  1IDZ A;  1QZY A;  2VLA A;  2HQN A;  2LYC A;  1JHH A;  2VOP A;  3L00 A;  3ESW B;  3RYR A;  4IRH A;  2JSP A;  1Y8R B;  3CMA I;  3IRQ A;  5K5R A;  1WJC A;  4ENK A;  1BI0 A;  1R49 A;  1ZLJ A;  4X0G A;  2HZT A;  1HXD A;  2GWR A;  2P6T A;  4D7M A;  1J9I A;  1FMW A;  3SFI A;  1DDN A;  2VJ5 A;  3NRV A;  4BQA A;  3GEZ A;  1FNN A;  1ZTR A;  1QO0 D;  4C3J J;  2DOF A;  2X1D A;  4A3F J;  2QLZ A;  1J0R A;  1Z21 A;  3BTI A;  2CV1 A;  1E3P A;  3CMM A;  3I56 I;  1XCV A;  2G7U A;  1O3R A;  1W7P B;  2ZO4 A;  2NVT J;  1K61 A;  4MTD A;  5K7F A;  2NS8 A;  3HSF A;  3QP5 A;  5JFR A;  1F1Z A;  1GXP A;  2RC4 A;  2F4M B;  2XGX A;  2XRN A;  3JRD A;  4Y33 A;  3BPX A;  4HF2 A;  2K9S A;  3A01 A;  1U6G A;  1IN4 A;  1R00 A;  2XAS A;  3P9I A;  3BZC A;  4WWC A;  4J01 A;  1HSJ A;  2HWV A;  2G0E A;  1RKW A;  5IYC J;  5JLW A;  4NNJ A;  2KKO A;  1PVI A;  4F3Q A;  1QPI A;  3O2P E;  2DO7 A;  1YW7 A;  4PJ0 C;  3ZQF A;  3CC4 I;  1OYI A;  2H1L A;  3IHU A;  1MH4 A;  2JWT A;  2ME6 A;  2R7R A;  5ILV A;  3CZ6 A;  2LH9 A;  3BR0 A;  3HZJ A;  3J81 K;  4LB6 B;  1G3T A;  2G7H A;  3TDZ C;  4LIT A;  4O6J A;  4HF1 A;  1D0X A;  2M45 A;  3RCO A;  1HLV A;  1ZYR F;  1OMI A;  1V5F A;  2GZW A;  5AON A;  3S3M A;  4B4C A;  3D0S A;  2FQ3 A;  2B0L A;  3V4G A;  4CSW A;  5TIS C;  3FXR A;  1ZG1 A;  1K6Y A;  2XB5 A;  2DFI A;  4PSX A;  1D1A A;  4M3D A;  1ETY A;  2PLY A;  4OIO F;  2ZBK A;  2NOJ B;  4V2G A;  2A6T A;  1H9T A;  2DBB A;  4BE2 A;  1H0M A;  1RR7 A;  4ZDL A;  2V6E A;  3PQJ A;  1W1W E;  4PCQ A;  3TOB A;  3ZGK A;  3C7J A;  3R6S A;  5M3M J;  4IKF A;  2XUB A;  3F22 A;  3REO A;  3H3V K;  3H3Z A;  4RLF A;  1B9N A;  4XSX F;  4M9Z A;  3K2A A;  4EMS A;  5J1U A;  1KGS A;  1K83 J;  3B02 A;  4HOB A;  4NC8 A;  1B4A A;  1WGX A;  3FKI J;  4NQW B;  4ESF A;  4BEH B;  4ENM A;  2QBY A;  3BR5 A;  3JRI A;  1DQU A;  1OJL A;  4OMY A;  3WTW C;  1PVE A;  1R9T J;  4J00 A;  2ZNZ A;  2HOE A;  2CFX A;  2K9M A;  2W85 A;  3GBG A;  3I5U A;  4IHS A;  1A35 A;  2ZFU A;  2K02 A;  3F3X A;  3ZOB A;  1HW5 A;  3WGH A;  2Q8K A;  1QHG A;  3IH3 A;  1EYU A;  1MSF C;  3BG3 A;  3OV8 A;  3RKX A;  4CZZ A;  4LG0 A;  3C2G A;  3LSJ A;  5LHH A;  4UNO A;  4G9Y A;  4KJZ A;  1RIO H;  3ABM H;  3U1D A;  4DBR A;  1PP7 U;  5KNL A;  5HNF A;  1HCR A;  4PJN A;  3OL3 A;  5CVV A;  4RB1 A;  4EM1 A;  3S1Q J;  1AOY A;  2XAH A;  2BY2 A;  4DZJ A;  4F7Z A;  5LLQ A;  2A5W A;  3I54 A;  2X48 A;  3KX2 A;  5E1X A;  4PUS A;  5DUI A;  1F4K A;  2VBY A;  1WFX A;  1VQL I;  2PMU A;  3DP7 A;  1BR1 A;  2DJN A;  2L54 A;  2H8W A;  1BW6 A;  4AYB A;  1L3L A;  3VOE A;  3FX3 A;  3KP7 A;  4ESJ A;  2NS0 A;  4UVB A;  1ZRC A;  3VYU B;  2BZT A;  4XLN F;  1NK3 P;  1B9M A;  3ZQL A;  2BOL A;  2R5Y B;  2A05 A;  3OYC A;  3RKQ A;  3ZXS A;  5BPI A;  1O3S A;  1UJ8 A;  2IS1 A;  3F9K A;  4Y4R A;  5M5W J;  2KQR A;  5E79 C;  3PM1 A;  4A3D J;  3CCE I;  1WJB A;  4XKV A;  1Q1H A;  1UFM A;  5CQE A;  2LKX A;  3CCR I;  1MBE A;  2FBK A;  1NG6 A;  2DA2 A;  3VSK A;  1X1B A;  1T38 A;  2XF7 A;  2R5Z A;  3E1S A;  3PVI A;  3GW2 A;  4RGU A;  4ON0 A;  2QM3 A;  3ABK H;  2DXI A;  1VQN I;  3RQI A;  4CYD A;  2IGK A;  4AWX B;  2FOK A;  5H20 A;  2DPD A;  5F0F A;  2WBM A;  2EA2 A;  2HDW A;  3A0B C;  2AXL A;  1QZZ A;  3PIO F;  3ZR8 X;  1BJA A;  4PDK A;  4LFU A;  4C9Y A;  2DMT A;  3BOQ A;  3K69 A;  1Z6T A;  1CF7 A;  1FOW A;  4BS9 A;  4JBA A;  2ZJP F;  2JZY A;  3P5J A;  3VSL A;  3WTS C;  3CP2 A;  1IN7 A;  1S9H A;  2E7X A;  1VFC A;  3D5L A;  3OIQ A;  5F1J A;  1HKQ A;  4XRS A;  2E5Z A;  5IP6 A;  2HPM A;  3RTR A;  2ZSH B;  2Z2S B;  4RB0 A;  1FYL A;  2XKO A;  1CGP A;  2KIF A;  3A1Y A;  5J8C A;  5J1Y A;  2MSY A;  3S1M J;  2K85 A;  5FFX A;  1ETW A;  4HQM A;  3MFK A;  3L7W A;  3HDD A;  2DT6 A;  1L0O C;  4M9X A;  3KZZ A;  2HQ5 A;  2HNH A;  1IZ1 A;  4P9U A;  2VE9 A;  4IZZ A;  2OU2 A;  3CCU I;  4BY7 J;  3RKW A;  3BLY A;  5BNG A;  1LB2 A;  5GP9 A;  5EZH A;  3N97 A;  1WWX A;  5L3D A;  2CQN A;  2LC2 A;  4HNT A;  4BDZ A;  1EH8 A;  2HOA A;  2KRC A;  3FIW A;  1YJW I;  3I55 I;  2P4W A;  1UCR A;  2PJR B;  1XD7 A;  5GTI C;  2ZXJ A;  4EV0 A;  2LSO A;  4A3E J;  1J5Y A;  3QYF A;  4RDU A;  4XLC A;  1E2X A;  3GZ5 A;  4XRM A;  1PJR A;  2LY9 A;  4RLQ A;  4YFN F;  1BI1 A;  3RPQ A;  4KFC A;  5HLI A;  4M9S A;  1TLH B;  3HB9 A;  5M5X J;  2OQG A;  2K27 A;  3IV5 A;  2BHZ A;  2DYR H;  1TBX A;  3O8G A;  4UUS B;  2V1U A;  4M6X A;  3CTA A;  2E2I J;  2L7K A;  4KN4 X;  2W7N A;  3BR3 A;  3ECH A;  1XGM A;  3BP8 A;  3CCL I;  1MSE C;  1XPX A;  1FEX A;  3QRF F;  3O8H A;  1YS6 A;  4IXA A;  4JP0 A;  4RAZ A;  5DTD A;  5E18 F;  3CMY A;  1N75 A;  3RZO J;  2F6C A;  2FX0 A;  2DMU A;  4RAG A;  1LFB A;  2BW3 B;  3OYD A;  1Y0U A;  3ZCO A;  5F08 A;  1I3Q J;  1Y56 A;  3E5Q A;  1IC8 A;  4PSW A;  1LNW A;  3OR2 C;  3V8J A;  3FM3 A;  2EPF A;  1BJZ A;  2VOD A;  2CFO A;  3MCZ A;  1T98 A;  3U9G A;  2HVQ A;  2M3A A;  4XBF A;  2Q10 A;  2K3F A;  3GTO J;  3I0T A;  3S17 J;  1Z05 A;  5IT9 Z;  2J5O A;  3VB2 A;  3R61 A;  2WC2 A;  4P5O A;  1HKT A;  1U5T B;  1V5G A;  1BM9 A;  2HXI A;  4EGY A;  2ESN A;  5DCM B;  2CW8 A;  2ZKZ A;  4D0P A;  2OZ6 A;  1ETO A;  1GHC A;  3FMQ A;  5TRD A;  3OYF A;  2R92 J;  1MGT A;  2Z3Y A;  1IXS B;  3K2Z A;  2QCO A;  2JVG A;  4PZJ A;  5CVU A;  3DFG A;  1R5G A;  3K7A J;  3CF5 F;  4I09 A;  4Y13 A;  4EGZ A;  1JGS A;  4FX4 A;  1LDD A;  3EUA A;  3DCF A;  3QPT A;  4GRI A;  2LTP A;  2JA2 A;  4KT5 C;  4UB8 C;  5IY5 H;  2TDX A;  3FF5 A;  1XGO A;  2UXN A;  1O57 A;  3M8F A;  1ETQ A;  2HS5 A;  3SDG A;  1Z7L A;  1Y8Q B;  2L4M A;  2ZCW A;  2OTL I;  1TWG J;  4D7N A;  4XKB A;  4G8X A;  4MEY F;  4Q4Z F;  2F48 A;  3AFH A;  3K1M A;  3QP6 A;  1ZRD A;  6PAX A;  3IH4 A;  1CQT A;  4QWQ A;  2VPL A;  5J40 A;  3LA7 A;  4E6K G;  2ISZ A;  3HGY A;  2GLO A;  4DYQ A;  1VTN C;  2W84 A;  1MMD A;  4II2 A;  2LP0 A;  4XR6 A;  2VBZ A;  5D6F A;  4EAT A;  3M8J A;  2DMQ A;  1W0T A;  2CW0 F;  2VB6 A;  1W7P D;  3L2V A;  3FXK A;  3H36 A;  4KIS A;  3HOX J;  3OIP A;  4EJU A;  1MH3 A;  3JAM K;  1FYM A;  4BH9 A;  1FOY A;  2MC3 A;  3K10 A;  1YW8 A;  3HHG A;  3GWZ A;  3E6C C;  2OUM A;  1DUX C;  1ZHF A;  3GUD A;  1ZAO A;  4DYR A;  3J7A Y;  1ETK A;  2MLK A;  1H89 C;  3FXJ A;  1MDM B;  3EYI A;  1I27 A;  3VFZ A;  3SQN A;  2XDV A;  3JRF A;  2R7T A;  2KIM A;  1ERD A;  4I02 A;  4A2U A;  2LG4 A;  1TQP A;  2QQB A;  1D1C A;  1JHF A;  3P9K A;  2DK8 A;  2PG4 A;  2AQE A;  1WH5 A;  4G7Z F;  3KYL A;  4UY8 I;  2IGN A;  3VDX A;  3HOT A;  4AIH A;  3PUB A;  3Q5F A;  2MC4 A;  1KU9 A;  3G1M A;  4ZC3 A;  2UUZ A;  1R1T A;  2W82 A;  4HA8 A;  3E5X A;  3Q0V A;  3F21 A;  4IX7 A;  2VQC A;  1X3U A;  4O3M A;  2HFH A;  2QYO A;  4QSH A;  2PMZ A;  4ZDO A;  4C2U A;  4ZYG A;  3NQO A;  1T56 A;  4OIN F;  2GA1 A;  1FY7 A;  3CDH A;  1ZGA A;  2P81 A;  1QRY A;  1TW3 A;  2ZXI A;  4B3A A;  2IPQ X;  4CUG A;  4B1R A;  1OCP A;  3TKY A;  3K4J A;  5FKM A;  2V4J C;  4I0B A;  4AM3 A;  2CW7 A;  1BN5 A;  1JE8 A;  2EV0 A;  1XGN A;  1GXQ A;  2EZL A;  2LLK A;  4QLC U;  3OYM A;  1O4X A;  5EZG A;  3CCV I;  3KET A;  4M3G A;  2Y9Y A;  1UB9 A;  4I98 B;  2JN6 A;  2OZU A;  2L4A A;  4CGZ A;  2ZME C;  1HOM A;  2FE3 A;  1MZB A;  1B1B A;  3BTC A;  2D45 A;  5A2Q Z;  3J7Z I;  1Z91 A;  4L9V A;  4EEF G;  1E3O C;  1BC8 C;  2OTJ I;  2L9R A;  3EUH C;  2XHK A;  5DEQ A;  4HEA 2;  2XAQ A;  2JPC A;  2JRT A;  1QHH D;  2DA6 A;  2LOO A;  3I58 A;  2RAE A;  1UHS A;  3VYS B;  3RZD J;  2JVH A;  2XGE A;  2F5C A;  2E1M B;  1HA8 A;  2EIJ H;  1R58 A;  4LLN A;  4KIT B;  5CVJ A;  3K9T A;  4YG2 F;  2JRM A;  1UZC A;  4RAY A;  2AQF A;  1XMX A;  2ODH A;  5KCM A;  3BG6 A;  3VYT B;  3ZMS A;  3TL4 X;  1B72 B;  1ZRF A;  2VUM J;  4HSR A;  3CD6 I;  3TO9 A;  2OF7 A;  3HUG A;  4YFX F;  2ZB9 A;  3HC7 A;  1D1B A;  1STZ A;  1QVT A;  2DPU A;  2V9K A;  3VPR A;  2L2O A;  4BQQ A;  3T0Y A;  1TL8 A;  1UHM A;  2GXA A;  2LRD A;  5E1W A;  1F36 A;  4E7J A;  1X1D A;  3FXO A;  1BR2 A;  4MFD A;  3W2W A;  3DLL F;  4LG3 A;  4P9F A;  1IXR C;  3S2W A;  1MNM C;  3OYH A;  2AS5 F;  4N4N B;  4A0Y A;  1HDD C;  3I9V 2;  1KYZ A;  1DP7 P;  2A68 F;  1HW1 A;  1GVD A;  2M9H A;  2HTJ A;  3OY9 A;  1Q1V A;  2CO5 A;  3HRS A;  3CCJ I;  3F6O A;  5EF6 A;  1X1C A;  2EWN A;  1X3W B;  3GZN B;  3FKJ A;  3K4B A;  4HV6 A;  4BJT A;  4ZZL A;  2R93 J;  3HSR A;  1XSD A;  1XN7 A;  2X51 A;  4A5M A;  1OYY A;  1HQC A;  1JI8 A;  1PP8 F;  5JLX A;  1ZEL A;  2HTS A;  3U1K A;  4E7Z A;  1SMT A;  2F5D A;  4ANJ A;  3EYY A;  4B3X A;  3L09 A;  5FKK A;  1MMG A;  4PJM A;  2EB7 A;  4Y15 A;  2WAF A;  3QOD A;  2CQX A;  2VXD A;  2FF4 A;  5IT3 A;  4E7K A;  1I1S A;  4D9J A;  1X2N A;  2IRF G;  4A0X A;  1Z1D A;  4UVA A;  3TMO A;  4MTE A;  2KJC A;  3DV8 A;  3G3Z A;  3MKZ A;  1T2K A;  3TW7 A;  4KT6 A;  2VQH A;  1ZN2 A;  5K5Q A;  2HU9 A;  1BI3 A;  2DA3 A;  4XOR A;  2XIG A;  5LFA A;  2IVM A;  3MKW B;  3H9G A;  3H5N A;  1ODD A;  5EEH A;  4M3E A;  1C0W A;  4OIR F;  2R5Y A;  3HRT A;  3DEW A;  3J7A O;  2FOW A;  3BR2 A;  1J75 A;  3W6J B;  4U7D A;  3ZQG A;  3GTK J;  5IOY A;  5C44 J;  5D8K B;  1U8B A;  3COA C;  2ZME B;  4HNU A;  2OJE D;  2ZSI B;  1WJE A;  5DD8 A;  2H09 A;  1NK2 P;  5B1A H;  4TV7 A;  1QPM A;  4IEJ A;  2IAI A;  2NVY J;  2ZJQ F;  3N05 A;  2Q2E B;  4RGS A;  1Z9C A;  3GFM A;  4HBL A;  4A3C J;  1XSX A;  4BXX J;  4A3J J;  2QQ9 A;  3K70 C;  5HS8 A;  3OYE A;  2L02 A;  1T8I A;  1VI0 A;  3IWF A;  5ILS A;  4FX0 A;  4L5J A;  2LKP A;  2LBF A;  4IL6 C;  5B3S H;  3LST A;  1JKO C;  1FX7 A;  5L3G A;  2H8R A;  2RVC A;  4ZYE A;  2E36 A;  1IRX A;  3U21 A;  4W97 A;  4U7B A;  3M7G A;  2A61 A;  2R7Q A;  1ORK A;  3FK7 A;  4IO9 F;  3GTG J;  2M7B A;  3HOV J;  1MBG A;  4HX7 A;  4UHT A;  3D5R C;  1G2H A;  3LL7 A;  4H0E A;  1X1P A;  3ISP A;  3DEE A;  2Y9Z A;  1NI0 A;  4HDV A;  1ZGJ A;  2A69 F;  1IUF A;  2VQG A;  2PJR A;  1QVU A;  2YX7 A;  2YX4 A;  4M71 A;  4ENN A;  2LNB A;  3CCM I;  3TO7 A;  2AO9 A;  1HKS A;  2HYJ A;  4HV5 A;  2P5L C;  4M74 A;  4BAY A;  2C6Y A;  2VJ4 A;  5CVR A;  4OAY A;  1YI2 I;  1ON1 A;  3TQN A;  1D5V A;  4WXH A;  3W3C A;  3H9J A;  2K9N A;  3BG7 A;  2VKD A;  4G7O F;  3M07 A;  1TW2 A;  2V9P A;  5F64 A;  2WAD A;  3QPL A;  4XLE A;  4UUS A;  3GFI A;  3S2H J;  3CUQ A;  3DBR B;  4PJL A;  3AG3 H;  2EFN A;  5ED4 A;  3V42 A;  4A6E A;  4I2O A;  1JT6 A;  2H6B A;  2HQR A;  1LE8 B;  2KMU A;  2IA2 A;  4Y52 J;  2JJ7 A;  3QYE A;  5DD4 A;  3NAU A;  2CQ7 A;  1JTX A;  4KIF A;  1BOA A;  1LDJ A;  2M4K A;  4GYG A;  1X1A A;  2JA8 J;  2CUF A;  2LD5 A;  2VN2 A;  1JGG A;  1EA3 A;  3OIO A;  3RIR A;  3EDP A;  1AU7 A;  3CCY A;  2P8T A;  1YW9 A;  3OYN A;  3S15 J;  4U88 A;  4IHX A;  5DCM A;  3GME A;  3OYL A;  1G4D A;  1LUJ B;  4A3I J;  3GLX A;  3QAH A;  5D5V B;  4GO1 A;  2A07 F;  2RNG A;  4CO8 A;  3LOC A;  3FHN A;  1RET A;  1RZ4 A;  1J09 A;  4G94 A;  5GAH J;  3Q0U A;  3TDU C;  1U9N A;  2COM A;  3KYD B;  1A6I A;  1V3F A;  4C2M J;  3IUO A;  3U2R A;  5ICF A;  2R7V A;  4RMN A;  1TNS A;  3CC2 I;  1LEA A;  3HG9 A;  3KP2 A;  3JSO A;  1QZE A;  1OYW A;  1K4T A;  1WI9 A;  1ZR2 A;  3I59 B;  4HAM A;  4QPO A;  4E4H A;  3SHF A;  3BJO A;  2HDD A;  2DA4 A;  3LA3 A;  2WV0 A;  4HG2 A;  4ZTJ A;  1K0Z A;  3RDI A;  4AIJ A;  2UWM A;  3FDY A;  1B59 A;  1R22 A;  4E7I A;  3PNY A;  3WTV C;  2DK5 A;  4D1Q A;  4NC6 A;  1ZKG A;  1P7I A;  1NTC A;  1H56 A;  5IYD J;  2VPR A;  3OOP A;  4M6Y A;  2FJ1 A;  2NNY A;  2O61 A;  4L9J A;  1Y6I A;  2XGD A;  3G6E I;  3BDD A;  2HDC A;  5D5X B;  5FKN A;  1W36 D;  5LGU A;  3S16 J;  2ZFW A;  4P55 A;  2P6S A;  5LRR A;  9ANT A;  1B6A A;  1MJB A;  2DOA A;  4BBR J;  1D5Y A;  3DTK A;  3NWS A;  1BIB A;  3DWL E;  3ABL H;  3CO7 C;  3FXQ A;  1HDP A;  2YUS A;  3CUQ C;  3NWT A;  1YYV A;  1QNT A;  3BZK A;  4EM0 B;  3H1C A;  3CME I;  1USS A;  2JK3 A;  1HC8 A;  1K79 A;  5GAG J;  2EH3 A;  2FBH A;  4RA2 A;  1WJ5 A;  2UZK A;  4Y17 A;  1YIJ I;  1HST A;  4WX9 A;  4NC7 A;  1K7A A;  5IOZ A;  1MDM A;  4X6A J;  2PN6 A;  3SDB A;  3DU5 A;  3C1D A;  3QPH A;  3QU6 A;  4CYC B;  4PJJ A;  3EET A;  4Q5S F;  4KMU X;  2GAU A;  4G7H F;  3C2H A;  1W5T A;  4A6D A;  2O0Y A;  2IS2 A;  2KPM A;  4L0Y B;  2FML A;  4M72 A;  4N0B A;  2VJJ A;  1LEB A;  2TRT A;  4QIW N;  3MZY A;  4QTR A;  1W5S A;  5B66 C;  2CUZ A;  2XV4 S;  5FLV A;  2W57 A;  2Y75 A;  3PNV A;  4HDU A;  5CKT A;  1I5Z A;  2PMZ N;  5LEK A;  5J3L A;  2D1V A;  4A3B J;  1TQM A;  3FXL A;  3IP4 B;  1RRJ A;  5FD6 A;  4CCN A;  1ZG3 A;  4LD5 A;  4XMY A;  1GV2 A;  2XB0 X;  5D5W B;  3CP8 A;  4L9N A;  2IXS A;  1E0E A;  3HGG A;  3V8L A;  5FFZ A;  3S93 A;  1XG1 A;  1WQ2 A;  2FUG 2;  2Y0M A;  4WCG A;  2PVI A;  3M3Y J;  2VKH A;  4FT8 A;  2X6X A;  2GBY A;  2Y30 A;  1FLI A;  1EF4 A;  1VQO I;  1SFU A;  3MKY B;  3K0L A;  3L2C A;  2HGC A;  1LVA A;  1S72 I;  3OWT A;  1RPW A;  4O5V A;  1KQ0 A;  2XC7 A;  4CCL A;  5BQT A;  1JKR C;  4ABZ A;  2EFP A;  2GIV A;  3A0H C;  1G59 A;  1FJL A;  3F8C A;  3J80 K;  2PJP A;  4F92 B;  1IV8 A;  3I4M J;  4GXO A;  4UB6 C;  3AG4 H;  3KP4 A;  1Y0N A;  3DLA A;  1SFE A;  1EH7 A;  5D4R A;  1RUN A;  2CQK A;  5HOD A;  2FEZ A;  4FTH A;  5HDN A;  3K1N A;  3F0C A;  2Y2Z A;  2EV6 A;  3T8R A;  3N4M A;  1H88 C;  2RKH A;  1VQP I;  5FLX Z;  5HVQ C;  1WZ2 A;  4BHB A;  3SJM A;  4XNF A;  4F93 B;  3HOW J;  1T0F A;  2XSD C;  1XS9 A;  3CJQ B;  1I39 A;  2EFQ A;  3FMR A;  5F0H A;  4U87 A;  1REP C;  1VND A;  2PI0 A;  3CUO A;  5GPA A;  4YIF A;  5KAF C;  1T08 B;  2JPB A;  2LF7 A;  1V54 H;  3GVA A;  3PFY A;  2DLL A;  2ECB A;  4WXC A;  3LMM A;  3WE2 A;  4CCK A;  4AID A;  2EZH A;  2FNA A;  4B47 A;  2K40 A;  2KLO A;  3WTX C;  4D5C A;  2FD5 A;  4HQE A;  2KZG A;  2Z1D A;  2OCC H;  1VF9 A;  2TCT A;  2CRG A;  3S3N A;  5ICG A;  3I71 A;  3A01 B;  2X6O A;  4L9T A;  3IKT A;  4BXF A;  3D5S C;  2M2E A;  3E0J B;  3H0D A;  2F4O B;  1SMY F;  2BYV E;  4H4K C;  2L5Q A;  1KA8 A;  3BY6 A;  3GTM J;  2JTV A;  3K4K A;  3CES A;  4ESB A;  2FMY A;  3WHC A;  3SYT A;  1LQ1 A;  1V5E A;  2P5K A;  2BBY A;  2LY1 A;  2XAJ A;  2GXG A;  1W4M A;  2A3S A;  1X58 A;  4N4O B;  2YR2 A;  1RUO A;  4KA4 A;  1YQA A;  3IWZ A;  5C4X J;  2QUF A;  1TT5 B;  1LPQ A;  4XM3 A;  3QPS A;  2NXN B;  4I76 A;  3L2U A;  4CHU A;  3AL0 C;  4EJO A;  1IN8 A;  2V1X A;  2BY0 A;  1FMV A;  2VT2 A;  4DBQ A;  3ERM A;  5LGN A;  3LSM A;  3K4L A;  2E5N A;  4EQQ A;  5HLT A;  1JTY A;  3H0G J;  3A03 A;  1XCB A;  1OR7 A;  1IDY A;  3BRO A;  2I5U A;  3GO5 A;  3RKY A;  5LD2 C;  3KEO A;  2CGP A;  2I10 A;  1P92 A;  1LFU P;  2P7V B;  2NRA C;  3ONQ A;  1VQ7 I;  3K1P A;  5EG0 B;  4E7S A;  4IOA F;  3IAM 2;  5C4J J;  5E3L A;  3SFZ A;  2WWY A;  3KPH A;  5LEJ A;  3G4S I;  1DU0 A;  1E3H A;  3G1L A;  5F27 A;  3R0A A;  4GYI A;  3IH2 A;  1JXS A;  1LJ9 A;  4BQO A;  2IS4 A;  5FRN A;  1D8K A;  4A93 J;  3RSN A;  3D1N I;  2HR3 A;  1P7J A;  1I3A A;  2Q2E A;  2QKL B;  4AUX A;  2R7F A;  1UG2 A;  3FXU A;  3KLO A;  2O6G E;  1WRJ A;  1YOV B;  1PUF B;  4DYC A;  4LG0 B;  4ZYA A;  3BR6 A;  2Q0O A;  2W4S A;  2BHY A;  2ELJ A;  5EYR A;  2GQQ A;  2WY7 Q;  4IPA A;  1YS7 A;  3WU2 C;  2VL8 A;  1Z3Y A;  2ELH A;  4S0H B;  3HL2 A;  5DS9 A;  4ZH4 F;  2XF6 A;  2CUJ A;  3IL2 A;  4B8X A;  3F8M A;  2R7S A;  3BJ6 A;  3QQA A;  2XRL A;  4KYW A;  3JSP A;  1SEU A;  1YIT I;  3GTJ J;  4JOM A;  3TED A;  1K78 A;  4GDF A;  4BQN A;  1J2X A;  4LIV A;  3MD2 A;  5H2F C;  2L9N A;  2MGQ A;  2PEX A;  5DCF A;  5HNH A;  2V6C A;  3CO6 C;  1X4O A;  2EBI A;  2VE8 A;  1B8I B;  2VQL A;  3JTG A;  4KIG A;  3FWE A;  4BXU A;  4NBQ A;  2I8D A;  2DFH A;  4M3F A;  4HZF A;  1X4P A;  2IA0 A;  1R7J A;  2IP2 A;  3FHZ A;  2NYX A;  2PBI A;  2CU7 A;  1MND A;  1YX3 A;  1N77 A;  3ULQ B;  3IKV A;  5KAI C;  3HJE A;  4HW0 A;  4CXF A;  1F43 A;  1SAN A;  2VKV A;  5E8G A;  1KU3 A;  4L18 B;  3WGI A;  2JUC A;  2HQA A;  2JUG A;  3A2K A;  3R4K A;  5H6R A;  5E3M A;  1FSH A;  1N78 A;  4M73 A;  3GCM A;  2HOS A;  3HPH A;  1FWZ A;  3IMB A;  2PQ8 A;  3TOA A;  2R5Z B;  1A04 A;  1W7P A;  1YIO A;  5FRO A;  2H94 A;  1Y1W J;  2DFF A;  5FD5 A;  4J19 A;  1JKQ C;  5EGO B;  1W5C C;  5M3F J;  2R7U A;  1OR7 C;  2O8X A;  4LJZ F;  2K4B A;  2QQA A;  1YTY A;  1ETV A;  3PL8 A;  2ID3 A;  2MBF A;  1WJA A;  2RV8 A;  2M8G X;  4UUT A;  1TWA J;  1TT0 A;  2YSR A;  3G1O A;  2L3D A;  1X3Z B;  1MBJ A;  2DMN A;  2ETH A;  4RB3 C;  1LE8 A;  3B6C A;  2RQP A;  4ZYD A;  2IGO A;  2JT1 A;  4C3H J;  1DPU A;  3V7S A;  3PO3 J;  3L2W A;  2E60 A;  1WPK A;  2V1N A;  4DNC A;  4DZP A;  1LVK A;  1ZQ3 P;  2L01 A;  5HS9 A;  2NAZ A;  3AG2 H;  4Y7N J;  2QA4 I;  3LSR A;  3LAP A;  3M4O J;  1AKH B;  1FP1 D;  2QQ8 A;  2RN7 A;  3E7L A;  1VQ6 I;  5K7Z A;  1U2W A;  2ESH A;  5FGM A;  1WI3 A;  4XOP A;  3T1B A;  3ZP5 A;  5LGT A;  3F8F A;  2CS3 A;  3WOD F;  2BV6 A;  3B73 A;  4RS8 A;  1S8N A;  3QOE A;  2HVR A;  3ASN H;  2Y48 A;  2ZNY A;  3CQZ J;  1SAU A;  3ZMU A;  2LRE A;  1T39 A;  3BQY A;  3HM5 A;  1TWH J;  5IP7 J;  1TWF J;  2E2H J;  4ETS A;  4G6Q A;  4BU2 A;  1IJW C;  3BPV A;  1VZ0 A;  1MMN A;  2M1B A;  4OIQ F;  3DKX A;  4RB2 C;  4FE7 A;  4LOC A;  2WY8 Q;  1KQ8 A;  3ZQH A;  3FM5 A;  4NQW A;  4BEH A;  3S8P A;  1X2M A;  3DBH B;  3KIO A;  1Y1V J;  4ASN A;  1YHQ I;  1HW2 A;  3H35 A;  4GFB A;  5BPD A;  3PNT A;  4OU0 A;  2JA6 J;  3TGN A;  2V79 A;  4HST A;  3JW4 A;  1R4N B;  3R0J A;  1MBF A;  4JX5 A;  2OC6 A;  3J81 Z;  2O7O A;  2IJL A;  3E6D A;  1FOK A;  3H3U A;  1ZK8 A;  4LB5 A;  1E17 A;  2DDB A;  5DM6 F;  1ACI A;  5F6F A;  1IO2 A;  5JR3 A;  2R7Z J;  4LK0 F;  5L3F A;  2EK5 A;  1TP4 A;  1R23 A;  3L2R A;  2ZC2 A;  5FB2 A;  3DU6 A;  5J1R A;  2XAG A;  2Z99 A;  2CJJ A;  4P96 A;  1VQ9 I;  1U0J A;  2AXT C;  1R5I D;  1O7L A;  4C3I J;  1WJD A;  1IF1 A;  2MH9 A;  2XPW A;  4RGX A;  3B6A A;  4CCJ A;  3WHB A;  4DOZ A;  3DKY A;  1P2F A;  3UNG C;  2A5Y B;  4XL9 A;  5DUK A;  1LKX A;  4N9I A;  2DA1 A;  1DGR M;  2KRF A;  3DBL B;  4RGR A;  2GXB A;  2HKX A;  3MEX A;  5FJ8 J;  3G73 A;  4CYC A;  3TW6 A;  5HOO A;  1WKM A;  1AWC A;  4UV8 A;  4U0V A;  3VWB A;  1SD4 A;  4HPQ A;  2VI6 A;  2BY1 A;  4XRF A;  1VQM I;  1XDU A;  4P1W A;  1LFP A;  3W2A A;  3LQR A;  3KFW X;  3C3W A;  4R79 A;  3DXJ F;  2IEK A;  3HRU A;  4HX8 A;  2WTE A;  2X0L A;  1TQI A;  1IGN A;  4BYY A;  3UR3 C;  1UST A;  2IGM A;  1S3J A;  1FP2 A;  1J59 A;  3GTQ J;  2E71 A;  1X19 A;  4KMF A;  1BOB A;  5M5Y J;  2IW5 A;  3JRH A;  1FOX A;  4UV9 A;  1XB4 A;  2LKS A;  2DJI A;  2HKO A;  1DP3 A;  1G8X A;  3MQ0 A;  3ABU A;  3JRE A;  1UG0 A;  1RI7 A;  1KON A;  3E97 A;  3AG1 H;  5H6Q A;  3JR9 A;  1POG A;  2FSW A;  5J47 A;  3ZMZ A;  3ZRG A;  2DYS H;  2MFZ A;  4A3G J;  1SVM A;  1SD6 A;  1SVL A;  2R7O A;  2DFE A;  3GX4 X;  1Z77 A;  3DTI A;  4FET A;  3OOU A;  3G71 I;  2BXY A;  5J6X A;  3H5A A;  3ZMD A;  2R4G A;  4MLO A;  3WGG A;  3F8B A;  4BL0 B;  1A6Q A;  2ZJ2 A;  1OCZ H;  1O3Q A;  1FTZ A;  2DA7 A;  1FC3 A;  3A02 A;  3GFL A;  2BGC A;  1AA7 A;  2QSH X;  1ZRE A;  2XAF A;  3FZV A;  1Z6R A;  2F5E A;  2K7L A;  2XSJ C;  4I7H A;  4PGH A;  2QEN A;  3OYG A;  4UVC A;  2ME0 A;  3S1R J;  3M1C A;  2NOG A;  5E17 F;  5JI6 A;  2M4G A;  2OCE A;  1R6R A;  2L7M P;  3FK6 A;  5CVI A;  3LSG A;  3K4N A;  1IV6 A;  4IHV A;  1GDT A;  1IRG A;  3BQZ A;  4IHT A;  3OMY A;  2UXX A;  2YU3 A;  4JX4 A;  4YFK F;  1VQK I;  2L0K A;  3WE3 A;  5B5E C;  5TJJ A;  3WU0 A;  2VOO A;  4Q48 A;  2EIN H;  4BNC A;  1S7E A;  2VKE A;  1U9O A;  2V7F A;  2R7D A;  3JRG A;  1OQY A;  1YE9 A;  2BW3 A;  5GAD J;  3VOD A;  4I01 A;  2KIQ A;  3BR1 A;  3GTP J;  1FBU A;  2E34 A;  4NHJ A;  4HYE A;  4XRS G;  3M1E A;  1ITY A;  5F1R A;  2E1O A;  3WTT C;  3JCU C;  2H6C A;  1RES A;  3AKZ A;  3CCQ I;  1R1V A;  4OWR B;  1U5T A;  3J80 Z;  1TZL A;  3HTU A;  1GT0 C;  4AIK A;  1MJA A;  1R71 A;  5EJC A;  1YO5 C;  2OAZ A;  2MD5 A;  2MLG A;  2DQR A;  1XX5 A;  3T5X A;  2CQQ A;  5DDG A;  4MFE A;  2DW4 A;  1UAA A;  2KHM A;  2X9D A;  2FBI A;  1D0Z A;  1QBJ A;  4MEX F;  3P9C A;  2VON A;  2VXZ A;  1GLN A;  4EJV A;  1DGW Y;  1OCR H;  1XDS A;  1Z7U A;  2W25 A;  2ZXH A;  3LSI A;  4LIU A;  5DYM A;  3ABT A;  3V7C A;  2IS6 A;  4EJW A;  1APL C;  2COB A;  4W1U A;  2BEO A;  4A3L J;  3SZG A;  2ECC A;  3HOZ J;  4B48 A;  2MG4 A;  3HUG B;  2PMH A;  3QYB A;  4FIS A;  1R36 A;  1WH7 A;  4B44 A;  2ZXW H;  1FT9 A;  3ZQQ A;  3DPU A;  3O3K A;  5ERI A;  3TBI A;  3HTS B;  2L9S A;  1MMA A;  3OS0 A;  1IAW A;  1WVR A;  3DPL C;  5D8L B;  2HXO A;  3BG5 A;  3PSF A;  3ZQ7 A;  2ACJ A;  1U78 A;  3CDL A;  1UHW A;  5FO5 A;  1SFX A;  3F8N A;  2NVX J;  5EG0 A;  1W0U A;  3KE2 A;  4DW6 A;  1G3Y A;  4A5N A;  4DGW B;  1JKP C;  1Z0X A;  1SC7 A;  1OFC X;  4IRG A;  2OBP A;  3OYI A;  3PFI A;  1K4S A;  2CV2 A;  1XC5 A;  4PGG A;  3WTY C;  3PUF A;  1RR8 C;  1TNT A;  4A3M J;  1NG7 A;  3C18 A;  2K4J A;  3HYI A;  5HS7 A;  2BXZ A;  3LWF A;  1DU6 A;  2X6W A;  2W00 A;  3HXL A;  4L5I A;  2F2E A;  1R4M B;  3V8K A;  5L3B A;  2WA0 A;  2VC0 A;  2HI3 A;  2KDZ A;  1PUF A;  1OCO H;  2AHQ A;  3QOP A;  2QF7 A;  4YEJ A;  2R3S A;  3IRR A;  4OAZ A;  1P4X A;  4XSZ F;  2FA5 A;  3BZ6 A;  1JUM A;  4WXD A;  3H9Q A;  5KK1 A;  4XQF A;  3J7Y J;  4AU7 A;  2K5C A;  3BCA A;  4HF0 A;  2GIZ A;  3DPT A;  3H92 A;  3L1P A;  4BE1 A;  4CIC A;  2EQR A;  2EA4 A;  3ERE D;  4OMZ A;  2K86 A;  4YEL A;  1ETX A;  2M0M A;  2DT7 B;  1BBY A;  4HLX A;  3OSG A;  4C30 A;  3VYR B;  3ELK A;  3CCS I;  2RNJ A;  2Z9O A;  3OYK A;  1F9N A;  5EEA A;  2Y0S N;  1OIS A;  3F72 A;  3I3L A;  3OL4 A;  3SZT A;  4BGD A;  5L3E A;  3LAJ A;  3K4M A;  2BVL A;  3OR1 C;  1M1E B;  1U5T C;  4BHP A;  4FHT A;  1MW7 A;  2KT0 A;  5LHI A;  1B8I A;  1FIA A;  3LQQ A;  4A0Z A;  2XF5 A;  2DT5 A;  2R7W A;  4E70 A;  2O9L A;  1R5H A;  4KNY A;  4IQ4 A;  5CJ9 A;  1FTT A;  1FPQ A;  1RC9 A;  2M7A A;  4GCV A;  2PX9 A;  1IW7 F;  4RBO A;  1YRN B;  3T8T A;  1IRZ A;  2ISY A;  3DKW A;  2CUE A;  2WAQ A;  1PDN C;  3DTE A;  5F04 A;  1GV5 A;  5B1B H;  4KDP A;  3BT9 A;  4XID A;  3GZ6 A;  3QWL A;  3Q3S A;  2JA5 J;  3HSE A;  4B43 A;  3JAM Z;  1YLF A;  3AAF A;  1DPR A;  3ZQC A;  3SZP A;  3FIS A;  5EGO A;  2LFB A;  4PFP A;  1S6L A;  1KZH A;  3S32 A;  4AVZ A;  2WB1 N;  1GVJ A;  5BOX A;  2XPU A;  2M30 A;  3ZN0 A;  2KIU A;  2OD5 A;  4IHW A;  3SEQ A;  4N9H A;  4F91 B;  5EEG A;  4L0Z B;  2EFW A;  3W6V A;  1TTY A;  3IAS 2;  2E19 A;  2VC1 A;  1JT0 A;  3KCC A;  2LBF B;  2DQL A;  1QA6 A;  2VBX A;  1MMS A;  2VIX A;  3OSF A;  4FE4 A;  1KU2 A;  1RNL A;  4S05 A;  4A3K J;  2QSG X;  1XMA A;  4CDG A;  5BMZ A;  1HF0 A;  3ROU A;  3S2D J;  1P6R A;  1MBK A;  4HNV A;  3E6B A;  2DU9 A;  1WJF A;  2HVS A;  4D5F A;  1V4R A;  5LHG A;  2STW A;  2VJI A;  5K5O A;  2MD0 A;  3HBL A;  4XOT A;  3KEY A;  2XPV A;  4R8H A;  2EFO A;  3Q9V A;  1AKH A;  2RGV A;  4CZC A;  1B72 A;  4A69 C;  4X1E A;  3MVP A;  1UEL B;  1ULY A;  2FRH A;  2MW8 A;  1BI2 A;  2OA4 A;  1MKM A;  2NVU B;  2W1O A;  3CLO A;  4JX6 A;  1IN6 A;  5K7H A;  3FBN B;  4NB5 A;  3DEU A;  3K6G A;  2E7W A;  3HOY J;  2Y31 A;  1YX5 A;  1SAX A;  2EV5 A;  1IN5 A;  1R1U A;  4C2T A;  4S04 A;  1BR4 A;  4UXN A;  2FXA A;  3PJR A;  5CLS A;  2OA9 A;  4XK4 A;  2RRE A;  3BG9 A;  5D6E A;  2ICW G;  4AVP A;  1JUS A;  1JUP A;  3RPU D;  4WF2 A;  1PUE E;  3OS1 A;  1D8J A;  5K1Y A;  1SD7 A;  3QU3 A;  2FNP A;  4JK1 X;  3CUQ B;  2FQ4 A;  2DTZ A;  2LDU A;  1MD0 A;  3GXO A;  1G6N A;  4BKX A;  1ONV A;  2HYG D;  2IBD A;  3GLL A;  2XGC A;  1BW5 A;  5FRM A;  2MA3 A;  3PIP F;  2ELK A;  3LNQ A;  3F6V A;  3GFJ A;  1A5J A;  1W36 C;  4OOI A;  2STT A;  3JTH A;  2F4I A;  2Q1Z B;  1BIA A;  3E3V A;  5J8F A;  4HLY A;  1ZH5 A;  3ZMT A;  4DJA A;  2HZD A;  2B7E A;  3GYH X;  3I64 A;  5CPR B;  5FLM J;  3WTU C;  4DQ2 A;  4XN3 A;  2CYY A;  5KVR A;  1FSE A;  3PSI A;  2QWW A;  2VT3 A;  2OQR A;  3BCB A;  2XKP A;  2MH2 A;  2OAA A;  4Y3O A;  3LSP A;  4A12 A;  3KLN A;  1WSU A;  1VQ8 I;  2KZV A;  5ICE A;  4V2F A;  2EIL H;  1IRF A;  4CCM A;  4RM3 A;  1VQ5 I;  3S14 J;  2EIM H;  4BHC A;  2L7F P;  3EQL F;  4XLH A;  3MMY B;  2ID6 A;  2D1H A;  2O5R A;  1T6S A;  2GOM A;  3PO2 J;  2M0C A;  4MQV A;  4ENJ A;  4PFO A;  4U0W A;  1SVO A;  4IRI A;  2LMD A;  2XRO A;  1I50 J;  1PYV A;  4MHG A;  1XTA A;  3SXY A;  2IT0 A;  1S29 A;  1V55 H;  4YII A;  2E1M C;  4V19 K;  4G6T B;  3JRA A;  3OYJ A;  3S1N J;  3RPU A;  2F5V A;  5FKL A;  1F0O A;  1TC3 C;  2QBY B;  5CQG A;  1MIJ A;  4IVN A;  4XIC A;  2DMP A;  2W24 A;  2ZME A;  1XSV A;  4EM2 A;  3PQK A;  1T95 A;  1A31 A;  3KZI C;  2KFD A;  3BC8 A;  4XN0 A;  1T0F C;  4XON A;  2L9V A;  3OS2 A;  4M3B A;  5DM7 F;  1KQ9 A;  4CA0 A;  2ODI A;  4XLF A;  3EUH A;  4PK4 A;  3I4P A;  5DV5 A;  3RYP A;  4I6Z A;  2H27 A;  5LRS A;  4F52 A;  3HKZ N;  3HPG A;  2DI3 A;  2QVO A;  2O3F A;  4E7H A;  3WG7 H;  1P4W A;  3IC7 A;  4RAF A;  2X85 A;  4E7L A;  3MKL A;  1QQI A;  3HEF A;  1ENH A;  3FMS A;  2Z33 A;  4XKC A;  3MZH A;  2CV0 A;  1RKT A;  2A6H F;  1OLT A;  2WAE A;  1BL0 A;  3P7N A;  3FBI B;  2Y0S A;  2ADU A;  3CC7 I;  1Z3X A;  2DCE A;  2A6E F;  4R1H A;  5GPC A;  2DOD A;  3CJR B;  3ZPL A;  3LA2 A;  3Q0W A;  2GM4 A;  3EPZ A;  5HLG A;  3NEU A;  3KYC B;  4MQ9 F;  5IYB J;  5ILU A;  2K9Q A;  2HEO A;  4BJ5 C;  3DF8 A;  2DN0 A;  2BY3 A;  2KL4 A;  5E1Z B;  1A36 A;  1LDK B;  3EUK L;  2X4H A;  5HDG A;  2M5W A;  3LFK A;  4KIB A;  3JRC A;  3KEQ A;  2QZ8 A;  3LFU A;  4XKW A;  3ECO A;  1I1G A;  1QGP A;  4AD9 A;  2CMP A;  3RJP A;  5E3N A;  4U0Y A;  3I4N J;  4IQJ A;  2DDA A;  3LSH A;  4ZZD A;  4NUB A;  1QU3 A;  2JMW A;  2XAU A;  1S5L C;  2WB1 A;  3KP3 A;  3W6K B;  3X2Q H;  3KP6 A;  1EKE A;  4HX4 A;  4IOC F;  1FIP A;  2R0Q C;  5FLX K;  1D3Y A;  3FXM A;  1S7A A;  3M9A A;  1YFH A;  5AIP A;  2GOX B;  3C2B A;  4IHY A;  3ZQI A;  1CF7 B;  2VBW A;  4CH7 A;  1ZGW A;  3RQ4 A;  1H9G A;  4FQG A;  3K70 D;  4DIQ A;  3NAR A;  4WK8 F;  2QEX I;  2K3P A;  4M6V A;  1F5T A;  4Z2Y A;  1YJ9 I;  2UV1 A;  5GTH C;  3A4C A;  5HDK A;  3AL0 B;  4QPQ A;  4XLP F;  2G9W A;  4Q47 A;  4XLA A;  5JHF A;  3E6M A;  3WG9 A;  1AHD P;  1Y39 A;  1BA5 A;  4LGW A;  1OPC A;  3S3O A;  4LMY A;  3ZMV A;  4ZTF A;  2M87 A;  4KN7 X;  5IT9 K;  3K4C A;  3I53 A;  1S7O A;  2L7Z A;  2OV7 A;  3BTL A;  2XVC A;  3MZ8 A;  1WCM J;  5E8I A;  4BAC A;  1GUU A;  2HOT A;  2NNN A;  2HPI A;  3TO6 A;  2KRH A;  4EJT A;  2J5P A;  5C3E J;  1EH6 A;  4KIC A;  2K9L A;  4ZDP A;  5EDN A;  3V7R A;  3CJN A;  4HRI A;  2X1C A;  3HOU J;  2QSF X;  2GA2 A;  1YJN I;  2X1E A;  3BWG A;  4IJA A;  5ICC A;  1H8A C;  1N25 A;  1FZP B;  5GAE J;  2LF8 A;  1O3T A;  1MJ9 A;  1J7K A;  4RM2 A;  1U3E M;  1EV7 A;  2O03 A;  2VAS A;  2E1C A;  4KUM A;  3OYA A;  5KHD A;  4IF4 A;  3ML6 A;  3JRB A;  4LLL A;  3I59 A;  2QGU A;  4YRV A;  4MIM A;  1KU7 A;  1FBQ A;  2LR8 A;  1XGS A;  1TWC J;  1NH3 A;  2LK2 A;  3CF2 A;  2MYS A;  2R7X A;  1YG2 A;  2P7C B;  2B63 J;  4Z6Y A;  4BE0 A;  5JHU A;  2P5V A;  1MNE A;  3M8E A;  4YIR X;  2WV1 A;  5BS6 A;  2E1N A;  1P9Q C;  4G12 A;  1OCC H;  3CJT B;  1G3S A;  2CWE A;  2Z5U A;  3TP3 A;  3OYB A;  2DAO A;  1K6O A;  1SFO J;  3L2Q A;  1ZAR A;  2JA7 J;  1OCT C;  2DA5 A;  2D5V A;  2NS7 A;  2KIS A;  4LLG F;  3L9F A;  3CDI A;  4I99 C;  3BJA A;  1ZLK A;  1U8R A;  4L5E A;  3TP0 A;  2W48 A;  2EZK A;  4FAS D;  4UUV A;  2KJB A;  1ON2 A;  3VEP A;  3ASO H;  3WU1 B;  3RI4 A;  4BBS J;  2DOE A;  5JVT A;  5TGT A;  4FCY A;  1PVU A;  3GTL J;  3O6B B;  2M8E A;  2Y69 H;  4LK1 F;  3GF2 A;  4ZYH A;  1JJ6 C;  5JVG F;  2LVS A;  5J4V A;  4JQF A;  1IG7 A;  3HHH A;  4CCO A;  2CSO A;  4BUP A;  5AIQ A;  2BVM A;  5IPA A;  1VQ4 I;  3MWM A;  1I6X A;  5E3O A; 
#chains in the Genus database with same CATH homology
 5E20 A;  2BE5 F;  2V9V A;  1O7F A;  1ZG5 A;  5LBQ A;  3DQV C;  1BC7 C;  3E5U A;  2IA1 A;  2JSC A;  3F23 A;  5HLH A;  1SD5 A;  1OKR A;  1XMK A;  2YPR A;  2EJR A;  2FU4 A;  4MGR A;  1IUY A;  2RDP A;  1FYK A;  2DTR A;  3HRM A;  3R60 A;  1KYW A;  2CG4 A;  1IXC A;  4EVI A;  3MAJ A;  1NHA A;  4K2E A;  3WTZ A;  3KZY A;  2HYF A;  4G6D A;  5CYV A;  3HIF A;  5L3C A;  3HOS A;  5A2Q K;  3KP5 A;  2D2W A;  1HBX G;  2V1D A;  4OIP F;  1G3W A;  3ZN1 A;  1K78 B;  5D4S A;  4I0A A;  5D5U B;  1P4A A;  4GGG A;  4MNU A;  3Q9S A;  2PFB A;  4B09 A;  1FBS A;  2F5F A;  1QZY A;  2HQN A;  1JHH A;  2VOP A;  3L00 A;  3RYR A;  4IRH A;  3IRQ A;  5K5R A;  4ENK A;  1BI0 A;  1ZLJ A;  2HZT A;  1HXD A;  2GWR A;  2P6T A;  1J9I A;  1DDN A;  3NRV A;  4BQA A;  3GEZ A;  1FNN A;  1QO0 D;  2QLZ A;  1J0R A;  1XCV A;  2G7U A;  1O3R A;  1W7P B;  2ZO4 A;  4MTD A;  3HSF A;  3QP5 A;  5JFR A;  1F1Z A;  1GXP A;  2RC4 A;  2XGX A;  2XRN A;  3BPX A;  4HF2 A;  1U6G A;  1IN4 A;  1R00 A;  2XAS A;  3P9I A;  4WWC A;  1HSJ A;  2HWV A;  2KKO A;  3O2P E;  2DO7 A;  1YW7 A;  1OYI A;  3IHU A;  5ILV A;  3J81 K;  4LB6 B;  1G3T A;  2G7H A;  3TDZ C;  4O6J A;  4HF1 A;  2M45 A;  1ZYR F;  1OMI A;  2GZW A;  5AON A;  3D0S A;  2FQ3 A;  2B0L A;  3V4G A;  3FXR A;  1ZG1 A;  2DFI A;  2PLY A;  4OIO F;  2ZBK A;  1H9T A;  2DBB A;  1H0M A;  3PQJ A;  4PCQ A;  3TOB A;  3C7J A;  3R6S A;  2XUB A;  3F22 A;  3REO A;  3H3Z A;  1B9N A;  4XSX F;  4M9Z A;  4EMS A;  1KGS A;  3B02 A;  4HOB A;  1B4A A;  4ESF A;  4ENM A;  2QBY A;  4OMY A;  3WTW C;  2ZNZ A;  2HOE A;  2CFX A;  2W85 A;  3I5U A;  4IHS A;  2K02 A;  3F3X A;  1HW5 A;  3WGH A;  2Q8K A;  3OV8 A;  3RKX A;  4CZZ A;  4LG0 A;  5LHH A;  4UNO A;  4G9Y A;  1RIO H;  3U1D A;  1PP7 U;  5CVV A;  4RB1 A;  4EM1 A;  1AOY A;  2XAH A;  4F7Z A;  5LLQ A;  3I54 A;  5E1X A;  5DUI A;  1F4K A;  2VBY A;  2PMU A;  3DP7 A;  2L54 A;  1L3L A;  3VOE A;  3FX3 A;  3KP7 A;  4ESJ A;  2NS0 A;  4UVB A;  1ZRC A;  4XLN F;  1B9M A;  1O3S A;  5BPI A;  1Q1H A;  1UFM A;  2FBK A;  1T38 A;  3GW2 A;  4RGU A;  4ON0 A;  2QM3 A;  4CYD A;  4AWX B;  2FOK A;  5H20 A;  2DPD A;  2EA2 A;  2AXL A;  1QZZ A;  1BJA A;  4PDK A;  4LFU A;  3K69 A;  3BOQ A;  1CF7 A;  1Z6T A;  4JBA A;  2JZY A;  3WTS C;  1IN7 A;  2E7X A;  3D5L A;  1HKQ A;  3RTR A;  1FYL A;  4RB0 A;  2XKO A;  1CGP A;  2KIF A;  5J8C A;  5FFX A;  4HQM A;  3MFK A;  3L7W A;  1L0O C;  4M9X A;  3KZZ A;  1IZ1 A;  4P9U A;  2VE9 A;  2OU2 A;  3RKW A;  1LB2 A;  3N97 A;  1WWX A;  5L3D A;  1EH8 A;  2P4W A;  1UCR A;  1XD7 A;  2ZXJ A;  4EV0 A;  2LSO A;  1J5Y A;  1E2X A;  3GZ5 A;  4YFN F;  1BI1 A;  3RPQ A;  4KFC A;  5HLI A;  4M9S A;  1TLH B;  2OQG A;  2K27 A;  1TBX A;  2V1U A;  4M6X A;  3CTA A;  4KN4 X;  3ECH A;  1XGM A;  3BP8 A;  3QRF F;  1YS6 A;  4IXA A;  4RAZ A;  5E18 F;  1Y0U A;  3E5Q A;  1LNW A;  3V8J A;  3FM3 A;  2VOD A;  3MCZ A;  1T98 A;  3U9G A;  4XBF A;  2Q10 A;  3I0T A;  1Z05 A;  5IT9 Z;  2J5O A;  3VB2 A;  3R61 A;  2WC2 A;  4P5O A;  1HKT A;  1U5T B;  4EGY A;  1BM9 A;  2ESN A;  5DCM B;  2ZKZ A;  4D0P A;  2OZ6 A;  1GHC A;  3FMQ A;  5TRD A;  1MGT A;  2Z3Y A;  1IXS B;  3K2Z A;  4PZJ A;  5CVU A;  3DFG A;  1R5G A;  4I09 A;  4Y13 A;  4EGZ A;  1JGS A;  4FX4 A;  1LDD A;  3QPT A;  4KT5 C;  2TDX A;  3FF5 A;  1XGO A;  2UXN A;  1O57 A;  3M8F A;  2HS5 A;  2L4M A;  2ZCW A;  4G8X A;  4MEY F;  4Q4Z F;  3K1M A;  3QP6 A;  1ZRD A;  6PAX A;  4QWQ A;  3LA7 A;  2ISZ A;  1VTN C;  2W84 A;  2VBZ A;  5D6F A;  2CW0 F;  1W7P D;  4EJU A;  3JAM K;  1FYM A;  4BH9 A;  2MC3 A;  1YW8 A;  3HHG A;  3GWZ A;  3E6C C;  1DUX C;  1ZHF A;  3GUD A;  1ZAO A;  2MLK A;  1MDM B;  3EYI A;  1I27 A;  3VFZ A;  3SQN A;  2KIM A;  4I02 A;  4A2U A;  1TQP A;  2QQB A;  1JHF A;  3P9K A;  2DK8 A;  2PG4 A;  4G7Z F;  3HOT A;  4AIH A;  3Q5F A;  1KU9 A;  1R1T A;  4HA8 A;  3E5X A;  3F21 A;  1X3U A;  4O3M A;  2HFH A;  2QYO A;  4ZYG A;  3NQO A;  4OIN F;  2GA1 A;  1FY7 A;  3CDH A;  1ZGA A;  1TW3 A;  2IPQ X;  3TKY A;  4I0B A;  1BN5 A;  1JE8 A;  2EV0 A;  1XGN A;  1GXQ A;  4QLC U;  3KET A;  1UB9 A;  4I98 B;  2OZU A;  2L4A A;  4CGZ A;  2FE3 A;  1MZB A;  1B1B A;  2D45 A;  5A2Q Z;  1Z91 A;  4L9V A;  1BC8 C;  2XHK A;  5DEQ A;  2XAQ A;  2JPC A;  2JRT A;  3I58 A;  2F5C A;  1R58 A;  4LLN A;  5CVJ A;  3K9T A;  4YG2 F;  4RAY A;  2ODH A;  3ZMS A;  1ZRF A;  3TO9 A;  3HUG A;  4YFX F;  1STZ A;  2DPU A;  3T0Y A;  1UHM A;  5E1W A;  4P9F A;  1IXR C;  3S2W A;  2AS5 F;  4A0Y A;  1KYZ A;  1DP7 P;  2A68 F;  1HW1 A;  2HTJ A;  2CO5 A;  3HRS A;  3F6O A;  2EWN A;  4HV6 A;  4ZZL A;  3HSR A;  1XSD A;  1XN7 A;  4A5M A;  1OYY A;  1HQC A;  1PP8 F;  2HTS A;  1SMT A;  2F5D A;  3EYY A;  3L09 A;  2EB7 A;  4Y15 A;  2FF4 A;  5IT3 A;  1I1S A;  2IRF G;  4A0X A;  1Z1D A;  4UVA A;  4MTE A;  2KJC A;  3DV8 A;  3G3Z A;  1T2K A;  1ZN2 A;  5K5Q A;  1BI3 A;  2XIG A;  2IVM A;  1ODD A;  5EEH A;  1C0W A;  4OIR F;  3HRT A;  3J7A O;  1J75 A;  3W6J B;  4U7D A;  5D8K B;  3COA C;  2ZME B;  5DD8 A;  2H09 A;  4TV7 A;  1QPM A;  4RGS A;  1Z9C A;  3GFM A;  4HBL A;  1XSX A;  2QQ9 A;  5HS8 A;  2L02 A;  3IWF A;  5ILS A;  4FX0 A;  4L5J A;  2LKP A;  3LST A;  1FX7 A;  5L3G A;  2RVC A;  4ZYE A;  4U7B A;  3M7G A;  2A61 A;  4HX7 A;  4UHT A;  4H0E A;  3ISP A;  4HDV A;  1ZGJ A;  2A69 F;  2YX7 A;  2YX4 A;  4M71 A;  4ENN A;  2LNB A;  3TO7 A;  1HKS A;  4HV5 A;  2P5L C;  4M74 A;  4BAY A;  2C6Y A;  5CVR A;  1ON1 A;  3TQN A;  1D5V A;  4WXH A;  4G7O F;  1TW2 A;  5F64 A;  3GFI A;  3CUQ A;  2EFN A;  5ED4 A;  4A6E A;  4I2O A;  2H6B A;  2HQR A;  2IA2 A;  5DD4 A;  4KIF A;  1BOA A;  1LDJ A;  4GYG A;  2VN2 A;  3RIR A;  3EDP A;  2P8T A;  1YW9 A;  4U88 A;  5DCM A;  1G4D A;  3GLX A;  3QAH A;  5D5V B;  4GO1 A;  2A07 F;  4CO8 A;  1RZ4 A;  4G94 A;  3TDU C;  2COM A;  1V3F A;  3U2R A;  5ICF A;  1TNS A;  1LEA A;  3KP2 A;  3JSO A;  1OYW A;  1WI9 A;  3I59 B;  4HAM A;  3SHF A;  3BJO A;  3LA3 A;  2WV0 A;  3RDI A;  4AIJ A;  2UWM A;  1B59 A;  1R22 A;  3WTV C;  2DK5 A;  3OOP A;  4M6Y A;  2NNY A;  2O61 A;  4L9J A;  3BDD A;  2HDC A;  5D5X B;  5LGU A;  2ZFW A;  4P55 A;  2P6S A;  5LRR A;  1B6A A;  1MJB A;  1BIB A;  3CO7 C;  3FXQ A;  3CUQ C;  1YYV A;  1QNT A;  4EM0 B;  1USS A;  1K79 A;  2FBH A;  2UZK A;  4Y17 A;  1HST A;  4WX9 A;  1K7A A;  1MDM A;  2PN6 A;  3C1D A;  3QPH A;  3QU6 A;  3EET A;  4Q5S F;  4KMU X;  2GAU A;  4G7H F;  1W5T A;  4A6D A;  2O0Y A;  4L0Y B;  2FML A;  4M72 A;  4N0B A;  1LEB A;  3MZY A;  1W5S A;  2XV4 S;  2W57 A;  2Y75 A;  4HDU A;  5LEK A;  1I5Z A;  2D1V A;  1TQM A;  5FD6 A;  1ZG3 A;  4LD5 A;  5D5W B;  4L9N A;  3V8L A;  5FFZ A;  1WQ2 A;  2Y0M A;  4WCG A;  4FT8 A;  1FLI A;  1SFU A;  3K0L A;  3L2C A;  2HGC A;  1LVA A;  4O5V A;  1KQ0 A;  5BQT A;  2EFP A;  2GIV A;  2PJP A;  3F8C A;  3J80 K;  4GXO A;  3KP4 A;  1SFE A;  1EH7 A;  5D4R A;  1RUN A;  2CQK A;  2FEZ A;  5HDN A;  3K1N A;  2EV6 A;  3T8R A;  3N4M A;  2RKH A;  5FLX Z;  5HVQ C;  4BHB A;  1T0F A;  2EFQ A;  3FMR A;  1REP C;  2PI0 A;  3CUO A;  4YIF A;  2JPB A;  2LF7 A;  3GVA A;  2DLL A;  4WXC A;  3WE2 A;  2FNA A;  3WTX C;  4HQE A;  5ICG A;  3I71 A;  4L9T A;  3IKT A;  1SMY F;  2BYV E;  1KA8 A;  3BY6 A;  2JTV A;  4ESB A;  2FMY A;  1LQ1 A;  2P5K A;  2BBY A;  2XAJ A;  2GXG A;  1W4M A;  2A3S A;  2YR2 A;  1RUO A;  4KA4 A;  1YQA A;  3IWZ A;  2QUF A;  4CHU A;  4EJO A;  1IN8 A;  2V1X A;  2VT2 A;  5LGN A;  4EQQ A;  1XCB A;  1OR7 A;  3BRO A;  3GO5 A;  3RKY A;  3KEO A;  2CGP A;  1P92 A;  2NRA C;  2P7V B;  3K1P A;  3SFZ A;  2WWY A;  5LEJ A;  3R0A A;  4GYI A;  1JXS A;  1LJ9 A;  1D8K A;  2HR3 A;  2Q2E A;  2R7F A;  3FXU A;  3KLO A;  2O6G E;  1WRJ A;  4LG0 B;  2Q0O A;  2GQQ A;  4IPA A;  1YS7 A;  2ELH A;  4ZH4 F;  3IL2 A;  4B8X A;  3F8M A;  3BJ6 A;  4KYW A;  3JSP A;  1K78 A;  1J2X A;  5DCF A;  2PEX A;  2V6C A;  3CO6 C;  2VE8 A;  3JTG A;  4KIG A;  3FWE A;  4BXU A;  4HZF A;  2IA0 A;  2IP2 A;  1R7J A;  3FHZ A;  2NYX A;  2PBI A;  3ULQ B;  3IKV A;  4HW0 A;  4CXF A;  5E8G A;  1KU3 A;  4L18 B;  3WGI A;  3R4K A;  5H6R A;  1FSH A;  4M73 A;  1FWZ A;  3IMB A;  2PQ8 A;  3TOA A;  1A04 A;  1W7P A;  1YIO A;  2H94 A;  5FD5 A;  2O8X A;  4LJZ F;  2K4B A;  2QQA A;  1YTY A;  2MBF A;  2RV8 A;  2YSR A;  2L3D A;  2ETH A;  4RB3 C;  2RQP A;  4ZYD A;  2JT1 A;  1DPU A;  3V7S A;  4DNC A;  2L01 A;  5HS9 A;  2NAZ A;  3LAP A;  1FP1 D;  2RN7 A;  1U2W A;  2ESH A;  5FGM A;  3ZP5 A;  3T1B A;  5LGT A;  3F8F A;  3WOD F;  2BV6 A;  3B73 A;  4RS8 A;  1S8N A;  2Y48 A;  2ZNY A;  3ZMU A;  1T39 A;  4ETS A;  4G6Q A;  3BPV A;  2M1B A;  4OIQ F;  4RB2 C;  1KQ8 A;  3FM5 A;  4NQW A;  4ASN A;  1HW2 A;  5BPD A;  4OU0 A;  3TGN A;  2V79 A;  3JW4 A;  3R0J A;  3J81 Z;  2IJL A;  3E6D A;  1FOK A;  3H3U A;  4LB5 A;  1E17 A;  5F6F A;  5JR3 A;  4LK0 F;  5L3F A;  2EK5 A;  1R23 A;  5FB2 A;  2XAG A;  2Z99 A;  4P96 A;  1O7L A;  1IF1 A;  2MH9 A;  4RGX A;  1P2F A;  2A5Y B;  5DUK A;  4N9I A;  2KRF A;  4RGR A;  2GXB A;  2HKX A;  3MEX A;  3G73 A;  5HOO A;  1WKM A;  1AWC A;  4UV8 A;  4U0V A;  1SD4 A;  4XRF A;  1XDU A;  3LQR A;  3KFW X;  3C3W A;  4R79 A;  3DXJ F;  3HRU A;  4HX8 A;  2WTE A;  2X0L A;  1TQI A;  4BYY A;  1UST A;  1FP2 A;  1S3J A;  1J59 A;  4KMF A;  2IW5 A;  4UV9 A;  1XB4 A;  2HKO A;  3MQ0 A;  3ABU A;  1RI7 A;  3E97 A;  5H6Q A;  2FSW A;  3ZMZ A;  1SD6 A;  3GX4 X;  5J6X A;  3ZMD A;  3WGG A;  3F8B A;  2ZJ2 A;  1O3Q A;  1FC3 A;  3GFL A;  2BGC A;  1ZRE A;  2XAF A;  3FZV A;  1Z6R A;  2F5E A;  2K7L A;  4I7H A;  4PGH A;  2QEN A;  4UVC A;  5E17 F;  5JI6 A;  5CVI A;  1IRG A;  4IHT A;  2UXX A;  2YU3 A;  4YFK F;  3WE3 A;  5TJJ A;  3WU0 A;  2VOO A;  4Q48 A;  4BNC A;  2R7D A;  3VOD A;  4I01 A;  1FBU A;  4NHJ A;  4HYE A;  3M1E A;  5F1R A;  3WTT C;  2H6C A;  1R1V A;  1U5T A;  3J80 Z;  3HTU A;  4AIK A;  1MJA A;  1YO5 C;  2OAZ A;  2MD5 A;  2MLG A;  2DQR A;  3T5X A;  5DDG A;  2DW4 A;  2FBI A;  1QBJ A;  4MEX F;  3P9C A;  2VON A;  2VXZ A;  4EJV A;  1XDS A;  1Z7U A;  2W25 A;  5DYM A;  3ABT A;  3V7C A;  4EJW A;  2BEO A;  2PMH A;  1R36 A;  1FT9 A;  3O3K A;  5ERI A;  3HTS B;  1IAW A;  5D8L B;  3DPL C;  3ZQ7 A;  2ACJ A;  1U78 A;  1UHW A;  5FO5 A;  1SFX A;  3F8N A;  3KE2 A;  1G3Y A;  4A5N A;  4IRG A;  2OBP A;  3PFI A;  4PGG A;  3WTY C;  1TNT A;  3C18 A;  2K4J A;  3HYI A;  5HS7 A;  3LWF A;  4L5I A;  2F2E A;  3V8K A;  5L3B A;  2VC0 A;  3QOP A;  2R3S A;  3IRR A;  1P4X A;  4XSZ F;  2FA5 A;  3BZ6 A;  4WXD A;  5KK1 A;  4HF0 A;  3DPT A;  3H92 A;  4CIC A;  2EA4 A;  3ERE D;  4OMZ A;  2K86 A;  4HLX A;  1BBY A;  3ELK A;  2RNJ A;  2Z9O A;  1F9N A;  3F72 A;  3SZT A;  5L3E A;  3LAJ A;  4BHP A;  1U5T C;  4FHT A;  5LHI A;  3LQQ A;  4A0Z A;  2DT5 A;  4E70 A;  4KNY A;  1R5H A;  5CJ9 A;  1FPQ A;  4GCV A;  1IW7 F;  3T8T A;  2ISY A;  3DKW A;  1PDN C;  4KDP A;  3GZ6 A;  3HSE A;  3JAM Z;  1YLF A;  3AAF A;  1DPR A;  3SZP A;  1S6L A;  1GVJ A;  5BOX A;  2M30 A;  3ZN0 A;  2KIU A;  2OD5 A;  4N9H A;  5EEG A;  4L0Z B;  2EFW A;  1TTY A;  2VC1 A;  3KCC A;  2DQL A;  2VBX A;  1KU2 A;  1RNL A;  4S05 A;  1XMA A;  4CDG A;  5BMZ A;  3ROU A;  1P6R A;  3E6B A;  2DU9 A;  1V4R A;  5LHG A;  2STW A;  5K5O A;  4R8H A;  2EFO A;  3Q9V A;  2RGV A;  1ULY A;  2FRH A;  1BI2 A;  2OA4 A;  1MKM A;  3CLO A;  1IN6 A;  4NB5 A;  3DEU A;  2E7W A;  1SAX A;  2EV5 A;  1IN5 A;  1R1U A;  4S04 A;  4UXN A;  2FXA A;  5CLS A;  2OA9 A;  5D6E A;  4AVP A;  4WF2 A;  1PUE E;  1D8J A;  5K1Y A;  1SD7 A;  3QU3 A;  2FNP A;  4JK1 X;  3CUQ B;  2LDU A;  1MD0 A;  3GXO A;  1G6N A;  1ONV A;  2HYG D;  2MA3 A;  3F6V A;  3GFJ A;  4OOI A;  2STT A;  3JTH A;  5J8F A;  1BIA A;  3E3V A;  1ZH5 A;  4HLY A;  3ZMT A;  3GYH X;  3I64 A;  3WTU C;  4DQ2 A;  2CYY A;  5KVR A;  1FSE A;  2QWW A;  2VT3 A;  2OQR A;  2XKP A;  2MH2 A;  2OAA A;  4A12 A;  3KLN A;  1WSU A;  5ICE A;  1IRF A;  4BHC A;  3EQL F;  2D1H A;  1T6S A;  4MQV A;  4ENJ A;  4U0W A;  4IRI A;  2XRO A;  4MHG A;  3SXY A;  2IT0 A;  1S29 A;  4YII A;  3RPU A;  2QBY B;  4IVN A;  2W24 A;  2ZME A;  4EM2 A;  1XSV A;  3PQK A;  1KQ9 A;  2ODI A;  3EUH A;  3I4P A;  5DV5 A;  3RYP A;  2H27 A;  5LRS A;  2DI3 A;  2QVO A;  2O3F A;  1P4W A;  3IC7 A;  1QQI A;  3FMS A;  2Z33 A;  3MZH A;  2A6H F;  3P7N A;  2ADU A;  2A6E F;  4R1H A;  3ZPL A;  3LA2 A;  5HLG A;  3NEU A;  4MQ9 F;  5ILU A;  2HEO A;  3DF8 A;  5E1Z B;  1LDK B;  2X4H A;  5HDG A;  2M5W A;  3LFK A;  4KIB A;  3KEQ A;  2QZ8 A;  3ECO A;  1I1G A;  1QGP A;  4AD9 A;  3RJP A;  4U0Y A;  4ZZD A;  3KP3 A;  3W6K B;  3KP6 A;  4HX4 A;  5FLX K;  1D3Y A;  1S7A A;  3M9A A;  1YFH A;  5AIP A;  1CF7 B;  2VBW A;  1H9G A;  4WK8 F;  1F5T A;  4Z2Y A;  5HDK A;  4XLP F;  2G9W A;  4Q47 A;  3E6M A;  3WG9 A;  4LGW A;  1OPC A;  4LMY A;  3ZMV A;  2M87 A;  4KN7 X;  5IT9 K;  3I53 A;  1S7O A;  2XVC A;  5E8I A;  2NNN A;  3TO6 A;  4EJT A;  2J5P A;  1EH6 A;  4KIC A;  3V7R A;  3CJN A;  2GA2 A;  3BWG A;  4IJA A;  5ICC A;  1FZP B;  1O3T A;  2LF8 A;  1MJ9 A;  1J7K A;  1U3E M;  1EV7 A;  2O03 A;  2E1C A;  4KUM A;  4IF4 A;  3ML6 A;  4LLL A;  3I59 A;  1KU7 A;  1FBQ A;  1XGS A;  1YG2 A;  2P7C B;  5JHU A;  2P5V A;  3M8E A;  5BS6 A;  2E1N A;  1G3S A;  2CWE A;  2Z5U A;  2DAO A;  1K6O A;  1ZAR A;  4LLG F;  3L9F A;  3BJA A;  1ZLK A;  1U8R A;  4UUV A;  2KJB A;  1ON2 A;  3VEP A;  3WU1 B;  3RI4 A;  5JVT A;  3O6B B;  2M8E A;  4LK1 F;  3GF2 A;  4ZYH A;  4JQF A;  3HHH A;  2CSO A;  5AIQ A;  3MWM A;  1I6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...