4KZEH

Crystal structure of an rna aptamer in complex with fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BL3-6 Fab antibody, heavy chain
publication title A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/rna
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kzeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kzeH01
1RK1B 4XHJC 1F6AB 2Z31D 2AJXH 3HN3A 4KKAC 5D1QD 4Y5VB 1QSED 5ADOL 1JK8B 3U4AA 3UO1L 1FJ1B 1X5JA 3MFFB 1PGRB 2BRQA 5IB4B 2UWEB 2H2PC 4TSCL 3PL6D 1I85C 3S5LB 4PJGA 5DF0A 5FYKE 3CDYA 1G9NL 3NZHL 1LO0H 3VGEA 1MJJB 2DM7A 1D5XA 5HDBE 4GRLD 5GISL 4IHOA 4A6YL 3GMNB 2WW8A 4LKCB 1NEZG 4IRJC 5I66A 3RVXD 4EI5B 2CXGA 1LEIA 1GOGA 1KT2B 2VISB 3AREC 1ZGLA 3QUZC 1OAYL 5D2NB 2AEIT 3I75B 3CFKA 3I9GL 3IJHB 4XH2A 4H88H 5EO9B 2HJLB 1WBYB 3FN9A 1DBML 3HG1E 1XEDA 3O6LH 4ZFGL 2ED9A 3IU3B 1NL0H 2JK5A 4HUUA 5F72S 1RMFH 2A9MH 4MLIA 4IRSA 4OQTL 4RGOL 4NQTA 4JFZH 1RZIA 3VXMA 4NUGH 2EDRA 4MQXC 1DQML 3C60B 4JPKL 3UTTD 5C2UB 4S1SL 1S9YB 3QPXL 4BH7B 5C0CB 1C5BH 1FNSL 1CFTA 1XGUB 5EBMA 3M8OH 2R4RL 3KYAA 3LCYA 4PJAF 2PYFA 2ORBL 4Q7DA 4UV7L 5DXWA 5DK2B 4HWBA 2IALA 4G5ZH 3AXLB 3K8MA 4Z7UB 3ZDXE 4L4VE 2VDOL 3FT2B 4FQXC 4LVHB 4H8WL 4EVNB 2X4NA 1CU4H 4XC3H 1NSNL 4HXAH 5CCKH 1MREL 1YJDH 3KNBB 3W82A 4Z5RB 4RWYH 5H37H 5DJYB 1L6XA 4JRXE 4Z76B 1DJSA 5DRZA 5LGKA 3P73A 2YMXH 1GC1C 2IBZX 2H9GA 2XTLA 1IAKB 3RWCA 2MHAA 1P7QD 3OXSA 4NUJA 2CKBB 3B9KD 4KAQL 3SKJH 1ZHKA 2DYPA 4H26A 1NMAH 1MAML 2F53D 4LSTL 4U4BA 4ZFOL 1EHLL 4R7DA 3FQUB 4K23L 2XTJD 3KHOA 4OZFB 4LLMA 1G9NC 5J06A 2GY7B 3ZYJA 1VCAA 1IGIL 1MEXH 3FONA 2XN9D 4L4TD 2XQYG 3UPCA 4EI6A 3HCVB 3MV01 1E4WL 5CBAB 5HI5D 5AG9A 2CIKB 5FYJH 1PSKL 2JCCB 2ZG2A 5LWYH 3CDCA 2YD4A 5L2KA 1B4JH 4I0PB 1UWEL 4WI3A 1QFHA 2FHCA 2OJZH 4X4YA 3LEXB 5L7XH 1ZK9A 3IGAB 1W72B 4LDEB 3AC0A 1LNUB 5HYQA 4ZO8A 5I8KH 1JGVL 1KN4L 3VFPB 1NFIB 3JWOH 3JWDH 2BJML 3GJFH 1DBAL 1MWAA 4B41A 4LCUA 5TQ0L 1RZ7H 1OLZA 2VC2H 4L8CA 5EUOA 4KROC 5HDLA 1T22B 1IM3A 5JHDD 4OFYA 3CXHJ 3KPRD 3HNSL 3IU4L 3VWJB 4GFTB 1IBGL 4MVBC 4IOIB 1DUYA 5DUPH 3ARGC 1NCCL 2VDNL 3GHBH 2FB4H 4ELME 3OAUL 4W6YB 1HIML 5DUBB 2P24A 3WN5C 1UA6L 4TVPE 5SWQB 3RWJB 3OAYH 3PXHA 1QG3A 3ZO0A 3O41A 4JFEE 3CK0L 5C0JB 1X5ZA 5T3ZD 3IXTA 4EJ1C 5GGRB 1MQKH 4U6HB 1KEGL 5EDXA 2Y4SA 4Y4KD 5TE4L 4OCRH 1TPXC 5E7FA 3IJSB 32C2B 4RMSA 1J87A 4ZPTB 4MAUL 1SYSA 3D87B 2LAAA 1DVFA 4WY7L 1C8PA 2NTFA 3JUZA 1YEDB 1F4XH 1FN4A 1ZSDA 1FZKB 2PXYC 2WP3T 2R2HA 3SDCB 1U8MB 3TA3C 5IVNA 5J1SC 2DL2A 3WDJA 3O2DL 5GGRY 2CIIA 4KTDL 1NDMB 1EO8H 3PP3H 4NQXB 3HE6C 1S7RA 1KF9B 1VHPA 5D1XC 4ZS7H 5DO2D 2P5EB 1SYVA 3E1F1 4CGTA 5BRZB 4PGJA 1R3HA 3PABA 2CXKA 2W38A 4PV9A 3MROB 4UV4H 4ZS6D 2ADIA 4B0MM 4RNRA 3FCTA 3T4AA 4ZPVA 1ZEAL 2XQYK 3WIHL 2WNGA 5BOZG 4K3HA 4LVEA 1E4KA 1YYML 3HC4L 1MOEA 3FT3B 1X6LA 4NHCL 3AFLA 2YD9A 4M4RA 1N59B 5D2LA 4FQ2L 1N0XL 4WHYH 3TZVD 4AQ1B 4QRUA 1JN6B 4JFOB 2QHRL 1KELL 5CSBA 2J8UF 2FJGB 4V1DD 4HQQH 4XBPB 4D3CL 1UACH 3DBXB 1MVUA 5EBLA 1FO0H 4Q9RL 2LQRA 1OY3B 4M6NH 5FO9B 3EOAB 1LO2H 3KPNB 4P46A 3TC9A 4HIJA 4KKAD 4KQ4L 3LV3A 3H7BB 3VXSA 3MBXH 2YC1B 4N90E 5E5MA 5DK0B 3T0WA 1J12A 5I16A 2WBKA 3VA2C 3ARXA 3BOVA 2H2PD 3DV4A 2ICES 4J6RH 3RDTC 3IKCA 4P23A 1WTGT 1QYGH 1R5IA 2OM5A 1EEYB 1TVBB 1HKLH 2IPTH 4P9HH 4POUB 4U05A 5DMKA 3ZL4H 3MGTA 3OKNA 4K7FB 1FH5L 5KW9H 2NXYB 3MRQB 3O4OC 4MA1C 4QEGA 4IRJD 4HKBA 1SEBB 3BQUB 1GVIA 4IIQB 4M4PA 5J11C 3NCYS 4AJ0A 3ARED 3R4DA 3QUZD 4XVTL 5DEFB 1OW0A 4I18C 2LTQC 1BBJB 4QF1B 4M61B 1JZ8A 5ADPH 3DMMC 1QSEE 1CD1A 3Q6GL 1KPUA 1WWAX 4MQTB 3CC5A 4ORGB 4PP1C 4NT6B 4GSDH 3KLAB 3X17A 3HUJE 3D6GA 1NAML 4H1LB 4ZAKA 2RB8A 4JG0H 1IEBB 1XGRB 2WMPA 4U6YA 3WHXA 4NWUL 4QRQB 3PGFL 4MQXD 4PJ7B 2E7HA 4HUKB 4LCIH 4POYA 1RK1A 4J8RA 1F6AA 2UYLB 3Q6FB 3K80A 3BPCB 5E8OB 3VG0H 4JO2L 1CBVL 4LSQL 4Y5VA 1MJ8H 4P2RB 3MYZA 5ILTH 2C3VB 3LKOA 5E9DD 4IMKC 1UWXH 3MFFA 1MFBL 2WQRA 5IB4A 2UWEA 1F90H 1KIRB 1I1AC 4OM1L 3BI9X 4I77L 5FM5M 3WUZA 4BK4A 1CCZA 4FQXD 2ZOKA 1X5AA 3BE1H 1GL4B 1HEZB 3TP4A 3GMNA 5E6IA 4LKCA 1AJ7L 3DUUA 5GS1B 1S7TB 4PB9H 1XFPA 1KT2A 2YZ1A 2VISA 1MJUH 1A0QH 3ESVF 4QHNA 3ZDYE 5EO1B 3UTTE 3RJDA 2OR9L 4PJ8C 3I75A 5HHNB 4GAGH 5EO9A 2HJLA 1AC6A 5KSAD 1WBYA 1EX0A 4QXUL 2EDNA 1A02N 3IU3A 2R0KH 4UNUA 2EYTA 1JBJA 4PTTB 2APFA 2X70B 3PWPB 4KKBC 1N0LA 15C8L 1BIIA 3MRCA 4JO4L 4NQDE 5D1ZC 4G7VL 4KKLC 3RHWK 12E8H 4Z95H 3BPOC 5IQ9A 5IW3A 3WNMA 1S9YA 4DN3L 1OAXL 4OF5A 4FFYH 4NNPL 1QRNB 2BVQB 2OJEA 5AUMB 2VLRE 2NY5L 4WW2F 4HAFA 4HS8H 1IGMH 5JA9A 2ZG3A 5DK2A 4X99B 4Z7UA 4JQVC 1J1PH 2LABA 4JHBA 4HPOH 3E3QE 1OOAA 2YPVH 3CX5J 4EVNA 4NN6B 5D96B 2F53E 3SGDI 2XNAA 5I1GH 1V5JA 1TJIL 2D0GA 4YDLB 3D85D 4KROD 3KNBA 1X5XA 1H8NA 4Z5RA 1H3GA 3SE9L 1ZS8B 3BP4A 5DJYA 5C71A 1FNFA 4L4TE 1U0QA 3V6BR 4U31A 2BXYA 3VXPB 1FLTX 5A3IC 4QNPE 4P4KB 2CLVA 4HBQA 5GGUA 5JA8B 2F74B 2CKBA 3X12B 3BD3A 2FHFA 4GUPB 4UINL 5IBUB 1AH1A 5D70L 4OSUH 1GHFH 5JOFB 3OAZK 2SEBA 3R06B 4HW6A 4OZFA 2ERJB 4B7LA 5CJQL 1IT9H 3RUGB 1XCTA 3ZSSA 1IC1A 3HZKB 1MCOL 1RZGB 2VZVA 3HCVA 4UT7L 5CBAA 2C3XA 2CIKA 2VDMH 4JAMA 3IVKA 3UJIL 4M9PA 2JCCA 3KPRE 5FCUL 2PXYD 3MGOB 2NX5D 4I0PA 5D4QA 2VSDA 3TA3D 2VDQL 1S7QA 1A6WL 2FECI 4DQOL 3IGAA 1W72A 5CZKA 1LNUA 2A6IB 2I9LB 3CVHB 5D1XD 1RULL 3F7RA 3SDYL 3VFPA 1NFIA 4MQSB 5ECJE 3FQXB 4YQXH 1HHIA 3BN9C 5T3ZE 4GLRH 4OQ1A 4ZO6A 4NWTH 1J0JA 4L3EB 5CAYB 5D5MA 2FYYB 2PN5A 1U8IB 5EC1A 4L9DA 3TH4T 2XQBL 2H3NB 4IOIA 2BRRL 4KK8D 3O2VL 4N1CA 4AEHL 1Q9KA 3SJVB 2BSRB 3I84A 3N1QC 5SWQA 1INEL 4WEBL 1PG7L 1P6AB 1Q72L 1PEZA 1URLA 5C0JA 2NY5C 2B0SL 4U6HA 2BERA 5LXGL 1HKFA 3MJ7B 1SJXA 1FVEB 3AGVA 32C2A 2CDFB 4ZPTA 1I7UA 1R5VB 2EDYA 3WBDA 3NCFB 1YEDA 3L1OH 3L3KB 5IV2A 3QAZB 3BFOA 2BNUA 3DURB 1I1FB 4LIQL 3OSKA 4JFYB 2DJ4A 5FDWB 3MNWA 5I1KL 3RDTD 3CLEH 1NDMA 2E9WA 4L8SC 4DKEH 4NQXA 5D7IE 4YWGL 3GMPB 4ZD3L 2P5EA 2VOTA 2X89A 4DK6A 4PJXF 2BMKB 2VIRB 3LD8C 3GBMH 2VO5A 3OBAA 4IS6B 5DI8B 3ARDB 4QRPB 2W9DL 4JKKA 4P9ML 1IMHC 1RIUL 4XPTH 4JKMA 1I9EA 1G9MC 3QDGA 1NFDE 2P5WA 3VGGA 4G6KL 3DMMD 5AWNL 5IOPA 1MCEA 4YE4L 3RU8L 1NMCC 1KSRA 4PP1D 3U0PB 1N59A 3IAPA 3TJEL 3BKMH 5HGDB 5DD3L 1T6VN 2OL3L 3OKMB 4JFOA 3IDXL 2GSIA 1PFCA 3PWLB 1KBGH 4OZIB 1FL6B 4DUVA 1IEAA 2FJGA 4NQUA 4ZOCA 2EDEA 3BHBB 3DBXA 4RDQF 1JFQL 2AJUL 1ZANH 4KDVA 5FO9A 4OUOA 4JFDA 3KPNA 4RSVA 1EXUA 4I3SH 3MRKB 2DQUL 2W60B 3H7BA 2AEWA 3CDGB 2YC1A 3UROR 1LK2B 2YA0A 1F6LL 4OZHA 4RMVA 2I27N 4X9BA 5EOTB 2MTPA 5DMJB 1F00I 3FQRB 1I1AD 3IDNA 3OZ9L 5F9OL 2LVCA 5KOVC 4R26L 1FE8L 2PO6C 2GQHA 1EEYA 2LAGB 3ARSA 2P49B 2ZNXA 1S7SB 4X5WA 3MRQA 1Z5LA 2X4RB 1SEBA 3BQUA 4IIQA 5FUZH 1N6VA 3NIGE 5EU6D 4AM0A 2VAAB 4GOSA 5DEFA 4PJ8D 3S37L 4R97C 4M61A 3CCHB 5IBTH 1BJ8A 5JLZB 4PJIB 4OIIL 5ESVB 5E9DE 2VAJA 1BVKA 4ORGA 2P43B 4I8DA 3BW9B 4NT6A 3NAAL 2PW2B 3UBXI 3KLAA 1A3LL 4PV8B 1LP9F 2JELL 4H1LA 4G8FB 1NCAL 4KKBD 2L7JA 4J12A 4RAUB 3AUVA 5F7DA 3U0WH 4QRQA 5D1ZD 4FQQB 4KJQD 3S36X 4PJ7A 5ANMB 4KKLD 1V05A 3L5WA 4ZDHB 1D7FA 4G6MH 3B6SA 4PR5B 3FRPA 3BPCA 3VFOB 5E8OA 1K4CB 3BESR 2AV1B 3WIFB 2XG5A 4P2RA 5D7JB 2C3VA 4JY6B 5GS3A 3WFHB 5D7KD 1CICA 3G6DH 5FHAH 4XCCH 3ZYIA 1QBMH 2IPUG 1NGPH 5DWUH 2BNRB 5DSCA 1Q0XH 3EDFA 1QNZH 2WWKT 1AQKH 3ORJA 1BM3H 1ZA6B 4HCRH 1BZ9B 1HEZA 4A2MA 3QIBA 4Y4FA 4OZGF 1HI6A 4N9GA 2DQEH 2J1KA 4NC1E 1FC1A 1BOGA 3VD7A 2X4QB 2WSKA 2F19H 2JLLA 2VWEE 1JWUA 4TUOB 4JJHA 1CG9B 4QXTA 4Z7NF 5EO1A 1Q8MA 2A83A 5A3ID 2BY0A 3QZWG 5C0EA 1J18A 3SKOB 3FB7B 4HWBL 3QUXC 1S9WB 1H8SA 1HHJB 2X70A 3PWPA 1WZ1H 3W0WB 2BY3A 5C92A 2V5TA 4XZUB 3LKNB 1GGBH 4JCMA 1UYWH 2LVEA 1A3RL 2OTWB 5C3TA 4OUUB 2MQ3A 4QYOB 4MA7L 2J8OA 3VRLE 4FA8A 4Q6IB 3L3HB 4Z0BH 1AI1H 5AUMA 1QLRB 3ARZA 4X9IA 3MV7A 3CH1B 2WBJC 4DWHA 3S5LG 3C5SB 4P2QE 3MBED 1XF5B 1YPZB 2JJTC 1J1XH 4I3RL 4X99A 4HG4K 4PFEA 4QRRB 1PD6A 3IS0X 4JDZB 5CP7B 4CN6A 3BN9D 5DA4A 1PKQA 3G6JA 1L7TL 3QHZL 5DA0B 1XGQB 3MTRA 3O4LB 1D9KB 1RVFL 1ZS8A 2HP4A 4KUZH 3FFCD 4G9FD 4CW1B 2HFGH 2F8OA 4ZNCD 2AXHA 4OFDA 3LN4B 1JF5A 2OI9B 5JW5A 3BT2H 3VXPA 2FO1A 4RIRB 2NX5E 1KCRL 2F74A 3O9WA 3X12A 2IPUK 1KEML 4GUPA 5H94B 5GJTH 2YBRB 4O58L 1MCFA 5D71H 4OT1L 5JOFA 3F62A 2R1YB 3R06A 2GHWB 3IKKA 2EIDA 2C9AA 1U41A 3KVQA 3NPSC 3RUGA 1MWAL 4XPGH 3HZKA 4HLJA 4J3OC 1RZGA 1MCCA 4IRSC 1T1XB 4QOKA 4O2FB 4CUCA 3RL2B 3MGOA 1NC2A 4TQEL 5EA0H 4LSUL 2J88H 4DUXA 1D3CA 3JV4A 3MNZB 1CXHA 4NBXB 1TCMA 4M48L 3H9SD 2A6IA 1JUFB 2I9LA 3EYSH 3CVHA 3IDYC 3RNQB 1PJ9A 4X6FB 1P84J 4FP8H 5J1AA 4DEPC 1KENH 4XPFH 5AG8A 4JM2B 4ODSL 4PY8I 2ITCB 5HHME 4CMMB 3SDXE 2F54B 3STBA 4GG6E 1U8IA 1A6TA 3FOMB 5T1DH 4RFOL 3MCG1 1H3VA 2H3NA 2Q3AA 3MXVH 3HZVB 2J5LB 1VFBB 3KJ6L 4XP1L 2BSRA 3SJVA 3WNKA 5L88H 3KPQB 1NL0L 3GNML 4F7CB 4HCRA 1M4KA 4X6CF 1RMFL 5HI4C 4PJFE 3QYCA 3G5VB 3BUTA 4JFZL 4XMLL 2X4UB 1YNLL 3D69B 4M5YL 4Z77A 4OZFG 3MJ7A 3IRPX 4XPHH 3VFRB 3PHQB 5BQ7A 1FVEA 1AO7B 2VDKL 1F2QA 1NANI 2CDFA 3GK8L 2AJVH 4HLZG 3SCMB 1BJ1J 1YY8B 5DUMH 4Z9KB 2EYRB 3M8OL 4NJ9L 4LOUC 4WUUA 3DURA 5DD1H 1JWSB 3QT2A 4JFYA 2AKRB 4OD1L 5FDWA 2QQLL 4NN7C 2VTFA 4HGWA 2W9LA 2PO6D 5DTFA 3S3JA 1JNJA 2Y6SC 4CU7A 1YJDL 2D2OA 4RWYL 1QOKA 4JZOB 3WLWC 2VIRA 5I8OL 4IS6A 5DI8A 3CSGA 1T2JA 4QRPA 5DC0A 2AXFB 3PWVB 4LGRB 3QEGH 4L9LA 3H7LA 1CLYH 4NNYB 2AJ3B 4XGZA 4LP4A 2VJXA 1F3DJ 4MJ2A 1BFVH 4UQ2A 5E4IA 2E7MA 2PYEB 3U0PA 4ONOA 5MEQB 1NCBL 4X6BB 2GAZA 5L9DL 1JZ6A 1QVOA 3OKMA 4FQ1L 2AK4D 1QSZA 1FL6A 2K7PA 1EVUA 4HIIB 5DS8A 3TH3T 4S1QH 2QL1A 3IDJB 2NY4C 1G6RB 2VL4A 4F9PA 3C2AL 4MCZB 1AD0B 3MRKA 2OX5A 5ENWB 2OJZL 2Y36H 1P4BL 2YPLB 1XGTB 1F58L 1LK2A 5L7XL 3UC0L 5KTEL 2P48B 5D8JH 5EOTA 5I8KL 1A7NL 3FQRA 1MCQA 2I60H 5DGRA 5SWZB 4ODHH 3K4ZA 4FFWC 4OI9A 3CSBA 3LS5H 4P3CL 4JR9H 1RZ7L 4Q58C 2G5BB 2VC2L 2H41A 3O3EB 3QXTA 5DLML 4PJDE 1J05B 3BKJL 4D2NA 5K9JH 5F93C 1FCGA 1S7SA 4ENED 5HVHC 2X4RA 1UJ3C 2NW2A 3I85A 4OLZL 5DUPL 2ZSWB 7FABH 3UJTL 4WWID 3DECA 4GO6B 4X8JB 2DQFA 1S5IH 1PYWB 3LQZB 5JLZA 3QIWC 3D3VA 4PJIA 5ESVA 1U3JA 4LSSL 5IB3B 3S88H 4LCWE 2PW2A 1MQKL 3KYNB 1FBIL 1MI5B 2P8LB 3U0TB 5E1HB 4ZUUB 1PZ5B 4F9LA 1E4KC 2GJZB 5DJAB 1LE9B 3MUY1 2F5AH 3H42L 4JDVB 5BMFH 4OLYL 3SGJA 1ZHLA 4FQQA 3D9AL 5ANMA 2Z8WC 1T3FB 1UWXK 2D9QB 4UOW1 4PR5A 4YXHH 2NZ9C 4OAWA 5ACZA 2AV1A 1KB9J 3F8UB 3HI1A 5F6HJ 4G3YH 4JY6A 3WFHA 3GSOB 2WBJD 1CIUA 1V8HA 1T89C 4XC1L 4OZ4A 4ZS7L 4GRWH 1I8MB 3ARBB 1A6ZB 5KN5B 2BNRA 4JO3L 3QNXB 1EDQA 5C07A 4WDIB 1CDIA 1BD2D 4MNGE 1V7NH 3ETBF 2VH5H 2VR5A 1BZ9A 4UV4L 2Z93B 5FA3B 3CH8A 1TITA 1RZJC 3GSQB 1NCWL 2X4QA 2VZTA 3KGRA 1QBAA 5FK9B 1RZFH 4PTUA 5I1JL 3K46A 1OSPH 4LRNL 3E8UH 3OKDA 5E94B 1G7QB 3Q2CA 4YHNB 2BHZA 4GAJH 2BHUA 2HH0H 3LRSA 5E08H 3GMLB 3QUYC 4H1LG 4J4PC 1I1CA 3QJHA 3NFSL 1S9WA 5F7KC 1HHJA 4M6NL 3GZKA 4XZUA 3FB6A 3LKNA 2GUOA 1R3IH 2Q6WB 1JHLH 4WVRA 5I6XB 5CIPH 3OGOE 2OTWA 2ZUWA 3FRPG 4OUUA 1K85A 2MQ0A 5CP3H 4QYOA 4ZAKC 2IANE 1LEGB 3FRUB 4G9FE 2ATKA 5EU4B 3THML 5BXFB 1NBZB 3KPSB 1N5YH 4Q6IA 3L3HA 1KXTB 1QLRA 3OHXB 3CH1A 2HRLA 1H15A 1X5FA 3OKEB 3C5SA 3BPLB 1HCFX 1YPZA 2IPTL 4P9HL 1CD0A 4NDMB 3HG1B 4DGYH 3UYPA 4WJ5B 2WK2A 5MENB 5JIKA 1A14H 2C4FT 2CKBL 5FM4A 3KR3H 4KRNA 3ZE2E 3RX7A 4LVOB 4X7SH 3RFZC 1XGQA 4PJAE 3O4LA 2MPAL 1D9KA 2KZ1B 2V9TA 4D9LH 2EXWC 5TF1H 4CW1A 3SE8L 5JW3H 4XNXH 4U0RB 1QBBA 3SY0B 3JXAA 2AJYH 4C56B 5I17A 2HA1A 4UDUB 1WAAE 2CMRH 3HRZB 3U83A 1H3PH 3PGCA 4MXQC 4RIRA 4EI5C 4K3JL 5HI4D 1XF1A 2X7LB 1JI1A 4ZTOH 4KUCF 5HHPB 3D5OF 4B5EA 1W72L 2EE6A 5D2NC 4L4VB 3FHQA 4UDTB 2R1YA 3VXOA 3RWIB 2ENSA 3TWCL 2FZ3B 3VG0L 1KJMB 3V5KB 1HHHB 3WLBB 1MJ8L 5CJXA 5CJOL 1U9KA 1T1XA 4ALAH 3ULUL 4O2FA 4Z7VB 4LOUD 3RL2A 3L6FB 1U8JB 4TSAH 3TIDB 1NC4A 3OX8B 3C60C 3MNZA 1ES0B 5IVXB 2E8ZA 5F3HB 2VE6B 3RNQA 5BCAA 5LGHH 1YEFL 4PJHB 4X6FA 1IFHL 5IJVA 3U4BL 3I3EA 1Q0YH 2CH8A 3WLWD 2VZSA 1PX3A 3DUSA 4GQPH 1MJUL 4WI6A 4KGJA 1T1WA 3LQAC 3AM8A 3I50L 4K7PY 3FOMA 4GAGL 4LVHC 25C8L 2X9XA 3HNTH 3QI9B 4P5TA 1CDYA 5GJSH 1HQ4B 3HC0B 3QA3B 5IVOA 5DHVH 4R4FL 3ZHKA 4K3DL 2R0WH 3ARPA 1XAUA 3QEQE 4OFYD 4ODTH 5IBUG 1JYWA 2X4UA 2GTWA 4YIQB 5GRJL 3OMZA 1KCVL 3D69A 1JCKA 1HSBB 1ZVSB 2VZUA 1FFRA 4GW5A 3D0LA 2BOBA 3VFRA 3PHQA 3RWHA 1AO7A 3NMEA 4JZJB 4Z95L 5EORL 5KS9F 2H2SC 2VLLA 4BSWA 2NY4D 1QFPA 4NRZB 3GDBA 4JPVL 1AC0A 4MAYB 3SCMA 5ICXA 3SDDB 1YY8A 4NPYB 4CDHA 3GRWH 2EYRA 4Z8FH 3HS0B 1NJ9B 1JJUA 1QLEL 4YHOL 3T3ME 1IGML 1R5WB 2R29L 4JY4A 4NKIH 1JWSA 1T83A 3UTSE 4FFWD 2YPVL 4BELD 5I1GL 3ZHLA 3RA7H 4MNQD 5CP3A 1WK0A 4LIQE 5FV1L 3LKSB 2AK4E 2FEEL 3CXHK 4OZIF 3H0TB 3N0PB 5IMOB 1OB1B 2IBBA 3MZGB 3TLRA 2W0PA 1X4ZA 5FYKH 3KG5A 5C09A 2AXFA 2I9TB 1FNAA 3PWVA 2DIAA 4QHKJ 1YEJH 3U1SH 3K4AA 3DO7B 3GI9H 3QIWD 1BBDH 4JN2B 3PQYE 1HN1A 4U2ZA 2PYEA 3MODL 1N8ZB 4PJ5E 4OSUL 2EKJA 3VWJC 1JGUH 4TUJB 2FCBA 4HIIA 5LCVH 1HDMB 1P7KB 1DQDH 4ZNEA 5KVFH 3RHWF 3RPKA 3V5DB 3MR9A 4OGYH 3GSNB 5B39B 2PUQT 3QDMD 4MCZA 5TGBA 2FX8H 5F7LB 5B8CB 5JNYB 1C1EH 5ENWA 2J8UE 3X3FH 1BJ1H 2YPLA 1J86A 1XGTA 3MX0A 3I6KB 4MJ5B 5LBSH 4JCLA 1S9XB 2HTLC 1CR9H 5C08E 1MFDH 4JFHD 3EJZC 5JQ6H 3O3AB 5SWZA 3ALWA 4P2OC 1OCWL 3WKNA 4G8IA 4NWTL 2ZUQB 1J05A 3SDCC 4U49A 1VPOH 1OT2A 4KK5C 1G84A 1MVFA 1GYAA 4I4WA 3NA4A 4JFXB 4DGIL 2ZSWA 5HJ3B 1YMMD 1AGFB 1JRHL 4QLRA 4M1DH 4X8JA 1WICA 43C9B 1OD9A 5A2KH 4YZFE 3ILQC 2MMXA 4OKDA 2J12B 5I1IH 2VXSH 2AEPL 5D7LA 3IFLH 1YNKL 3KWWB 5ID0B 2FBJH 4Z7WF 4G9DB 3QUYD 4J3WA 3KYNA 1MI5A 2P8LA 4J4PD 3U0TA 3MNVB 1DBBL 4ZUUA 1IVLA 1NMBH 2CLZA 5DJAA 1LE9A 5C0FB 2BY1A 4FXKB 4JDVA 4Q9QH 5FHBH 3FTGB 4WHTA 2KL6A 3P77B 5T5FL 1T3FA 4PJGE 5DHVA 2VUOA 5DQJA 5C0AB 3U7YH 2ZPKH 2Z31B 5GPRA 5D1QB 1VDGA 4KTEL 1NPUA 1DBKL 1I8MA 1QSEB 2MSPA 3ARBA 1A6ZA 2HVJB 3QPQC 1YEGH 5KN5A 1VKXB 3QNXA 1UCBH 3VXUB 4UZGA 1NCTA 4WDIA 3PL6B 4NO0D 3GBML 5I15H 5D6DA 3GRWA 2Z93A 4N0YH 3VCLB 3ZLQC 1VACB 5IQ7L 1CE6A 2C3GA 4L29B 4UQ3B 1MSPA 1W0WB 5FK9A 4YAQB 2P42B 5DFWH 1ZV5A 3ELAT 2NXYC 5F7EH 3CFDB 5E94A 3BKML 1G7QA 4MXQD 3VXME 1AP2A 1WF5A 2B1HL 3BQUC 1UT9A 1B6DA 4EI5D 2YZ8A 4I2XE 3CIQA 4P5MA 1Q94B 3BZDA 3GMLA 5EUKB 1T2QL 1F97A 4JG1L 3KDMB 5HHXH 2G60L 3TF7C 5GGSA 2DTML 1K4DB 4XVJH 4KVNL 4TVPH 2Q6WA 1CGXA 3GI8H 1MFCH 4NKOB 1KCSL 1LEGA 4PJCB 1LEKA 1T7YA 3VXTA 5EFIB 1FNLA 4YHLL 3FRUA 5EU4A 1KJ3L 5BXFA 1NBZA 3KPSA 3BYTA 1TZHB 2N56A 3TO4A 3PIQA 1U95B 4DKFL 3OHXA 3IDUA 1AR2A 2ICWJ 3C60D 3FT4A 2XYCA 4LSPL 2ADJA 4NDMA 2R2CA 3HG1A 2DBJA 4WJ5A 5MENA 4PRBB 5C0CD 3H8NA 4KZEH 1PBYA 3QNZB 2FBOJ 2Z92A 2OTUA 1N3NA 4HWUA 3QUMA 3OR6B 3QCUH 3EJYC 5CGTA 1J9CT 3DXAD 4F57L 2UUDK 4U3CA 4UDUA 1CD8A 1F4YL 1SJHB 1WIOA 1FYHB 2IMNA 1T0NA 5GS1C 5IEKA 3D2UA 4S10A 2QSCH 4P4RB 1A6UL 1H0DB 4YBQC 4WEUD 3CLFL 3U0WL 1P7QB 3EAKA 3QRFM 4L4VA 3CVHL 4ZG1A 2PKDA 3MV11 3CFEA 5E2VL 2H2SD 2PTTB 2FZ3A 3GJEB 1KJMA 3V5KA 5KVDH 2XTJB 3WLBA 3GSWB 3O45B 1J1OL 3P0VH 5E95B 5D7SH 4JRXA 4KTYA 3HLAB 4Z7VA 2XN9B 3VW3L 4C57C 3V7MA 3L6FA 1U8JA 4KDTC 5ALCL 3RWGA 4FABH 1ES0A 5EUOE 1AQKL 3CX5K 5F3HA 4HCRL 5CEYA 2VE6A 3U7WL 5GRXG 3LQMA 1PG7X 5I19L 4NGHH 3LSOB 1TJHH 3IAQA 2ILLA 5T5NF 5I1EL 1EHAA 3B2VL 1HOCB 3F7YB 3DVNB 4OCSL 3LN5B 3VFWA 4K71B 1AXSA 4EUPH 4NKDB 4NN6C 5D96C 1AKJA 2A6KA 3WD5H 2YPKB 3DSNA 4MA3B 3QI9A 5JHDB 4TNVF 4N0FB 2EKSB 3QA3A 5EBGA 4HKXB 4FZ8H 1X5LA 3VWJD 2RGSA 1WZ1L 3SE3A 4M7KL 4YIQA 2ZCLH 2F9BT 4M43H 5F7WC 1UYWL 4YJZL 4BFEA 4P4KC 4MNQE 3T1FB 4JZJA 1M7DB 2JTDA 2Y7QB 4MAYA 1ZGLP 4Y4KB 3M45A 4Z0BL 4ISVA 3HS0A 3KAAA 1NJ9A 2OQJA 4YK4B 2UZIH 2X4TB 3JV0A 2ERJC 5J12B 2A0LC 5D9SB 3VXRB 1L7IH 4ELMA 2HTLD 3EJZD 2BOCA 2DS4A 3NH7H 4OLEA 5JW4Q 4RX4A 4P2OD 3TM6A 4FS0A 4JFEA 3TV3H 5C0RH 3SDCD 3G5XA 3FOLB 1FG9C 4LEXH 2D7TH 3H0TA 4KK5D 2FD6H 3TIEB 1QHPA 5IHBA 3BZFA 1T03H 1HXMA 4Z7QF 5E70A 2I9TA 1PW3A 3QH3B 3K2UL 3QDME 3WO4B 4MB3A 1T20A 2VXTH 3T2NL 3DO7A 2QLVB 5MI0B 5BRZD 3P4MA 3ILQD 4JN2A 5GJTL 3K8LA 1PX4A 4JFHE 4TUJA 1IM9D 3S36H 1XIWA 2W1NA 2NY7H 5BZDB 5T1LD 3VXSE 5GGQL 1HDMA 3TZVB 1P7KA 4HMEA 4ODBD 1UZ6E 2AP2A 4V1DB 1HNFA 5JNYA 5E2TH 5JHLH 5EA0L 1YMME 2J88L 2WIIB 4C4KT 4MJ5A 3I6KA 3DV6B 4XB8A 5J6GB 1S9XA 4QXGH 3EYSL 3S37X 2DF3A 3LRGA 1KXQE 4X9FA 5CZVH 1FORL 3BD5A 3BXNB 1JF6A 4TULH 4X9GA 1N6QH 4TTGA 3SGDH 3QAZC 4POZC 3V4UH 3UJJH 5DJCA 2CUHA 1JNHA 5C7XH 4JFXA 3MXVL 5HJ3A 5HXMA 1AGFA 2BP3A 5IESL 4X80H 3UMTA 4LLVB 3GM0A 5GSRB 1MIEH 2W65B 2FGZA 3AAZB 2GY5A 4TPRH 4OFKA 3QUZB 1H9VA 3ARDC 4YDIH 4L1DA 3KWWA 3ZDZE 5ID0A 4G9DA 4EQ3A 3Q5OA 4XPHL 1IAIL 2ARJB 5L0QC 5EU3B 4FXKA 2AJVL 4ZOBA 3WHE0 4JHWL 4JKPL 1A7RL 2UWEE 3P77A 4L3AA 4PJ9B 2X40A 4XVSH 1OT1A 3PDOB 3D39D 4ZUSB 1CLCA 1D6EB 3ME0A 5LKNA 5EPMB 2CLRB 2Z31A 3V52L 1SM3L 5D1QA 2PR4L 1TIUA 2DQTH 3BP7B 4F9PC 2V5SA 2DDQL 5DVOA 5EO0B 4I3GA 1QSEA 5JW4M 5E9DB 3BDYL 2OK0L 3I02B 4P2RD 2YA2A 1DQLL 3PL6A 4LLWB 5A16B 5D2NE 2VZOA 4WNQB 3AROA 2DD8H 4FQXB 3ZKMC 3AMKA 4FZEL 1WFTA 1T7WA 5BV7B 1KB5H 4YUEL 3EJYD 2VXUL 4UQ3A 4CVZB 1H3TA 1W0WA 2C7UB 4YAQA 1WV7T 1BFVL 4GBXD 5CEZL 4U6XB 3MMEA 5B22A 5T3ZH 2XWJA 1FDLH 4QTHB 1R3JB 2KZWA 4IMLB 1SY6H 3H3KA 4HJ0D 2QJDA 3BPNB 3MCLL 2R0ZH 4X6EB 1FIGH 1Q94A 4YBQD 2YN3A 4O02H 5KSAB 5EUKA 4MJ6A 4LSDA 1I4FB 2P8PB 3N1MC 4HX1B 1TNMA 5E8NA 5C0CE 1K4DA 1HINL 2CDEA 1VGKA 3S34H 3P0YH 4M1GH 3AS1A 5EZLA 5E8DH 1MHCB 1D5MB 4LARL 4N0CC 4S1RH 3RL1B 1N7MH 4Y8AA 1QFUL 2Y36L 2B4CC 4NKOA 2HJFA 4G6AD 4PJCA 4JGJA 2XZZA 4Z7UE 1CFQB 1XR9A 5D8JL 1TZHA 3B9VA 3MRNA 4Y8DC 3UTTA 1U95A 2XRAH 3JV6A 4KI5F 5I76B 5KAQG 4HAGA 3R8QA 4K9EL 5HI3C 5DT1H 1YC7A 5IM7A 4NZUH 1INDH 2LE9A 4PRBA 2XICA 3VDCA 2L0DA 5F7YC 1QRND 1XF4B 5D7JC 4PG2A 4AMKL 1SEQH 3QNZA 1P69B 2IADA 2IF7A 3H3BC 3BIAX 1JZ3A 3AMLA 3OR6A 4PUBL 2P45B 1S5IL 2VDPL 1M7IB 3E6HB 3HMXH 4K8RL 5BW7C 1JI2A 3SPVA 4BJLA 4HPYL 1SJHA 1TDQA 3STLA 3UAJC 2IWGA 1U8QB 1UEYA 4ZOAA 5CGMA 3KPMB 3QFJD 4G80B 5IEHB 5IVXF 1WITA 1W0VA 1P7QA 4LKXB 5E8EB 3HNVH 3LKPB 5ISZB 2JCCE 4PJHF 1UH3A 3UYRH 4NQCB 4P4KD 5B38B 4KPHH 2F53A 2PTTA 3BRGC 1XZ0B 4ERSL 3GSWA 4YGVB 1FNGB 1ZXQA 4G3YL 5EZIL 1ZLSL 3MUHL 2AS5M 2V2TA 3HLAA 4L4TA 2XN9A 2B2XL 3D48R 5DMGC 3REWA 4GRMB 2COQA 4FQIH 3H2WA 1II4E 3PHOB 3MJ9A 1DUZB 2H32H 3HMWL 2EEDA 4AIZB 3ULUE 2HKFH 3RVTC 3TA3B 4Q6IC 3LSOA 3QBTB 3AS2A 4YHIB 1MNUH 1YC8A 1HOCA 4KUCD 3CMOH 3DVNA 3LEVL 1RZFL 2IG2H 4U0QB 4K3EH 1MIMH 1OSPL 3F58H 4RRPA 5TDNA 4XWOC 5LG1A 1JNNH 4BQ9A 4LPYA 2V17L 5JHDA 2EKSA 4QY8B 4L3ED 5C0NC 5E08L 1D9KC 3MSPA 4BZ2L 1JHKH 1S9KC 2YSSB 1M6OB 3LKQB 4HMCA 3V0VB 1R3IL 4M6ML 4JN1L 2OI9C 5TQ2L 4ODUB 1HSAA 3WIIL 3T1FA 3WFBL 3SQOH 1N4XH 3GMMB 4QRTB 4F8QA 1A47A 1M7DA 2DKUA 2A1WL 3MOAH 4UT6H 4ZFFB 4Y4KA 3NFPB 3N85H 2MNUA 4WUKL 4EN3B 2FHBA 3VD9A 4MD0A 3LKRA 4OBSA 3QQ4A 1MPAH 2G5RA 4YEFA 1VESA 2P5EE 3GB7B 1U8LA 4DGYL 2EC9T 1MHEB 4ZUTB 1P84K 1OSZB 4HBCL 5BRZE 1KIUA 1LK3L 4LCYA 4WTZA 4C83B 2BSED 5ERWB 4POZD 4YC2B 2BVTA 5DQDH 5KSBB 5DVMA 1GC1H 1T1YB 3TIEA 4D9LL 2DQDL 5GHWH 1F3JB 4XNXL 4HS6A 3OXRB 3GMQB 3MO1B 4PS4L 3UO1H 4WO4B 4JM2C 5EU5A 1QP1A 1C7TA 1CFVL 1U3YA 1U8PB 5IKCB 3LY6A 3SN6N 3ARDD 3EDEA 1CDGA 4XXCC 1G9NH 1CT8B 2A77L 3AM8C 4HHAB 3NZHH 4WWKB 2CPCA 1DDHA 1TLKA 2YRLA 5GISH 2WV3A 3QP3A 2J5LC 2HVKB 2FEEI 3NIDE 3TZVA 4KJPC 4PRID 1CFSB 3EO1A 5MEOA 3EOTL 3M1BB 2E6PA 1HHKB 4V1DA 5GS0C 1OAYH 4NFDA 3I9GH 2V5MA 2WIIA 2X1XR 4WFGD 1DQJB 3RY5A 1DBMH 3DV6A 5EU7C 4AL8L 4ZFGH 1GXEA 5J6GA 3VXNB 5TE7L 5LGHL 2XV6B 4UNVA 1A7BA 2YHGA 3GFUA 3SCMC 3MRPB 4OQTH 4ONHA 4RGOH 1BQHA 3BXNA 1Q0YL 1I1AB 2FEDC 2IQAB 1I85A 4UU9B 2P4AB 4B7IA 1DQMH 3R0NA 4JPKH 4GMSL 5DRXB 3ZKMD 4S1SH 2HG5B 2AK1L 3HNTL 1RUAL 1A1OB 1FNSH 4IRJA 4KV5F 3BEVB 3L3IB 1BX2B 2ICWA 4NKQB 5GSRA 2R4RH 2W65A 2ORBH 3AREA 3BKCL 3MJGX 4ODTL 3QUZA 5EU6B 3TCXA 1DANT 1FHGA 2YXFA 4LPWA 5CSGA 4XNMB 4PJ7E 3RI5K 4MHHG 1T04A 2ARJA 1NSNH 1QTYT 1ITBB 5EU3A 1MREH 1MCDA 4P2RE 4WEMB 3NIFF 4J3XA 2EDBA 5B39G 1JRHI 5FGCB 3GRWL 4X0KB 4Z8FL 1PEWA 4M7LL 3EW3B 1WZLA 1ETZA 3PDOA 5C0DA 4ZUSA 1CTOA 4NKIL 3CX2A 3UZQA 5EPMA 1RJLB 2CLRA 3Q3GB 1I9JL 5EO0A 4KAQH 1EEQA 3FAXA 1MAMH 4LSTH 5HI3D 2PF6A 5E9DA 3MLYL 3I02A 4K23H 5F9JB 3T1WA 5D7JD 4IRZL 3MYJB 5HPMB 4LLWA 1C5CL 2ADGB 5A16A 1IKNA 5FYKL 4WNQA 3F6LA 5HHOD 1KTDA 4FQXA 1PY4A 3KJ4B 4NQED 5CZXC 5IJKC 1MFEL 3B5TA 4F33A 3U1SL 2AVGA 5F8QC 2C7UA 3GI9L 4BSVB 5BVJB 1UWEH 3V6OC 4I13B 2RFXB 3Q1SL 4LHQB 3PWPE 2R0LH 3N1FC 5HGBB 3UAJD 4U1GB 1KN4H 3ROOB 4HIEA 2NTSP 4IMLA 4X6EA 4LEOA 3PP4L 3V5HB 4Q97A 5KSAA 1CLZL 1V3JA 2BJMH 1I4FA 2P8PA 1DQDL 4HX1A 1P53A 5EC2B 1ZLUH 1WQVT 1QRNE 4OGYL 3RX8A 3T0BA 3I2CH 2FX8L 1MHCA 1NANH 4M9OA 4HWEL 1AXTL 3HNSH 3RL1A 1A1NB 5CJ5A 1KB9K 5I75B 4NJAL 2ZUUA 2VDNH 4XCYB 3QUML 3IS1X 5JZ7C 1HIMH 5LBSL 5F7NC 3B2UC 1MFDL 1UA6H 1D5IL 5DJ8B 3W0WD 5DMGD 5CWSA 4KQ3L 5I76A 5A1AA 2NY1B 4CVUA 4J23A 1LWRA 2Q3ZA 1JYNA 3CK0H 4UTAL 2QSQA 1X5YA 5CEXB 3RWFA 4M62L 4D8PB 1KEGH 3BO8A 1ZVYA 3QISA 1A7OL 5AZEL 2Y06L 5TE4H 3CPLB 1FZMB 1P2CB 3MBEB 4KK6C 5FA4B 4MAUH 4M93B 2KBGA 1S7VB 3ARBC 5HHVH 4WY7H 3KPOA 5FF6B 2C1PB 4QRRD 4P57B 1D5ZA 4XWOD 3MLSL 1FFPB 3E6HA 5D6DC 4MDJB 2IFFL 3C8KA 3IFLL 3FFCB 3GUTA 1CI5A 3O2DH 1WC7B 1PLGH 4YHKH 5C0ND 1UCTA 1JL8A 3CMGA 4U1NB 3RUGE 1NMBL 3QQ9C 3KPMA 2XA8H 4G80A 5IEHA 3JWOC 4Q9QL 1U8OA 3FN0L 5E8EA 4HKJB 4H0IA 3BZEB 5IB1B 4MQ7B 4NQCA 4PJBF 5B38A 1O7SA 3ULVL 1NAKL 3FAWA 3F5WA 2NCMA 4ODXB 1QFWL 4XNQB 1XZ0A 1ZEAH 2E8YA 4PJAB 4XNUH 3WIHH 2ARWA 5DJ6A 2ZPKL 4W68A 1YYMH 2CJUL 3HC4H 4ETQA 5HHQB 4DJMA 4XAKE 4GRMA 4ODWB 4KWUA 4JPIA 1MAJA 1N0XH 4FQ2H 4YX2L 5FCSH 1S78C 4L3EE 3MA9L 4DUWA 1OP5H 4GAFB 2PXYA 3BGFB 1KELH 2NX5A 3O6MH 1U58A 3IFOB 3TA3A 4D3CH 4Q9RH 1UKQA 4YHIA 3EGSB 1I1YB 3H9SB 1WWBX 3MQIA 3HR6A 4GH7B 3GIVB 5D1XA 5CBEB 3BPLC 4KQ4H 1JYXA 4L5FL 5TH2B 3LD8B 3HB3C 4X7TB 5F1NA 5F7EL 3ES6A 4JM2D 5J0BA 2Y5TA 4LVOC 2I25N 2F54D 4OFIA 2VZ1A 1M6OA 4U0RC 4XVJL 2D03L 1FH5H 2AXGA 4KI5C 3V0VA 3VFSB 3QUKA 4U1LB 1K2DB 1N64L 4FQLH 4ODUA 3JTTB 4QRTA 1NGZA 5K9KA 4HFWB 1P1ZB 3SDXA 5GS0D 4PPTA 2CGRH 2EIZB 3NFPA 4JVPA 4TSBL 2B1AL 1IQDB 1FL5B 3ZE1F 1AXIB 2Q8BL 2WZPD 3NPZB 5E2WL 1AO7D 1I9RL 4LNRA 3GB7A 2QEJA 5ITBL 4NM8H 4ZUTA 5EIQA 3ULSB 1OSZA 2E6QA 4WV1B 2HTKC 2IGFL 4KZEL 3KYOB 1NAMH 4NRYB 3UTPE 5JXAL 4RZCB 4C83A 1EBAA 4PJFA 4QRPE 4A2LA 4F58L 2FEDD 4NWUH 3DHJA 5ERWA 3RDTA 1JGLL 3PGFH 4YR6B 3FJTA 5KSBA 3QRGH 3MRDA 1T1YA 2QR0B 5MEPA 1QR1A 4HULB 4FFZH 3JWNC 3U48A 4JO2H 1CBVH 4FFVD 1MRDL 3OXRA 3EYOB 3GMQA 3C6LC 2CQVA 4EXPX 3G5YB 1J5OL 4OZIE 4BH8B 1U8PA 2F58L 3ZTNL 4I77H 2X2YA 4I18A 4LVNB 1U8NA 2DM4A 2BNQB 1I7TB 1RUML 4OJFH 3T04D 1UB6B 2HVKA 2PTVA 2ZJSL 1M71A 2ZCKL 3M1BA 2J7LA 2AK4B 2Q20A 2VLJD 1HHKA 2CKNA 2I5YH 4PY7A 5DJXB 5AYUL 5HPOA 5M7QA 4Q2ZB 1JE6A 4FABL 4QXUH 1XF3B 3VXNA 2B20A 3DX9B 4MAYC 2FIKB 3EOBA 3MRPA 3U30B 3SDDC 4IMKA 1N26A 1TJHL 1I1AA 5ITFA 2IQAA 1U93B 1QO3A 2XZCL 3IRZA 3WUWB 4YLQT 5LJYH 1ND0B 1VSCA 3WJJC 5DRXA 3W2DL 1ERNA 4PJIE 1BPVA 3GSXB 3I6GA 5CZXD 1OAXH 5MHSD 2RHEA 1IGTB 2EXYC 1A1OA 4NNPH 4TNWK 2IH1B 5K9QG 4I1NB 2K1MA 3BEVA 3L3IA 1BX2A 2C3WA 6FABH 2XZAH 3BKYL 4DW2L 2NY5H 4LU5L 5IMMB 3IFNL 5EU6A 5GS2H 3MGAA 1C7SA 4PJ8A 2IQ9L 4JQIL 2ZCLL 4XNMA 5ANME 4TVSa 4F37F 1ED3B 1FGNH 4GXUN 5E8PB 3EYVB 1TJIH 5HY9B 3VE0B 4YO0B 3SE9H 5F44A 1ACYL 1CTNA 4ZUWA 3C6SB 1MLBB 3DRQA 4MZ3A 5KVEH 1DQQA 5DEGB 5D1ZA 2BNRE 5JZ7D 1I8KB 5FB8B 3B2UD 5CILL 1X7QB 2GJ6B 4HXBH 1SQ2N 1MCLA 1ONQB 1T0MB 1TVHB 4FN0A 3Q3GA 3DX6B 2I07B 4UINH 2MKWA 1GPOH 5D70H 5B8CC 1VFOA 3RZWA 1IAII 1KLFA 4LEXL 5F9JA 2JB6B 4RAVA 5F89A 1WVZA 3A6CH 3MYJA 1UM6H 3LHPH 5HPMA 3BAEL 2ADGA 1G9MH 1CK0L 4KK6D 5DZOA 3QB7C 1MCOH 1BD2B 4UT7H 3S4SB 1EERB 4OKVB 4PP2B 5FYJD 3UJIH 1DCLA 3IJYB 4BSVA 5BVJA 2VDQH 1A6WH 4DQOH 1EZVX 3W0WE 5HGBA 1HWHB 4LGPB 3S36L 4O4YH 2ADFL 3QQ9D 3SO5A 1RULH 4U1HA 3SDYH 3VRJB 2RJMA 4HK0A 4X4ME 5F7MC 5CEZE 2GKIA 3QXAA 5KOMC 3FQWB 3KS0J 2P7TB 1S3KL 4LSRL 4JFFB 2VXQL 5E2TL 3CD4A 2GJJA 3O2VH 1PZUB 1YPZE 4LHUD 4AEHH 4XCYA 4NCC2 2X4PB 1IZKA 4QRRE 1UM5L 1EFQA 2HFFA 1U3ZA 3QR2A 1INEH 1IC4L 3MREB 1PG7H 5IK3A 4TULL 1B6UA 3BH8A 3KPLA 1S78D 1N6QL 4XCEA 1RUPH 5I73B 4ZTPL 5CEXA 2B0SH 1NUDA 3UJJL 1KUMA 3KPSD 5FFLA 2FL5B 1FZMA 1P2CA 3MBEA 1DL7H 1A9BB 4YXLL 4G8GB 1LO3L 1JGDA 4ODVL 2ZP0T 4PLKC 2C1PA 2JB5H 4PLNC 4P57A 1MIEL 3HB3D 1QRKA 3PL6C 4TPRL 4LIQH 4MDJA 5HGHB 1BWWA 3WYRA 1XGPB 2AV7B 3FFCA 4P48A 4G9FA 3UTQB 3ZE0E 4U1NA 5HGAB 3ZKND 3K2MC 4K94L 1J7VR 3MLWL 4MXVE 3EDJA 3CFIC 4R8WL 4YWGH 4ZD3H 1FGVL 2HT4C 4NOFA 3MJ9L 1JPST 4KI5D 2AXJA 4C56D 4NZTL 4BQ6A 3FO2B 3CVIL 3FB8B 3BZEA 4G43A 5IB1A 3LMJL 1P4LB 1W8NA 4KKCC 2W9DH 4ODXA 4XNQA 4WW2B 4P9MH 4EKXA 1RIUH 2EDXA 4PJAA 1VB9A 4G6KH 5AWNH 2G2RA 4YE4H 3RU8H 5DMIH 1CDCA 4ODWA 3TYFB 5SX5H 5DR5L 4GW4B 3TJEH 5DD3H 2HTKD 2OL3H 2F54E 3IDXH 2I24N 1KPRB 3L3DB 4P0DA 2APBA 2Y1VA 1E6JL 3OL2A 4WI8A 2AJUH 3UZEA 3H9SA 4NN7B 2CD0A 5CUSL 2ICEB 1S7XB 1EBPA 3VD5A 2DQUH 5C70A 5GRYA 4BFBD 3BYYA 3C6LD 5TH2A 5D93B 4PBWD 5T3ZL 4X7TA 1CIDA 5ACMA 3WKML 5JIHA 1A1MB 5GXBB 5A2LH 3OZ9H 2R0ZL 4BQ8A 1FIGL 5F9OH 4DVRH 5EU7E 1AO7E 4N5EC 1NGXB 5F8RC 1CZ8L 4R26H 4E41D 1UKSA 3MRMB 3K8KA 2JJVA 2VITB 4PYGA 1EEUA 1JVKA 1IQWL 4U1KB 4M1GL 4YDJB 3REVB 3VMNA 4S1RL 5B38G 1ZE3C 3JTTA 5HVGB 3MCKB 1P1ZA 1EEZB 2HLAA 5ABDE 1F4AA 2EIZA 4K2UL 4PGZA 3S37H 3FMGL 3V95A 4XB7A 3QCTL 1Y6NR 1IQDA 5EIIA 1HK6A 1FL5A 2W0FA 2XWTB 4OIIH 1ODAA 5DT1L 4ORZC 4L1HA 4Z7OE 3ULSA 5DJ2A 2ZUTA 3NAAH 4YPJA 3U7AA 1A3LH 4WV1A 3P9LB 3KYOA 2JELH 4NRYA 1RU9H 2V7NB 3CNKA 3SDDD 3FN3A 4GT7A 1B90A 2F5BH 1IAOA 1OAQL 2Z0BA 1JTPA 4JZNB 5LVEA 3P9MB 4YR6A 3EFFA 1BVLA 4K94C 4AEFA 2NY2D 2PO6A 3L5XL 3HA0A 4XMKL 2NY6C 4J3VA 4RX4D 1XR8A 5E5RB 1X4XA 3S3SA 1OLLA 1FV1B 3EYOA 4M03A 3DWTA 2VLJE 4FRWA 3B5HA 3SKUD 2GFBB 5GGVY 5TDPA 3T3PF 4BH8A 2O5XL 2RIKA 4WHCA 3LPWA 2EE2A 4ZNEE 1QEWB 4Y5YC 3BH9B 4K71C 1U36A 3HNVL 4GKNA 2BNQA 2HKHL 3UYRL 1Q1JH 2XXCB 2YPLE 3MRGB 1RURL 2FWOB 5GIRB 1TVDA 1B0RB 2AK4A 1FG2A 3L3JB 4GAYB 4ZQKB 3DETC 2VLMD 5SWZE 5DJXA 5MHSE 3V0WL 4BA8A 3T0DA 5B4MC 4Q2ZA 1KC5L 1DFBL 4M3KB 4X6DF 1XF3A 3V6OE 1DN0B 3QXDA 4FOMA 3ET9F 5DK3A 3DX9A 4PJXB 2FIKA 3LOWA 4HWBH 1YEHL 4WFHD 1VGEL 3T0EB 1XCQB 4YK4C 1U93A 1G7MB 5J12C 4D9RE 1ND0A 2O93L 3F7PC 4J1UB 3LH2L 3T2QA 2F15A 3VGAB 1WJ3A 3GSXA 4QHMB 3WJLA 1FC2D 2PW1A 3ZT6A 1IGTA 1TJGH 5I1HL 1AGBB 2IH1A 4P99A 1MI5E 2Z35B 4JQXA 4HDIB 2YA1A 2NW3B 2OXGA 2J8UA 3SKNB 5IMMA 1JHKL 1LVEA 3IAGC 4NM4L 4I3RH 1MHPL 5JDSB 4U6TA 3WO3B 1YMHB 2QHLA 1DEEA 4NHUA 3WO4C 5E8PA 3RX5A 4WIQA 2Y72A 3QJFA 3HI5L 2F8VA 5HY9A 4PRPB 1N4XL 1L7TH 3QHZH 5MI0C 3DVIA 4YO0A 3QUYB 2FH8A 5J8OA 1RVFH 1BZ7A 4RQQB 1D5BA 3QIUD 4QCIB 4R4NC 5FM8A 1KNOB 3C6SA 1MLBA 4X98B 3IDIB 3NTCL 5DEGA 1T4KB 5F7FA 1YYLH 1I8KA 2QQKH 5BV7L 5FB8A 5BS0B 1X7QA 4NKMB 1T0MA 1TVHA 1MHHB 1ONQA 4BFIB 2EIEA 3BISA 1KCRH 2AI0H 3DX6A 1WBXA 5IG7B 3BD4A 3HAEB 1U3HD 1AR1D 2I07A 3GGWB 5FXCH 4OT1H 2WBJA 5DQDL 5C0AD 2Q8AL 3LRHA 5IR1A 7CGTA 5GHWL 2JJTA 4BUHA 1MWAH 3ECBB 3MOBH 5F1IB 3U82B 1BD2A 1EA9C 4NO0B 3S4SA 2MKLC 4JM4H 3OJ2C 4PLKD 1WFOA 3NBNA 3VXUD 4ZUVA 2J6EA 1X5KA 4TQEH 3IJYA 1LP9B 5C2BL 1P6FA 2GTZB 4LSUH 4R90H 5L8KB 2HN7B 5I2IB 5E2UL 4M48H 1ZLUK 3WXWL 5C0BD 1L0XA 3MV9B 3MUJA 3VRJA 3ZTJG 1GIGL 2YUVA 1A21A 2HT4D 4RISH 4ODSH 3FQWA 4PRHB 2P7TA 1BGXL 3U46B 5SWSB 1KJ2B 3KPSE 3DNKA 3K7UA 2BVOA 1CVRA 4KKCD 4S2SB 4DVBB 1FYTB 4RFOH 4NSKB 4YPGB 3GKZA 3KJ6H 4XP1H 5MENE 1S7WA 2AERT 3GNMH 5IIEB 4UBDC 3TVMB 4OZGB 3MREA 4R7NB 3NABH 3M17A 1GGUA 5F97E 4PJ9C 1GRWA 1I9IL 4XMLH 5ESAB 1YNLH 5FYKU 4M5YH 4I2XA 4YFDB 4N0RA 3WFEL 2VDKH 5HDBF 3HRPA 4KI5E 1F02I 4C56E 5AZ2L 1A9BA 3GK8H 1RIHH 1WIPA 4CVXA 1FFOA 3UCRA 2DM3A 4V2BA 4NJ9H 1R24B 4UIMA 1RPQA 1F5WA 1S8DB 1XGPA 1IKNC 3X14A 3W9EA 4OD1H 2QQLH 3W39B 5LAXB 3DXAB 1RAMA 4ZSOB 3UTQA 4N5ED 4WRLA 5H35B 4X83A 5BV7C 4LP5A 4MD4B 5GZNC 2CRMA 2LU3A 2VABB 3FO2A 4LAQL 3KS0H 1U8KB 3L7FB 4MJ4A 4Z7VE 3T77A 1BAFH 5I8OH 5JPNB 1P4LA 1BP3B 4JDTL 4WW2A 3ZMRA 3BPNC 5DVLA 5KSAC 1QLFB 3WS6C 1RZ8B 1K8DB 3DUHA 5IVXE 4A6YB 3BZ4B 1TNNA 4KH2A 5FGBC 1OP5K 5TPWL 4PJHE 4NRXB 4LPXA 3DTXB 5JIIA 1NBYB 1VFUA 5KG9B 3PWNA 3ULVE 3GSVA 3TYFA 1AD9B 1NCBH 4F7EB 4HC1A 5L9DH 4LQ1A 2VLKB 1FRGL 3MRJA 4FQ1H 1RZJH 2GYSA 1KPRA 4DCQB 3ZDXF 2YWYA 2R2EB 4PJEB 2C4FU 4JO1H 1HQRB 5IGXL 1KG0B 1NGQL 4R0LB 1OTTD 5IROA 3C2AH 1EGJA 1QFWI 4KHTL 4GS7B 5E00B 2ICEA 5CD5D 4RGNB 1S7XA 2NY6D 5DVKA 1DTUA 3MRRB 2VERN 1P4BH 1WWCA 2DMCA 4KMLB 3DROB 1YEEL 1F58H 2R0LL 2NLJB 4UTBL 3UC0H 5KTEH 1Y6MR 4C54A 1A1MA 1A7NH 1QD0A 3SGEH 2DWEB 1R3LB 1NGXA 3MRLA 1YEKL 3RI5F 3MRMA 4P3CH 3BUYB 1IKFL 2VITA 3CSYA 5DLMH 3BKJH 3RBGA 2PETA 4OI7A 2X1OA 3AB0B 1RSFA 3HKFA 3I2CL 1ORSB 1YY9D 2IBGA 4BKLB 2ARJQ 3GSUA 4FQHA 3MCKA 4OLZH 5DEZA 3MA7B 3UJTH 1JWMB 1EEZA 3DETD 4MJID 1NGYA 2GIYA 1G1YA 3B43A 5B4MD 4PRDA 2XWTA 4LSSH 2QKIB 3P11L 4LRIC 3ALPA 1FBIH 3P9LA 4XBGB 2V7NA 5D72H 1C16B 1I8IB 3H42H 1XF2B 4MWFB 4O2EB 4OLYH 2X9YA 2ATPB 3P9MA 3D9AH 5HHVL 3VXRD 2R15A 4P2OB 4LSVL 5C6TH 9CGTA 5L6YL 5FOBB 4MNQA 4X6CB 4AYFA 1FV1A 35C8L 1QKZL 2FO4B 5F6HI 1IARB 4HJGB 1UJ3A 2GFBA 2VLME 1PLGL 4YHKL 4Y19D 5HSFA 4PGDB 2GK2A 2Z8RA 4XC1H 3DVGB 4JO3H 2XA8L 5F3BB 2X4OB 5KVMC 5SV4A 3QIWA 1E4XL 2BFVL 5CHNB 2O61B 4WFHE 3VFVA 4KZDL 4MHHI 4EDWH 3ZKSD 5GIRA 1NCWH 4KK8C 4XNUL 1IM9B 1B0RA 2VKWA 5T1LB 3VI3E 4ZQKA 3H9YA 4R4ND 3NOIA 3WL9B 5I1JH 5JXEC 4LRNH 4CN4A 4BUGA 1S7UB 4D0CA 5ID1B 3QDMA 1I3RB 4I5BB 1DN0A 3O6ML 1YNTA 4F2MB 3BEWB 4EN3C 3NFSH 3MLTB 2DLIA 4NZRL 3WE6B 1T89A 3OJDB 3L3GA 5JOEA 5KZCB 5HYEA 4XNZB 4ZYKB 3THMH 4ESKA 1AGBA 2P44B 2DI9A 2NW3A 4YC2C 1FVDA 1Q9LB 1YMMA 5BOPA 1A6VL 1MY7A 2K9UA 2JE8A 3SDAB 3U2SB 4S0TD 3GBLA 5ICZB 5IMLA 4N0UB 2CKBH 3RRQA 4JGMA 4FQLL 4UNTA 8FABA 4WO4C 1IGYA 5SV3A 5INDB 5C0AE 3QUYA 3SQBA 2MPAH 3DPBA 2CGRL 4J4PA 4M6OL 4OZFH 4H25A 2Q7YA 3SE8H 4WWKC 2WIMA 3VGDA 4YHPA 1KNOA 2E9JA 3IDIA 2VUYA 1T4KA 1ZT7A 2WINB 2NYYC 4HLZH 4UB0L 5BJTB 3QZWA 1ZWIB 4NM8L 3TO2B 3VXUE 4NKMA 5EBWA 1KIPB 4Y16D 4BFIA 4UBDD 1CYGA 4K3JH 1EMTL 4NCC1 1A7PL 3D39B 4I48B 2FGWH 3GGWA 4PJ9D 1W72H 4P2CG 3QRGL 3WMSA 4GW1B 3WUWG 2OP4L 4GXUM 3TWCH 4FFZL 2QQNL 1G0YR 1FAIL 3RZCB 1J0IA 5CJOH 4NO0A 1JK8A 1JHTB 3ULUH 1FJ1A 3W9DB 4AENB 1T5XB 2VKXA 3S5LA 1LP9A 2GTZA 4ONGL 3KLHC 2DQGL 4QT5B 5I2IA 1MJJA 3P3YA 4GBXB 1QQDB 4MMZC 3WFDL 1YEFH 4Y1AD 3MC0A 1IFHH 4OJFL 5HVWA 4JGUA 2D7MA 4XP5H 4JVWA 5GZND 3U4BH 2VYRE 3PWJB 3HUJF 4PRHA 4PJCE 4EI5A 4HSQA 1AY1H 1KJ2A 5EN2B 3J8F7 5LQBH 1UM4H 2CR6A 2I5YL 4I9WD 3I50H 4S2SA 5D2NA 3BN3B 4DVBA 3IJHA 25C8H 4YPGA 3MPCA 4LCCB 2BVEA 4P49A 4CMHB 4R4FH 4K3DH 5IIEA 1YQVH 4OZGA 4DFIA 4R7NA 5I30L 1UXSB 3MRIB 4V2CB 5ESAA 1G7JB 5GRJH 1KCVH 4K7PX 4KJQC 2XFXB 1ZT4B 4KI1A 3C60A 1OAKL 5EORH 1YN6B 4W4OC 1A6AB 4JPVH 5B21A 4BH7A 5C0CA 3VI4E 3S4SG 5GSVB 3TYGL 6FABL 5IHZB 2XZAL 1XGUA 1QLEH 4YHOH 3ZDYF 2R29H 1S8DA 5JO5B 3AXLA 4DOHB 1YDPB 3NCBB 3ZKXB 2O5ZL 2EIBA 3FT2A 3W39A 3DXAA 3KJ4C 3RGVC 2ESVD 1FGNL 5H35A 1TZIB 2XTJE 4N9OB 1K3ZA 5FKPB 1A5FL 2VABA 3KXFD 1U8KA 4Z76A 2BVPB 2XN9E 3QFJB 4U1GC 2V7HB 5KVEL 3K0WA 3CFBB 5F96L 4HK3J 1IAKA 3SO3B 1A6PA 1X9QA 4W6WB 4QHKI 5SX5K 4HXBL 1RZ8A 1K8DA 3BZ4A 4OIAA 3NZ8B 5ISZD 3DTXA 4NQCD 3G5ZB 3MODH 1GPOL 1DLFL 4ZXBB 4F7EA 1Z9MA 3FQUA 3Q5TA 4X4XB 2DLTA 5I75C 3Q5YA 3A6CL 1QSFD 3LHPL 1UM6L 4YFLI 3CUPB 1G9ML 1KN2L 4GKSB 2R2EA 4FMKA 4MGXA 4LNVA 3C2SA 1KG0A 2AEQL 1C5DB 2NY1C 4R0LA 5JHDE 4LAJH 2W9EH 1T1ZB 4TNWF 1ZA3B 3LEXA 1ULVA 3QG6B 5KJRL 2Y25A 2NLJA 3MBEC 4QHLB 1MCPH 2X1QA 4O4YL 4M93C 3S96B 4QNPF 1CVSC 4LPTA 1R3LA 4EDXB 3GM8A 1OCWH 1WZMA 3RTQC 1CGTA 5DURD 1KACB 2B39A 4H1LH 1T22A 1K5NB 3VWKC 1ORSA 2UV3A 3VWJA 4U1JB 1VADB 4DGIH 1JRHH 1RUQH 3VXRE 3MA7A 2WWMC 4LLQB 5DUBA 5JXED 3RWJA 3VFUB 5I1DB 1DLHB 1UC6A 4LGSB 2AEPH 4I0KA 2QKIA 1YNKH 3QHFL 1OPGH 1RUPL 1FCCA 5GGRA 5I1AB 2ITDB 4XBGA 4EN3D 2ZSVB 1DBBH 4GQ9L 1MUJB 4P59L 3IJSA 3CFCL 1DL7L 5E2JA 1I8IA 3QO1B 4HMDA 2DRUA 4MWFA 3V7AE 4O2EA 1Y0LB 2LV4A 2WQ8A 4P2OA 2E7LC 4KDWA 1TQCB 5J3HC 5T5FH 2JB5L 1CXIA 3F7QA 5C9JB 1EAPB 4X6CA 1FZKA 1MELA 2CUMA 3BGFC 3SDCA 5T1KD 4R2GC 1U8MA 2FO4A 5DD0L 3GEWB 4J2XA 4KTEH 1KCUL 5K9QI 5IFHL 1DBKH 3DVGA 4NP4H 1BREA 3DARA 1Z9SA 5KS9B 5F3BA 2X4OA 3NFNB 4V1DE 5BRZA 5IWLA 4WO4D 5HYSB 3MROA 5CHNA 2O61A 2IAMD 4M3JA 1KIQB 5IQ7H 1IM9A 5JORB 4Z78B 5L0QB 4AH2B 5T1LA 4WWKD 5KSVB 4CRPA 4DGVL 3FT3A 4MA8L 5JPMB 4PRIB 2NYYD 5DMIL 2ZCHH 2NR6C 5DJ0B 1S7UA 1TETL 5ID1A 2B1HH 1JN6A 1I3RA 2DQJL 4C58B 5IFAL 1T80A 3BEWA 4XBPA 4M1CC 1T2QH 4JG1H 2G60H 1BLNB 2DTMH 1KLUB 3MV8B 1J10A 1TTFA 1NKOA 3EOAA 4H5SB 3WE6A 4KVNH 4DAGH 5D7IF 1NUFA 3RIAF 4HJJH 3K3QA 2JIXB 4WV1C 4OGXL 1KCSH 5DK0A 4ZYKA 4YHLH 1KJ3H 4WFED 1MCRA 1Q9WB 3LN9A 1N5AB 4DKFH 3KYMB 4DVRL 3KLHD 1SJEB 3FQTB 2D0FA 2ICWI 1NFDF 3MRFB 4LSPH 1OP9A 1TVBA 5F9WB 1CF8L 4HZLB 4K7FA 4N0UA 1J0ZA 4D0BB 3NCEB 2A9NL 3SGKC 4FXGB 1T5WB 5INDA 3BDXA 4APQC 4LVNC 3GSRB 3OF6D 1BBJA 4QF1A 1G7HB 2X9WA 4S1DC 4FNLH 1IZJA 3FB5B 2DKMA 2WINA 1CQKA 2D7NA 4F57H 2HWZL 4NFCA 5DDHB 1F4YH 1HILB 1YEIH 1ZWIA 1B0GB 5EB9A 2IJ0C 2J6EL 1TCRB 1RU9L 3JSSA 1A6UH 1IEBA 1XGRA 3D39A 3T2PA 2F5BL 1OGAB 5ALBL 2PTUA 3CLFH 4JJ5B 4JRYD 4NN5C 4I0CC 3CVHH 2L4OA 4Y1AE 5CSZB 4OF3A 4GW1A 1WBZB 3V79C 4HS3B 3BRDA 3Q6FA 2UYLA 5E2VH 1KTRL 2EH8L 3HZMB 3OJMB 1NQBA 3LIZH 4XI5D 5J56B 2X4SB 2FATL 3LB6C 2R56L 1J1OH 1JHTA 3U30C 4LLYB 1F11B 3W9DA 4AENA 4Z7WB 5HHOB 1JIBA 1KIRA 3NIGF 3VW3H 4Q6YA 4NQEB 1JTTA 2OXHA 1A4KB 5ALCH 4RDQG 4QGYA 5K9OB 4QT5A 1Y18B 5J13C 3RGVD 4GBXA 1Q9OB 2RQ8A 4PGBB 3U7WH 3WJLC 1Q1JL 4ENEC 5I19H 4OTXL 3VFMB 4FQJL 5GS1A 4JQXC 1S7TA 5I1EH 3B2VH 3VG9B 1L4IA 5EN2A 1KFAL 4OCSH 1EK3A 5HHNA 5KBNC 1TZGL 4LCCA 4FTVD 1OTSC 3LEYH 4PTTA 3HAEG 2W07A 4PG9B 2Q7NA 2OZ4A 3ARFD 3V6ZB 1R3KB 1UXSA 2Z9TA 3MRIA 4M7KH 1G7JA 2ESVE 4KDTA 2XFXA 1ZT4A 1YN6A 3QO0B 2FJFB 2NY1D 1A6AA 5HTSA 4LK4A 1TJGL 1QRNA 3RBSA 2BVQA 2KUTA 3DJ9A 3QDJD 3O8XC 2DOCA 4EOWH 4R96B 4WU5B 3DX8B 2BCKB 5JO5A 4LHJB 1YDPA 3EYQC 4Z0XB 5ISZE 3D25B 4NQCE 5I66B 1TZIA 4RWHA 3G04B 2NXZD 3STZB 3RTQD 4CVWA 4HC1L 4OB5L 1EVTC 1FIEA 2HRPH 4DTGL 3VWKD 4W6XB 4XH2B 4PJEF 1L6ZA 2BVPA 4G6FD 4MNHB 1A7QL 3QFJA 1JPSL 2B5IB 1YYLL 2C1OB 3CFBA 2QQKL 2UVFA 3K2UH 2WWMD 1EGJL 5C3LD 4HUUB 1TTUA 4P4KA 4GKOA 3T0VA 3T2NH 1F2XK 2AI0L 3NZ8A 5E56A 3PWUB 1P5UA 2UUDH 5CJBA 1RZIB 4Z6AT 1WISA 2WLZA 1UH4A 3CU7A 3E6FB 1EO7A 3CUPA 5B3NA 1UXWB 5GGQH 2NY0B 3MOBL 5K93A 3HPJB 1RJZB 5JW4R 1C5DA 4JM4L 1BEYL 5EBMB 3FHAA 5J3HD 3U6RB 4YDVB 5I73C 4Y4HC 3MLXL 1ZA3A 4R2GD 4P3WA 3HHRB 4JREB 4R90L 1CDUA 1MCKA 5I1CL 3W11C 2X4NB 3G6AB 4QHLA 1SMOA 2C4XA 2FH6A 2JF1A 3C5JB 3U79A 4UUJB 1FORH 1OVZA 4EDXA 3FQXA 1O7VA 4RISL 4XWGH 5HDOA 3QXUA 4BFGA 4L3EA 5DRZB 5GGVL 2FYYA 5CJ8A 4DFHA 2R8SH 4H0HB 1K5NA 2QBWA 2FX9L 3RWCB 2MHAB 4HUMB 1V7ML 1VADA 2WWKO 5J6HB 3EDDA 2VDRH 1KGCD 5IESH 3OXSB 3N06B 1ZHKB 2DYPB 3A67H 2CO6B 3AS3A 3VFUA 4R7DB 2NR6D 1DLHA 3NABL 3UZVB 5D6CB 2AABL 4LLMB 3FL7A 5KSBE 1MRCH 4WW2C 4M02A 5IW1B 4M1CD 3FONB 2ITDA 1IAIH 1MUJA 4EI6B 1INQB 1G7LB 2EEAA 3QO1A 1R5VA 1RIHL 5IT2H 1Y0LA 3BGMB 5L2KB 1I7RB 1JP5A 4JHWH 1A7RH 4JKPH 3L3KA 1QUNA 3SDXF 3G9VA 1I1FA 3EIFA 4GG6F 3WFCL 2EICA 2BVYA 3V52H 1SM3H 2Y5EA 1X44A 4H0GA 2PR4H 5F21B 4LCUB 5IROC 2DDQH 4L8CB 5I1LB 3GMPA 3BDYH 1GGIL 2OK0H 4G6JH 5D93C 1DQLH 2BMKA 1DUYB 5HYSA 1BAFL 5TE6H 3ARDA 5J1TC 3T3PE 4NO3B 4M7JL 4FZEH 3EFDL 3CU1A 4APQD 4YUEH 2VXUH 2M2DA 4XP9L 4S1DD 4XBEH 5KSVA 3UPRB 5ESQB 3KPPB 1NUNB 5CEZH 5JPMA 2BNQD 4PRIA 5GRUH 3TJHC 1R0AL 3OB0K 2VLJB 1RIVL 2CRYA 5DJ0A 4B50A 5AAWA 4WI7A 5HGDA 1RZJL 3ILPB 3PWLA 4OZIA 3MCLH 1MF2L 5AD0B 3BHBA 4JO1L 1DVFB 1E4XI 2E5EA 1BLNA 4BQCA 1KLUA 4H5SA 1HINH 3GBNL 1X5HA 1K6QL 4TVPD 5M94B 1GZPB 4LARH 1EUUA 2W60A 3CDGA 1QFUH 1Z0NA 5EU6E 2YUZA 3LB6D 2CIIB 3RVUD 4AIOA 3T8XB 1D6VL 1ZHBB 1FLRH 3KHQA 1WGOA 4HUXB 2RR3A 3MRFA 5B3JF 4K9EH 1R3HB 3PABB 4HZLA 3ARRA 3O2WL 3FCTB 3T4AB 5FGCE 4D0BA 4AMKH 2GITB 4LASL 4O5LL 3WNLA 1VFAB 1MY5A 3RVWD 5IB2B 2VAAA 4PUBH 2EDQA 3GSRA 2VDPH 1KXVC 4N68A 3CCHA 4OLXL 5D2LB 3AY4C 3FB5A 1F4WL 4QRUB 4K8RH 5JW4N 4NZJA 4HF5H 5D7KE 3OR7B 4HPYH 1U6AH 1OTSD 3BW9A 3RGHA 1B0GA 4PV8A 1G0XA 5EBLB 2G9HB 4G8FA 5D72L 2NPLX 3HE7C 4P46B 4RAUA 4JJ5A 4F15B 3LV3B 1JTOA 3JTSB 5C6TL 2R1XB 2GJ6D 1YZZA 4HS3A 4ZDHA 5E5MB 3VFOA 1SBSH 4PJDF 2YWZA 1K4CA 3WIFA 4ERSH 2X4SA 5D7JA 3DV4B 1KJ2L 5EZIH 4RFEB 1ZLSH 4P23B 3O8XD 4LLYA 4XP6L 4BZ1L 3T0EC 4Z7WA 3NCJL 1R5IB 5HHOA 3VD4A 2B2XH 3CXDL 1Z9LA 5DMKB 4NQEA 2GSGB 3C87A 3C09C 3QWQB 1A4KA 1RZKL 3EYQD 3NGBB 3VGAC 3HMWH 1ZA6A 1Q9OA 4PGBA 5BW7A 1MJ7L 4BK5A 5GRZA 1IC5L 2O26U 5GS0H 4L3CB 4EDWL 4U3HA 4QRSB 1SJVA 2WANA 4TUOA 1IL1B 1CG9A 3O6KH 4N8PA 1WLHA 3LEVH 1QHOA 1KPUB 3WV0A 3GJFB 5TFSH 3SOBH 4JHAH 3RP1A 2P46B 4KVCL 2V17H 4PREB 1B4RA 1KULA 3WHXB 5I74C 1OAZL 3SKOA 2XIDA 3MRHB 4JFFD 1JMXA 1EJ6A 4LHUB 3FB7A 4PG9A 2CK0H 5FAAA 4BZ2H 5FYLD 3LQAL 3V6ZA 1R3KA 1RD6A 3BGAA 3B9EA 3W0WA 4J8RB 3ARQA 3H6JA 1H8OA 4M6MH 4JN1H 4K07A 5TQ2H 3WIIH 4X4MA 2YR3A 3QO0A 3DGCR 3LKOB 3WFBH 2FJFA 1RJCA 2A1WH 3FFCE 1OF2B 4CAGA 4WI4A 4WUKH 4Y4HD 3RKDC 3HI6L 1IRAY 4UT9L 5EOCJ 3KLDA 2ZOKB 4QXWA 4R96A 1XF5A 4WU5A 3DX8A 3W11D 2YRPA 2BCKA 4Z0XA 4HBCH 5E6IB 4QRRA 3GMOB 3D25A 4G8GD 3V4PL 3DUUB 1LK3H 1UFUA 4JDZA 5DQ9B 3QWRD 4NYLB 5CP7A 5FO8B 3G04A 1NCDL 3RNKB 3STZA 4CU6A 1T66C 4OF7A 5HVFB 2XZQL 4QHNB 1BHGA 4MSWB 1A64A 2DQDH 3TN0C 4F8TA 3ALXA 4MNHA 3I3DA 2A73B 4N1EA 2C1OA 3LN4A 4M5ZL 1G6RH 4PS4H 2EYTB 4JB9L 2EYSB 4PBXA 5CD3B 1CFVH 2IH3B 2J8HA 2NZIA 3PWUA 5DVNA 5HBBA 2FGWL 5H94A 1X4YA 2YBRA 1BIIB 3MRCB 2A77H 3H9SE 1CFNB 3E6FA 2XI9A 2DQHH 4OGAD 4HT1L 2XKSA 1RZKC 5IQ9B 3DLQR 5F9AC 1UXWA 4YNYB 3HPJA 1RJZA 5FGRA 3EOTH 2OJEB 3TVMC 3O0RL 5F1SA 3ZE2F 4RBPH 3U6RA 4YDVA 1FO0B 1Q38A 1KGCE 4ZMAT 3ZSTA 4AL8H 5HYIA 4NQDD 2R2BB 3G6AA 2XNAB 1JUFA 5TE7H 3UPAA 1JPGB 5DZLA 1UWGL 3C6LB 4C55A 1WAAF 3C5JA 4LLAA 4U1MB 4UUJA 4XP5L 5C1MB 4JM2A 3AS0A 3BP4B 2ITCA 4CMMA 1AIFB 2F54A 1AY1L 4UOW0 5LQBL 4XXCA 4E41B 1UM4L 2VLRD 3TEUA 4GMSH 2CLVB 2AK1H 5GGUB 3ZT7A 5J6HA 3HZVA 1RUAH 1VFBA 1OM3H 3KPQA 4F7CA 5MP6H 3TJHD 2QADB 1YQVL 4F7PB 4XVUD 3BKCH 1CGVA 4NC1C 1A2YB 2SEBB 5D6CA 3G5VA 2H8PB 1CD9B 2VWEC 2JKXA 3MRBB 1MRFH 1XCTB 3W81A 3G08B 5IW1A 3MZTA 3B83A 1INQA 4HUNB 4JAMB 3IVKB 1G7LA 5J7CC 2D7OA 1KCKA 3BGMA 1I7RA 2DL9A 5GGTA 1S7QB 4M7LH 3CGTA 1T7ZA 5GRVK 3UTZB 2NY2B 5KVGL 4GMTH 2AKRA 2BNQE 2ZKHL 1HHIB 2HT2C 2W92A 1I9JH 4R0LC 2ZUXA 2X10A 4GS7C 5I1LA 1K8IB 1GOHA 4RGNC 5D5MB 1M7XA 3ABZA 3MLYH 1QBLL 4JLRB 4JZOA 5EC1B 1RHFA 2JJUA 4IRZH 2FDBP 2CSPA 1HYSD 1C5CH 4JEGB 4QGTA 2X1WL 4NO3A 1Q9KB 5KSUB 3O6FD 5IHLB 1MFEH 5EWIL 4NNYA 4NO2B 2AJ3A 1I8LC 1CGSL 3UPRA 3DOSA 3KPPA 5ESQA 4NQSB 3AB0C 3Q1SH 2VLJA 5MEQA 4X6BA 3N9GH 4AEIL 3T3MF 2E27L 3ILPA 4XXDB 1A22B 4OLUL 1AGEB 3PP4H 5AD0A 3HE7D 1CLZH 1I7UB 4H8WC 2V2XB 4WCYL 2DLFL 3IDJA 1RFDL 2D0HA 1WT5C 4L4JA 1G6RA 1RY7B 5IV2B 2YOCA 2W9EL 4KHXH 2BNUB 1AD0A 1GZPA 4HWEH 1AXTH 4OCXH 2DAVA 4R4BB 2XACC 3VDBA 1I3VA 2H1PL 3MNWB 4NJAH 5T3XD 3QUMH 3T8XA 1FVCB 2EE3A 4HGKC 4AG4L 1MCPL 3T0ED 1LDSA 1ZHBA 1D5IH 2ZWLT 4KQ3H 4HUXA 5IJKA 5J9PB 3MUZ1 2G5BA 4UTAH 3O3EA 3V6OA 4M62H 2L7UA 4KK9D 3JUYA 2D4DA 1A7OH 5AZEH 2Y06H 5HYSG 5CGYC 2GITA 2NMSA 1VFMA 3DYOA 3QDGB 2P5WB 1VFAA 4O51B 1RUQL 4HK3N 2YD7A 3LS4H 2GJ6E 5IOPB 5IB2A 1IEHA 1PYWA 3LQZA 1EAJA 1DSFH 1PVHA 3MLSH 5IWLC 4Z18A 4UILH 1F3DH 2GSIB 2IFFH 5IB3A 4PRPD 3OR7A 1OPGL 1Z3GH 1IEAB 3C5ZD 3QIUB 2G9HA 1CXEA 2VR9A 4TUKH 4K7PH 5DJZB 1PZ5A 1WCBB 2Z91B 2GJZA 3GO1L 4JFDB 1J0KA 4XHJD 1BD2E 1EXUB 3RIFK 5HDQL 3FN0H 1U3HB 3JTSA 2OMNA 5BS0D 2R1XA 5DD5L 3MLRL 3ULVH 1NAKH 4OZHB 1QFWH 3IDNB 2KQMA 4RFEA 3H3PL 3RKDD 2CJUH 4F80A 3GSOA 5FUCC 1MCNA 5GRVL 2GSGA 4NP4L 1VEOA 3S6CA 4YX2H 4X5WB 1Z5LB 4HH8A 3MA9H 2OLDA 4XNZC 4YZFF 4XNYL 2AQ1A 4O9HL 5DFVC 1WUNT 1P5VA 4JFFE 4LFHD 5FYLE 2OZ4L 4KFZC 1T66D 5FA3A 4L3CA 4AM0B 4QRSA 3GSQA 1IL1A 4PGEB 3TN0D 4HH9B 5C0BB 2AJSL 3SDAC 1CXKA 3GJFA 3TBVB 5I9QB 4L5FH 1BVKB 2ZCHL 3MV9D 4IDJH 1MCIA 1S5HB 4PJGF 1ZOXA 4PRHD 4YHNA 4PREA 5SWSD 1CN4A 5F7DB 3MRHA 4LHUA 1FYTD 4G42B 3L5WB 4G8GE 3QHTC 2D03H 3B6SB 4DAGL 4QTIL 4U6VL 2K3TA 3TFKC 1N64H 1E6OL 4HJJL 1O5DT 2VDLH 4S0SD 3U36B 4TTDC 3TVMD 4OLWL 1CICB 1JPTL 1OF2A 1FP5A 3OGCB 1MFAL 4TSBH 1XGYL 1T21B 3B9DA 2B1AH 5DSCB 2VSCA 2Q8BH 3QDHA 5E2WH 3TBSB 3OKEA 3DYMA 2EDFA 4TOYL 1I9RH 4YEEA 3QWOB 3QIBB 4Y4FB 5ITBH 5J57B 1HI6B 1OP3H 4XX1G 4N9GB 3WNOA 2IGFH 3GMOA 3RZCC 3EZJB 4HUWB 5JXAH 1OQXA 1BOGB 5DQ9A 4NYLA 5FO8A 4X4ZA 2WM0A 2EECA 1JWUB 1KTKE 3RNKA 4F58H 1EO5A 1IAMA 4CU8A 4QXTB 3Q48A 3CAFA 3MUGB 1JGLH 4MSWA 2A83B 4FNLL 4Y5XC 3SY0A 1V3MA 4CL7A 4GBXC 1MRDH 2A73A 3FQNB 4OLVL 1T7VA 5E6ZA 4C56A 3S3PA 5C0EB 1J5OH 3GSNH 1YEIL 3HRZA 3K4DA 3OG6B 3PJSB 2EYSA 5CD3A 1HZHL 2IH3A 2X7LA 4HJ0C 2F58H 3ZTNH 5HHPA 1RI8A 1I3UA 2HYMA 2WUCL 1BQLH 1ZLVK 1CFNA 4UDTA 3UDWA 1JF1B 3RWIA 2XT1B 2VQ1B 1RUMH 5E4EC 2BXZA 3LIZL 4LCCC 2ZJSH 4YNYA 1HHHA 4CMHC 2ZCKH 1LMKA 4G6AC 3MV7B 4J3SA 4MYWB 2VLKD 3MLZL 2OCFD 3LVEA 1A4JB 1FO0A 1CLOL 5AYUH 5FIEA 3TIDA 2VRAA 3OX8A 4OI8A 1G7PB 5EOCH 2NY6B 4KC3B 2R2BA 4RMTA 3SBWA 5HYFA 5IVXA 2HT2D 1IGCL 1PKQB 1JPGA 3G6JB 1NCNA 1GOFA 3C6LA 3EYFB 4GXVH 3EYUH 4PJHA 4U1MA 3GHEL 4PJBB 4RGND 1I75A 5BZWB 3T0AA 3NN8B 3X3GH