4KZEH

Crystal structure of an rna aptamer in complex with fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BL3-6 Fab antibody, heavy chain
publication title A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/rna
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kzeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kzeH01
5CJQH 3TBWA 5EZIH 1NC4A 5C07D 4M93B 1X4YA 1A1NB 3O4LA 4ZFGL 2AS5M 3U46A 3QO1B 4I0PC 3QB7C 3GIZL 4R97B 3CH8A 2GT9B 3P2TA 1WTGT 4O2FB 3CMOH 1AKJD 3MNVB 2PXYB 4O02H 5IGXH 4YC2C 32C2B 2O93L 1RMFL 3QUZC 4MXVF 3FB8B 4HPOH 1JFQL 1FZJA 2Y9RT 4GMTL 4KMTL 5T3ZD 3LQZA 4WCYL 2GSIB 1H3VA 3T77B 3P9LB 2NZIA 4DZ8A 2L7JA 3F58L 5EH1A 2ICWA 4Y1AD 1MCFA 3WLWD 4UUJA 1H3PH 5I16A 1LP9A 4MJIE 1I4FB 4OD1H 2K1MA 5GJTH 2YUXA 3S36L 4LLVB 3DOSA 4G8IA 1JP5A 3ZE2F 4BA8A 1ZLSH 4MHHG 1SJHA 3DVIA 4Z95H 3UTZB 3O6LL 4S0TD 3O45B 4UV4H 1RZJC 1CXIA 3I02A 4V1DD 4L4VA 3FO9A 4R9HA 5C7XL 1FVDB 2F8OA 1FGNH 1WAAF 3WFCL 4NPYB 4Z7VF 3QDMA 5H35B 5DRNB 3GGWB 5BV7H 3MLTA 3VFUB 3VD7A 4HIHA 5DJCB 3S88L 2HLAB 2FGWH 4JM2B 1A0QL 3DNKA 4F9PC 1C08B 4N0FB 1KXVC 5DUMH 5EZLB 5EO1A 3ULVF 2BSSB 2I25N 4GW5B 3BZEA 3G6JB 1JNNL 1XCTA 2WUCH 1QFOA 4RA0C 5BXFB 2ZOKB 4YFEA 1DLHA 2FX8L 1DQQA 3QG6A 3E2HC 1XCQB 4PRDA 1KLUA 1YQVL 5K9KA 1EO5A 4TRPL 1A2YA 1CS6A 3KPSA 4H1LG 4Y19B 4JCLA 3JTSB 3V4UH 1A7NL 3C5SA 5IK3A 5ISZB 5L6YL 3SE8L 2A73B 1EMTL 2COQA 4FXKB 4Q7DA 1T04A 4U1LB 1AGEA 3X14B 1FVCB 1ZV5A 1JHTA 1T4KA 2EYTB 1RUKH 1Q9OB 1QVOA 3FRUB 4JFQB 4PUBL 1SVCP 4MQTB 4U6YB 3MV7D 4NQSB 4I8DA 2BNRD 3T4YB 2OJZH 5AZEH 1OP5K 3HZYB 3U4BH 4B41A 3IKKA 1VFAB 3MXWL 4WHTA 3SPVB 4UT7H 3BE1L 2X4QB 4GRWH 4HC1A 5HDBE 1GGUA 5IBLC 3TZVC 5EC1A 2DQJL 1QSEE 4ZD3H 4G5ZH 1XF4B 4PLOB 3ZKXB 1ITBB 4WW2F 2ZKHH 4ZYKB 4I3GA 2R2CA 5JQ6L 1ND0A 4X5WA 2KZWA 4K7PH 5AYUL 1NGYB 4ZQKB 1HN1A 1DBKH 2NPLX 4Q0XH 1GGIL 3H3PL 4P5KA 5EBWA 3OXSA 2EYRA 2YPLA 4PB0L 4GS7B 5IHZB 1V3JA 2BY2A 4KZDL 4PRIB 3DX7B 1SEBA 3J7HA 4HDIA 3JUZA 4Z76B 1X5YA 2M26A 5SWZA 3MZTA 3O0RL 3O2WH 4MNQB 3RVUC 3SGDI 4K94H 2XZAH 4YHZH 3ROLA 4HXAH 3O9WA 1H15B 3KYMB 4QXGH 3ARBD 3SGEI 2MMXA 4MCZA 4MA8H 4YK4C 1Z2KA 5E8OA 2AJYH 4NC1E 3D2UD 5MI0C 3B9KA 4XC3H 1I7RA 4Y16B 4DGVL 1RY7B 3T2OA 1XZ0A 3C60D 4NQVB 3M17A 2IAMA 2NNAB 2OL3L 1XF2A 3H7BA 1FL5A 1HH9B 1CU4L 3GSQB 3THML 1J5OL 5FK9B 2O61B 3QUMA 1D5MA 1FO0L 4S11A 1OAXH 2H8PA 3QAZB 1WLHA 2PETA 3LRGA 4H25B 5IWLA 3AAZA 3QDGB 1FL6A 2VC2H 4Z78A 5JDSB 3L3HB 1ZLUK 3PHOA 1NJ9A 3WFBL 4K8RH 3VI3E 3UJJH 1I9IL 3WD5H 4BSVA 1T0MA 4OLZL 5FUCE 3PUCA 2HT2C 1OQXA 1S9VA 3EUUA 4Q9QH 3IDNB 4IRJC 5DT1L 4IOIB 4ODVL 3CZJA 2W59A 4HC1L 2EIBA 3PP4H 2CIIA 4DUXA 4P9HH 5D96B 2Y07H 2AKRA 1QLFB 2DIBA 3MUJA 1CFNA 4RGNE 3PV6B 1PLGH 2CRMA 4NCC1 4KDVA 5JPMB 3PGFH 4DAGH 1NSNL 4OZ4B 3DIFB 1ACYH 3SDAB 3BQUC 4I3SH 3RBSA 3LRSB 5C0IB 4PJFE 3TCXA 4X6DF 2X9XA 4CMHB 1P5VA 4P59H 1FRGL 2VDOH 3BJ91 3MODL 3W2DL 4UQ2A 3HC0B 3ZDYE 3D18B 1P4IL 4FQXA 1T66D 1R5WB 4MA3A 3UBXA 1N5YH 1FIGH 3O6FB 1T1WA 2WQRA 1KJMA 1MFEH 5DLMH 3S37H 5B3NA 2NX5A 4PG9B 2ZJSH 3RVVD 2ESVA 4WI4A 5I9QC 1A6PA 4WO4B 2WIIB 4R0LB 3O3DB 5ACMA 2XTJE 2G60H 5IF0B 5E8PB 8FABB 3W39B 3VWJB 4LDEB 4PJAF 4X98A 5I8OL 2F53E 2XNAB 1YYMH 2WWKO 4KKLD 2AK1H 4D0BB 2DQEH 4BYHA 4AQ1B 3NACL 1XGPA 1FSKB 5E9DD 1R3KA 3QUML 3SDCD 1M71A 1LO4L 1NBZA 4JFXB 3DGGA 3KYOB 4U6VH 4M7JL 3FCTB 1RUML 5GPRA 1INDL 2YRLA 3E3QE 1S7VA 3ZKMC 4ZUWB 5GZOC 1ZEAL 1UH2A 4K23L 4MDIA 2BRRH 5M7QA 2P5ED 3ZYOA 3RNQB 2GK2A 3OKOA 4IOFD 3OBAA 5DJZB 1MJJA 2IADB 1VERA 3TNMA 4JFDE 1I7ZB 4R8WL 1WUNT 1XGYH 1K8DB 1QSZA 4HKBB 5IVOA 5F1NB 5FM5O 3T65A 3CSYB 3UJTL 4ZUUA 1JN6A 4PYHA 3NN8A 2AEQL 1QD0A 2JK5B 1XIWD 1G7IB 1WVZA 4NKOA 1A1MA 1L0QA 1CF8L 3EYVA 1UA6H 5LJYH 4UDUA 2J8UE 4HUUB 3PWJA 1WICA 5ICYB 2DI7A 1BX2A 4TQEL 4L4TD 5E1AA 3QUYD 4K8RD 4MA7L 4JM2F 3MUY1 4NCDA 2NY1B 3PG2A 2IG2H 1QFUH 4Y7MA 3FJTA 4LVEA 4JHZA 1U8IB 4J1UB 3QZWA 4M1CC 4U2ZA 1A1OA 3D85D 4DKEL 3VWKC 2QTEA 4B0MM 3QXWA 2P49B 2FBJH 1JIBA 3RI5F 1JPSH 1DBBL 4ZUTA 5HTSA 4C56D 4F15C 3N1MC 5TE7L 2RQ8A 3RKDC 5EU3B 5EOQL 2X9WA 4M48H 2A6JB 1TDQA 3CCHA 4JPIA 1U8HA 2E7LA 4AM0A 3MRMB 1N5AB 4OAWA 2MTPA 1BFSA 1ZT7A 1TCRA 3WBDA 4JFPA 1Q0XL 4JZNB 5AAWA 5ABDE 2VWEC 2VQ1A 3H42H 3C8KB 3DVGA 4XZUA 4EN3C 1HHHA 1Q1JH 3V4PL 5I8CB 2N4IA 1AC6A 3ET9F 4ELKA 3MRDB 3V4VL 1QRND 5INDB 4L8CA 4U1HB 5ENWA 2DJ4A 4QRPB 4EI5D 5IV2A 1DUYB 1KTDB 1OD7A 1YEGH 4U3HA 5CJ8A 3QQ4A 3QCTL 3M07A 4CMMA 4OTXL 2OXHA 1DFBL 4LVHC 2UY6A 4U6XB 2VDNH 3UTTA 2ENSA 3GJFA 5DI8B 1AO7E 3ARFC 2C9AA 3F5WA 2D03H 4ZXBC 1IAIM 1OAZL 5C3LD 4XPAL 3REWA 2I5YL 1WIPA 5HY9A 1X6NA 1LO0H 4QHMB 4XVSL 1ZVSA 1GIGH 3AM8C 2AV1A 2GITA 3E8UL 4LLUA 2AJUH 3PDDA 3KDMB 4HLJA 3O3EA 3HAEG 4W68A 5CBAB 2F53A 4TULH 5HHQB 4KHXL 4PTUA 1KXQE 1U8QA 2XWBA 2OLDA 4NRYB 5T5NF 4WFGD 5DD1L 3NFNA 1HYSC 4H20L 4ZO6A 1AIFA 4NC2B 1A6AA 1P4BH 4JZOB 5J6GA 1Q9KB 1F90L 3OXRA 3PQYB 1OAKH 5BS0B 1EUTA 1WSST 4HIIA 4LVOB 5EDXA 3TVMC 2VLJE 1RK0B 3D0VA 1XGUA 1NCBH 1OSZA 2Z8VC 2HKHH 3LV3A 5C0NC 5FEBA 1RJCA 1PSKL 5L2KE 4RGMB 3NAAL 1UM6L 1CLOL 4FQIH 4L5FH 1P2CA 4CVZB 1FCCA 1HSBA 4NM8H 3CZFA 5TF1H 4JFDA 1A7QL 4JEGB 4NC0B 4GSDH 1G7LA 3E6HA 3AMLA 1CGSH 3EYFA 4JN1L 4K9EC 4JRYD 4HFUH 1YN6A 3ULUF 5DD0L 4RGOH 2VZ1A 3HC4L 3S36X 3X12B 2HVJA 2W9EL 3U30C 2HFGH 5I17B 4S1DD 2XPGB 4BH7A 3RIFK 4MQXC 5HYSB 4F9PA 1I7UB 4LLMA 4GJTB 2KH2B 5JZ7D 3AS0A 4MGXA 3BUYA 4NO2A 4JFFE 2GSGA 4ALAH 4HS3A 4PJCB 3ZE1F 4R7NB 1BVKA 5T33L 5E6IA 2Q1EA 2HYMA 4TUOB 3TM6A 1S5IL 4KROC 3WCYA 3K74B 3T1WA 1U8LB 3JV6A 5DMJB 4MXQD 5BRZB 3LQAC 3FRPA 2C3VB 1MRDL 5I1JL 2E9BA 3DUHA 3PL6B 2X4TA 1LWRA 3SOBL 2AV7B 1QR1B 3FB6B 4WFFD 1CI5A 3MA9L 3PNWA 5C6WH 4OZFH 2JELL 4XMLH 4NRZA 3QQ3B 3S3SA 4UNVA 3QEGH 1WZ1H 5HYIA 1FDLL 3ECBB 3LN5A 2AABH 2E5EA 4KUCD 3WJJA 4BJLA 5J8OA 4FZEH 5DSCB 1MCBA 3BPLB 4OF6A 4G9FE 3RZCC 1D9KC 4TSAL 3QI9C 2R0ZL 1B4JL 5HVFB 4OZGE 4N0UB 5JHLL 1HXMA 3TO4D 4OCWL 1BQSA 5D2LE 2PO6C 5IMMA 4PJEE 5IQ7H 4EIGB 4AEEA 1HIML 2ICEA 3GHEH 3LS5H 2OZ4A 1YJDL 1Y6NR 4QEGA 4V2BA 2ZUYA 2BSED 3OB0K 4E42B 1FN4B 3S4SB 2CD0A 3VG9C 4P2RB 5D7SH 2FEEI 1TVHB 3IFNH 2C7UB 3ARGB 3V6BR 1HSAB 3I50L 5GRZA 4I5BB 4MD5B 2B4CC 3BKJL 3BH8B 2FLBT 4OIIL 5F97E 4KJWC 2KBGA 5GGQL 1DQML 4PRPE 3S35L 4PJBA 3L3OA 3HZMB 4E41E 3R06B 5GIRA 4JFEE 3FB7B 2BDNH 4O58H 2ID5A 4OUOA 1JNLL 3OJVC 4P57A 2O5ZL 3AU1B 1BWMA 2CK2A 2WANA 4I18C 2EXYD 2JJVA 4EUPB 1H3WM 5EIIA 2NR6D 5I6XC 3E0GA 3OG4B 2FX9L 1BJ1H 4FTVB 4I3RL 3BIAX 3LH2L 1G0DA 4G8GE 2IFGA 4TSCL 4R7DA 3MGOB 1T83A 4MVBD 1JZ6A 2C4FT 1ZLWH 1N6QH 3VH8A 4ELMA 1YYLL 1TPXC 3FO2A 4L8DA 1UJTA 1B0WA 1E6JH 2MQ0A 1S8DB 3N1PC 1KBGH 1W0WA 4YWGH 5BCAA 4ODWA 2AK4E 4ZAKD 4S2SA 1KB9K 4W4OA 4X4YB 1CD1B 1MH5A 2C1OA 2DIJA 5EB9A 5D6DA 2CKNA 3OPZH 3KWWA 3Q5TA 4YHPA 5GGUB 2LV4A 3LKOA 5DRZB 3VXSE 3K2MC 1VCAA 1VKXA 3GUTA 1BBJA 3NZHH 1RQ5A 4XBGA 1ZT1A 4Y4KB 3VMNA 3FQXA 4HUVA 2ZSWB 3MBEC 1AHWA 2PR4H 3NZ8A 3IYLW 1UZ8B 3H9HB 1I8IA 4WY7L 4Y2DB 4BQ9A 1DUZB 3W9DB 1T1YA 5KANI 4N8VG 3VFTB 1N2RB 3TNNB 5C0BD 1J1PL 1JHLH 4X6FA 1IGIH 5LBSH 1WCQA 5LXGL 5HI5C 3CSGA 2R56L 1R3HB 4NJAL 3GSWB 1ITCA 5BO1L 4LU5H 3TBSB 3U7WL 4M5ZH 3UTQB 2FRGP 4OJFH 4PLJD 4KKBD 3SJVD 3KPQB 1OARL 1TZHB 2VWEE 3BQUA 3VRLE 4HJGA 4MNHA 4XNYL 4U1IB 4ZTPL 4KY1H 1UEYA 4TUJA 4DTGH 1LVEA 3W0WA 4UOJA 4YH6A 4DOHB 3WXVL 2CK0H 4R2GD 1ZHNB 4YLQT 4NWUL 4YQXL 5KVGL 2HH0L 4PP2A 5KTEL 5DRWB 4RWYL 2IJ0C 2EO1A 4J6RH 3CH1B 2GY5A 2LFGA 3QXVA 4G9FA 1JK8A 4OZGA 3RWHB 5F3BB 3WEXA 4QNPE 4LSTH 2VXTH 3DJ9A 5D2LA 4PJEA 4XH2A 3U7YL 2UYLB 4PJ8C 5I1EH 4BZYA 2H2SC 1GGCH 2JIXA 4JFZH 1FAKT 1G1CA 1BOYA 1CDCA 4F7CA 1HHJA 3TA3D 4Y5VB 3U36A 1IAII 5ILTH 4RISL 4PGDB 2J88L 3OX8B 3BPOB 3JV4A 3VXME 5JDJA 4HX1B 4HWBL 2JCCE 3GIZH 5IM7A 4U7SA 1JZ7A 5CZXC 1MJUL 5HGHA 1FYTE 3TLRA 3FT3A 4WIQA 5I15L 3VI4E 2DQFA 4Z7WB 2XWTA 1X5XA 1U6AH 4D9QD 3PJSB 4E41A 2WMPA 1RMFH 2R1YB 4J3VA 1RIVL 4GMTH 5DO2D 5FM8A 5J6HB 4M6OH 1GC1L 3AUVA 3F58H 1H5BB 3MCKA 1JUFB 3KPRA 1I1AD 1T5WA 4OI8A 1F6FB 1U3YA 4N5EC 2XXMB 3VXRD 3DV6B 3FONB 2MHAB 5JIPA 4XWOD 4G8GA 5CIPB 5DRXA 1KJ3H 3R8QA 5HHNA 1MJ7H 3CIQA 3QWOA 2Y25A 5CEYA 1KJ2L 3JWOL 1F6AA 3WNKA 5GGSA 2J7LA 1FNGA 4BZ1H 4WHYH 2FHCA 1GJIA 5B22A 4A2LA 2QQKL 2VXSL 2PCPA 3FQRB 5KSAA 3SDYH 1G7JA 3T0VA 4KQ3H 4X9FA 3S34H 3BO8A 1KG0B 1RIUL 4K3DL 3VXUB 1KNOA 1QFWH 4JG1L 3EOYG 2HFEB 5TFSH 4DKFL 5JR1L 4FMKA 4OV5A 2OJEB 3IRZA 3WIIL 2ADJA 2OK0L 3MUHL 2VR4A 3N9GH 1I3GH 2QADC 4P2OD 5DHVH 2XQBL 3K2UH 5K59E 1F13A 4OGAC 4BFGA 3WHE0 2EXWD 2HTKD 3LDBB 4FS0A 4P49A 1F4YL 1I1YB 2CDFB 3EAKA 1VACB 3LPGA 1MI5D 2XI9A 3UO1L 5JHDD 4JRWA 4CKVX 1K85A 1AJ7H 4BSWA 5B8CC 4TNWK 5L6YH 3LVEA 3SE8H 4MD4A 2DBLL 3P4MA 2YC1A 3VFPA 3OSKA 5ACZA 3WS6C 3T4AB 4LGPB 5C08A 3SDXE 3A6CH 3QPQC 4RBPH 4YHNB 1T7XA 5JQHC 1AD9A 1AXTL 2BSTB 2NXZC 2E8YA 3MV9D 2HWZH 3E6FB 2J8HA 1LO2H 2PTUA 2R9HD 1IE5A 5F89A 1P7HL 1MFBH 4WJ5B 1YEFL 2V7HA 3JTTA 4PLNC 1XR9B 1MVFA 5JUEL 1KIQB 1EFXA 4BFIA 3BP4B 4AIZA 4Q97A 2FJGB 4LKCB 3U0TB 5JQ6H 1AQDA 1RZ7H 3QT2A 1S7TB 2YD8A 4KRPD 1IM3B 1G7MB 4LMQI 1WEJL 4HHAB 3VGEA 2VDLL 1X5KA 4IS6B 2IANE 1GGIH 2HG5A 1YDPB 4YXKL 4YHOL 3PGDB 2GK0B 4OD3L 4PB0H 4WWKB 3I3BA 1EPFA 1HI6A 3GHBH 2X1QA 4QOKA 4DFHA 3HE7C 4FQLL 3DXAB 3OR7B 3VXMA 3IDUA 1X4XA 4I77L 3RJDA 2EEDA 3WUWG 1DL7L 1SMAA 3QXUA 4PY8I 3OKNA 3P9MB 1IFHL 5ITBL 1L0XA 3J8F7 4JQXC 2JE8A 4Y0GA 4LHUB 3L5XH 3M1BA 3WNPA 1Q9LB 4L3ED 5DD3H 1L6ZA 2EDEA 3BZDA 4LPTA 5J4MA 5CKGA 1UYWH 4LAQL 4QRUA 3CXDL 3JWDH 1IGTB 3HPLA 5EUOB 3KYAA 1JGUH 1CU4H 3G04A 3RIAF 3C2SA 4JQVA 5CCKH 4LNRB 1YC8A 5F7NC 1FLRH 1NC4B 3O4LB 4I4WA 3QNYA 3RDTC 1T5XB 2VDPL 3JSSA 5TH2A 5HHMB 1I8MB 2DYPB 2PYEB 5TE6L 2P24A 4U1MB 5GGRA 2CLVA 5HVWA 5EU4B 2EDXA 1GSMA 3NH7L 4WV1C 3WFBH 1A47A 2V9RA 4P5TA 4F7MB 1UT9A 2GJ6E 3NGBB 1KTKE 4F8QA 4YHLL 3F7PC 2ED8A 5DT1H 4ODVH 3WO4B 4UUJB 2Z31D 3QIUC 4HC1H 1CDIA 5B21A 3WFHA 2GI7A 1LP9B 5CSZA 5MP6H 4HEPG 2VITA 1V7ML 4RDQF 4HIEA 3EDJA 4PGEB 1OTSC 2IGFL 3K7UA 4PJDF 1E6OH 4IMKC 2V2WA 1NSNH 2CXGA 4HXBH 4QTIH 4WUUD 4Z8FL 1T2JA 4BSJA 1EVUA 2VLLB 5B38G 5D71L 1UEMA 3QDMB 3V95A 1T1ZB 1JI2A 2IEPA 5A16A 4JGJA 1N6UA 4NDMA 4HIHB 3W2DH 2RB8A 2FL5A 4XCCH 2BVPB 5TGBA 3SDXA 3HZKA 3UAJC 2W0LA 1W0VA 3T2NH 2AQ2A 1CLYL 3GB7B 3QG7H 3RAJH 4U7MA 3KYKL 1D9KA 2BFVH 2OL3B 4K3JH 3SO5A 1KPUA 1MCNA 1KCKA 2VLKA 5K9KB 1IKFL 4EKXA 2H9GA 2PO6A 1MCWM 3B3IB 1FO0B 4JLRB 4PRNA 3FHQA 3IB4A 5DK0A 1ZHBB 3TN0B 5BQ7B 3QIBC 1NPUA 5JIKA 5J9PB 5D93C 4EOWL 5EU6D 5JLZB 4JVWA 5FYKE 4Y4FB 2D7OA 4XWGL 5C0DB 2M8XA 1S7QB 1Z3GL 1S78D 4FFVD 1JE6A 3WS3B 4O9HH 1A6TB 4L3CB 3ARDA 4NZUH 3KR3L 4TOYH 3AS3A 1LEIB 4JE4B 1YPZE 1G7QA 4L4VD 5T1MA 1AGBB 1CZ8L 1ZA3B 2CMRL 1INDH 1F00I 1MLBA 1F3DH 5EFIB 4N8PA 4K9EL 4Z7WF 3PIQA 3ZKND 3DX6A 4NNXA 3S5LA 1L6XA 4WDIB 3MV7B 5I2IA 1NAMA 3S35X 2JKXA 3VRJB 1I9RH 3D3VB 4ODTL 3EJZD 2EC8A 4LSQL 4XRCA 4NN7B 1NBYA 2NY4D 3BH9A 5DA0B 5EZOL 4KJYB 5CD3A 4R96A 4M7ZC 4WI6A 3QJFA 4H0GA 4UDTA 5LAXA 2HVKA 1FYHB 4L29B 3VJ6A 3KPSD 2AEQH 1QBML 3MUGB 4PB9L 3L7FA 2R0WL 2HN7A 3EO1A 3QPXL 4TVPL 2G9HA 2PKDA 3RIFF 5HJ3B 3GRWA 3MJ8A 3GBNH 1QBBA 1NMCB 3SY0B 4JY4B 2R0LL 5IG7A 4OQTA 4P4KA 4RFOH 4G8FB 2YWYA 3ROLB 5IQ9A 4PJIE 1TTGA 1UB5B 2CLZA 3O9WB 4NNYB 5DGQA 4L8SB 1ADQA 3U2SA 3C6LC 3GMNA 2WBWB 1ROWA 3NCJL 3MBEA 4RCAA 2JJWA 3MFFA 2GJ6A 4DKEH 3ES6A 1G1YA 1ULVA 4B50A 2WWMD 1IEHA 1WT5C 1VHPA 2IAMB 3OAZK 3HR6A 3KYNA 4LIQL 5TE7H 2AEWA 2R69L 5L88L 3FZUC 4P2QE 3KJ6H 3ETBF 1C5BL 3L7EA 2DJSA 2FD6L 2W07A 1VGEL 1C16A 2GQHA 4JGMA 4OFYA 4YGVB 2QL1A 4PJ5E 5D2NA 2ZOLA 3BSZL 2QEJA 5KAQG 1Q0XH 4LF3B 1JMZA 4YBHA 2LU7A 2R4SL 5K9JH 2R8SL 4LLYA 1FPTL 2BCKA 5JORB 4UILL 1ONQA 3V4PH 1QQDA 4HJJH 1U58B 3MOQA 4BQ6A 4YDVB 4YDKL 3OKEA 3QEHB 1T3FA 1T0MB 4KDTC 5D1QA 3U4AA 5I66A 2Z0BA 2H2PC 3O3AA 1CICA 5IVXE 4U3XA 1BIIA 1XH3A 2DAVA 3QQNA 4ODXA 5CJXC 4OTXH 3RBGA 1DFBH 5GRVL 1L9MA 2CIIB 2DQHL 3X3GH 3O2VL 2A6KA 2J5LB 1FFPB 3CFCL 1CFNB 12E8H 1EA9C 3IVKA 1TVBA 1NAML 3QDJA 4JAMB 3B9KD 2VUYA 2EDHA 5FUZL 4D0CB 2VZOA 1NDMA 4PR5A 3WLWC 1T7YA 5EOTA 5LCVL 3LKSA 5CP7A 1CWVA 3DRQA 2AJ3B 3MRGA 3HCVB 4JHWH 4MJID 4P46D 5HGAA 2DIAA 3V79C 5I1CH 3BP7A 5DD1H 4LVNB 3HE6C 2OR7A 1T89A 9CGTA 1F90H 1FQ9C 1N4XH 1D5BA 5F88A 3WIFB 3GRWL 3OKDA 1CVSC 1AXSB 3DETC 3O8XA 1X5LA 2GAZA 2NTFA 4DW2L 5HHVH 2NX5B 5I1AA 4HG4K 6CGTA 1A6WL 4HGWA 3BEVA 5F6IB 3EFFB 2OR9L 3GSXB 4OQTL 4OLEA 4IRZH 3GMMB 3ILQD 5CBEB 5I71B 4OLUL 1N7MH 5CEZL 1RZGB 1ADQL 2KL6A 2W65A 3B9DA 4XXDA 4OT1H 4GRLC 3BVNB 4R97C 4GRWB 4X4ME 3RPIA 3G5VB 1MREH 3NCFB 5CS7A 3RTQA 5FO9B 4NQEE 5F9AC 3TT1L 1CDUA 2OTWA 5EUOF 4PLKD 1DBAL 4U6TA 3U7AA 1XGPB 3LY6A 3DVNA 1PD6A 1CDJA 4TVSa 3MRRA 5F7WC 1MCQA 1YEJH 1R3KB 2Y5EA 1LE5B 4XI5D 2FIKB 5FGCE 3KPOB 1ZHLB 4RAHA 2NXYB 4G3YL 2R4RH 4ZFOB 4XTRD 5I1LB 3ZHDA 1QG3A 4LCUA 3G6DL 4QXUH 2DI9A 1WAAE 5KVEH 2AAVA 3MRHA 3MCLH 4KHTL 4HF5H 5DD6B 2VN4A 3CFBA 2Z35A 3IF1B 1BJ8A 3C87A 1CQKA 3TNMB 3FFCB 1GRWA 3ZDZF 1S3KH 2LAAA 5CUSH 1DBML 4BQCA 2YD7A 1A9BA 3FQWA 1S5IH 4QT5A 4N8CH 3IU4L 1VADA 1DQTA 5DQJB 3JV0A 2BHZA 4OCMC 1QSED 3NN8B 4K3EL 5FM4A 4ORZC 1MRDH 1VFBA 5I1JH 2ATKB 3RGVD 3QRFM 4P2QA 2P5EB 2BNQA 1A1MB 1IGCL 5GGVY 3MRFA 4KAQL 3HAEH 3O2DH 4GW1B 5KZCB 1I75A 3D25B 4YGAB 2JELH 3JZ7A 3Q1SH 1HDMA 4D0DA 4NO5A 3L3IA 5ETUA 1OY3B 4BZ2H 5ICXA 1QR4A 1JVKA 3BGMA 2H45A 1MIEH 3U0PB 2ZUQB 1I1FA 3K46A 4A6YH 4XVJL 1IAKB 1XIWB 1JGLH 5JHLH 4OCWH 1AY1L 1OTTD 3QZWB 5DEFA 2IBBA 3G5XA 1BLNB 1DQDH 1IAMA 4Z7NE 3OL2A 5DQ9A 5IVXA 3RWEA 1KPVB 4GAYB 3IGAB 4L4TB 4G6FB 2ZCKL 3QUYB 4X6EB 1J88A 4M6NL 5IB1A 3TPUA 4TN9A 2A9ML 2X4PB 1K4DB 2Z93B 3MLUH 4POZC 1BEYL 4JPIB 2OMBA 1OAYH 5IEHA 1CDYA 2A9NH 4N9OB 3C60C 3I50H 3VXPB 2XN9E 3SGJC 2X1PA 3O41A 5DMKA 1G9NL 2X44D 3EW3B 5CEXA 2X5PA 3F65A 1HHHB 4LL9A 2F74B 4XAWL 1MEXH 3O3BA 1X6LA 3A6BL 2EYSA 3FOLB 4HD9A 3MLRH 5E5RB 3WIHH 3R1GH 3NIGE 1RZJH 2R15A 1Q94B 2VABB 4PRHB 4RIRA 4G8EB 2BK8A 2FX9H 4KFZC 1K6QL 4NKMA 3GJFB 2BERA 3QHZL 5E1HB 1JPFA 1JZ3A 4TSCH 4X80L 5J13C 1P9MC 3V6FA 1FFNA 1ZA6A 5HGBA 2VXQH 4KWUA 1F5WA 1EEZB 1WWBX 4MAYD 4DKDC 4PY7A 2F54E 5F9JA 4X4MA 4GBXA 1E4XH 1KJVA 4EI5B 4XPGL 2E7BA 3CFEB 4OCYH 1AFVH 3HMXH 4U1KB 4QY8B 2A6IB 5DC0A 1F3JB 3MMEB 1WWAX 2ED9A 4UNUA 1NMBL 1MHHB 4U0QB 2CPCA 3G08B 4Y5YB 4PV8A 2KPNA 4RGND 1RIHH 4OZIB 4LKXB 1CFTB 4HV8B 4U1JA 1A3LL 1AIFB 5C1MB 3OXRB 1TNNA 3CXHJ 2ZSVA 4FQQB 1FNEA 4MDJB 1TQBB 2DLFH 5C6TL 3F62A 3CK0L 4FQJL 4QRRA 5FCUL 5HYJA 1RZIB 1HE7A 4GW4A 1IL1A 1DDHA 5DQDL 3WO3B 4P4RA 4MQSB 1JWSA 5I1IL 2NY0C 5ESQB 4J4PC 1NCCL 4DQOL 4TNWF 1NBVL 1XMWA 4WY7H 3DPBA 1NL0L 5FOBA 1WAAA 4Z7VA 1HSBB 4NQDE 3T2PA 1ED3B 2DQGH 4NQCA 4LQFL 5HYQA 4ZPVB 3MNWB 5SWSE 5LXGH 1MRFL 3UTTD 4NJAH 1IGYA 4HWUA 5BO1H 2WBJA 1PQZA 3VFMB 2OZ4H 4YNYB 5KSUA 2DOCA 1L7IL 1IT9L 4WEUD 2VR5A 1P4LA 1LO5A 3MRKB 4LDOB 3DRTA 4JJ5B 2XTJD 2EC9T 3DVFA 2HVJB 4HH9A 4DGIL 4XNYH 5HXMA 1YZZA 3AREC 1U3HB 3AGVA 2F53D 1YEDB 4D9LL 2BXZA 2JF1A 4KKLC 4BH7B 2ITDA 1MUJB 3WXVH 2XG4A 4NWUH 1KT2A 4RWYH 1S9YB 3TBVA 4AEHL 4PJ7E 4MB5A 3V0VA 4CRPA 1T80A 3LSOB 3U4EA 3QIWC 1DANU 4I0PD 1ZLWK 3U9PL 2EDQA 5IIEA 4O4YL 3BGFB 4K94C 1JPST 1E0OB 2DTML 4CMHC 1ORQB 4EIZC 2FATL 3N1QC 5T3ZE 5C9KA 3QUZD 4AEIL 4X5LA 3RVTC 3EOBB 2E7CA 3FTGB 1ZWIA 3S96B 2HT3D 1QLRA 4JFDD 5HVGB 2MOVA 5ID0B 3ALXA 4JHAL 4P23A 4WW2A 5E94A 4AENA 3CPLA 5E8EB 3ROOA 1FLTX 4M02A 2J8OA 3VA2C 4OLVL 1F4XL 3OKKA 4ZFZB 2NY2B 4YR6B 2V2XB 2PYFB 1KLGA 1YEEL 1RIVH 2OBGA 4DVRL 4CNIB 2MJWA 3WN5A 2NW3A 4HLZH 5E6ZA 4M4RA 1TTFA 1FG2A 3TC9A 3I75B 1FSKC 1UC6A 2YD6A 4O2EB 2Q7NA 3EYUL 4JO4L 1VEOA 2BJML 4ZDHA 3QRGL 4GRWF 1KPRB 3TO4B 3WDJA 3RNKA 1R24B 4P9HC 4M7LH 2F54A 5IHUL 1INEL 4PYGA 2QQKH 3UTSE 2VXSH 5D70H 1CG9A 3B6SA 3LKPA 4LSUH 1MAMH 1DVFA 5TJWK 3ULVL 1FL3B 2OR8A 3S3PA 4NQXA 1KCUL 5JXAL 3OHXA 3KS0H 4GAFB 1X5FA 3DYMA 1OM3L 1ZLVH 1B2WH 1NGPH 3TIDA 4RZCA 5F8QC 1RFDL 4JG1H 4DKFH 5IMLB 2WP3T 4TUKL 5JR1H 3A67H 1R5VB 5D1XA 1CLZH 3RP1A 4JCMA 4R7DB 3AROA 3PP3H 1ZS8A 3VH8B 5IBLD 3TZVD 4N0YH 5FDYA 3FO2B 2YD1A 2UWEB 4XBPB 2VTFA 4NQDA 3D1MC 5HHOB 3CJJA 3G6JE 4JPVL 3X13A 1HHKA 2NY1C 2YMXH 5BZWB 4ODWB 2DBLH 4S2SB 5GS1C 1AO7D 3DMMA 2IQ9L 4APQC 3QO0B 2A38A 4YHPB 4ZFFA 4JM4L 2JB6A 5D7LE 1VKXB 3WLBA 1BBJB 2X4UB 4Y19E 4XBGB 1U36A 1AXTH 4S0SD 2X7LB 3DUUB 5D1ZA 3HZVB 4LBEB 2X4SA 1EEQA 1AHWB 4RFEA 1CR9L 3CFJB 1G6RA 2AXGB 4KDTA 5KW9L 4PJ7A 5FKPA 1KJ2B 4GO6B 1IQDB 4X6DA 4X6CB 1EGJA 5AZ2H 3TJEH 3RVUD 5K9OB 1PKQB 1S5HA 3QNXA 2DWDA 5DR5L 2MPAL 2VLJD 4UTAH 1EJOL 1CFVH 3BDYL 4YDIL 4WNQA 4JDVA 2YRZA 4QHKI 3IU3A 4NKDA 3VFWB 3RVXC 5L2KD 2QSVA 3TO2B 2WQ8A 1MQKL 1I8LC 1KYOK 5DK3A 3AXLB 3P4OA 4MB3A 4LCCA 1FV1A 4OLYL 3T0EB 1L0YA 3RZWA 1O0VA 4JJHA 3W0WB 1WIUA 2DICA 1F4WH 1W0YT 3QFJA 4G42B 4F9LA 5IJKA 1BVLA 4XVTL 1DL7H 5A40E 1MCIA 2QR0B 4PJAA 3MYZA 4FOMA 2J4WH 3PWLB 4LSRL 4LRNL 4Z7UB 4PJXB 4OZFB 5IOPB 1ETZB 3B2UC 3MACL 3PWPB 4PRIE 3RX7A 3GK8L 4MSWA 5GRJL 1G7HB 3OAUL 1LMKA 1A1NA 5IHBA 4RX4D 4R2GB 2HT2D 3QO1A 4MNQE 2JIXB 1KCSL 1S7UB 4IRJD 4JY5L 4JFFD 4Q74A 4NZTL 2Y4SA 4RBPK 4F7CB 1UJ3B 4PD4K 3T0BA 3MNVA 2PXYA 3P73A 4PJHE 2XICA 32C2A 3FB8A 2GJJA 3CU7A 5E2VL 2AERT 4RGMC 2GSIA 2NY3D 3T77A 3P9LA 1OB1B 3N85H 4OZIF 4P0DA 1TLKA 2DQFB 2XWTB 3BQUD 1MFAL 1GPOL 1OGTA 2J2ZA 4W81A 2HFFB 3DBXB 1I4FA 4FQPA 3G5YB 3TA3B 4LLVA 4GT7A 4KK5C 1NCAH 1NFDB 2YUVA 1TVDA 2VH5L 3UTZA 1GCFA 3O45A 4ZODA 4G9FD 5C0GB 1FVDA 1G6RL 4NPYA 3K80A 5DUPL 3ME0A 5DRNA 3GGWA 1MCCA 1EGJL 4J23A 5DJCA 1I9JL 1UGNA 2HLAA 4JM2A 4Z8FH 1AI1L 1C08A 1EUUA 5LQBH 2BSSA 4GW5A 3G6JA 3D5OF 5BXFA 3VXRB 1JGDB 2VDKL 3UJIL 3MJ9A 2J6EA 2ZOKA 1J1XH 1NAKL 1JNJA 3IETB 2UVEA 2CRZA 1XCQA 3H0TB 2X70B 4ZNEE 1AE6H 1SQ2N 4UT9L 4QHLB 1CLYH 4Y19A 3CDGB 4MCYB 4OZHE 3ZLQC 3PL6C 3JTSA 5ECJE 5ISZA 4PRPD 2A73A 4U1LA 4FXKA 5C0RL 3C9NB 4E41D 3X14A 1FVCA 2MWCA 1TTUA 2EYTA 1Q9OA 1CGXA 4JFQA 1EXUB 3FRUA 3DUSB 4MX7B 4U6YA 4NQSA 3SDDB 3R8BB 1I85A 3BPLC 3BIBX 3KPRD 3QCVL 5E99L 3T4YA 4HIXL 3BISA 4JPKH 5JNYB 3HZYA 3GMOB 1VFAA 3SPVA 4QO1A 2YC1B 4XP6H 4G8GD 4MJ5B 4MVBC 1F58L 4JFYB 2X4QA 4XWGH 4PV9B 1JYNA 4WU7B 3Q3GB 1DEEB 4LP4A 5CZVH 4C57C 4E5XA 2YKLH 3W5NA 4EXPX 1XF4A 5GS0C 3MLYH 1MHPL 4OQ1A 2AJVL 3LN4B 4ZYKA 5JW4R 3MRJB 4XPFL 4ZAKC 1BGXL 2CMRH 5KSAD 3VGHA 4BFEA 3IJYA 4GFTB 3QEQB 5IROA 4YXLH 1F8TL 4K9EH 2V7HB 1NGYA 4ZQKA 3ARGC 3FB5B 2P5WE 3VXSD 3C5ZA 5I18H 4B7IA 1N0XL 3VFNA 3WJLC 1AQDB 3ARRA 1REIA 3JVGC 2AJZB 5IHZA 4OD2B 2FX7L 4LSQH 1OGAE 4KUCF 4G6JH 4Z76A 4YX2L 2UZYB 3EJYC 4M1CD 4D8PB 4K2UL 3VWKD 3O6ML 4MNQA 4PB9H 2RCSL 2R0WH 4Z5RB 4NQTA 2E7HA 1P84K 3UC0L 4ZO8A 3EIFA 1H15A 3KYMA 2MQCA 2XA3A 2UZIH 5H8DA 3I84A 3RKDD 4KRPB 3VXQB 1KEGH 4KKBC 3L5IA 1D6VH 1PBYA 5GSVB 2DDQH 1CTNA 4FZ8H 4Y16A 3KLSA 1FCGA 4NQVA 2NNAA 1UKSA 4JDTL 3MJ9L 5C86A 2J6EL 4D9RE 3M1BB 5DJYB 3GSQA 5CILH 5FK9A 4X7SL 5KJRL 3NCJH 2A6DB 3L1OH 5C92A 3GMPB 3HPLB 3UMTA 2R69H 3VGGA 1RUAH 3G04B 4H25A 3WKNA 7FABL 3PXHA 2UWEF 3QDGA 2ORBH 1IM9D 5JDSA 3L3HA 1S7RA 4L3EB 3BFOA 5I1GH 3GO1L 2ADFL 5F72S 2OTUB 1CFSB 4QCIB 2P24B 4Y2DC 5T1LB 5IT2L 1NUDA 2EDKA 3IDNA 5BW7C 4IOIA 4PPTA 4Z6AT 1DN2A 3I9GH 4IIQB 4PP1C 4YXHL 1KFAH 2PW2A 1UADC 4YHMH 1U93B 2B5IB 2K9UA 1QLFA 4QOKD 3BGAA 2B4CH 4ZNEA 3PV6A 1P69B 2OS7A 3VXMD 4POYA 5JPMA 4Z0XB 4IMLA 1A6VL 1F97A 4IRSC 3DIFA 3SDAA 3GBLA 1FYTD 2O5YH 5F9OL 1BPVA 2F5BH 3LRSA 3P4NB 5EC2B 5C0IA 1PZ5B 4L1DA 4KVCL 4X6CF 3TVMD 3NA4A 4K71C 4YZFF 3HC0A 5C0ND 3OZ9L 3ABZA 1J8HB 3ARUA 3DV4B 4H5SA 2LABA 5FUZH 3D18A 5DWUL 3KXFB 1UCBL 4XPHL 2FIRT 1JV5B 1R5WA 3FN9A 3LEVH 4QRPE 5LCVH 3O6FA 1P7QB 3UCRA 2Z31B 2FR4A 4OFIA 1JWUB 1K4CA 4PG9A 5DMIH 1RVFH 1AGCB 2GW5A 3UDWA 3BN3B 1X5GA 3B9AA 4ZUVB 4PJGB 4WO4A 2WIIA 4G9DB 4R0LA 4XBEH 3RWIB 5KVFH 4K3HA 2EDWA 1MFCH 3O3DA 1TZIB 4ZOEA 1S9KC 3B43A 4NKQB 5IF0A 5E8PA 4MNGB 3W39A 3VWJA 8FABA 2VXVL 3E1F1 5AG9A 4Z7UF 4RMUA 5D7IB 2BVEA 4PJXF 4P5TD 4Y5VC 4WI5A 3WE6B 2XNAA 3BPOC 4D0BA 2YR3A 4LNVA 2Z92B 4KVNH 3K4ZA 4MQXD 2SEBB 4F33B 2VB5A 2CJUH 3HNSL 3HI6L 4GG6E 3PQYE 5BS0E 4FA8A 2O5XL 3EYSL 4JFXA 3X3FL 1KCVH 3N1GC 3KYOA 3GSNA 3ULUL 1BD2E 4XPBL 3FCTA 3KJ4C 1DBAH 4KPHL 5I76B 1M4KA 4ZUWA 1UZ6E 3ARDB 1EFQA 1H5BC 1FP5A 5HHXL 3RNQA 1C5CH 1MCPL 2FYYB 5DJZA 2R29L 5D5MB 3NA9L 2XY1A 3HUJB 1UM4H 1NDGB 2IADA 4G3YH 1A14H 1MCKA 3GMLA 2DKSA 5EU6B 3SCMC 1I7ZA 4UIKL 3TFKD 3W82A 4HKBA 5JTWA 5F1NA 1QYGL 3CSYA 3MLVH 5FDWB 1NAMB 3EBAA 1FJ1B 3NTCL 1R6VA 3GI8L 1J05B 2NY5C 2NY7L 4WI2A 4Y4HB 1EHLH 2JK5A 1HOCB 3MV8B 1G7IA 1HILA 1NFDF 1V7NL 3AS2A 3RZCD 1D9KD 3QI9D 1DBMH 4R96B 1FORH 4HUUA 3M8OH 3IU4H 3PF2A 4DZBA 4XNMA 1MCJA 3WV0A 4OCXL 5LGKA 2EIZA 2PO6D 4K3EH 2RFXB 2UY7A 3MV01 2HN7B 4QGYA 1RUPL 2D9QB 1IGCH 1DSFL 5D8JL 2FEEL 2JJTA 3VGBA 4WTZA 3GBML 4AT6B 4H1LB 2JJSC 4PJCE 1U8IA 1NGZB 3QHTC 4U0RB 2EEAA 4J1UA 4X9BA 4RAUB 3QXTA 1RAMA 1S7WA 2IAND 2IFFL 1NCNA 2YS4A 3EZ8A 5FYKH 5BRZE 4RRPG 1YECH 4XVJH 4M5YL 15C8L 2CKBH 5IB2B 5EU3A 5TQ0L 4PJ9B 2A6JA 1Q9WB 3HRZB 3CVHB 1N5AA 3MRMA 3KNBB 5F7FA 4JZNA 4JO2L 4NP4H 2ZCKH 3NIDE 4M6NH 1OLLA 3GMQB 3C8KA 3L7EB 2YEZA 1J0HA 2B1AL 1IQWL 4OB5H 4N0UE 5I8CA 5D2NB 5D7JB 3I2CL 4HUXB 5F7DB 4J3WA 4M61A 3MRDA 3KPTA 1GZPB 1ORSB 5DD5L 1G9NH 4NJ9L 4QRPA 1DUYA 1KTDA 1WITA 4JR9H 4LLYB 3GSNL 4O5LH 1IC7H 4P9ML 4C59B 3GZKA 1QQDB 5CGMA 1J8KA 4HPYH 4S1SL 2DMCA 2EO9A 3IFLL 4QXWA 4XP4H 5HYFA 1EO7A 1NUFA 1A22B 2ERJB 3ELAT 1BIIB 5DJ0B 4WWKC 3QUXC 1L7TL 4M8VA 5I19H 4QHMA 3CLEH 2ADGA 4GMSH 5C09B 5E2TH 3MQIA 3KDMA 4UINL 1JHKH 5E4EC 4M1DL 5HHQA 3MBED 4EDWL 1PAMA 5BMFL 2DL9A 2LTQC 3K0WA 2GJ6D 3QDJB 4NRYA 4QRSB 3CFDB 4Y5XC 4JZOA 1Q9KA 4XPGH 1GGYA 3PQYA 4G6MH 3SKJL 1Z9MA 1BF2A 5BS0A 3ARSA 5JO5A 3TT3L 2DD8H 2GUOB 3LKSB 3QISA 4X7EC 4OLWL 4FTVE 5HI5D 3TIEB 2YOCA 4OFYD 1QOKA 1CCZA 4KI5C 1A3RL 3T0WA 4CVZA 1CVRA 3PWUB 3CK0H 2ZCLL 1IAOB 2QSTA 4OM0L 5EORH 4S10A 4B5EA 4LARH 1NCCH 4Z7OF 1MCSA 2B1HL 4P46B 4MJIB 1NBVH 3NCYS 4XXDB 5D1QD 5GSRB 4LDLB 2O26U 2VZ3A 4LQFH 4O51B 5CJOL 1NGXB 2P48B 5E70A 3X12A 3DWTA 1TXKA 2DM7A 3IDMB 5I17A 2MCPH 3WSQH 1L7IH 3OMZA 3HI5L 5HYSA 3ILPB 1I7UA 4ODBD 1YMMB 4WI3A 3GIVB 3AMKA 1IAIL 4DGIH 1DLFL 3IDIB 1KV3A 5FYKD 1Q0YL 3DTXB 5HHPA 3T1FB 4TUOA 3PHQB 4AEHH 2EH7H 2AVGA 3BDXA 3LIZH 5BRZA 3KPPB 4Z0BL 1QA9B 2C3VA 5CZXD 4O4YH 2AV7A 1QR1A 3INUL 3FB6A 3U83A 2IQAB 4X7CC 1CT8A 1TENA 2ZG2A 3QQ3A 4DOHE 4U49A 3IJHB 3ECBA 3TWCL 5DSCA 5GHWL 3UEZA 3EJZC 5GRUH 1QSFB 5I75C 3HG1B 4YDLB 1NUGA 4N0UA 2WNGA 1HDMB 4NO5B 4JHAH 5ADPH 2BSRB 4YHYB 5ICXB 1U8MB 5EOCH 1MPAL 5DS8A 1QSEB 5LVEA 2X10A 2QSCL 1JGVL 3RGVB 3DSFH 4PJGF 4Q9CA 4E42A 1FN4A 3OR6B 3S4SA 3HC3H 4P2RA 2IH3A 1QFWI 4DVRH 1TVHA 1LK2B 3H8NA 4GKZB 2C7UA 3ARGA 4U1NB 3RY5A 2C4FU 2X89D 5IFAL 1HSAA 1MSPA 4I5BA 1AP2B 4MD5A 4CAGA 4GAGH 5D7IF 4UT6H 4TPRH 3GSUB 3BH8A 3WJLA 3WFZA 2F58L 4MS8C 4XC1L 3EYUH 3JVGA 2AJXH 1UENA 2QADD 4JO4H 1NCDH 3UZEA 2BJMH 1HNFA 1NEZG 3HZMA 5IEHB 3MYJB 3R06A 4FNLH 4X8JB 3TYFA 4JREC 3GFUA 3FN3A 3GMRB 3IJSA 4FN0A 5L8LB 3ZDXF 1G9ML 1AD0A 3CDYA 3AU1A 1INEH 2P7TB 5JHDE 4RNRB 2CQVA 5DMKB 1Y0LB 1P6AB 4EUPA 2LVCA 2RBLA 4P2QD 1LE9B 4FXGA 4MAUH 2D4FA 3C2AL 4FTVA 1KCUH 4KTDH 4YUEL 2EYSB 3U0WL 1X5HA 4PJ5D 3MGOA 5D5MF 3RX5A 1K5NB 3HUJF 4YE4H 3QPQD 4TUKH 4RIRB 1CK0L 4CVXB 3C6SA 2DQCL 1RHFA 2NXZD 3EOTL 4TTDC 3L3GA 5CLWA 3T8XB 4PS4L 2NTSP 4P3DB 4X4YA 1CD1A 5D4QA 4MWFB 3D39E 4OCRL 2DL2A 5GGUA 3VXUE 5F9JB 5MENA 5DRZA 1KJVB 3O9WC 3TH3T 4Y4KA 1SM3H 3EO9L 4XP5L 4MHHI 1NLBL 4XHJD 3V0WH 2IQ9H 4KJPD 4QRQB 1UZ8A 2HMIC 1OVZA 1TJHL 1DUZA 2IAMC 3W9DA 2WIMA 5BW7A 4MAYB 3VFTA 5HPMB 3TNNA 1W72H 2IBZY 4JFHE 2YHGA 2B2XL 2OQJB 4H0HB 2BOCB 4WI9A 1R3HA 2V5RA 3D6GA 3GSWA 5IW3A 5E2WH 3TBSA 3HE7D 3UTQA 5KW9H 2BMKB 3SE3C 4YFDB 2D7TH 3UPRB 4NM4L 2HTLC 5F1KC 2VKWA 2GJZB 3DO3A 3KPQA 4NQCB 1UWEL 3ULSB 5HYQB 5IWLC 1TZHA 1FFQA 5F7EL 2MPAH 1A7RL 3OF6A 5ANMA 4JGUA 4AIOA 4PJFB 1EJOH 3MC0A 5JMRA 1LEGB 4U1IA 4UB0L 1G84A 1TJIH 1KOAA 4F7PB 3FN0H 5C0CA 1QZ1A 4YO0B 3S6CA 5DRWA 1N0LA 4F58H 1ZLVK 2OP4L 3TF7C 3CH1A 1YNLH 4HFWB 5DJ2B 5DUBB 1NCWH 3MR9B 3L95B 3EKCA 1NMAH 3FQNB 4HH9B 3HNVH 3RWHA 5F3BA 5JIIA 2LQRA 1MAKA 4NQED 4LQ1A 3DO7B 3KG5A 2X1XR 4NHCL 2UYLA 1NLDL 3HAEB 4MXWH 2YXMA 3HNTH 3MACH 2XTJB 4LEXH 25C8H 4ZS7L 3GK8H 2C26A 4XTRC 5GRJH 1MCDA 3W11C 3OAUH 4N1EA 4OF3A 5JW5B 4Y5VA 4GKNB 1X7QB 4PGDA 3V7AG 3OX8A 1KGCE 4LVNC 3TYGH 5I1DB 4HX1A 4FQXC 1KCSH 2F5AH 4JY5H 5JXEA 3SO3C 3CVIL 3H9SA 1EZVY 3CC5B 3O11B 5L9DH 2XWJB 4Z7WA 1ZHKB 4KUZH 2R1YA 5F6IC 2CUHA 4WW2B 4ZOBA 5E94B 5E2VH 5J6HA 2WBJD 4YC2B 5E00B 4HKJB 4KI5E 3QUZB 1OTSD 3RA7H 2XQYK 4IEFB 2APBA 1P53A 1H5BA 5IBUG 1JUFA 3UP1A 3CUPB 5KVDL 4OV6F 5IVZB 1RULH 3ZSSA 4RSVA 3FONA 2W9DH 2MHAA 2B7DT 5CIPA 1EO8H 2VDQH 5F71A 4XGZB 3O4LE 2FJHB 3ZT7A 2NW3B 3UAJD 5DFTA 5SWQB 5GISH 1K2DA 4NUGH 4CN6A 4V2CB 2XA8H 1G6RH 4S1RH 3FQRA 5DUPH 1P7KB 5B39G 1LEKB 1XGQB 1I7TB 1KG0A 1AI1H 1RUQL 3MCG1 1IC4L 2HFEA 4ODHL 1T03L 2OJEA 4KK8D 5T1KD 2VDKH 3B9VA 5I1HH 5DVMA 1LP9E 3KPLB 4NC1C 2FECI 4P23D 1I1YA 2CDFA 1VACA 5D1XB 5FA3B 1HZHL 5MEPB 3QDME 1U8JB 2XZCL 3QYCA 3V9FA 4Q2ZB 1R3LB 4XPTL 4WGWB 3T4AA 1PY4A 5DGRA 4R26H 3TEUA 2VLRB 1CBVH 2YN3A 2I9LA 3L3JB 1I3UA 3WMSA 1WJ3A 4YHNA 1HKLL 2AJSL 2ZUQC 1IARB 5TE4L 5BVPH 2BSTA 4KI1A 3E6FA 3K8KA 1GGBL 1ZGLB 1IC5H 2LAGB 1XR9A 1KIQA 3TZVB 2F54D 4PG2A 3LS4L 3BP4A 5HDBF 4FFYH 2FJGA 4OGZA 5ALBL 2X4SB 3U0TA 4GAJL 1H0DB 1S7TA 1HHGB 5E08L 1IM3A 1ZT4B 4FMFA 4RGNC 1F8TH 1G7MA 4HHAA 4IS6A 2AXFB 4X6DB 4JPWH 4EEEA 1ZGLM 5FGRA 1YDPA 1N0XH 4WHYG 3PGDA 2H26B 2GK0A 3H6JA 5I74C 4WWKA 1SBSH 3QBTB 4AH2B 4TSBH 3C6LD 1UACL 1ZK9A 5FF6B 4EBQL 5CINL 2CIKB 1OPGH 1U3ZA 4CDHA 3VG0H 4ZG1A 3DXAA 3VMPA 3KLHC 3OR7A 4XMPH 3BIKB 1BQHG 5LGHL 3P9MA 4NQDD 2R2EB 5M95B 3UC0H 1KN4L 3FZUD 5SWSD 1RU9L 3EYQC 1A7PL 1KCRL 3D3VE 1Q9LA 1TETH 2VLJB 1GZQB 4HKXB 3QFJB 4S1QL 2D2OA 1S7SA 5DZOA 3EJJX 3QQ9D 4M03A 2AGJL 5L2KB 5CHNB 2YPLE 4YHKL 4P2CG 5L7XL 3MJ9H 3IAQA 1IGTA 5EUOA 5KJRH 5D1ZD 4MSWB 2VIRA 4KU1A 1NC2D 4AIXA 4LNRA 3S3JA 4XCEB 2A1WH 2NCMA 3DX9B 5SWZE 3GSOB 1T5XA 1BAFH 4XCYB 1I8MA 2B0SH 2DYPA 2C3GA 5E8NA 4ISVB 2PYEA 3TP4A 1RJLB 2H2PD 4M7LT 2Z4QA 4U1MA 1OWWA 1YJDC 3P73B 2CLRB 1BM3H 4R4FH 5EU4A 3E3QC 1XGTA 4N8VB 2DLIA 2ZG3A 3GO1H 2ADFH 4F7MA 1IGFL 5C07A 3AB0C 4DCQB 5TQ2L 4Q6YA 3MLPA 1KELH 1ODAA 2R39A 2HT3C 3VI3F 4IRJB 4YXHH 2OI9C 1OGTB 3PABA 3TH4T 4JFFB 1CGUA 1MHEB 5C0JB 4ZUSB 1C1EL 1AKJA 4JVUA 2VL4A 1NH6A 5FHAL 4PGEA 2A83B 3VXOB 5IB5B 2GKIA 3HE6D 3QXAB 4XNZB 3LHPL 4LCYA 2VLLA 5HPOA 1T1ZA 3O4OC 6FABH 4M3JA 3DETD 1BFVH 4HS6B 3H9ZA 4WI7A 1U3HC 1FAIH 1GHFH 1N59B 2BVPA 2FSEB 3OZ9H 1OLZA 1SY6A 4PJFF 2ED7A 1N64H 1TZGH 4WFHE 3GDBA 1UCBH 2UV3A 1UKTA 3GB7A 1YNTB 1UWGL 2D0GA 4GRLD 4WEBL 2D31B 4NYLB 3V2AR 3ZDYF 4KKCC 1ZTXH 3BGFC 5SX4I 2OL3A 3MLXL 2BC4B 5E6IC 1C12A 2PXYD 2GYSA 3TBTB 4F7EB 4FQ2H 3C09C 2XYCA 3B3IA 1FO0A 4JLRA 3QNZB 4ZNCD 4AMKL 1ZHBA 3TN0A 5BQ7A 3P0GB 2QQNL 3UTSD 5BJTB 3WKMH 5J9PA 5JLZA 4MLIA 2X4RB 3BW9B 1J87A 4Y4FA 4ZTOH 3UZVB 5C0DA 1S7QA 3WS3A 5FOJA 3WJJC 1A6TA 4L3CA 4OFDA 3ZTJH 1RZKL 3MRQB 4UBDC 1X9QA 3HNSH 3HI6H 2CDEA 4F57H 1LEIA 1AGBA 2X4OB 1ZA3A 4ONGL 4GUPB 4PRPB 2NYYC 3SE9H 2NX5E 3D69B 1B90A 4KPHH 2IBZX 5DXWA 3GI9L 4E5XB 5EFIA 1MJ8L 2ESVE 4JFEB 1F42A 4JM2D 4C4KT 5HYEA 1K3IA 3I6KB 4WDIA 3MV7A 4F2MB 3VRJA 3ZHLA 3D3VA 4G7YL 1CD9B 3IJYB 4P2YA 5KSBB 4KJYA 1QYGH 3HR5B 5GRVK 2EH8L 3CDCA 1PG7L 4LEOB 3IS0X 1GAFL 4M9OA 3C5ZB 3C8HA 5D7LD 5J1TC 3VFNB 4L29A 4Y19D 3MUGA 3RY6A 1XGRB 4BFBD 2IPUK 3V5HB 5ISZD 2Y1VA 3Q6GL 5HJ3A 1RD6A 3IDXH 2AK4B 5J3HC 5J1SC 2X09A 3QDHA 3SY0A 4JY4A 1CXEA 5SV3A 1UQSB 4ONFH 2OCFD 2QHRL 1DQJB 5GGTH 4G8FA 4WUKH 2J8UF 3VXSB 1WBXB 1UB5A 4JB9L 4NNYA 2ATPB 4L8SA 2XACC 3GBMH 3V8OA 4Z77B 3ARXA 1EHAA 2WZPD 1SY6L 1LILA 3FFCE 5CWSB 4POZD 1T83C 5CD5C 4HS8L 1R3IH 4PRAB 3KGRA 4LSPL 3VWKB 2V7NB 4M5YH 15C8H 3MFGB 5ELIA 2YPKB 4AQOA 5TQ0H 4F15B 2E27H 4W4OC 4YGVA 1EZVX 3B5TA 5EU7C 4HQQH 4FABH 5D6DC 4UU9B 2A77L 4OBRA 3SE3A 3STZA 1GC1C 3VGFA 4LF3A 3IDGB 1SEQL 4PY8J 1WZKA 2FH8A 4OLXL 4ODSL 4AL8L 3FQTB 1S7RB 2WK2A 2B1AH 1AHWC 2BNUB 4PRID 5JORA 2EDJA 3CLFL 1U58A 4EN3B 4YDVA 1PG7W 3QEHA 1HINH 1E4XI 2Y23A 3JWOC 4MNQD 2X6MA 4LLAA 1QSVA 1Q8MA 2XY2A 3ARZA 4IJ3C 2PW2B 2V17L 1RSFA 5DJ6B 1MCOL 3QCUH 2VR9A 2DI8A 1FFPA 3HMWL 4UIMB 2XFXB 3RJQB 2NY3C 3FQUB 4CU8A 3ARFB 4UTBL 4IMLB 4JAMA 2CGRH 4Y16D 4ZXBB 1JPGB 4D0CA 5C2BL 4JQIH 2Y36H 2HKFL 3GJEB 1OF2B 2YZ1A 5AWNL 3T0EC 4M1DH 3WUWB 4EDWH 3BKMH 3UYRH 1NGWB 2AJ3A 3HCVA 3D0LB 2DQIL 2NY0D 4J4PD 4OSUL 4U05A 3UXFA 4H5SB 4X7FC 2DJUA 2FO1A 1CXHA 4HK3N 4ZSOB 3SKJH 2JCCB 4PRHE 3HFML 3B2VH 3WIFA 2FR4B 4D3CH 5EPMA 3RU8H 1AXSA 1FYTB 5DHXB 3UTTE 3F6IA 4EQ2A 3ZO0A 1K4CB 3TVMB 3EFFA 4G43B 3GSXA 5CJQL 4YFLF 3UBXG 3GMMA 5CBEA 1RZFH 3MOAL 5FA4B 2ZUSA 1RZGA 1KTLB 2CXKA 5EZIL 3UX9B 1E4KA 3MRNA 1LNUB 3BVNA 2ZCLH 3G5ZB 3AC0A 3G5VA 1TJGH 5FO9A 3OAZH 2AXHA 3IXAA 3ARED 2V6HA 4WU5B 2VQUA 3C08L 4O02L 5IGXL 3DECA 3FT2B 4HPOL 1KIRB 5JA9A 1ES0B 1YUHB 1LE5A 3QIWD 4HGKC 1QFHA 5CJOH 2APVA 2FIKA 3KPOA 3QEUA 1ZHLA 1INQB 4YFLI 3GSNB 1DQLH 1D5XA 5ADOH 4NFCA 4HCRA 4ZFOA 2CH8A 3GKZA 1H3PL 5I1LA 4N0RA 3RVTD 5HVHB 4QGTA 1H8NA 4OD1L 2I9TB 5GJTL 3BPCB 4Z95L 5DD6A 3IF1A 1FIEA 3CGTA 3GMLB 3FFCA 4UV4L 3WNLA 3IDYC 1U8OB 3NPZB 1FGNL 4HIJB 2QQLH 4OM1H 4L8BA 3T3ME 5B38B 2Z8RA 5DQJA 5BV7L 4KROB 5D6CB 2FGWL 1HILB 2ATKA 2P5EA 5KSAC 5DUML 3INUH 4AYFA 3R4DA 5IR1B 5F6HI 2WUCL 4GW1A 3MGAA 2LVEA 5FKAB 3D25A 4DZBB 5CP3H 2IH1B 3MRCB 4XNMB 2EIZB 2QKIB 3B8SA 5KS9B 2P5WD 2DB8A 5EBLB 3VFSB 1CGTA 3TWCH 4NWTH 1X5IA 1MQ8A 5GHWH 5ESAA 4ZPTB 3U0PA 3I6GB 2YK1H 4QLRA 5F7UA 4M7KH 1IAKA 3SQOL 1XIWA 3RZCB 1OGAD 4OIBA 3RWDB 4BKLA 3V4UL 1RV6X 4D94A 5BZDA 1S7WB 4KJQC 3PHSA 1BLNA 1MPAH 1YEIL 4LASL 5F1OB 4X0KB 4OZGF 5J12B 1KPVA 4GAYA 3IGAA 4L4TA 3QUYA 4X6EA 5DTFB 5D2LF 4PJEF 4OGXH 1FNLA 2X4PA 1K4DA 2Z93A 4XP1L 2OJZL 5AZEL 3U4BL 4DGYL 4K3GA 4ERSL 3W9EB 2OSLB 3MUZ1 3PE9A 4C83B 3VG9B 4UT7L 3FL7A 3VXPA 2YA2A 1X5AA 5T1DL 1KB5H 2IANB 4NBYB 1WCBB 4ZD3L 5DK2B 4D9RD 2YEZB 4XB8A 2ZKHL 2HJLA 1BOGB 2F74A 2XKNB 1K3ZA 1IKNA 3FOLA 4M61B 4HULB 2ZCHH 4LGSB 3G9VA 1Q94A 2VABA 4PRHA 1DBKL 4G8EA 4Q0XL 4I18B 4HCRL 2BVTA 5ESVB 2P8MB 5F96L 4ZFOL 2NY1D 2APTA 4F7TB 4YUEH 3MLWL 3PDOB 3OG6B 5GS3A 4APQD 3LKRB 5DJDA 4DEPC 4ETQB 1EEZA 4I2XB 1CK0H 5KSBF 3VFOB 1QRNA 5IP4A 2ADGB 1TPXB 3WNNA 2DQCH 5FGBA 3O2WL 4EI5A 2RR3A 3CFEA 2WUBH 2Z9TA 1P6FA 4U1KA 4QY8A 2I07B 4PJBE 2A6IA 1I1CA 1F3JA 4HXAL 2VOTA 3MMEA 1MHHA 1M7DB 1U92B 3G08A 4Y5YA 3TV3L 4OZIA 4GLRI 4LKXA 1Q38A 1CFTA 4HV8A 1PX4A 2AJYL 4QWWC 4JRXB 1BP3B 5CZKA 1IEAB 4MA1C 4FQQA 4RWHA 4MDJA 1BMGA 5JO5B 2Q76A 3EO9H 1S9XA 1OW0A 1RZIA 4XP5H 5ESQA 3BWAB 2RJMA 3ISWA 4ELME 4NZJA 1HXYA 1MRCL 3RVXD 5TPWL 5IJVB 3MBXL 3EOAB 4PREB 5B4MC 1G6VK 1OAXL 4QRPD 5I8EB 1ED3A 3BP6B 1CIUA 4JQVC 2B2XH 1XF1A 4ZPVA 1YEKH 3MNWA 3HI1B 3X11B 2HRPL 4JKMA 5GS0H 2VC2L 1M6OA 3VFMA 5EU7E 4YNYA 2LU4A 3LN9A 4K8RL 3B4NA 3LPWA 3UJJL 5C0AB 3MRKA 1V8HA 3WD5L 2E6PA 4JJ5A 4K7PY 5GJSL 2EDYA 1P1ZB 4Q9QL 5FGSA 3B2UD 4HZLB 4P5TC 1U3HA 4HWNA 1YEDA 1S9WB 5J89A 1MUJA 3PP4L 3VRLF 5JW4Q 1CN4A 1MNUH 3LZFH 1S9YA 1MWAH 4FQCH 2APXA 3LSOA 4X6CE 1BQLH 1RJYB 1PLGL 4JRYA 3VCLB 1PKQE 3PQYD 3PGFL 4KTEH 4DAGL 5BS0D 3QWRD 3QXDB 3ESVF 5IMOB 2X4NB 5HHPB 2PW1B 1ORQA 4I3SL 5B3JE 1BD2D 4N1CA 5E24E 5AEAA 3L9RB 4YAQA 4K07A 4P59L 4NHCH 2VDOL 3OKMB 3EOBA 3FTGA 4CVUA 4QNPF 3OKLB 4AZ8A 4CW1B 3RL1A 3STLA 4PJ8B 2DMBA 5C2UB 1U2CA 3S96A 5L0QC 3TFKC 5IVNA 3T0EE 5DMGC 1CT8B 2YSSB 3FRPG 5ID0A 3W0WE 1MFEL 5DLML 1JZ5A 2OX5A 4JG0H 2CKBB 3IFPB 4KK5D 5A3IC 1KB9J 3MGTB 5E8EA 1R0AH 3VFGH 3U6RA 2ZJSL 4MD0B 4ZFZA 5GQBA 5EBMB 4YR6A 4PJXE 3K4AA 2IBGA 2V2XA 2PYFA 3ZL4L 1YPZB 1ZVYA 5C71A 1WC7A 3PWPE 5HI3C 1PKOA 2JCCF 2PF6A 3VD4A 5DS8B 2D9CA 4CNIA 3VI4F 3PWVB 5FB8B 3GKWH 5KVDH 1AQKH 5EA0H 4Q6IB 1YYML 5IB4B 2AK1L 2DQEL 3I75A 5IEKB 4O2EA 3K81A 3CX5K 5E8DH 4YPGB 4NNPL 2IH3B 4FP8L 3BZFB 1O7SA 1KPRA 2YD4A 3TO4A 5BVJB 1F2QA 4OI7A 1R24A 1ZSDA 3ARDC 2WM0A 4X7TB 2I26N 1L4IA 3FMGL 5BRZD 3JXAA 3LMJL 4XNQB 3PL6D 1FL3A 1PG7X 4X4ZA 1AGFB 4UQ3A 3TYFB 4L1HA 5EIVA 2Y6SC 3IJSB 4R90H 2LU3A 4XP9H 1AD0B 1RUQH 5EWIH 1XGYL 4AG4L 1BWWA 3KPRE 5IMLA 2VZSA 1C7TA 4JDZB 2W91A 1R5VA 4MMXC 4QYOB 3HLAB 2E9IA 4FXGB 1T20B 3MXVL 4PJIB 3VFVB 3V5DB 3KVQA 4LRIA 4YIQB 4H26B 4HUWB 1UA6L 2EIDA 5SX5H 2YUZA 4NZDA 5IW6B 4DVBB 3IFOB 1RURH 2UWEA 2YA1A 3S98A 4XBPA 3V5KB 4LSSH 2R0KH 5GS0D 1I3RB 3C6SB 4HWBA 5HHOA 2NY6C 2ADIB 3MLZH 4C58B 5IHLB 3EO0B 3L3GB 3QR2A 1CE1L 3BP5B 5BZWA 1U9KA 3TCLB 5B8CB 4OF7A 4I1NB 2NQCA 5IFHH 2J12B 2IG2L 1JPTL 1CL7I 4P99A 3QO0A 1YNKH 4G7VL 4P4KC 3ARGD 2FEDC 2P8PB 2L4OA 4X5XB 5MENB 1WWCA 1J0JA 2X4UA 1CYGA 2FNBA 1B4RA 4J3SA 5KS9F 2VXUL 2YBRB 1BBDH 2FBJL 2X7LA 3DUUA 3SDXF 3OGCB 5J11C 4KZEH 3HZVA 4LBEA 1JPSL 4NZRH 4PJ9C 1GGBH 3CFJA 2AXGA 1BREA 2DQTH 3EJYD 4HLZG 1KJ2A 1IQDA 4LCIH 4X6CA 5K9OA 1PKQA 3HTLX 3TH2T 4PJDB 4MLSA 5IBTL 1JWMB 4FTVD 1FNSH 1DP0A 5D2NC 2VE6B 2XXCB 2V5YA 1IILE 5C08E 3VFWA 35C8H 3SE4A 4CN1A 3TO2A 3QFDB 5MEQB 1B6UA 1EDQA 3LPFA 4JY6B 4NT6B 4LP5A 3AXLA 5ANMB 3SGKA 3DI3B 3MJ6A 3P11L 4G6AD 3T0EA 5TDPA 5C0CB 3QEQE 4LCWB 1Y18B 2WP3O 1TMCB 3T0AA 3WUZA 5D1QC 2H3NA 2NY5H 4G42A 2ZUTA 1CICC 3HE7B 1D6EB 2D03L 2QR0A 3WNMA 2XG5A 3PWLA 4Z7UA 3SJVA 3VA6A 1IZKA 4PJXA 4OZFA 5IOPA 1ETZA 3PWPA 3Q2CA 2AEPL 2AW2A 4S1QH 1LO0L 3P0VH 1GIGL 1G7HA 2AJUL 3MSPA 3GSVB 1J10A 1HQRA 1KC5H 4TULL 4JKWA 4FFZH 4Y2DD 3MLSL 1CDGA 5ICZB 1S7UA 4MJ6B 2HAZA 1IMHC 1JI1A 4HKZB 1YY8B 43C9B 1P4BL 4PP1D 1UJ3A 1M7IB 1FNHA 4ZS6C 4QOKE 2W60B 4NQEB 4RMTA 4ZFGH 1T22B 1NCBL 3RDTB 1T89C 2HKHL 1OB1A 5DVLA 3H9SB 1A8JH 4IRSD 3WYRA 2HT4C 3O8XC 4FQIL 2VMFA 2XQYG 4DK6A 4NM8L 1JFQH 4KMTH 1A4JB 2HFFA 3DBXA 1JZ2A 1IGFH 3G5YA 4WCYH 3TA3A 4WV1B 2H32H 1NANI 5E03A 2A2QT 5TQ2H 1NFDA 2EIEA 3W81A 4GG8A 4GSDL 2BY0A 1CGSL 5C0GA 1G9NC 3RTQC 4NGHL 3QIUB 4CGTA 4LSVL 3S36H 3NIFF 4RGOL 4NKIL 2HFGL 5KAQF 3O6LH 3IKCB 1KACB 1K2DB 4RMVA 5H94A 5C7XH 1UXSB 1BZ9B 2VSDA 3WFCH 2E8ZA 2C3HA 3PGCB 3VXRA 1JGDA 3DROB 1B3JA 5AD0B 3S88H 4ALAL 1A0QH 3IETA 2ZUXA 1JRHI 1EBPA 3H0TA 2X70A 5H37H 4QHLA 2NLJB 1JNNH 3CDGA 2A0LC 3O81A 4MCYA 2N7AA 5JXED 4YDJB 4WEBH 5E4IA 3HRPA 3FO0L 1EAPB 2FX8H 3C9NA 1KCLA 1YQVH 4TVPE 4TRPH 4HWEL 3RI5K 1EXUA 3DUSA 4MX7A 1YMHB 4HMDA 3SDDA 1J8HE 2VDRL 4XMLL 4P5MA 3L6FB 1A7NH 3KXFE 1NEUA 3DSNA 3JBG7 3QEGL 1WZ1L 1EMTH 3BN9D 5JNYA 2AABL 4KQ4L 4FZEL 3GMOA 1J0ZA 5T1KB 3QIBB 1WFTA 2XKSA 4P2OA 4MJ5A 1B88A 5CAYB 3MA7B 1FBIL 4JFYA 4PUBH 3SCMD 4PV9A 4WU7A 4L4JA 3Q3GA 4F3FB 1DEEA 2I9LB 3T3PE 1VEMA 4PJGE 2XN9B 5IQ7L 4KC3B 5K33A 3MXWH 3WL9B 3LN4A 2KQMA 3MRJA 1JNHB 3BE1H 5FXCH 3LS5L 4LIQE 3HS0B 3VMOA 1DN0B 3QEQA 2VLKE 3GI9H 4EQ3A 1T2QL 2DQJH 5CFHA 2YPVL 3FB5A 1YPZF 3D39D 3RWFB 2FZ3A 3VXUD 2DMKA 4G80B 3IFNL 5E5UB 3OJDB 5IMKB 1II4E 5JPNB 4UOW0 2AJZA 4R4BB 4OD2A 4XHJC 1JF1B 3F6LA 1MVUB 4KJPC 2BVUA 2BY1A 5AYUH 1JYVA 3IAPA 1H3XA 1TCMA 1GAFH 3H3PH 5AAMA 1IGJB 1FZOA 4D8PA 4M7ZB 4LPWA 2I60L 4O58L 2BOBB 1FFRA 4Z5RA 4KZDH 4B7LA 4JFHD 1PW3A 3K4DA 5KBNC 4J7RA 3Q6GH 1OTUD 1EBAA 2LE9A 3VXQA 3O0RH 3VXTA 4OBSA 2PTTB 5GSVA 3RUGB 4NO0D 5F9WB 4FG6C 1N6QL 4BELD 4M1GL 4K7FA 3MV8E 5DJYA 5DDHB 1AXIB 4WW1B 2VSCA 1E6JL 2A6DA 1KBGL 2Q3AA 5ACLA 4YWGL 4HS8H 4XB7A 1S7SB 4PJIF 1T21B 4QHKJ 4DGVH 3ARWA 3SKMB 1U8PB 3BESR 5EO0B 5EN2B 2OL3H 4GBXC 3GMPA 5EO9B 1KEML 1A6ZA 1HKFA 3THMH 4GH7B 1J5OH 2VIRB 2H6PB 1FO0H 2B39A 2K7PA 4L3EA 3LCYA 1OP3H 2OTUA 5E8NB 1CFSA 2PR4L 4QCIA 5AUMB 5T1LA 2Z4QB 2VL5B 5CSGA 5TDOB 4J3UA 5CEZE 1RHHB 5I1KL 4WWKD 3QUXD 3SKOB 5J06A 4I0KA 4IIQA 2PN5A 1XGTB 4O00A 4XVUD 3CAFA 2X2YA 1U93A 5D72L 2H41A 1JHLL 5LBSL 1I9IH 1IGIL 1A5FL 3PDGA 4OLZH 5C07B 1F4HA 1KGCD 2NW2B 4NSKB 4Z0XA 5GZNC 4ACPA 4O2CB 3PABB 1H8OA 3QJHB 5JW4N 4HJ0C 2V17H 3P4NA 5EC2A 1HHIB 1PZ5A 1RJZA 1MCOH 1GVIA 1SYVB 4LHUD 1AKJB 3ULVC 2WBJC 4FQHA 5IVXF 1KN2L 5D2NE 4YEFA 2VDML 4KI5D 4UTBH 4DK3A 1J8HA 4DTGL 3FOMB 3DV4A 5DHVA 5C0EB 3KXFA 4LCYB 2G5BB 1DBJL 1JV5A 4Y1AB 5DJXB 1P7QA 3ARYA 4J6RL 4Q9BA 1FRGH 2Z31A 4WGVB 3MODH 4EVNB 4OSUH 1NC4D 1JWUA 3NVQA 1AGCA 3O4LD 4JVPA 3REVB 4LSTL 3U9UB 4ZUVA 1P4IH 4LLDB 5HHMD 4PJGA 4G9DA 4RAVB 3RWIA 1CXLA 3HE6B 1TZIA 1EJ6A 4V1DB 4JZJA 5I1EL 5C09E 1VB9A 1C12B 4MNGA 5ID1B 1GGCL 5FYJE 4HWZB 3P30L 5D7IA 4UAOB 1T0NB 1QRKA 1WGOA 3WE6A 3MOAH 3WFEL 3QDJE 2Z92A 2CR6A 2SEBA 2WINB 5ILTL 4F33A 4KK8C 1NFKA 2ARJQ 1JZ4A 2QQQA 4GRLB 3MOBL 5I8OH 1OSPL 3S8WA 1IGML 4P23C 4WW2C 2EE2A 3C08H 1U6AL 5I76A 5IW1B 3NACH 5TDNB 1QACA 5I0DA 1TITA 2CDEB 4M6OL 3QUMH 4LHJB 1LO4H 2FYYA 3UTSB 5D5MA 3IDJB 4ORGB 3QDMD 4M7JH 3HUJA 1NDGA 1RUMH 5EU6A 4AEFA 1ZEAH 4OCLC 2EE3A 4K23H 3EGSB 2R2BB 4J2XA 3WN5C 1KJ3L 4RMQA 1ZANL 5FDWA 1XFPA 1MJ7L 1FJ1A 2BNRB 1J05A 2Y5TB 3MRPB 4Y4HA 5FO7B 1HOCA 3MV8A 2YD2A 5CJ5A 4BZ1L 4R8WH 3S5LG 1G7PB 4KXZH 3VXNB 3UJTH 4XXCA 4RFNC 3SDYL 2IPUG 1JZ8A 4KQ3L 3NPSC 2RFXA 3WHXB 3S34L 3TN0D 1YMME 1J18A 4WTWA 3ZYJA 1CF8H 3L3DB 1DVFC 3CMGA 1QFWL 5TFSL 1DTUA 4AT6A 4H1LA 4GKOA 5FV2A 2VNCA 1KSRA 3N9GL 1I3GL 1NGZA 2OTPA 4Y4FD 2OYPA 1BVZA 4RAUA 3MRLB 3K2UL 4TQEH 4R3SA 1NUNB 1DE4B 4MA7H 3DX8B 5D7LB 5FYJU 3D87B 5CGYD 5D1XC 3SQOH 5IB2A 4MS8D 1AJ7L 2IPTL 4PJ9A 1Q9WA 3HRZA 1YEIH 4LASH 3CVHA 4HG4J 1Z5LB 3KNBA 1DBBH 1R5IB 4AK1A 3A6CL 2BNQE 3CDFA 3GMQA 4N0CC 5EOQH 1QSFE 5M94B 3HG1E 4L9LA 2DWEB 3D3VD 3BD4A 3DMMC 4XP1H 4Z7NF 3ARBB 4DGYH 4ERSH 1BFOB 5I8KL 1X4ZA 2EDRA 5D7JA 2HWZL 2MCG1 4HUXA 3QQ9C 5F7DA 1LO2L 1PJ9A 3D2UB 3STZB 5T1DH 3I3EA 1MFBL 3GSRB 5C0FB 5GS2H 1GZPA 5CLTA 1ORSA 4H8WL 3C60B 3WDIA 2YPLD 5F7HA 5EBGA 5D1ZC 4DN3L 4Z7QE 5HD8D 3AS1A 4LPYA 5ERWB 4NN6C 4TTDD 1RZ7L 1KENL 3V4VH 4I9WE 5SWZD 1V3LA 1VFUA 5D7KE 5BV7B 3QCTH 5DJ0A 4HCRH 5F96H 3O9WD 1KIPB 3UPCA 5C09A 4M43L 3NIGF 4U6HA 1MFDL 1OL0A 3MLWH 1SYSB 1OAZH 5KOVC 4XPAH 3GHBL 3VGDA 4CBPA 2D0FA 5J13B 2I5YH 3U82B 2HMID 4QRSA 1T7ZA 3CFDA 2IAMD 4RQQB 4XVSH 5F7YC 3E8UH 4IDJL 4LCCC 1RK1B 1GOGA 3VGAC 2GUOA 4NO3B 4KHXH 2VJXA 4AJ0A 4PJHB 3TV3H 3TIEA 3BKCL 2ITCB 3L5XL 4ODUB 4F9LC 5J56B 2X05A 5IJKC 2C1PB 4H20H 5DD3L 5GGVL 3HB3C 5A2JH 3F7YB 2Y06L 2HTLD 1UYWL 2OXGA 2UUDH 5EPMB 3PWUA 3RUGF 1IAOA 1LD9A 3JWDL 2HJFB 1BJMA 1JGUL 3CFKB 4MZ3A 1PSKH 4M93C 5CCKL 3NAAH 4P46A 1UM6H 4MJIA 1CLOH 1G9EA 2CRIA 1MRCH 1QBAA 2NY0B 5TPWH 1FLRL 3MBXH 4WFHD 5EU5A 3MRNB 5GSRA 2DS4A 3C5JB 4MXVE 4R4NC 1A7QH 3G9AB 4O51A 2PXYC 2EE9A 3FAWA 4GRMA 1NGXA 3IXAB 1MF2L 2HRPH 2I24N 3CVHL 4MYWB 1A4KB 3IDMA 1EV2E 4JN1H 2WLYA 3ILPA 2VERN 1YMMA 5JW4M 5I73B 5IFJB 5DD0H 4U1SB 5GJSH 3QEUB 3HC4H 3GIVA 5F3HB 2GCYB 4QRRE 2W9EH 1D5XB 5HYJE 3ZE2E 2CO7B 3IDIA 4LPUA 1HNGA 1FFOB 3VRIB 3W11D 3DTXA 3BT2L 3T1FA 3AREB 4Q58C 2RAMA 5MP6L 3PHQA 4KK9C 1URLA 4Z7VE 3KPPA 3LKNA 4FQXD 1JTOA 1QA9A 4XNZC 5HI4C 3RQ3A 1YEHL 4OZHB 1E6OL 3F7VB 4NQCE 5E9DB 4HXBL 4QTIL 3FHAA 1OHQA 3QIWB 3SDCB 5T33H 2CR3A 1JGEB 4PJ7F 2IQAA 2NX5D 3ULVE 4L8BB 4JM2C 1I8KB 2E6JA 2ESVD 5DJ8B 4XCCL 3IJHA 2N1KA 3GJFH 1UVQB 3SOBH 5FYJL 4MQ7B 3T2NL 1QSFA 3VDCA 3HG1A 3MA9H 3QG7L 5GS2D 1OD9A 3RAJL 3PWNB 1O5DT 5FO8A 2BFVL 3K8MA 5CJBA 4K3JL 2BSRA 1FDLH 1U8MA 2Q7YB 5DC4B 5ESAB 1QSEA 3MV11 4TSAH 2IALB 1B4JH 2R0ZH 4LPVA 1F4AA 2X40A 4XCNB 3RGVA 3KPMB 3ZL4H 4BKLB 2DQDL 4XMKL 1TNMA 5BZDB 3OR6A 2NXYD 2C5DC 4X83A 1HIMH 1LK2A 4GKZA 4U1NA 3NCYP 1I85C 2P5WB 1YJDH 1AP2A 2BX5A 1K8IB 5I30L 4QKXB 1N26A 4O9HL 1ZKAA 3GSUA 3Q5OA 3P4LA 2FECL 5HGDB 4NZUL 4TOYL 4NNPH 1E28B 3FFCD 3G6AB 4FP8H 1QO3B 1OGAB 1AGDB 3MYJA 4X8JA 3RY4A 1QHPA 3GMRA 3D85B 5J1AA 1LO3L 3MREB 3BKJH 4JN2B 3ZKXC 3FMGH 2P7TA 3NCBB 2Q86B 4RNRA 3V6OC 4OIIH 1Y0LA 2BHUA 5GGQH 1FH5L 1DQMH 3LMJH 3S35H 1LE9A 4C56B 4OI9A 4QRTB 2HJLB 4PBXA 2IMNA 2XOTA 1RZ8B 5IROC 5KZCD 1I9RL 3BRGC 1JNLH 2EZ0C 2O5ZH 1K5NA 4QF1B 3C5ZC 4AG4H 4PGBB 3HA0A 1N3NB 1BJ1J 3ZMRA 5TF0A 4CVXA 4GS7C 4Y8DC 3MXVH 4I3RH 1C8PA 3LH2H 3S7GA 2W1NA 2ZNXA 2Q8AL 3T8XA 4P3DA 5DJDB 1YYLH 4MWFA 3GBNL 1QRNB 3RIAK 2FJFB 2R1XB 4G6FD 5E6YA 4RFOL 1CE1H 4RMSA 3RWJB 2DQUL 4Y89A 1JPTH 3MJ7B 5GS1B 4G7VH 4QRQA 3G6JF 5I0ZA 4Y16C 1WV7T 4CJ1A 5DYOB 4HH8A 4APQB 1PFCA 2Q76B 2OM5A 2VXUH 4MAYA 5INCB 5HPMA 1S9XB 2OQJA 4H88L 4F8TA 2BOCA 2MSPA 3KJ6L 3CD4A 1G0XA 2GTWB 3ULUC 3QAZC 1HXYB 5KSVB 1UKQA 3KLHD 2BMKA 1A7OL 5CMAA 1J1PH 3UPRA 2VLRE 2GJZA 3ULSA 4PRHD 1F6LL 4WFEE 2R56H 5IBTH 3EYQD 4PJFA 5K9JL 3T0XA 1LEGA 3U7WH 1NCTA 3LEXB 1M6OB 4LGRB 3K1DA 4F7PA 5DZNA 3RFZC 4EDXA 4XCFL 4HJJL 4YO0A 1FVEB 1OARH 4HSQA 4HFWA 5DJ2A 5DUBA 4BH8B 1YY9C 3MR9A 3L95A 3FQNA 4PTTB 1MCRA 3P11H 2H1PL 4ZTPH 5D96C 3H3BC 3CSBA 4YQXH 3DO7A 5A2LH 3X3GL 5KVGH 2HH0H 1AR2A 2CO6B 2VAJA 3LEYL 3HPJB 5KTEH 12E8L 4LLQB 4X6DE 3HAEA 3O2DA 4JRYB 4KK6D 3SDAC 5SX5K 1U91A 2AEPH 2VRAA 4W4NA 1CGVA 4XAKE 1QUNA 5JW5A 1U8NB 4YAQB 1CE6A 1HCFX 3U7YH 4A6YA 4GKNA 1X7QA 1XF3A 3JUYA 1PEWA 4JHWL 3MLSH 3OJ2C 5I1DA 3RL1B 3STLB 4X6BB 4EZMA 1BZ7A 5I1CL 3O6FC 1C5DB 1CDBA 2G75A 3CC5A 3O11A 4I0PA 2XWJA 1ZHKA 4GG6B 2X1WL 1N4XL 3SQBA 1FZKB 1L9NA 4RISH 3TBYB 2J88H 5DFVC 3QFJE 3Q6FB 3UDWC 1BD2B 3BPNB 5HHVL 4HWBH 5E00A 4HKJA 3QUZA 4WO4C 3U6RB 4R0LC 3U1SL 1FGVL 4EI6B 1MJUH 4IRZL 4PJAE 4PJHF 5EIQA 4DJMA