4L05A

Cu/zn superoxide dismutase from brucella abortus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
b'ESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural, Functional, and Immunogenic Insights on Cu,Zn Superoxide Dismutase Pathogenic Virulence Factors from Neisseria meningitidis and Brucella abortus.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Oxidoreductase
total genus 34
structure length 154
sequence length 154
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4l05A00
2GBTA 2C9SA 1UXLA 3L9YA 4A7GA 2WYZA 3KM1A 1SOSA 3ECUA 2XJLA 4A7SA 1SXNA 4MCMA 1BA9A 1F1GA 1E9QA 1SXSA 1XTLA 3L9EA 3QQDA 2WYTA 1TO4A 3HW7A 1PTZA 5CU9A 3F7KA 3CQQA 2AQQA 2SODB 1IBBA 3MKGA 3LTVA 2AQNA 1CB4A 1OEZW 1SXAA 1OALA 2ZKYA 5KBMA 2Q2LA 2WKOA 1F18A 4A7UA 3CQPA 2JLPA 5KBLA 2V0AA 1RK7A 1Z9NA 3KH4A 1E9QB 1PZSA 1EQWA 1YAZA 2C9VA 1SDYA 3MNDA 1IB5A 1E9PA 2C9UA 4OJAA 1F1DA 1HL4A 1AZVA 3GTTA 2Z7UA 1DSWA 2ZKXA 1B4LA 2LU5A 3S0PA 2AQRA 2JCWA 1TO5A 3PU7A 1U3NA 1UXMA 4N3UA 1SXCA 1MFMA 1SDAB 2ZOWA 1E9PB 2WZ0A 1FUNA 1COBA 2AQSA 1N18A 2AEOA 4U4IA 3ECWA 1JK9A 4BD4A 2E47A 2Z7YA 3KBEA 4L05A 4A7GF 2ZKWA 4B3EA 4A7TA 1S4IA 2GBUA 1IBFA 1SXZA 3GQFA 1KMGA 1XTMA 4A7QA 2WWOA 1IBHA 2XJKA 1B4TA 2R27A 3HFFA 3H2PA 2GBVA 1YSOA 2K4WA 2AQPA 1SRDA 2WZ6A 2WKOF 4OH2A 2VR8A 1JK9B 5KBKA 1OZUA 1N19A 3KM2A 1SXBA 3F7LA 1PU0A 1F1AA 2AF2A 2APSA 4MCNA 4N3TA 3GTVA 1HL5A 1QUPA 1CBJA 2Z7WA 1IBDA 1E9OB 1JCVA 3CE1A 3T5WA 3HOGA 2VR6A 1Z9PA 1DO5A 3SODB 2NNXA 4A7VA 1ESOA 1OZTG 2WWNA 3H2QA 1XSOA 1BZOA 3GZOA 2Z7ZA 1E9OA 4BCZA 3K91A 3KBFA 4FF9A 1L3NA 2AQTA 4BCYA 3KH3A 2E46A 3GZPA 3GZQA 3RE0A 1SPDA 2WZ5A 1YAIA 1OAJA 3ECVA 3QQDB 1P1VA 2VR7A 1Q0EA 1EJ8A
chains in the Genus database with same CATH superfamily
3ECQA 4LCCA 1MHEB 5CFHA 1CGSL 3OKMB 5HDBE 3TNMB 1AHKA 3WFZA 1RUKL 1A9EA 5HPOA 2X42A 1XGRA 3MNZB 1RZPA 4KOBA 5IMMA 3QQ9C 2ZONA 1P7BA 2C3VB 2XVBA 2GPZA 1UJ3A 3AZUA 4YIQB 1FORL 4JO3H 1KC5H 4ZODA 5HI4C 2LFEA 1J0HA 3PABA 5D6CA 4PJAE 4JRFA 1F18A 3H9SE 4JREB 5G5DB 2IPUK 4BK5C 4BFGA 4Z76B 3FDWA 1N3NA 3BAXA 1RZKL 3V0VB 2UZYA 2C4XA 3D08A 5F44A 1LHZA 1XH3A 3NEXA 4UU9A 4XNZC 4G5AA 5F0JB 4K8RL 3C12A 3RFZC 5TGBB 3BVUA 4YHIA 1LEIB 2GSIB 2CBQA 2Z8RA 3PV6B 4N0YH 2Q7YA 5JNYB 1AGDA 4AL8L 5TQ2L 5AAPA 3IEAA 5FDWA 2JH2A 5I1CL 5I6OA 1NUGA 3A24A 3C9NA 1WA1X 1U8KA 3T0EC 4L9LA 4U1SB 3IVKB 3IFLH 1NJ9B 3MLWL 1YEFH 4OD3L 4HXBH 1PYWA 3T0EE 4Z0BH 2V37A 2YRLA 4MMXB 3L5IA 1S9KC 5DZLA 1MFDL 4F5CE 4FXKB 4GOSA 1B4TA 3NIDB 3NUKA 3V10A 3O2WH 1OLLA 2C3WA 1XF3A 5J6HB 3A4DA 3S34H 5IF0A 1SF5A 1DZ0A 2CA3A 2G2RB 1N19A 3TBTA 4L3EB 2EZ0D 3LSOB 1T0NB 5CIPA 5C08E 4DAGL 2IH3A 4P57A 1G1KA 4L1DA 2R83A 1O9ZA 2DD8H 2J8HA 3OX8B 1KFAL 3T2NL 1CPUA 2LQRA 1U95A 4LGPB 3RZCC 1G7JB 1JWSB 1NCHA 1AS8A 1OVZA 1YCSA 4ZS6C 3NAAH 3RDTB 4YXHH 1J5OH 3ESVF 2JKRM 2CR0A 1BVKB 3MHZA 2MKWA 2HG0A 1VFOA 2UY6B 4NZUH 4PJAA 1OAKH 4H8QA 1NM9A 3H9SA 2H2SC 4FX5A 3JV5A 3D0AA 2CSPA 4M6NL 2X2HA 5LG6A 3LN5B 5I82A 3IJ7A 1A66A 4L1LA 3P30H 5T1LD 1D2OA 5J7CC 3QA3A 4R4NC 1YEDB 4DP6X 4WSJA 4LVNC 4N2CA 4BK5A 2F54B 1QO3A 4R7VA 1C08A 2V7NA 1EGJL 5CJ5A 4N8UA 5GJSL 5CJ8A 1G9NC 2OSWA 1MVYA 3O3EB 4NI3A 4BSVB 2G9HA 1EHLH 1FFOB 1TETL 3W5NA 1ZK9A 4LCCB 2XFGB 2F8VA 3TFBA 4J3WA 1A9EB 5G4OA 3QQ4A 4FQLL 1XGRB 3T0EA 1EIBA 2NPLX 3B9KD 4ZTEA 5IMMB 4WI0A 1AMYA 5L8LB 4DKEL 1RZFL 3DO7A 3U79A 1FA4A 1FE8H 1UD5A 1UJ3B 4AE1A 4F5CA 4F9LC 1UACH 2K4AA 5E2WH 2CCWA 1AFVH 3PABB 4HCIA 5D6CB 1SEBA 1W72L 3DX0A 1LO2H 4O51A 1PX4A 2TRHA 5AOKA 4P3CL 1B4LA 3EDDA 2GW5A 1F97A 5F7YC 3ATDA 3TGXA 4DN3L 2W65A 5IQ7H 4PW9A 4KUZH 3QJSB 2YBGA 2A77H 2AEPL 3EAKA 5C08A 4WV1B 2CPUA 1X5MA 4WTXA 1XH3B 5IK3B 2KZ1B 1E7UA 4G8EA 2YEQA 1RK1A 1DBJH 4FS0A 4K5NA 3FTXA 2EDTA 2WANA 3ECWA 4LCWD 5HHOE 4HHGA 2XIIA 4YHIB 2HFGL 3BZFA 4B3EA 4C54A 2EVGA 4I7ZC 3BP4B 5IQ9A 1URIA 2Q7YB 4WENB 5E5MA 3CFKA 4HOWA 3QJFA 1OHQA 1OM9A 5FFLA 2RR3A 1Z3RA 4PWGA 2X4QB 2GC4C 5FDWB 4GAJL 3VU2A 3RZCA 3S36X 1NDMA 5J5EA 3C9NB 3LEXA 4L9LB 2R2BA 2IPKA 4H1LG 3N85H 2EXWC 4XPHL 2HLFC 4LP4A 1FQ9C 2DQTH 1VERA 5A6IA 3MCYA 4GAYB 2Q6WA 4HFUL 3SKJH 3W82A 3ISRA 3QNFA 3FQRA 3SO3B 1JPFA 3KPSD 3EJPA 5HGAB 1JCVA 4FLOA 4AUUA 3SBRA 4OFDA 1AIFB 1XF3B 4OZGE 5IF0B 2QADD 5F70A 3R8QA 2H6PB 3FK3A 3Q8CA 1TJIH 1UC6A 4GW1A 3ZQWA 3TBTB 4R2GB 1INDL 2OMWA 4ZX4A 2ZUSA 3NCYP 4XPTH 4MDIA 3FAWA 5CIPB 4DGVL 4GG6F 3JZYA 1QI4A 4HS3B 3KH3A 4P57B 3LZRA 3G08B 5HDBB 1CWVA 3KR3L 5KYXA 1AQMA 1TEGA 3GXNA 3T0WA 3TZVD 4LCUB 5AKTA 4R97C 4RIRA 3CN2A 4YDNA 3HUJF 3I2CH 4KQ4L 3S37H 1A9VA 1NC4B 3RKDC 4WU5A 2DLTA 4RA0C 2QT6A 1TFHA 3L1OL 4PJAB 1CVSC 2N0MA 4JHWH 3SDXE 1D7DA 5B3JE 3PJNA 1MDAA 5AYTA 2BCKA 4Y16A 1RPKA 3VFVA 1AS7A 1HSBB 2XZZA 2EUZA 2CZNA 3QYNA 4IRSC 3LHPH 1WIUA 3FAXA 3M7OA 1WIPA 3QA3B 1MN4A 3GXFA 4HPHA 2VDKL 3N40F 4TSCH 5L0QB 4HOZA 2WXKA 4KKAD 1C08B 3VQLA 2V7NB 3NK4A 1FIGH 1J8HA 1GSKA 2IADB 1U30A 4XNZB 1LK2A 4RA3A 2AJUH 5I66A 3RFZB 5FO7B 2HKFL 4EZMA 3KWWB 3CDZB 5ABDE 5H8DA 2ZF9A 3L13A 4FQ2L 4YHZH 4P0DA 1XCXA 3UYRL 1GS8A 1EXGA 5E1IA 1ZOXA 3TEXA 4HGMA 2R23A 5KWYC 3QDME 1FHGA 3T0EB 3ZT5A 4GP4B 3OPUA 3UAEA 4HJTA 3PG2A 3X1BA 3ZQXA 4LAQL 3SDDA 4ZMZA 1KB9K 4GRWF 5IMOB 3MRLB 5I1JH 1IBZA 3GNMH 3V79C 4NO2B 1SEBB 4AC2A 4O51B 4OZGA 5IB5A 4JDVA 4ZX3A 4BXVA 1BLNB 4GIOA 5CF3A 5AG8A 3HAEG 4WWKA 2W65B 3SE4A 5AVTB 1I7ZB 5C08B 2GC7C 4OCWL 4PJBE 4AXWA 1A6VH 3C6LD 1RK1B 4XWGH 3ZDYE 1NOFA 2ALWA 3MPCA 4OLYL 1P4LA 4NAQA 1LO5A 3BZFB 1AHMA 1CF8L 1UZ6E 5IQ9B 2WINA 3CFKB 3QJFB 4N6RA 4DO6A 3O2VH 4YBHA 2V5YA 3ATBA 4S11A 3RZCB 5DZ9A 3BXNA 1NDMB 5HGHA 3SDXA 4FEMA 3WIHH 3LEXB 4X7TA 2F7IA 4WEBH 2R2BB 2IPKB 2DMHA 2X09A 1VADA 3DDFA 5C09E 4A7VA 1IGMH 3Q44A 2G9KA 4Z78B 2XVKA 1YY9C 2CMRH 4J3OH 2Q6WB 4HS6A 2VDKB 3CJJA 1KIPB 5TF1L 3OSKA 3FQRB 1JPFB 1MIML 3G5XA 5F3HA 3QG7L 1X7QB 4OLZL 3N06B 2IPTL 2BXYA 2ICCA 4GINA 4LQFL 4IRSA 4BA0A 4CW1A 2YD2A 1S7RA 5HVWA 4GW1B 4U1JA 1BXUA 1WPCA 4LVNB 2OMWB 1GTNA 4K5MA 3FRUB 4JG5A 4R4BA 1B6DA 4HU8A 1L6XA 1TUPA 2OL3B 1PIGA 3VXUD 1HCZA 2X4UA 4IKIA 4KY1L 2B5IB 1YJDC 3DRTA 2Q3XA 3QDMA 1OAYL 2I9LB 2X4SA 4RIRB 2Q8BH 4KI5F 1BGXL 4K3GA 3T8VA 4Z7WF 2B59B 4FYQA 4XNYL 4L18A 4LE8A 4WU5B 5EUKA 3W81A 4Z3TA 5JHBA 4FDWA 3HI1A 1QTSA 1QRND 3E8UH 3RIFF 2BCKB 4HKBA 2OMVA 4Y16B 2NY0D 3VFVB 5TE7L 2OMNA 1S8DA 3Q05A 2F1EA 2VDPH 2ZSWB 3CZEA 4PJBA 4XT1C 5I26A 4K3JL 5HHOB 2JCWA 3SO5A 4P49A 1UWGH 1UYWH 3ARQA 3ZL4L 1SXCA 1HS6A 2EDQA 2VDNL 1W6LA 1LK2B 5HDLA 5I66B 4DK3A 2OYPA 4AI7A 1FN4B 2MRYA 3ROOB 3SCMA 5HHMD 3VGBA 4M7KL 1K72A 1RJZA 3TTSA 5C09A 2RFXB 1WEJL 4GPVA 1Y7VA 4LCVA 2AS5M 2ESVB 3TJEL 2R23B 1O5DT 5E7BA 3RHWF 1OCRB 3SQOL 2NY3D 4TVPH 5C0FA 1IBHA 2WBXA 1OCWH 1S7VA 2QSVA 1KNOA 1R3IH 2Y7MA 3D0VA 3DPDA 3GSNL 3PGCA 3PWPB 2VXSL 4OCLC 2ZZUT 1SVZA 3IDYC 3WTUA 4Y89A 2VN5A 4UOZA 4JDVB 4NKIH 3RL2A 3VWJD 1XV8A 1QA9B 4GEIA 2BX5A 3P73B 4IBZA 4XMKL 2C9PA 5IBTL 3A6OA 4AXWB 4EVNB 3ZHFA 4BKTC 1X4YA 3IDNB 4IJTA 3N44F 3MLXH 1P4LB 4KTDH 1LO5B 1TNMA 2ZX6A 2VERA 3JWOC 4Z7UE 1J87A 1DVZA 4F24A 4I13B 4OY9A 2WINB 1RURH 3V7AG 4N6RB 3WFDH 3TT1H 1M57B 4HA1A 3BXNB 5HGHB 4WWOA 4XNBA 3SDXB 1AD0A 2ZUXA 4X7TB 3NZHL 2F5BL 3L4TA 2EXTA 3VD0A 1VADB 1NMBL 1K6QL 4G70B 4C8XA 1CFMA 2B3IA 3ENEA 4X6CF 2ZX9A 4WUKH 5IIEA 1U8PB 3H4HA 4HS6B 4CDHA 1CFVH 4UB0H 1CF1A 2FUQA 2YD6A 3K8MA 3C5XA 1WBZA 3O6MH 4QRRD 4JHAL 2QPDB 2CKBB 2WOBA 1XWVA 5E6SB 3T09A 5JO5A 5D7LD 4FQJH 4V1DD 2JQAA 1XZ0B 3QEQD 4IRSB 4UIKL 4N2KA 3VB8A 4AQ8C 1S7RB 4JFVA 4U1JB 3SE8L 2LVEA 2VXTH 3DO3A 2HKHL 5DZOA 4R4BB 4XN2A 2F9BT 2O4EA 4KH2A 2HG5A 2DYPA 1TCMA 3GINA 2X4UB 1VPOH 2PCPA 1UM6H 3BN9C 4FNLL 3RRQA 3WJJC 2KBGA 2X4SB 1WO2A 5EUOF 2OMXA 2IH8A 4N0RA 3UO1H 2JB6A 3L5JA 5EIQA 1C5BL 1MDTA 3T9WA 5I8OH 1CIDA 3BRFA 3LV3A 4LAJH 1H6UA 3HI1B 3C08L 5J0BA 3BAJA 1AO7A 1UXMA 3CGTA 5E4EC 2Z64C 4HKBB 1WCBA 2OMVB 5F7BA 4QLWA 5ICZA 3T6ZA 5C6WH 2DDQL 3C60A 3DI3B 1U8OA 3WS3A 4ILDA 2C3HA 4PJBB 4G42A 5KG9A 3O4LD 2VCOA 4JKPL 3ZDYB 7TAAA 2H45A 4UF7C 1SXZA 1UM5L 4Z7UA 5ITFA 1JF1B 2CJUH 4M6AA 1JHTA 1ORSB 1N7ML 2XWBA 3NCBB 2Z6FA 3NACH 5GRWA 4O4YL 2P52A 2VLME 1QBAA 3NT0A 3T6VA 1RJZB 5C09B 3IGLA 1IX2A 3GJFA 1BJ1J 1DBAH 1MAMH 3FCTA 4IU2A 1DHKA 3VO0A 3GTVA 3ES6A 5C0FB 4PRPB 5JOEA 1OK8A 3AU1B 3TVMD 3D0VB 2EUXA 3RIAK 2G3NA 3E9UA 1CFNB 4KJQD 1SJEA 3KCWA 1ESOA 2BM3A 3F7PC 4FKHA 3TC9A 5KJRH 3QP3A 3RL2B 5TJWK 4YXKL 2WXMA 2BSED 4QRPE 5AYQA 1XCQA 3GZPA 4N0CD 2P80A 3NJKA 4LKCA 1KIRA 3MRIA 3JTTA 3FU0A 1WA0X 1SDDA 3BKMH 2OMZA 3K2UH 4XVUC 3NJXA 4AQ8A 4ALAL 3GRGA 3GI8L 1TJMA 5BZWA 3GPSA 3T4YB 3HC3H 3G5YA 5E9DE 2X53A 4LQ1A 2C9RA 5T5NG 5K1VA 5JPMA 1ZS8A 5I1LB 3ZTEA 4B9KC 4PI0A 1B0IA 4GXUM 5CU5A 7PAZA 1SXNA 2WWMC 4JM4H 4MB5A 1F3DJ 4Y4HC 4BFRA 1S7UB 3KLHC 3WJJA 4PGZA 4TTDD 4G3YL 4GO8A 4JFDE 4X42A 1NPJA 4WI9A 1SN5A 4LSSH 2D7OA 2D7NA 3CQFA 3THML 1NMAH 1YLBB 1KT2A 3DX9A 5IIEB 1H9DA 2W0PA 5ADPH 4S1RH 3TO2A 1F4HA 5C71A 3J27A 1RK7A 1BVLA 1WBZB 3WIAA 4LP5A 3MV7D 3V0DA 1G7IA 5AOIA 3FS9A 1FP5A 4KJPD 5JO5B 2C9VA 2OP4H 2OMUA 5BS0D 4QCIB 3KYMA 2XDHA 4OIBA 2DL9A 3HE7D 3Q3GB 2P47B 4AKPA 1T21A 2YRZA 2L7UA 2J6EL 4Q9QL 2DEXX 1EEYB 4UMGA 3UJJH 4TF4A 4DW2L 4UANA 4RMWA 2ZYRA 2DYPB 4J3BA 3TU6A 3DSFL 3D69A 1KJMB 2FX9H 2PCPB 1JZHA 3NFPB 4XN5A 1DEDA 3BEVA 4KK5D 4M6NH 1MF2H 2OMXB 4JFOA 1R3JA 2WD0A 4JMNA 2JB6B 3Q2NA 3U4AA 3NJGA 2W8CA 3W0WE 3LEVL 4GI9A 2QLYA 1SJXA 3UBXG 1MLCA 5FPIA 3CTTA 4EJ1C 4JRWA 3EXJA 4PP2B 1WCBB 5ICZB 1R3HA 2QDVA 1MHPH 4QRPA 4AEIL 1OF2A 1L9RA 4ENEC 1EGJH 1AZBA 4HAFA 1IC7H 3IDYB 1U8OB 3HMXL 5K33A 5A2IH 4G42B 2UXVA 4BFKA 5KG9B 4PJ6A 3LZPA 4RVBA 2OR9L 2EIZA 2WXOA 3FO1A 1ZTXL 4FFYL 2FD6L 4Z7UB 1QKZH 2CHZA 3TASA 2XWBB 1A4JA 4N6QA 5DJZB 4B9YA 3DX6A 3LH2L 2A74C 4JAMA 5MEPA 3NIGE 3OL2A 3LMJL 4WCYL 4JFDA 1IC5L 1DANU 4NQSA 2NZ9D 3GJFB 4BHUI 3FCTB 1LO3L 4IU2B 4U1KA 3UGXA 4DN3H 1I7TA 2X9WA 3ES6B 1MH5A 2E6JA 5ITBH 5FYLD 1JWUA 5A3ID 5B4MD 3OKLB 5IGXL 1IAKA 1SJEB 3ECVA 2C7UA 3QUKA 3D18A 4U7MA 4AT6A 4HUWA 4D9QD 1BQHG 2I25N 4PSRA 4TSAL 3F12B 5DZNA 3BHBA 3HTLX 1KIRB 3MRIB 4WI7A 4GJTB 2OMZB 5BRZD 4QXUL 3CMOH 5D1QD 3NA9H 2CAKA 3G5YB 4A7UA 3K5SA 4G8GD 4HFUH 1ZS8B 2ZNXA 3W0WA 2CLVB 3NK3A 4GBXA 5I6NA 3L7EA 4OCNC 2YIHA 3EO0A 3VXME 4NPJA 2D7TH 4Q56A 3ZUCA 2KZBA 2UX6A 4YSTA 4EI0A 2WCGA 4KVNL 5EC1A 4AIEA 1M3IA 2K6ZA 1KT2B 3DX9B 5E5RB 1SFDA 5FGSA 3EH5B 5JHDE 3TO2B 4S0HA 1BVLB 2VLRD 4JHUA 5E4EB 1B0RA 3EO1A 2CRIA 1F4WH 1G9ML 1OAQL 4NQCE 1ZLWK 1G7IB 5AW8B 3CXHK 5LGKA 3QXVA 5K9QI 1N59A 1BREA 3NIFE 5K39A 1KLUB 4OGYL 4LVOC 1J8RA 1CFSB 1XCTB 4N1CA 5KJ7E 4XHQA 5EIIG 3OAYK 2C3XA 3TS8A 2HA1A 1HXKA 5I74C 3O3AA 2AJVL 2OJ1A 4W9FC 3T0AA 5INCA 3UTSE 1A14L 1WTLA 3EDEA 1R3JB 4JG1L 2XV6B 3BUIA 4KU1A 2VR8A 3OHXC 3CVHL 1PDKA 3PNWA 1ZV5A 1H15A 1MIEH 1A65A 1WIOA 1HINL 4RFNC 4TNVK 2BSRB 3T6WA 1NAMA 3CN1A 3OLGA 3C75A 3MR9A 1G84A 4HIQA 2KZWA 2F74A 4AYGA 5F97E 1RU9H 1R3HB 4QRPB 1YYLH 3KXFD 1CXIA 2CH8A 2BNUA 2HMIC 1HYRC 2JI1A 3DVGA 5CM1A 4GMSL 1RLWA 1MCJA 1QR1B 3GRWH 3MLZH 1J1XL 2IIJA 1WRFA 4XMTA 4KNQA 3CVDA 2EIZB 3FO1B 5AKRA 2A6KA 1DJYA 3I9AA 5EOQH 4AM0A 4DGYL 3PAYA 3WD5H 3A23A 3WFHB 2WBJC 5E9DB 4LRIA 5LCVL 1A4JB 2H1PL 3CFDA 3DX6B 1U2CA 3FUDA 3M07A 4JAMB 5MEPB 3VRJA 4G11A 1IMHC 1AGEB 1O7VA 3VXMA 4JFDB 1P6AB 1GGYA 3VW3H 1R5VA 4J2QA 3AS0A 4LSQH 4AIZA 4U1KB 3MBXH 3Q8BA 4FGMA 4UQ3A 4Y4HB 1SYSA 5E95B 3V6FA 1K5WA 4HPOL 3EDFA 4WK4B 3BVTA 1MH5B 5LBSA 5JHDA 2O1AA 1JWUB 4DPRA 1BF5A 2XZQL 1N5AA 4NQCA 1P6WA 2MWCA 2C7UB 1I1CA 3A4AA 3MRNA 3QUKB 1SVCP 3WCYA 1KIQB 4AT6B 3HJ0A 3HHMA 2CK2A 4KJYA 1CF8H 3BSGA 2R0ZH 3GEWB 3KBHE 3NP4A 4EI5C 3IETA 3NSJA 2XKUA 1QPKA 3I50H 4H4NA 3VSQA 3BHBB 4IKKA 1GZQA 2WO3B 3N44B 3U2IA 3VFPA 3Q6GL 1PAMA 5KS9F 3S2CA 3MRFA 3UTOA 1GKEA 3KPTA 2K9UA 3FONA 4DFHA 2ED9A 2QFRA 4IU3B 5DGRA 2J71A 3S3PA 5I19H 4N9OB 4LARL 3HN3A 3HNTL 5GGQL 3W0WB 4OF3A 5TF1H 1E4XH 4TM9A 4ZMNA 4A1RA 4PJXE 3FO2A 3GC3A 3QG7H 4OLZH 3OXSB 5AVVB 2VERN 4OJFL 4D3CH 4NO3A 1LP9A 3U36B 2KDYA 1MCQA 1JE6A 2WLIB 2ZKWA 3QORC 1HJBC 4PAZA 5DHEA 5HGBB 3KPQA 3EO1B 3CLFL 3AY4C 3VFSA 3N0PB 1WQVT 3BYTA 4J3OC 1F5WA 2W38A 4UMSA 4XNXL 4YZFF 4WFGE 2XV0A 3APCA 1N59B 1NBYA 2XPZA 3PE9A 3NZUA 5K39B 1JHLL 2FT8A 4H8WL 4Z7QE 5L9DL 4OI7A 1H8LA 3ABMB 2WBJA 1TOXA 5FUZL 4NO0D 3VFGL 1E6OL 1F4YL 2Y2TA 4R7DA 2A74B 5EUOB 2ZPKL 3ZDXE 4ONGL 2QELA 1WWCA 4F7MB 4PTTA 5B1CA 5TE7H 1TLKA 4I3SH 4MD4A 3LZFL 4KQ3L 3GMLA 3PNWB 4OCSL 3W9DB 4JGUA 1H15B 1NCBH 4JNXA 4X6BA 4DGUA 5GRYA 2F74B 4HC1L 3QZOA 2Z4QB 3MOAH 4PS4L 1EJOH 3L5HA 1YQVH 5ACZA 2BNUB 2E56A 3RGVC 4OZHE 4MYPA 3DVGB 3ZKND 4YS4A 2EACA 5BVPL 4HBQA 4C56E 4OZIF 2GK0A 1HZLA 4IRZH 4TQIA 4EI5A 1T0MB 4M7KH 4Z23A 3RA7L 3RX9A 1SOXA 3POHA 2A6KB 4ZXBA 4AM0B 4L3CA 1JZFA 5CGYC 1A8JH 1GGUA 3PDOA 1BA9A 3ZN6A 1GC1L 3RUGE 3WNMA 4MRBA 2ZAHA 4DP2X 5I18L 4FCAA 5K1JA 3VRJB 3CPLB 4NNXB 4PJXA 2JKIS 4XN1A 5K69A 3NBNA 3IGAA 3VXMB 3GSVA 4QRQA 1E5YA 1GKOA 1ZPLA 4MFHA 1R5VB 4N90E 5G4MA 3DO4A 4M00A 3X1FA 4AIZB 2JK5A 1OWRM 1SYSB 3EJYD 4JFFE 2GT9A 5D55A 4XMPH 3ZK0A 4MZ2A 5JHDB 2ZCHH 4QHKI 3AG1B 1ZV2A 2B16A 1MFCL 3WIHA 4P5MB 1OGAD 4WI5A 2HB0A 1DVQA 1ZVYA 2B0SL 3TFKC 4KJYB 3NIFB 2OSLA 3IETB 3AY4A 3VGGA 1OT2A 3ZZLA 4OV6F 1QR4A 4TVPE 3GYRA 2EE2A 3A6CL 5DCCA 1GZQB 4X7SH 5DO2D 3VFPB 1SZNA 3MUZ1 5E1AA 2HJKB 3MVSA 3UO8B 3FTYA 4LVOB 3U6XS 3FSAA 2YSTA 4GQPH 3E9TA 1KCWA 1BMWA 1RD6A 1RHHB 3KBEA 3RGHA 2PUQT 2FATL 4P2OC 3UTSB 2I9TA 4N2BA 4N20A 4TLUA 4M9PA 2E59A 5IROC 1T4WA 4FE9A 4JZOA 3IE4A 5A2KH 1ROCA 2YPKA 1KCRL 1OQXA 2MTAA 4J23A 1MRFH 2WN3A 5MI0C 4BZ2H 4ZPVB 1KN4L 4B6ZA 1PZDA 5BOJA 1E2WA 1I9IL 4LMQE 5IUCA 4NO3B 5L7XL 4UIKH 4UTCA 2WQWA 4RFNB 1OB1A 4OZHA 4FADA 4LHJB 4Y9BA 3BOVA 3WG7B 1MNNA 1HZHH 4C56A 5DJ0A 3BUPA 2ATAA 3DMMA 2BVUA 2ZP8A 3IFNL 2K7PA 4PJHE 3KPQB 3CDYA 3NZSA 1SOKA 5JUEL 6TAAA 1PCSA 1QABA 1LEGA 3IJEA 4O58L 1BVNT 3QUZD 1I3VA 2DJMA 3NPZB 4FNLH 2ZE0A 1ZE3H 3RUGA 4MD5B 4WHDA 5IT2L 1DFBH 4FOMA 1JNHA 5B38G 2WBJB 3TF4A 1E3ZA 1N8ZB 1U9KA 3MLUH 5DFTA 4YX2L 4R7DB 4ZX6A 2F19L 5IWLA 2QQNL 1KBKA 4NHCL 2ITEA 3GHBL 3VMPA 4JFFA 2JV6A 1Y18B 4GMTH 1QHQA 3G6AB 1NKGA 3P4OA 4OV5A 1UXWA 3BT2H 3FU6A 4MD4B 3MA9H 4QHUA 4HJGA 1PF3A 5D70L 3CN0A 2UUDK 1Q0EA 5SWSD 1NDGA 3GIZH 4WDIA 4JM2F 1U0QA 2VDOH 1OV8A 5E99H 1XTLA 1XD0A 5AL8A 1FH5H 2CE6A 2OFQA 4UT6A 5ACZB 2JCCE 43CAA 3VQMA 2C9XA 5CINH 4L4TD 3E1ZA 4WHYG 3LXBA 2GK0B 1BPLB 3U46A 3V0FA 2JTYA 1SMDA 1HEZA 1CGTA 3CFUA 4PR5A 4EI5B 1ADQL 4NQVA 5C97A 1DJSA 2XSKA 4WNQA 1ASPA 1EEZB 1YEEH 2X5PA 2WVVA 1U92A 3LZOA 3PDOB 5F1IB 1DCLA 4JQXC 1XL4A 3BESR 4NUQA 1N6QL 1BFVL 2FX7H 3QWOA 4PUBH 1YDPA 2R0WL 4PJXB 1QSFA 5PCYA 5T3ZL 1DQVA 3D39A 3IGAB 1YC8A 5E56A 3GSVB 4QRQB 4XOBA 1GS6X 3SIKA 3VGFA 1FGVL 4P2OA 2HRPH 1SLWA 1ETA1 5J9PB 1NM4A 5FKPA 2JK5B 3ULUH 4PLNC 3WTXA 3BPNB 5D1XC 5GS0L 2GT9B 1AXIB 2A9DA 2CHXA 2KPNA 2JLLA 2W88A 5CLTA 1D5IL 4PJHA 2YJQA 3LX9A 3MV8D 3BRGC 1COBA 3TNNB 1AH1A 4LSRL 5D1XE 1IGFL 2F5AL 5E1GA 4Z77A 3QORB 2A6IB 2Y1ZA 2ZSVA 1V3MA 4B95C 2OSLB 3A4EA 2XYCA 2XWTA 4TUOA 1H3UA 5KVDH 1G7QA 1QLEH 5LGHL 1RV6X 5FR3A 4RDBA 4IJ3B 1F6AA 2A9ML 5E1AB 4BH7A 5D7IF 2X38A 7FABH 1CD1A 4MKMA 3FRPA 4K23H 5CP3H 1KGWA 1KCVL 1WUZA 4L1SA 2I9TB 1T1YA 3CDGA 1MCPH 2H3XC 1MRCL 4KAQL 1VFBA 1T5WA 1ND0A 2EUVA 2YPKB 2ZXBA 3FHQA 1BMGA 5BV7L 2WIIB 4AJVA 4NFCA 5JIDA 3UTQB 1HN1A 4N8CH 5HP5A 3KPMB 3QJQB 1S3KH 2JCCA 2Q87A 2R69L 2NXYC 1ID5I 3CNKA 4OZHB 5DJ0B 4PREA 4NLAA 2BVOA 2Y06H 3O45A 5GISL 2F7RA 3DMMB 3K91A 1XHHA 4RQQA 5FYJH 3SE9L 4U1HB 4QTHA 2VMEA 1LEGB 3IJEB 4MQTB 5CJXC 3VXRD 3RGVB 1SY6H 1OXYA 3AREC 2WMPA 2ITDA 3KPRE 3RUGB 2NXZD 4M48H 1IFRA 4G9DB 3ROLA 4LT7A 2VDPB 3SYQA 5TFSL 1HDMA 3LEVH 2FQEA 1HL9A 2QPUA 3BKJH 4B9JA 2X1WL 3OF6A 4HHAB 3LN4A 5JXED 2XICA 1MPAL 1SXSA 4DO5A 1B9ZA 2JNZA 2DLFL 5AW9B 5TH2A 4JFFB 2KQNA 4R0LC 2N01B 2NY4B 3UIZA 1UXWB 2ZP9A 3NH7L 4KUCF 4QHUB 4HJGB 1A0QL 4E9YA 1J1OL 4UQIM 5KBMA 4YVNA 1NDGB 4WDIB 2OCFD 2OR9H 3BD5A 3EO9L 3QJUB 2QEJA 2YAEA 2LAAA 2DIJA 1FLRH 5EPMA 1RULL 5BZXA 5LN8A 4GUOA 5E8DH 4F33A 4YUEL 1AQKH 2BHFA 3RKPA 2ARJQ 4JR9H 3SDCD 4EIZC 3B3IA 1UH2A 1F90H 1PG7W 5SWZE 2MNJB 4PR5B 5L2KD 2ORBL 3AABA 4NQVB 4MZIA 4F92B 1E67A 2Y7QA 4WI6A 4WNQB 3SKMA 5FF6A 1SBBA 4APXA 1U92B 4ONFL 3PWVA 2XT1B 4FZEH 4K3DH 4AKOA 4QTIH 3HC0A 4WK2B 4K3HA 5CD3A 4AV4A 1QLRA 2MTPA 1MEXH 3QWOB 1TZIB 1R19A 1YDPB 2B3RA 1RZ8A 1FDLH 2BY1A 4JJHA 4P2OB 4B60A 3UPRB 3JV4B 2E47A 3FN9A 9CGTA 3PJSA 5J89A 4TPRH 1DQTA 4FI8A 4EIBA 3K0YA 1LDPH 2DOCA 5MI0B 1U8LB 5CO1A 2ZG3A 4A7QA 1U8CA 4CSTA 3FNKA 1A7RL 2NR6A 4PJHB 4ZBJA 1UUSA 4MHHG 4WO0A 3PQYE 3O8XA 2X4OB 2FZ3B 4RDQG 3BUYA 1UG9A 2W95A 4QXUH 4JK0D 2DWEA 4GXUN 4Z77B 2ZSVB 4GIPD 5C7ZA 3TJHC 3KPRA 1IKNC 2HWZH 2YKLH 3B2MA 2DLEA 3NCWA 1LNUA 4J8RB 3CHRA 4PRBA 1QACA 3Q5TA 2XWTB 4TUOB 4E0RA 1UA6L 3S36H 2VJ0A 5CJXA 3WTVA 1G7QB 2AJSL 4OCMC 3SYAA 2ADIA 3GM8A 1KF9B 3AREA 4IOFD 4PYHA 1FJ1B 1JTTA 5IQLA 3IU4L 1HIML 1SFHA 4BH7B 2PCFA 3KHOA 1CD1B 2RCSH 3DA0A 3FRPB 3Q01A 1NANH 3CK0L 4KVNH 4LIQL 1BAFL 3LNFA 4JX0A 1IEHA 1VFBB 1T5WB 1ND0B 2G60H 2QSQA 3G7TA 2VDQL 5IR1B 2NDFA 3ARYA 2GQHA 2D4DA 5ANME 4EKJA 1Z0NA 2EDRA 4HPYL 3ZOAA 2EDFA 2JCCB 4MA7L 1FO0H 1OAZL 4HLZG 2VLJE 2BVOB 3O45B 1JNLH 5SWZA 3M6DA 2ETWA 2BZDA 3ILQD 1EEUA 3DHMA 4QTHB 1CLYL 1VB9A 1A7PH 3QWNA 4XO8A 5EOCL 4KV5F 3I9PA 1QD0A 2AJVH 2D7MA 4LSTH 2WMPB 4L3ED 4OFPA 4F57H 4X4YA 5JQ6L 2ITDB 3QI9A 1EGJA 4KZEL 4H88H 2OZ4L 2GBAA 4OCRL 5B1KA 2CUHA 3CVHH 3T0BA 3JSSA 5DUML 1HDMB 2CCVA 2EO1A 2QPFA 3RG1C 4LSPH 1G6RH 4I0PA 3D3VA 3LN4B 3RDTD 4ABUA 3L17A 3MDJA 4ZK8A 2QQLL 5DUBA 2KLTA 4O00A 4RX4D 3UYPA 5B8CC 5TH2B 3D5OF 1DVFC 1OAXL 3DHUA 4E9LA 5IFAH 2XRAL 2O30A 3GRBA 4LLWB 3KPOA 5ADOH 3PQYA 3QCUH 1G9EA 2Z7UA 4X4XA 2Q10A 1FBIL 3VXSA 3OAWA 1QX1A 5D1XB 4K7PY 4ANUA 3FL7A 1OSEA 4JFUA 4MQ7A 2C1PA 3GLEA 2WJ5A 1PL3A 4Y9FA 1U4EA 1JNNL 2VOTA 3SKOA 3MUUA 4F33B 2DPKA 3WMQA 4PQXA 2H6OA 1B9KA 4GQQA 1TJHH 4ZD3H 1MFUA 3MV9E 1QNZH 2DLHA 3DJRA 2Y7QB 3SKMB 1XSJA 3K80A 4Q58C 3NG5A 4YSDA 3Q7JA 4APXB 3PWVB 4X7DC 5GGVH 5J06A 4U33A 1UZ8A 2CGYA 1CD9B 1HHJB 3V0JA 2G4GA 5CD3B 1QLRB 1YRKA 2VABB 4PH8A 3RIAF 1RZ8B 1KJ3L 3OBAA 5E94A 4JGNA 1FIEA 4NJAH 3IGKA 5ANMA 4P9HL 4ZT1A 3T1FB 1MWAH 3GI9H 4KKBD 2AMGA 4J12A 1S9VA 2VLJA 5KSUA 1U8CB 4FERA 4CSZA 3JUZA 4IOIA 3LN9A 4WTWA 4NKDA 1TU2A 3J8F7 3O8XB 1G0DA 2LAGB 3WJMB 2NXYB 3BUYB 1WITA 3D0LB 1QNIA 2NY6C 3KPRB 2QHLA 2NT0A 3F84A 1LNUB 3PGDA 4PRBB 4H7VA 3QJZA 4LARH 4E68A 3EJCA 1DEEB 1QUNA 4QRTA 3AREB 4DIXA 2OW7A 3GWJA 2PCFB 1XMWA 3LVEA 3RX7A 4PJ5E 4HBCH 2BIIA 5L4JA 3IJ9A 4LU5L 1WBYB 5I6PA 1RIUL 4ZS7H 5CCKH 3VFNB 3ORJA 4WI8A 2W9DL 1ZLSH 4NZ8A 5B8CA 5EF2A 2PP7A 1MCSA 4R0LB 5FXCH 4LOFA 1D2PA 5IJCC 3QNYA 2Y7NA 5BO0D 3IDJA 4FP8H 3RL1A 4FLQA 2ITCA 1DBMH 2IQ9H 2YAFA 2DTSA 2YAMA 3U4EA 2MKLC 5SWZB 5MERA 3MV9A 3JT2A 3KH4A 1CE6A 4U7SA 2X87A 1P4BH 4OGAC 5D4JA 4HIPA 2ZPKH 4HDIA 4YBQC 2IWGA 5GZNC 3QI9B 4Z7VE 1G6VK 4JE0A 4LHUG 4Q0XL 1SF3A 2NY2D 1HL4A 1O9WA 2AGJH 2IOMA 3B7UX 3GRWA 3L5XL 5BJTA 3ZZQA 4AUJA 1G94A 3SPVA 3CZUB 5AFAA 1PZBA 4AYEC 4KROC 3WY2A 5JMOC 3TYGL 1KEML 2E9WA 1WSST 3NP3A 2YEZA 2IWFA 4LF3A 2VC2H 4K5OA 3QIWC 5E9AA 1S5HA 2ZJSH 4PV8B 5BVPH 5DJYA 4JFWA 3V8CA 5KN5A 1CLOL 3PQYB 4DZBB 4X4XB 3QQ9D 1JFQL 3H9SD 4WY7L 5DVPA 4FHJA 3RA7H 3T8XA 5E00A 2HX7A 2DI9A 5DS8B 2TAAA 4MTMA 5HI4D 2VDRH 3ZKMC 4BK8A 3BVXA 2J1XA 1EXUA 1X4ZA 1YVLA 2JSFA 2C1PB 3O81A 9PCYA 1VDGA 4JGMA 2CHDA 3OJMB 2MCG1 3SKOB 2X0WA 3UTTE 1GCYA 3F65A 2DMCA 3AXLA 3ABGA 1GGCL 4YHOL 1RUAH 1WFTA 2IF7A 3B3BA 4H2AA 1HZKA 4MCYA 4IHBA 4PJ5A 4P8QA 3UMNA 1NFIB 2XWXA 3U2JA 4C83B 1Z0MA 1UA3A 4DN4L 1VEOA 3U1SL 2R0KL 1CTNA 1UZ8B 3UZEC 3LKRA 2K7QA 3WL9A 5JYLA 4X6EB 2HH0L 2ERJB 1HNFA 5I8KL 4PY7A 2J55A 4JO2L 1L7IL 5JQIB 5E94B 2XWJA 4ZMYA 2V2WA 5ANMB 1KTJA 1G4MA 3ZYZA 1UZGA 1E28A 2IDSA 3VI3F 5CSGA 2FLMA 3T0ED 4AVHA 4HOMA 3L08A 3EUUA 1TYEB 5IOKA 1N10A 3MZGB 1S9VB 1ULVA 5KSUB 1DVTA 3P4LA 5KSVA 3C5ZA 4IOIB 1B2WH 3V5KA 2CO7B 3UG5A 4HT1H 1TU2B 3DV4A 4EF3A 3HRPA 3O6KH 3IJSA 3ABZA 3LS4H 1VGKA 3MRKB 4Z7VA 2NNRA 5C08D 3PGDB 3FTUA 3F05A 4JE4B 3MX0A 5ALBL 5E24E 3LQZB 3SPJA 5I0DA 4PS8A 3QUML 3D34A 2Z31C 1QUNB 4QRTB 1L9QA 1HKLL 1NEUA 1EO8H 5GZNA 1GGIH 5F7HA 1PX3A 3VDCA 3GSXB 5EF1A 4PD4J 2GEEA 2VXVH 5CFAA 1J88A 3MXVH 3PP4L 5ERWA 2J1YA 3RZCD 4ZS6D 1DQDL 4KITB 4HS8H 4RRPM 4YSRA 4YQXL 4RAVA 3Q1EA 4EE2A 4MS8C 3IFNH 3HI6L 5B8CB 3PNRB 5I1HH 1HILB 1DVFB 3B5GA 5KUKA 2EC9T 3HZKA 3QIWA 5DT1L 3IDJB 4FFVC 2C9UA 3FTVA 2H2SD 3GIVA 4HEMA 3UTTA 3U4EB 3BP7A 1TJGH 2ZF8A 3CZKA 3RPIA 3UC0H 1NGQH 1JZ5A 2AQ3A 3LXAA 5MERB 3MV9B 1CE6B 2YK1H 5D71L 5FGCB 5FUOL 4BQ9A 1GCFA 1D5XA 4OD1H 4R4ND 4HDIB 4NHCH 2ZAIA 4YDVA 5L2JA 1PD6A 1W9XA 3II1A 3K2MC 1ZGLM 5BZZA 3T0DA 3QW9A 5FGRA 4Y5YC 2WLJA 5BJTB 4IRZA 1D6EA 1ZE3C 3BWAA 3O6LL 4TNVF 3SPVB 5EF0A 3UZEA 3TV3L 3RJOA 5GRJH 1G7LA 5E6YA 3M86A 3OZLA 2YEZB 2Q76B 2GJ6E 4LF3B 3I02A 3K74B 3MXWH 3VTAA 1G7PB 5KN5B 1SEQL 3L16A 4P2QE 1TCRA 3F64A 1KCKA 3HBGA 1UEMA 4JRYE 1FFPA 1YEIL 4ICXA 4E9SA 5C0BE 3T8XB 1GH7A 4JO1L 4Y16D 4PVBA 2BY3A 5J6GB 3OZ9L 2H1XA 5DF0A 1XIWA 1LWRA 2YFOA 1NINA 3SKUD 3T4AA 1N6QH 4P59L 1Z3GH 4W93A 4JFSA 3X1NA 2R0WH 4NI6A 1BIIA 3RAJL 2YAOA 2NY6B 1HCYA 4ODWB 5D7HA 1UOKA 1GA2A 4MCYB 4RWYH 1MCRA 1Y1UA 2XVGA 3MRCA 4GKOA 1CI5A 3NFNB 2D03L 5FC9A 1YNTA 3LKRB 3WL9B 2WBKA 2ENJA 6FABH 1D5IH 4BWUA 4PY7B 3FPYA 3K1DA 2CIKA 4LZKA 1QPXA 2XWJB 3LHAA 2V2WB 4ORGA 1YEKH 4UTAL 5DR5L 5K9OB 3VWKC 3WE6B 1SHMA 4H25A 5K59F 4EXPX 3RI5F 3SDDD 2EXWD 3O6FC 3TV8A 3GBEA 5KSVB 5A2BA 4Q6KA 2BVPA 3ULUC 3V5KB 4UQ2A 5FYJU 1NEZB 3DV4B 3I6KA 1KG0A 3M8OH 4BZ2A 3OR6A 1CDHA 3D6GA 5IHZA 3GMMB 3IJSB 2ZUYA 1VGKB 3VXOA 4Z7VB 5FHBL 3ULUE 1WISA 3DGDA 4IHOA 3BAEL 2FQGA 3MX0B 5I1KL 2QV2A 7CGTA 4YWGH 1OLZA 2UXTA 3E2HC 5AOZA 3WGUB 5F9JB 1WT5A 2BWQA 5DRWA 3FXIC 5FECA 3ATEA 4Y5YA 3RWCB 5ERWB 4M03A 2GJ6A 4W81A 5DJ8A 5CN1A 3UZQA 1RIVH 4K94L 1TIUA 3ILPA 4P2QA 2K6WA 3RWHA 3ZO0A 4DPBX 2XZAH 4RAVB 3NRQA 4UZGA 4EDXB 2GHWB 5KVDE 5ILTH 2A9NH 4OF6A 1PS3A 3L3GA 4N2DA 4B9ZA 3BT0A 1MFMA 2XXMB 5GGUA 3T3ME 2CIIA 3BUTA 3JV0A 2WTRA 3QIWB 1ED3A 1JDAA 3CBJB 3L3DA 4WWNA 4MJJA 2XPYA 4AEHH 3GIVB 3UTTB 1HC1A 2J3SA 5CP7A 3BP7B 5J6SA 2NY1C 1TZGL 3RPIB 1OE1A 5B7FA 1CL7I 2P8MA 1E2ZA 1OAUL 4IRSD 1QHOA 4N2FA 3UBGA 1P7QA 1D5XB 3FU8A 2FQFA 2DI7A 1FNFA 2Q2EB 2BW4A 2PPCA 4YDVB 2BHYA 5L2JB 4QT5A 2YD7A 3LJ3A 3BPCA 4DQOL 2WVTA 1J1OH 2FLBT 4MAUH 1N6VA 3ZVVA 1AKPA 4ADIA 1D6EB 3BWAB 5FYJE 4XXWC 4YVUA 3WNLA 1R0AL 5CBAA 3WUZA 3QDMD 4BGDA 3UC2A 1RERA 1G7LB 4XGZA 2CDFA 3L54A 4ESKA 2QHRL 3VQ2C 5D2LE 5AZEL 3NRPA 3ARUA 2KYIA 4GNKB 3BH9A 1MJ8L 1FFPB 2XX1A 5KTEH 1X7SA 2G5BA 2PXYC 2XETA 3HR5A 3GZOA 1YNKL 2Z65C 4P99A 2ZYSA 2FECL 2IBBA 4M6OH 4TRPL 3SBPA 1KTRL 1CU4L 1CS6A 2NY7L 5E8OA 4K7PX 1YYCA 5F7EL 2GYSA 4JFYA 4YK4C 1P4IL 5AEAA 3SYCA 1JHKH 3OJ2C 1A2YA 5F96H 2JKJA 3LVTA 4NQEA 3JWNG 4I9WE 4IIQC 1ASQA 4JFZL 5T5FH 3X3GH 2DM7A 2ICEC 1M9SA 4LCIH 2CO1A 2EZ0C 3MRCB 3SGEI 1X5GA 3PDGA 1Q1JH 2Z31B 3EW3B 2RTTA 1YNTB 4OFVA 3SCMD 1BEYH 3EBAA 4MB1A 2WSPA 5C09D 2QZQA 2W94A 4GT7A 2H1LM 1UUNA 4HLJA 4YFEA 2JB5H 1N0LB 2C3GA 4ORGB 3WAKA 3WOVA 5DD1L 4L4VA 1HHKA 4MLSA 2WKOA 4RRPA 5CP3A 2H26A 2VRQA 1PSKL 2DWYA 1YY9D 3VH8B 2BVPB 3LRSB 2DQDL 3P77A 2CBTA 2C34A 3CVIL 2I24N 1KG0B 3WS6C 4ONHA 2Z0UA 3OR6B 4I4WA 5EZOL 4UWQB 4QI3A 3LS5L 4UBDD 3VXOB 4RESB 1E40A 2W0FB 4LIQH 3P9MA 3AG2B 2J6EA 2ZKXA 3MRJA 4PS3A 5F93C 3LXUX 4R26L 1U8QA 2VM9A 4Z18A 5HDWA 3N40P 5D9SA 1F3JB 4N28A 2YXVA 4JPVL 3ALXA 5TE4L 1SY6A 5IMKA 4Y5YB 4UCFA 3WLBA 4J6IA 4WJKB 5D2LA 1Q9OA 2GJ6B 5DJ8B 3Q48A 4RLDA 4XXWA 3UZQB 1NCDL 2VAAA 1WVZA 3ILPB 4P2QB 4XP6L 4KX7A 4JRYB 4PFEA 1YA5A 5C0BB 2P8PA 1H6FA 4XX1G 2VMCA 5CN2A 4KK9C 3L3GB 5DK2A 5E2TL 1EZLA 4Y19E 1E8YA 4L0ZA 2IQAA 1F41A 4XNAA 3SOBL 5GGUB 1WAEA 1JDCA 2WTRB 4EXKA 1ED3B 1DP0A 5DHVH 3MA7A 3P1VA 4KKRA 5I6MA 3L3DB 1FRGH 1QSEB 2KKQA 2PXYA 3EUDA 4A55A 3QFJE 4EUPG 3C6EA 3HMXA 1ZS2A 2P8MB 1NIEA 3GMNA 4OUUA 2AKRB 2QQLH 1P7QB 4FFYA 1ZEAH 2VDOB 4O02L 4AMWA 3IMRA 4QT5B 3CBKB 4O5LH 3RY6C 4F20A 1H3TA 3BPCB 1IGCH 2X0UA 4G9FE 4HH9A 4FG0A 5F9OH 2DYPD 3QARA 5C0RL 5DMIH 5C9KA 2WJ7A 4JPWH 3Q0HA 5CBAB 2YWZA 3BP5A 1J5DA 3MN8A 2GVYA 1V54B 4XCFL 2CDFB 1LQBC 4XGZB 1IBGH 1Y6NR 2G30A 4GXVH 4B96A 1BW8A 3NN8B 4RGNC 2W91A 3RBGA 4OFQA 1K5NA 4PW3A 4DK5A 4XWOC 1AO7D 1EHXA 1SVBA 3O6FB 3TBYB 3IMUA 5HYIA 1F56A 1YY8A 4RGNE 4XO9A 2DQCH 4LDOB 1WAAE 5E8OB 3SDYL 1KTLA 2WWKT 4PHZA 1IE4A 4CL7A 1A2YB 4B7IA 3EG9A 3FT3A 1QWNA 1V3LA 2VSKB 1FVCA 3BH4A 1H3PL 2QVMA 3TIDA 1INQA 4M7JL 4NQTA 1JN6B 3RVXC 4ANWA 2IANE 3E2HB 4U6HA 1QWHA 3U6RB 4PJCE 4Y2DA 4FLHA 4OAWA 1W0YT 5CZRA 1SDYA 4YSAA 5AVWB 3TZVC 2R29H 4Y19A 1WYJA 4XP5L 1JRHH 2YRBA 5DVLA 2E4FA 2XWEA 3T3MB 3BLKA 1A6AA 3M46A 5HHXL 3H6AA 3QFJA 5DYOA 2H26B 1GGBH 4DJMA 1RSYA 1JPST 3ZUNC 1D6VL 1KYDA 1U3JA 3P77B 5I15L 3PS6A 3HHSA 2TRYA 4OLUH 4BYHA 5DUPL 4ONHB 2CDEA 4BZ1L 4HGWA 4I4WB 2NY1B 3DYPA 4WFFE 3F85A 3VRIA 2P80D 1FO0A 4G9FA 3P9MB 3VFTA 1LK3H 1MY7A 1M7DA 1MCCA 1U8QB 3HIZA 2LLGA 4KKAC 1XGYH 1ORQA 2DM2A 3RY6A 3U83A 1ZGLB 4E5XA 2HUEA 2VZ1A 2BZ7A 3E8VA 2O6DA 2APTA 1WS7A 2YO3A 4PRDA 4F7KA 1CK0L 3V2AR 3FTZA 1CL7L 1OK0A 1XEDA 1UENA 2BDNL 5D2LB 1ZSDA 1OZUA 2R15A 2VAAB 5F7LB 4O9HH 2PR4H 3CVHA 2VMFA 4HAKA 3LOWA 4J2XA 1ZLUK 2P8PB 5DK2B 1G6RA 4FABH 2R1XA 3CZJA 4HH8A 3II2A 2M1KA 3EH1A 2Q9OA 1E9OB 2VXQH 4JCMA 4QYAA 3ILDA 3FOMA 1WAAA 3OKNA 2PXYB 4X6CA 2DQEH 4Q0XH 2VRAA 4WO4C 1Z66A 1NCAL 2MMXA 3EOTL 4OUOA 3GKWH 3GF8A 2WUBL 3L5XH 1M9WA 2QVTA 3GMNB 1SUHA 3GBNL 4YK4B 5DC9B 2BP0A 3BE1H 1A9BA 2IANA 2Q8AL 5C7XL 3OQ3B 2HVJA 4QXGL 4GSDL 5D7SH 2VLMD 4UT7H 3DK0A 4IIQB 1I9EA 4HH9B 4PJCA 5JA9A 1JZGA 4YDMA 3TT3H 4EN3C 5FWQA 5DMKB 3BP5B 4CRPA 1U8IA 3SJVE 3KM1A 1SOSA 3S88H 3TURA 2B8OT 5HI3C 3FTSA 1H19A 2HPOA 1JGIA 1UASA 4GSXA 4KMTH 4RMBA 1B3JA 1FFNA 2FWUA 2X4RA 3B2PA 5T1JA 5FS5A 2NY5C 1GGCH 1EV2E 1DTUA 2DQIH 2R9HC 3IWVA 1GAFH 4TNGA 4QRPD 3CHPA 3UABA 3VNYA 1MWAA 1NLDL 5I30L 3GKZA 1TZAA 2Y3AA 2AHIA 3B56A 4C4KO 2HX8A 1KTLB 1T7VA 1IRAY 5DVOA 4CMMA 4X5QA 1CDJA 4R96A 3L4WA 3EG9B 3FT3B 4WQOA 1MAKA 1QW9A 3EYQC 1FVCB 1QSZA 2QPSA 5E9DD 1INQB 4X7FC 2B1AH 4XVUD 3EYUL 1K8IA 1AQHA 4AVJA 3KGRA 3JQOB 4PJ7F 4KTEH 4NO5A 3GDCA 2ZUVA 4JFDD 1Y6MR 1I3RB 4OAWB 3OGCA 4OD2B 3L6FA 3INUH 4Y19B 2P5EA 4Y4HD 3RWJA 2FJSA 4TS6A 4HJ1A 1A6AB 4UV4H 3VXUE 3OXRA 4PJDF 1QFUL 1REIA 3ML8A 2OXHA 3QFJB 5DYOB 3VA2C 2P48B 5DMGC 1MG3C 5JXAH 1JGLH 2LHAA 3HHSB 4G1EA 5CAYB 2QSCH 3FPXA 3QXTA 4OGQC 2VN7A 4WO4A 4CUCA 4HGWB 2NLJB 3FQWA 2PYEE 1ZXQA 4JKWA 2MPAH 1UM4H 2JVUA 3IJYA 4G9FB 1OSPH 3MODL 5G55A 1M7DB 2DICA 4EAEA 4KNUA 2O5ZL 1DVUA 1FSKC 3QO1A 1ORQB 4FRWA 3AVEA 5FLUA 4MMZC 3WN6A 3SJVA 2V9QA 3T5WA 4E5XB 5HHPA 1CMOA 4L8DA 3LAFA 1TXKA 2VSDA 4YZWA 3W0WD 2RJMA 4EN3A 2I7OA 4GBXD 3DX1A 3D25B 3FOLA 2I5YL 1VGEH 4GO9A 4YHKL 4Y5VA 3KBFA 3S35L 1Z9SA 1G6RB 2R1XB 1D5ZA 2EIDA 4RGNB 5F1KC 2Y5EA 4XXCC 5GRZA 3FOMB 3FT2A 3OKNB 1P5UC 1ZJBA 5EO9A 3N42B 3S4SA 2IJ0C 3P54A 1ZJAA 2LOEA 3Q1SH 2IEPA 3P0VL 2NOYA 3QUHA 3WIFA 5FWRA 2ZOOA 4HG4K 3TV3H 3L9YA 4P5SA 5BNXD 2BP0B 1E9QA 1A9BB 2P42B 2IANB 2UVFA 5GRUL 3QQDA 1KGIA 2HVJB 1FCGA 5F0PB 1AG6A 2ICES 4PJCB 1PAZA 2AAAA 1SEQH 3P02A 2IAMC 3KYNA 2AV7A 4AZUA 1A7NL 3ATAA 3FB8A 2D9QB 3B34A 4JQIL 4XBEL 1U8IB 2VR4A 1MCEA 1M05A 1NEPA 1V55B 1WLHA 3IPBA 3TZVB 4BJLA 4YSSA 4P59H 1FFNB 2X4RB 5AVYB 3P3TA 2B1HH 4NQUA 3UBHA 4P07A 4GKNA 3RAJH 3FMGL 1FFQA 1J05B 4GXFA 4IDJH 4XOEA 3WUWG 2WOYA 3SGDH 3ETBF 1QBLL 5FV1L 4JN1H 3H9HA 3N9GH 1MWAB 2VO8A 3VGAB 5I8EA 2BHZA 3QH3B 2D03H 5F6HI 3SZ6A 1BJMA 2FB4L 4CMMB 4RGOH 4TN9A 3V9EA 1EBPA 4R96B 1U33A 1ZANH 2NY5L 4WTQA 2YAQA 2DWTA 5EN3A 3GGWA 3WBDA 2FLRT 5I6KA 1MJ7L 5DR5H 1MFVA 2K0RA 3QE5A 2BY0A 3OJVC 2GITA 4AUYA 5D7LE 5LVEA 3I75A 3FH8A 4ODVH 4NO5B 1KJ2L 3VXMD 4ANXA 2Y72A 1JVLA 1IIIA 4QDGA 3Q9PA 1VIWA 3L6FB 4J3VA 3RWJB 1KB3A 3QRGL 4JDEA 4U1NB 2GIXA 3OXRB 3KM2A 5FCUL 4YGVA 5JHDD 3QFGA 3E6FA 5JW5A 2EILB 3MJWA 4AVKA 3UJTH 1E6JH 4LSVH 4NQCD 3R06A 3C5SA 1KCSH 4LRNH 5DD3L 4TL4A 1AI1L 4N1HB 3B9EA 3STLA 2GUOB 1P5UA 4NUPA 3GSRA 4RMRA 1HKFA 4WO4B 3A67H 3FQWB 2BIOA 4YSEA 4W9EC 1URLA 4L8SC 3QDHA 5E08H 1Q0YL 4XTRD 1OP5H 5EEWA 1JVKA 3HNSL 1FZOA 3KWXA 3CZSA 4HUVA 3G9AB 4OVUA 3H53A 3QO1B 4RBPK 1QFWI 4XC1L 3OR7A 5HHPB 3SJVB 1U8JA 4HULB 3U0PA 4C4UA 4L8DB 1A64A 3CFEA 4G6JH 4PJ7E 2JXMB 5E6RB 5GS2H 1S5IL 3LDBC 4EN3B 2QGEA 3GZKA 4JHBA 3GMQA 3FOLB 1IU1A 3H3PH 1AHWA 1NAKH 3DV6A 4JY5L 1S7TB 4DKFH 5DWUH 5H37G 1Z9SB 5IOPA 1OAUH 1D5ZB 2IDTA 3VG9C 4P4RA 3DPBA 3L9EA 5D96C 1IL1A 3FU7B 3K72B 3DGCR 3ZR5A 3FT2B 2ADFH 5BPPA 3CSFA 3ZMNA 5EO9B 1VHPA 2P4AB 2VC2B 4OKDA 3S4SB 2HLAA 2XNAA 2VXUH 2HMID 4Z7OF 3CHSA 3WIFB 4WW2F 4ZPTA 3QIUC 3CD4A 3CXDH 3ESOA 1E9QB 3L9BA 2Y7SA 5DEJA 3V4VL 2Q3AA 3CDCA 5KYUA 1WUNT 4ZO9A 2IDUA 2WBJD 2FDBP 2ZWKA 4KO7A 4OIIH 4HUXA 1MJ8H 1AZVA 1I4FA 3FB8B 3U2SA 3O3DA 4X4ME 3DUUA 2BOLA 3MACL 2EE6A 3VXUB 2UX7A 3VM5A 3UEZA 1M05B 1CU4H 2YD5A 5F71A 2PTUA 4GKNB 1A6UL 4BKSC 4ERSL 1OT1A 2A9CA 2DWSA 4F7EA 2FYVA 2A99A 1ILUA 1W8EA 2PYEB 5I8EB 1PJWA 1WA2X 2IALA 4K7PL 5T5NF 2EVFA 5D7KE 2XUWA 4H1LB 4W4NA 2X2UA 4EI5D 5ICYA 3TH4T 1T7ZA 1JV5B 1UT1A 2GB2A 1MHHA 2VDLH 4MBRA 4L8SA 2EVJA 1V3KA 3F00A 3NSYA 3V55A 4YSQA 1F1AA 3K6NA 5INDA 2NQDA 1FSKB 5GGTL 2APSA 2Y0SA 2Z0BA 4F27A 1LXMA 1S9YB 4G6ML 1CGYA 2MHAB 3FUEA 1T80A 4E9RA 2Z7WA 3QFDA 4M43H 4HWEH 3JV6A 3B2DC 1VRSA 1K3IA 1F58H 4QYOA 3EFOB 3VXNA 1ZT1B 1T5XA 2CJSA 5HHMB 2HRHA 3VRLE 3P3SA 4F8PA 4JDEB 4FNUA 1WF5A 3GLZA 2DQGL 1E90A 3LS5H 3N04A 4YGVB 3E6FB 5JW5B 2EO7A 1AGBA 4B41A 3MCLL 4IDLA 3QPQC 3C5SB 4R26H 5JYMA 4JPKL 4N0FB 4WFGD 3STLB 2IXQA 4M02A 1FV1A 1P5UB 3Q2WA 1ZVHA 3GSRB 2D0HA 2IC2A 2YUZA 1C16A 3LPOA 3QO0A 5DQ9A 3V7AE 1VKXA 4J3OD 4P5TC 4ZFFB 2W81C 3VNZA 3N43F 2ZXGA 3T3PE 4X8JB 1LWJA 3MOBH 5CHNA 3IRCA 1NCDH 3C5JB 3QIUA 4IM8A 2WQVA 2WUCL 3B2XA 4X4MA 3OR7B 3P4MA 1J9CT 1U8JB 3U0PB 1FL5A 1DL7H 1RZ7H 2CGRL 2IAMB 5AB2A 1LO4L 5B39G 1C5CL 4NRYA 2BC4B 4LIQE 3GMQB 2OPCA 1I8LA 4KH9A 4O2CA 4WHCA 1A5FH 3DV6B 1L0XA 2JKSA 1GJWA 1URZA 3BUBA 2ZX7A 2Z8WC 5IOPB 1UH3A 1CYGA 4EZJA 1CDCA 3CFBB 1O9VA 3DPBB 4P4RB 3RWIA 4KHTH 1IL1B 2APWA 3MC0A 2ENQA 3IKKA 4C56D 4NFDA 5B4MC 2C8NA 3DMMD 5F3BB 4DP0X 1BECA 1F4AA 2C4FT 3PYCA 2HLAB 2Z8SA 2XNAB 3IGUA 4CSPA 1TMQA 1AYOA 4HKJB 3O4OC 4IW4C 2J1ZA 4WHYH 3PGFL 5T3XH 5D7LB 4ZFOL 4DERA 3AGWA 1BFSA 3QEQB 5FOBA 4Y2OA 5CGYD 5KYUB 4EBQL 1FYTA 1X5LA 1N70A 4HUXB 4N90D 4M62L 4MD0B 1NLBH 1I4FB 1TVBA 3WNPA 3WNKA 4BM7A 4JFFD 3U2SB 5T5FA 3DUUB 4CGUB 2NY4D 1FYHB 1MW1A 2E4TA 4HISA 1I8MB 2Y6SC 1LYQA 3TH3T 3LPPA 3ZIMA 4YSCA 3VUAA 2DBLH 1KUMA 4RCAA 3FSWA 4NKMA 2HTKD 3DGGA 1AR1D 4F7EB 3KLSA 3CXFA 4YDIL 1LEKA 4JHVA 4TVPD 4UQAA 4ZUTA 4F7CA 2IALB 2VSMB 3O3UN 4F80A 3TFKD 5LNEA 3GS4A 3DHPA 5ICYB 2BOCA 2ZAGA 3N41B 4OTXH 4QMEA 4I48A 4P5TA 4UOQA 1PBYA 4FTVA 1BOYA 3HS9A 2PO6C 4FJYA 4L8SB 4PJ7B 3SY0A 3EJJX 5INDB 3QULB 1VFAB 4ZFQA 4XMLL 1QSFD 2ENPA 4QO1A 2ZTBA 4P2OD 1J5HA 4HWNA 5ID1A 4MJIE 4AM0Q 4QYOB 5DHYA 2QJDA 4PJFE 3VXNB 2UZXA 1AE6L 1T5XB 2A1WL 3LDBB 4PJDB 4XE0A 5CMAA 5DLMH 4BFNA 5L4MA 3P9LB 2CG9X 1UKSA 3MNWB 2O5NA 1U8MA 3PXHA 1HT6A 5MP6H 1QFWL 4UQ9A 3IWUA 1AGBB 1ETZA 1GS7A 2E74C 3AWEA 3CFQA 5F7DA 5EO0A 3VG9B 3GS7A 5D96B 1L9TA 5FO8A 3B5HA 4TULL 4HALA 2IH9A 4ELME 2OULB 1FV1B 5AYUH 1I8AA 2IOOA 3L3JA 2VW6A 5DQ9B 5ESAA 4XP1H 1IBBA 5FO9A 1VKXB 5DHVA 5JR1L 3MLPA 2BDNH 1HWWA 4D0BA 5CHNB 2VDML 3QIUB 2X40A 1SLXA 1SYVB 5CN3A 4XVSL 4HEPG 4Y1TA 2AFNA 3MFGB 3P4MB 4ODTL 5JPNC 4Q8BA 4S1SL 4X99B 4S1QH 3QUYA 4NRYB 1CR9L 4TUKH 4APQC 1LL1A 4PGCA 4G72B 1C1EH 1L0QA 5D93C 3QXAA 1YN7B 3QXWA 2XQYG 4K4KA 1BAGA 1CZ8L 3QR2A 1LD9A 3GBNH 4QKXB 1P2CA 3RWIB 3D4GA 3IDXH 4YL4A 4QXGH 2X4PA 4PWJA 4OQ1A 1OE3A 1A02N 4FXGC 3GJEA 3ARDA 4NM8L 5FB8A 2FSEB 5CUSH 2YOAA 3MRRA 3TBBA 1JF5A 3CC5A 5FYLL 5HSFA 1WHOA 5HHNA 5IVXF 1H8SA 5DGQA 4Y2OB 3IU3A 2PO6A 5KYYA 4XR8C 4FFWC 2NCEA 4MJIA 4M4PA 1TVBB 2IFFL 4PJFA 1S9XA 1MJUL 1K9TA 1GTFA 3MRPB 2Q1EA 1NGZA 4MDRA 1Q90A 2AP2A 3OGOE 2Y36L 1GW0A 2IGLA 1YECH 4Z0XA 3VXTA 2DF3A 2LV4A 4QHPA 1MREH 3JVFC 2BVQA 1EXHA 1LMKA 1YN6B 4GLRH 1KJVA 2JJUA 1SNRA 5ALCH 4ELMA 1H5BC 3IMVA 4NKMB 3RU8L 4XXDA 3SPHA 3DGGB 1RUPL 1TQVA 1R3KA 1LEKB 1TTCA 1MCKA 5HVHC 1G5GA 4KRNA 4F7CB 2IAAC 4N86A 3T3PB 3N1PC 2X28A 3WV0A 2J72A 5TDOA 1G1CA 3ISYA 3WI9A 2Y25A 3FF8A 2BOCB 4AZ8A 2OMYB 4I48B 2Q86A 4IS6A 4P5TB 3STZA 1PMYA 4NQQA 1ET7A 1QBML 1B90A 5J1AB 1U36A 4M61A 4NXKA 5CZXC 1A4CA 3NABL 4HIEB 3IAPA 3L4VA 4YLCA 4OGXL 4Z6AT 1KEGH 2UZIH 1OW0C 4L8CA 5JPNA 2BH0A 4QO1B 4BQBA 4HCRL 5ID1B 3PWLA 5DHYB 1UB6B 3V4PL 4APQA 1PPIA 2UZXB 5CMAB 2QTVA 4OGZA 4OM1L 3NJVA 5D7EA 1U41A 1U8MB 3M1BB 4U1LB 3B2UD 1ETZB 3QDJA 5F7DB 4XOCA 5EO0B 3VAEA 3O8XD 2O6EA 5FO8B 3D9AL 2NXYD 4NQDA 1KBGL 3QJXA 4LVEA 2EYRA 1Q0XL 4UNTA 4XX5A 1JYWA 3BAWA 1V5JA 4HLZH 3KPRD 3L3JB 5ESAB 2NSXA 1OPGL 3ZKNC 4AE0A 1JTOA 5FO9B 3GJFK 3KPNB 5DHVB 4R8WL 2JIXA 4UNVA 5IHLB 1F8TH 3O4OB 3UBXA 1AZRA 3ARED 4KHXL 2BP3A 2F58L 2JQZA 5EU6E 1E5ZA 2HFTA 4H5SA 2YZ1A 2IBGA 5LN4A 5I5IA 4X6FA 3ETTA 4AGMA 2YGQA 4NFBA 4EN2A 2EICA 2H0EA 3L48A 1MZZA 4KXDA 4WKZA 5JIHA 2CM6A 3AY2A 3QXAB 1K3ZA 1FNHA 1BG1A 4ZW8A 1RVFL 3EJYC 2IBZY 1ZIBA 1S7WA 4G43A 4XN8A 1IVLA 4NKQB 4UAOC 3GBMH 1F2XK 35C8H 3QWQB 2XBTA 4X0NA 5SWZD 3UH8A 5FB8B 2L04A 2IO5A 1AP2A 4NM4L 1RXLA 1OOWA 3MRRB 4PJ8A 2XA8L 4B5ZA 4KZ0A 1Q94B 2H9GA 1AXTL 2F1BA 3QI9D 3CC5B 1GSMA 5SV4A 2G2NA 3CSTA 3GHEL 4YLQT 3VD2A 4UYPA 4KRLB 4G5ZL 4NZJA 3F58H 1OANA 5HHNB 5EFIA 3IU3B 2PO6B 3ZSSA 5KYYB 4I0PD 1IC4H 3D3VD 4MJIB 3RNKB 5E1QA 1BAWA 1BLIA 1RZQA 4NRXA 4PJFB 3RB7A 1S9XB 2GJJA 1SBSL 3QK0A 4GW5A 5ENWA 3S2AA 2HVKA 1GOFA 5BUPA 5IZ7A 4K71C 4OB5L 3MRHA 2A6DA 2JELH 1G7HA 1MUJA 1CFBA 4Z0XB 3MLRL 3VXTB 3DETD 1DUYB 3PQYD 2FWLB 2XFXA 2BVQB 4GKSB 1KJVB 4ELMB 1DE4A 2FGWH 1I3GH 2N59A 4XXDB 1HH6A 4HYTB 1NL0L 3HBQA 1T1ZA 1R3KB 2N0KA 1UTDA 4ZYKB 3PWJA 4UQEA 1EMTH 4PJ9C 2XJLA 2PWHA 2XTJE 2VZ3A 5TDOB 4JW3A 5F1NA 3TJHD 1NGPL 2V17L 2ED6A 5EU6A 3RTLA 4AZ8B 1X5KA 2UUDH 1OARH 4IS6B 5LB1A 2Q86B 3STZB 8FABB 5F2FA 4M61B 3BLBA 2VLLA 3KJ4C 3U9PH 4KJWD 1FF5A 1V7MH 4FQIH 4X6DE 1EERB 4ZMQA 3WFCL 4LEXL 4L23A 4L8CB 2R8SL 1GYUA 5JPNB 3II3A 4PN6A 5F21B 3R18A 1QOKA 1IFHL 1MFAL 1QAWA 3PWLB 4Y5XC 4P04A 3TEUA 4APQB 5HHVH 2N56A 2WSKA 3MV01 2VLJD 1A3LH 1T1WA 4KXZI 1TITA 2FJUB 2BP5M 1CXKA 1U2HA 3JT0A 4K9JA 1YEWA 3FN0H 1KENH 1DSWA 1ZVSA 4HP5A 4DEUA 1KOAA 2OSYA 2XBZA 3ZTJH 1U3HC 2EYRB 1JD9A 4XZUA 2FEJA 5E2VL 2IG2L 2V9UA 3BQUA 4FXGB 1P9MC 2VW4A 2WY3B 4NHUB 1I8IB 1B4JL 3PP3H 3RHWK 1MJJA 3UBXB 1QFHA 4AV0A 2X3BA 3DJZA 2FX8L 4NENA 5CZVL 4V2CB 2O93L 4Y1AE 4ODSH 4YDKL 4MJ2A 4X6FB 1HQ4B 4XVJH 3FU9A 5D8JH 3MUY1 1JGUL 3EYVB 2DIEA 5FOJA 2EDDA 3K6FA 4M3KB 4YAQA 4C47A 4WKZB 2WM0A 4FAAB 1DVFD 4JL2A 2VJ8A 1MCOH 1BXVA 3E1F1 4BDVA 5KSBA 4JG0H 3WEBA 4JVUA 4UNUA 3I9IA 4ZDHA 1RAMA 4G43B 4GKZA 4TSBH 5IFHL 5JOPE 2FRGP 3JZ7A 5KW9L 4ZMXA 4UDUA 2VYRE 1H5BB 3U0TA 3WSQL 1E4WH 5B1AB 3QEHB 1MKFA 3MV9D 4DETA 2KQMA 3BSZL 1I85C 2V2TA 3BZDA 1CCZA 3BW9A 4JO5A 1BVNP 3DTXA 3U9UA 1CO1A 4PJ9A 4KDTC 1IEAA 2H9GB 3NIDF 3OAZH 1CE1L 4L2LA 1E5AA 3DX3A 4X6DA 3DUHA 3E3QE 2VNCA 5ELIA 4Z7NF 4R84A 5EFIB 4UM9A 3NJHA 1EZSA 3ETSA 1GJUA 4F7PB 3ARFC 4R5XA 1A6UH 4AQAB 3OB8A 2P7TA 5I0XA 5KEZA 1Z6JT 5ENWB 4GW5B 4N8VG 4IBLT 4OR1A 3EOYG 4XB7A 5L4FA 4K7PH 2E75C 5LGJB 1G7HB 1MUJB 4Y5XA 2FT6A 3VXQA 3ZYOA 3DXAE 5ISZA 4NNPL 4K5LA 1PTZA 4XPBH 1DQQA 1TZHA 2G4EA 3ZY7A 5JQHC 4BSWB 4GAGL 4NZRH 4YXLL 3JXAA 1HH6B 3VACA 4L3FA 5IHWA 3W5MA 4UYQA 1BM3L 4F2ME 1T1ZB 2H0PA 3D52A 4UOJA 1V7NH 3PWJB 3BPLC 1U3HA 2X89A 3HG5A 2NY6D 4IYKA 4UT9H 1OP3K 3V7MA 3WHE0 4XNUH 5F1NB 4ATTA 4Y1AA 5EU6B 4QJ5B 1P9MA 1KYOK 1I7UB 25C8H 3KHQA 2ZX8A 4TNWK 3OPZL 4PJ5D 4QPEA 4XC3L 4JQVC 1NC2A 4OJAA 5IEKA 2FT7A 2EYTA 2YD4A 4TXVB 2R7EB 2DQGH 2X2YA 3TBWA 4NC0B 5AW3B 2Y24A 4BUQA 1CDYA 1XGQA 3EJTA 4ZUWA 3ZRCC 2QQQA 2H0JA 3W56A 2BP8A 4QAWA 4FZ8L 5JOFB 4HETA 1HE8A 3BPOC 1TDQA 1EDYA 3QT2A 2C1OA 4B27A 1X7TA 3RJQB 1FG2A 1TVHA 2G0LA 3C5ZD 5EIIB 3MFFA 1IAIL 4MB4A 1ZVSB 2N1KA 2QL1A 3AT8A 3QPXL 1DBBH 2GIMA 4UAOB 3VDBA 1ID2A 2R27A 1JERA 4BUGA 4PWKA 2GBVA 5JZ7C 5D5MA 1NIBA 3HZYA 4P23A 1Q9LA 3SDCC 4LSUH 4OGAD 1I85A 1LO4H 2P46B 2IFGA 2MNWA 4X9HA 3PFQA 1AD9A 2X10A 3IT8D 2BNRE 1IGJA 5DTFA 3CZFB 4KDTA 2FWOA 5GZND 4U7KA 3S5ZA 1BDYA 1ZHBB 1YUKB 4G59C 1TNNA 2DKMA 1KTKE 2YGNA 4JEGB 2XV3A 1CIUA 4YE0A 3VCLA 5FA4A 1RFDH 4UOW0 2APFA 4POUB 4OCYH 5TPWH 2J2ZB 3AJ7A 1A6PA 1B0GA 3ARFA 4UTBL 4YAQB 2OK0H 1TQBC 3IKCB 3DXAA 3PXLA 1OD7A 2ATKB 1F42A 3O2DL 1YZZA 1OY3B 1CFQA 4HSCX 4XNMA 2F61A 3EFDH 4K71B 4BDVB 3QIWD 4PIBA 1UOVA 4ZDHB 3CSBA 3S9DB 2YMTA 3H7BB 1QFOA 4GKZB 1O7DC 1WZMA 4XCNA 3UTTD 1O5PA 5GGSY 4FEIA 1IQWL 2XTJB 4P06A 4IBWA 4KNSA 2OTWA 1UD6A 4JREC 5DD0L 1Y1DA 3FN3A 1O7DE 2YXWA 3H7LA 5I16A 1BQSA 1PJ9A 1S2EA 5CZKA 2WNWA 2WNXA 4PJ9B 1VCBC 1FFTB 1IEAB 5CLZA 1I9JH 4PB0L 1QBBA 3JTSB 2R2EB 4A7SA 3WEXA 5IEHA 3VVVA 1L0YA 5L8KB 2WO2B 1HOCB 2Y3NA 4X6DB 2WP3O 1E4KC 4F3FA 4Q97A 1LO0L 4UM9B 4CILA 5JIKA 1MQKL 5HDQH 3BGMA 3KJ4B 3MQIA 4RDQF 4PRIE 2GSGA 2Y2WA 3ZT6A 3BRDA 3IF1A 3QHZH 5FA3B 3F7RA 5HDBF 4NOBA 1IM3A 5AKSA 5T3XE 3U25A 4Y5XB 4LPCA 5B21A 3KW7A 2YMXH 1L3WA 4HF5L 1JYXA 3LQAH 2ZXWB 4GP8B 4X5WA 4ZG1A 5I75C 1WE5A 1DQQB 1TZHB 2NYKA 2XXFA 2DJSA 1TKWB 2G5UA 4PGBA 1CTOA 2E8ZA 3WKML 1XIWD 4MMXC 4A39A 3V9FA 2ZCKH 1OB0A 1JGEA 4PJAF 5DRXA 3E6HA 4JFQB 4B3VA 1QMUA 1U3HB 3W38A 5A2JH 2BNRA 4WI3A 1UWYA 2H3NB 1PNDA 4L4TB 2KI6A 4MJHA 4H20H 2A1WH 3MO1B 5IEKB 2Z31D 2EYTB 1X5JA 5GRVL 2W9EL 3CLEL 4Z7NE 2LU3A 1EANA 4L05A 4NBZB 1RUQL 5AW0B 3KMDA 5DJ2A 2ZUQC 4MYWB 1XGQB 3R1GL 3PPEA 3OM3B 4ZUWB 5TQ0L 1I1AC 4X83A 3ZZSA 1MFNA 3AITA 1JPSH 3FW6A 4L3AA 4Q4IA 3UAAA 1KBWA 1E5CA 2KC0A 2MQ3A 4FKEA 4P05A 4NERA 3GMRA 2P9RA 5A2CA 1FG2B 1BJ8A 1TVHB 3P0YL 4L0PB 5JHLL 3MFFB 3O3BA 2HT4C 2VDMH 5C0JA 4W6WB 1TQCC 1K8DB 4YHMH 1II4E 2WXPA 3QJRB 3AC0A 4UILH 5EHFA 1I1YA 3W9EA 1E30A 1QUPA 2B1OA 5LGYA 2QVKA 3HZYB 3NTCL 2J5WA 1NDTA 3OVUB 4LLQA 4MHHI 12E8H 5KSAA 1IGJB 5DTFB 3ZRSA 4MJ6A 3EADA 1BZOA 2FWOB 3J2PA 2QKIA 3BISA 5J11C 1FAIH 2AXFA 4HJ0D 4PRIA 1DN2A 4OSUL 4R4FH 3N50A 4ISVA 4HAGA 3MU3A 2LT9A 5LG1A 5FA4B 3VCLB 1FGNL 1YPZA 2GJ6D 3RE0A 1XBRA 5TF0A 1B0GB 2VE6B 3ARFB 4HUUA 3BMVA 4P2QD 1W80A 3IYLW 5GHWL 5C0BD 4CVXA 1FNSL 3K7UA 4R83A 5DJXA 1CFQB 4XNMB 4IMLB 5BXFA 2VR5A 4K55A 4F2MB 2BS8A 1IKFL 2HUHA 3E38A 1DLHA 2P5WE 3B1UA 2Q5BA 3F01A 5JORA 2IBZX 2OTWB 4BUHA 5G2NA 4ATWA 3VGEA 4GRLC 3I3BA 1P7QD 5I16B 2CGZA 3F04A 2H4EA 2OSXA 3QCTL 4QHNA 5EA0L 4CJ0A 3KS0J 3OWRA 3WEXB 5IEHB 4AJWA 2DJUA 1RK0B 3SE3A 1NCUA 2E7LA 1D7FA 4IKJA 4KXAA 3OKYA 4G6AD 1JS4A 1BXXA 3BGMB 2FAUA 4L5FL 2GSGB 2VDLB 2EDLA 3TP4A 1WD9A 3IF1B 1FPTL 1KGUA 3TH2T 1E7VA 1HX0A 2LU5A 4L9LC 5KVGL 1U6AH 4U6YA 4RZKA 2CBMA 2K8QA 3U7YL 4HKZB 1T2QL 1SLVA 2IH1B 3K6OA 3BPOB 5ECJE 3BVVA 1DN0B 3ARGA 3BFWA 4PBVC 1NCWH 4K9EH 2I60L 1WHPA 3OKDA 1KPVB 3PWUA 4Z8FH 1ZT4A 5DMYA 3ULUD 1JGEB 3PWNA 4LASL 5C9JA 1HHGA 3B6SA 4OGXH 1MCFA 2BNRB 4GEJA 4ZW6A 4ZTOL 4NQED 1LE5A 1NPUA 4F58L 1ACYH 1KTCA 3SDCB 1YSOA 2EDHA 3TPUB 4EDWH 1JK8A 4HXAL 1PZ2A 2ZXCA 4A37A 2FJGA 2ZOLA 5L2KB 2EH7H 1GJIA 2NY2C 3S8GB 1OO2A 2EC9U 3IDIA 4OLVL 5DJ2B 5CSBA 3L7FB 4NJ9L 3L3KA 4LLAA 2YLHA 2GFBA 3L95B 4WKXA 2OJZH 5IHUL 1L9NA 3BIKB 1TQBB 1NGXA 4ODUA 4KO9A 1CDBA 2P5WA 1MCHA 5C07E 4NOFA 5FYKH 4R3SA 1QQDA 5B38B 4R8WH 4XH2B 5IB4A 1ANUA 1KCUL 2HRLA 4NXSA 5CJQH 3WGVB 3U1QA 3QWRA 1I1YB 3H9ZA 3W9EB 3PXJA 4QWWD 2NY1D 3ELQA 4EUPH 4OM0H 1GPOL 1RZIA 1ZHLA 3DIDA 4I1RA 2CR3A 4GRLA 5B7MA 4YHPA 4LBEA 4OZGF 3U1PA 3P3YA 5KSAB 4X98A 5L0QC 4P2AA 5FYJD 4YE4L 5CS7A 3AT0A 3W1ZA 2I69A 3A6BH 4YHNB 1A6WL 1J10A 4PRIB 4XB8A 2K6YA 3LZNA 4NP4L 2CO6A 5DI8A 3ARRA 3MBEC 2OTUB 4D9RE 1DVYA 2OW6A 4TOYL 5IESL 4K0OA 4FC3E 2ZCLL 5TE6L 1XZWA 4LCWA 4AMKH 5DJXB 5EF3A 1NFDE 1DSFH 4ELKA 5AZ2H 5BXFB 1NOAA 5CR8A 1MCWM 3EOBB 5HYSA 3SDXF 1AXTH 3RWEA 1DLHB 3G04A 2PXYD 2A4ZA 5B3JF 2F8IA 2Q20A 1BYOA 4JFTA 3GHEH 5I75B 3K2IA 3EZ8A 2ZNWA 3GSOA 2D31A 4OQTH 4I9WD 3TJPA 2BFGA 4GH7B 2CK0H 4X80H 3BC9A 3WENA 3LNEA 4W70A 1SM3H 2HTLD 4NUJB 4QHNB 5C0IA 1PLGH 1MCDA 2XPGB 4Z7NB 2AI0H 2FH8A 1CBVH 5BMFH 2ODIA 1T5KA 4DP7X 3OAUL 3PF2A 3FFCE 3DRQA 3U0WL 4XPFL 3ARTA 4JVPA 1N18A 2B2XL 4EKXA 4BFIA 2ZUQB 4G7VH 3V0WL 4A6YB 4MS6A 4ZSOE 5C07A 1UD3A 2AJYH 4PWFA 4ABQA 3MLTA 1I1AB 4D0DB 3I6SA 4H44C 4U6YB 1KMGA 2AZAA 2W07A 1KELL 3KW8A 4FLRA 1RIHL 3KJ6L 4LVHC 1NGPH 3TM6A 4D8OA 3P69A 3RWFA 3ARGB 1RL1A 5CSZA 4N24A 4M5YL 3OKDB 3PWUB 4LPTA 1ZT4B 1TQCB 5IB3A 1ROWA 1XGUA 3B6SB 4JB9H 3L5WA 4FQCL 3N1QC 4PB9H 4HK0A 3Q5OA 3IN2A 1LE5B 2BSDA 1TTAA 4P9ML 4AYSA 3OKEB 3HC4L 5I0YA 3MYZA 5TD4A 3WKQA 4DF9A 4PJBF 2FJGB 1GIGH 2ZOLB 2HJFA 3ZDYF 3N2JA 5J11B 1ZPUA 4Y2DD 2Y07H 1UZ6F 4FNTA 2FR4A 4F8NA 2B5IC 4RMSA 1DLFH 3D4ZA 2YQBA 3MBEA 1NFDA 4Y19D 4BXSV 1CG9A 3WXWH 4ETQA 2GFBB 2WQXA 1NAMH 1X3DA 1NCTA 1L7TH 2NTFA 4RISL 5E2VH 2O5YH 3S4SG 2DQHL 5KVFL 1F4XL 2P5WB 1KDIA 1CDUA 1X5XA 3K4DA 3QFJD 4KK9D 1B4JH 3HG1E 2N7AA 3TONA 4R3SB 1QQDB 4PGEA 1MFEL 3CZNA 5IB4B 2L0DA 4Q9RL 4Y16C 5EZPA 3U7AA 3SPIA 2QMJA 3CIQA 4NGHH 4ODHH 3IAGC 1RZIB 4X2UA 4G9FD 4GRLB 4HJJH 1AXSA 4O2FA 4YHPB 1I53A 1IZKA 2SODB 2BJML 3FFCA 2GSMB 4FA8A 4U1GC 3O0RH <