4L05A

Cu/zn superoxide dismutase from brucella abortus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
ESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural, Functional, and Immunogenic Insights on Cu,Zn Superoxide Dismutase Pathogenic Virulence Factors from Neisseria meningitidis and Brucella abortus.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Oxidoreductase
total genus 34
structure length 154
sequence length 154
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4l05A00
5KBKA 4BD4A 1JK9B 2JLPA 2V0AA 2WZ5A 1HL4A 2XJLA 3KBFA 3MKGA 1IBDA 1P1VA 1E9OA 1F1GA 2C9SA 3GZPA 5KBLA 2GBTA 1OZUA 1E9PA 2GBVA 4A7VA 1IB5A 2SODB 3T5WA 1QUPA 1IBFA 1JK9A 1IBHA 3L9YA 1YAIA 4N3UA 4BCYA 1Z9NA 3KM1A 1TO4A 1YSOA 2WZ6A 2AQQA 1JCVA 3GTVA 1SDYA 1BA9A 4N3TA 2WZ0A 1N19A 1F18A 1OZTG 3F7KA 1N18A 1SXZA 2Q2LA 2K4WA 1PZSA 1U3NA 1SRDA 1XTMA 4OJAA 2WKOF 3HOGA 4L05A 1ESOA 1OALA 1HL5A 3K91A 2ZOWA 1OAJA 3KH3A 2LU5A 3KBEA 1B4LA 1EQWA 1SOSA 3ECUA 1EJ8A 4A7GA 2AQPA 3CE1A 3HW7A 5CU9A 3GZQA 1MFMA 1IBBA 2Z7WA 3MNDA 3ECVA 4FF9A 1PTZA 4A7TA 3QQDB 2JCWA 1RK7A 1SDAB 2VR7A 1F1AA 5KBMA 3F7LA 3HFFA 1F1DA 2WWNA 4MCNA 2AQNA 1XSOA 2Z7UA 3S0PA 1OEZW 4B3EA 3GZOA 3KH4A 4BCZA 3QQDA 2E47A 4OH2A 2APSA 3PU7A 3CQQA 2R27A 2WYZA 2VR6A 1BZOA 1B4TA 3L9EA 1E9QB 2E46A 1AZVA 3RE0A 2ZKXA 3H2PA 1YAZA 2GBUA 1E9OB 2C9UA 3ECWA 3SODB 2AQTA 2VR8A 2XJKA 2AQRA 4U4IA 1E9QA 1XTLA 3KM2A 2WKOA 1SXSA 1SXNA 2WWOA 1Q0EA 2ZKYA 2ZKWA 1UXLA 1DO5A 3LTVA 1L3NA 1UXMA 1TO5A 3H2QA 4MCMA 2Z7ZA 1SXCA 1PU0A 2AQSA 1SXBA 1FUNA 1SXAA 1S4IA 2C9VA 4A7UA 2Z7YA 3GTTA 4A7GF 2AF2A 1CBJA 1DSWA 4A7SA 1SPDA 3CQPA 2WYTA 1CB4A 2AEOA 1Z9PA 4A7QA 1COBA 3GQFA 2NNXA 1E9PB 1KMGA
chains in the Genus database with same CATH superfamily
2VDMB 2IGTA 3FTGB 4IHOB 4P46B 4RAUB 4BD4A 2YS4A 1D5BB 5E6IC 4OQTA 1NMCC 2FLRT 3U1SH 1WBYA 3WEXB 2BOCA 4HMDA 3HNSL 4K7FB 5EIQA 4C83A 4DAGH 1CR9L 2VB5A 3BH9B 4P23C 1AE6H 1XCTB 5BZXA 4FFVD 1MFCH 2Q20A 4JRXE 2X4RA 5DJ8B 2CR3A 2DKMA 4Z3GA 3RZCA 3K0WA 3QORC 3S3BB 2VLMD 4PCTA 1JDCA 1LQSR 1D5XA 2H2PD 1SEBA 3MDJA 4LOFA 4NQDB 5C07A 3R7QA 1OD9A 5JXEA 2YA1A 2WKGA 4NO0B 2PWGA 4Y4HB 3PP4H 5DVLA 2FWOA 2AKRA 4XH2A 5G2NA 4XB3A 3GKWL 2IPTH 1YNTA 2BY3A 1KB5B 4O9HL 4QXTA 3QCTH 4UM9A 4Z7VF 2RR3A 4S0TD 5FF6A 4HOWA 2FT7A 1FRGH 5ALBL 3S88L 2Z35A 4NI3A 3ZU8A 4TQIA 4MNQD 1MCHA 2FH8A 3MYZA 4XN9A 4QT5A 4PG2A 1J0KA 4PJHE 4AQ1B 3SBWC 5CBAB 1QSEE 3DBSA 2WWNA 2ZX7A 2JIXB 1OIOA 2R0ZL 5FIEA 3U9PH 1EZSA 3KH4A 2AVGA 4KKCD 3QIBB 4OBRA 3WFCH 5J6HB 1RFDL 2XPGA 2B20A 2WUCH 3CLEH 5C3TA 2IGFH 3LH8A 2OMXA 1ZA3B 3R4RA 3HZKA 3WBDA 2F1BA 1NC4D 2YAOA 3N1FC 3WENA 1UB5A 1UOLA 2XG5B 5KYYB 4HIIB 5J11C 1FZMA 2EEBA 5IG7B 2A74B 1YAZA 3NIDB 3ARZA 5EFIA 1JZ3A 4R4FH 4R4NC 4NERA 2BCKB 3U0WL 4KK6C 3B5GA 4YFLF 3KM2A 1AHMA 4HOMA 5C0AE 1A4KB 5ERWB 5I1IH 3QPXL 2BRQA 5LXVA 1KBPA 3MJ6A 1CYGA 1HINH 2X53A 3EKCA 1JPEA 3CD4A 2YXWA 2NYYC 4UTAA 2QTEA 3CPLB 3FTZA 1KJ2H 2B4CH 4FXKA 1CF8L 1PU0A 3LQMA 3ZT7A 5IQOA 4IM8A 1CT8A 3GJEB 3REWA 4GW4B 4JQIH 4BE5A 3BUYB 4U1LA 2X09A 3SDAB 3ERXA 2R56L 3ARTA 1AKPA 4AKQA 4GOSA 4XP6L 4BSVA 2DAVA 4JREB 2WWKO 1FV1A 3QIUD 4DPRA 3PAYA 2XY2A 1EAPA 2CCWA 3WUWA 3FB6B 5KVMC 3Q2NA 3BP5B 4J4PA 2CH8A 4JPSA 2NY3C 5HHOE 1U8PA 1QSFD 4ZMNA 1CFVL 4HULB 4JRYD 4XI5D 5EBWB 3KPOA 1BZ9B 1D9KD 1P1VA 4QHKI 1BLNA 3S35H 3BP4A 2Z92A 1AIFB 1JXGA 2DZEA 4I18A 1ETZA 4PRHE 4UQ2B 2NX5E 1I85A 3QRFM 2VOTA 4C4BA 5TQ2H 1G0DA 5AB0A 2D3NA 3FQNB 1FLRL 1FVDB 4FTVB 4G5AA 3QWOA 4Q56A 4QRUB 3DIFA 3CN4A 3CVIL 4OFQA 4GSXA 4X6FB 2R0WL 5H37G 2DQHH 1EMTL 4ERSH 4PY7A 4ZFOA 3ZYIA 5KSAA 5HGHA 3DGDA 1K2DB 1RZ8A 3S36X 4DGIH 4FXGC 2ZICA 4YBHA 1I1CA 5T1KB 5DF0A 5C0CA 1SHMA 4N2IA 5FC9A 2VM4A 1GTNA 3O4LD 3P4MA 5IB5B 3TIEB 1MFBH 1UQSB 4M29A 3WJLA 3CXDL 3V4LA 1AC6A 3D4CA 4NQEA 1AG0A 1UEMA 4HK3J 2Q76A 3TBCA 3EDDA 1H5BA 4ODTL 4YWGL 5KANG 5CKAA 1QBMH 4ZXBA 3L2NA 1V5JA 1BD2D 4AIXA 3UCQA 5E5RB 5IR1B 5DFWH 5AKSA 4GXVL 4ZMOA 2YPLB 2OP4H 2VXQH 1QTPA 2ZOLB 4KJQC 1MWOA 4N0UE 3MLXH 5AKTA 3ELQA 5J12C 3U30C 3QZOA 1BOYA 1TYRA 4MA8L 1SYSA 3S5YA 4F92B 1HH9A 3EYQD 1SGKA 3T0EB 1I3RB 4NM8L 4QI3A 5I0ZA 3QE5A 1E40A 4BBWA 3ILDA 1R0AH 1K6QH 3HPJA 4KK8C 2J1XA 4ZI8A 1I53A 1KIRA 1MPAH 3ES6A 5SX5H 1WBXB 4TNVK 4KTYA 3FOLB 4KPHH 3F85A 4D0CA 3K4AA 3WIAA 2TAAA 4WSJA 4TMPA 5HJBA 3T1WA 4XT1C 3VI4F 4NP4H 3TT1H 2DH3A 4K71C 4AV4A 4ZPVB 3PL6D 3C60D 4FJZA 2OAAA 4LLWA 2QVFB 3KS0H 4F7PB 4QCIA 4FA7B 3RNKB 2NW3A 3VFMB 3DX4A 1GS6X 3IDJA 4APQC 3MPCA 4PLKD 2VCOA 1DEEB 4HS8H 2X2YA 4POUB 2EJ1A 1R3LB 2EABA 3NYKA 1Q0XH 4LLQB 4A68A 2GK0B 4NLAA 4PJBE 5A2JH 2ZUSA 4M93B 5DTFB 4DCQA 1KCLA 2F8VA 1KGJA 2JKLA 5ACZB 3CZJA 4JGJA 3NACL 3Q1SH 2CJTA 2KL6A 3PV6A 3DMMC 2BHZA 2CO2A 4M3KB 5F6IC 3AUWB 4GW1A 3LDBC 4HF5L 4LLUB 4M4PA 4CU7A 3IEAA 3PGFL 3NRPA 1IBGH 3RA7L 1MJUH 5DSCB 3OXSB 1KEGH 2UZPA 3MV7D 3H6JA 2BNUA 5HTSA 2H7WA 2X05A 4P2YA 2XOTA 2YPVA 1HJCA 1OGAE 3AS1A 3OX8B 3E1ZA 3IFLH 4M5YH 5FCUL 5CLTA 4Z7WB 2PTTB 2VXVH 1RZIA 1EEYB 1PLGH 1BYNA 3RJOA 3UO8B 9PCYA 4G8FB 1JWUB 4PJIB 1ZT7A 4HKJA 4U3XA 1H3VA 1RUPL 3G6AA 3I75A 4BINA 5LQBL 2XY1A 3OKNB 3ZO0A 2G2RA 5D72L 1MLBB 3EDKA 4ZRGA 3S4SG 1E6JL 1E90A 1ZCRA 3OAYH 3PWJA 3H4HA 4QGTA 5FHBL 5I73C 1OO2A 2W59A 3S5LB 3WYRA 1I7ZB 3A5VA 3QH3B 4MJJA 3OGCB 4PJDB 4JE4B 5DRXB 5B1BB 1OP4A 3IGFA 2GJRA 3BVDB 3I50L 4HXBH 3O8XC 2GVYA 2VZSA 5K59F 5HD8D 1NANH 1T0NA 1XWVA 2VMEA 5EOCH 4JKLA 3RX7A 3M17A 1RUML 4Y2DA 4OLVL 5AAWA 2Z9TA 3ME0B 4OZIB 5T8IA 3ZE2B 1HT6A 2E74C 4O51B 2OMVA 1IKNA 4WW2A 5I1DB 3ALWA 3MRHB 4A2GA 3GMOB 4E9WA 2AS5M 4X7SL 1RVFL 4P5TC 4A1RA 2W0KA 2YKLL 1QRKA 5CLXA 4LARH 5I6PA 2C7UA 1RP8A 4ZW6A 5H2BB 3BKJH 3MQIA 4W1TA 3FFDB 1NCTA 2WYIA 3VFOB 2DWTA 3WKPA 4OCWH 5IWLA 1BSIA 3ATEA 4RMUA 1NDGB 1AQKL 3QUMA 3RWJA 4UF7C 2AI0H 3O3AB 2KZBA 4MA7L 2XXCB 3ARVA 1RXLA 1QRNB 4WRLA 3RWGA 1QBLH 3EFFA 1DDTA 3CVHB 4EF3A 3AWGA 2DM2A 1VFAB 1C5CL 1SJEB 3HAEA 4K23L 4M8QB 1T0MA 3LRSA 5I28A 1G7LA 5HHMB 4LSPH 1ZGLP 1MNUL 1ZVHA 1JMXA 1PG7L 1HOEA 3DSNA 3ATFA 1FVEA 4IDJH 1JHTB 5DJYA 1WV7T 2F74A 1K9TA 1EPFA 4L1LA 3KLAA 5DZNA 3BH4A 2Q86A 4Q97A 4XAKE 1O9ZA 4TM9A 1NCBL 2XZCL 3P4OB 4OTXH 1CDGA 4MD5A 2UY7A 3TPUA 5MEPA 4EXKA 5F1OB 3U46B 5DHDA 4K94L 3MLZH 1IVLA 3DSFH 2ATPB 4P2RB 3L3GA 1OZTG 3F58L 3Q5YA 1V7MH 3WHE0 4HMCA 4MNHA 2NNRA 1CXHA 3IRZA 3RJQB 4U1HB 5JQ6L 1T20A 2HVKA 3NP3A 3IMWA 3NVQA 5BCAA 2WXQA 5I6XC 1OAJA 1G9HA 3OXRB 4KRNA 4TUKH 4BQ9A 3KBEA 5KJRL 2Z31D 1VHPA 5SWZA 4R83A 2IH3A 4P3DA 2EIKB 3O6LL 3ESMA 4WI2A 2QADB 1MCWM 3LPGA 4JMNA 3E3QC 4IHBA 2EVHA 2V2TA 5DS8A 1FA4A 3RPIA 4G9FB 2N4IA 4OIFA 2OSLB 2AK1L 1ACXA 2GW5A 1EXUB 4OLYH 3GMLA 4X6DF 1JVKA 1F4XH 3H1ZA 2Q5BA 1SBSH 2QQQA 1KGWA 2QKIC 4RISH 4W9GC 2XQBH 3TIDA 3NCCB 3DECA 1UVQA 3EYUL 1TYEB 4WU5B 5ID0B 2Y7SA 3QNZA 5D7IF 1JZEA 3AGWA 3HE7D 4R8WH 5MEQA 3BPOC 3T4AA 2GJ6E 3GSVA 2Z8RA 3B8YA 3F2LA 2V2WB 3CHPA 4C56D 4BFBD 2A9BA 5AB9A 3O0LA 1J18A 4XR8C 5AD0A 3D3VA 3JVFC 1G9ML 5F89B 3P9LA 2IBZX 1GCYA 2ZF8A 3LEVL 1J1PL 1WHPA 5E99L 3RL1B 4KO7A 1ID5I 1QQDA 3Q6GH 1W6LA 4U49A 3TN0D 5KSVB 4AJWA 2OJZL 1T83A 2HRPH 3A4EA 3G5ZB 5E9NA 2EEAA 1EUTA 3QULB 3DOSB 2JCCA 4YJZL 4NO3B 3RGVD 1WG3A 2WINB 1JV5B 2JH2A 1DQML 3Q3GB 3OQRA 3U9UA 3JV6A 1QEXA 1LMIA 5F0MB 1P53A 2WP3T 4X7TA 3QSKB 4ZBJA 1VKXA 2D9QB 2XXMB 3O45B 4FG0A 5DO2D 5HDLA 4EZLA 4A6YL 5HHPA 3GMMB 5MEND 1H3PH 3BFOA 3OF6D 1LK3L 3F7VA 2OXHB 1GY2A 1A4BA 3FRUA 1I8UA 3SOTA 5HI5C 5HY9B 3FQTA 5T1MA 4JO1H 1GR7A 2YGNA 3CVCA 4CVZB 1HHHA 4G8GE 2ERJC 5G5DB 3S7GA 4IRSA 4JM2C 2Q2LA 3FYIB 1PZSA 2N0KA 5FUCC 2F8XC 1KIUA 4WFGE 1J8SA 2EDQA 1RJZA 3D69B 4ODVL 4LSUL 1ID2A 4MQSB 3ZZSA 5J5EA 1HL5A 3SCMA 4NWUL 4EN3A 5GZOA 5D6CA 4ZG1A 4G43B 2VL5B 3BPNB 1AI1L 4JB9L 5EEVA 2ARJB 5KS9A 4LGPB 1IUZA 3PUUA 5EO9A 3VCLB 2ZKHL 3FB5A 3BAYA 2BOBA 4L4TB 4W81A 1RK7A 4AM0B 4BSWA 5BUAA 4JG1H 2GY7B 2K1MA 1JGVL 4TVSa 1OM3L 1R9FA 2KDYA 1LL1A 4M7LH 4DTGH 4QY8A 1B9ZA 3TVMB 4BEIA 1X5AA 5AWNL 1UM5L 1FORH 4O4YL 4RNRA 6FABL 3H9SE 5INDB 5C0BA 3FO1A 1MI5A 2OZ4L 5GS0D 1B0WA 4IS6B 1EEZB 3KDPB 2C1OA 2ICCA 3MGOB 3BH8A 1AD9B 2BNRB 5L2KA 3IRCA 4Z7OE 3I3BA 1KTLB 4N25A 4YH6A 1U2CA 3E1F1 1KYAA 2CKBB 3QEUA 1F6LL 2J55A 4OZFB 4WI6A 4S1SL 5IW1A 3M8OH 4ABUA 5I1KH 2HX7A 1JPGA 2PXYB 32C2B 4H8WC 4OIBA 4XO5A 4G83A 4MZ3A 2QZ5A 2F2HA 3UDWC 4R26H 3L6FA 4P9HL 1VFUA 1A5FL 1HIMH 5BUPA 1YNTF 2P46B 3NSJA 1SXCA 5TGBB 3CSFA 4UYQA 2GB2A 1UM4L 5I74B 3MLSH 1IJ9A 5C0GA 3EDEA 4LVNC 3QWQB 1J86A 3GI9L 1ZTXL 3HN8A 2J5WA 1XBDA 3V5KA 2GI7A 4NZUL 3D8MA 4AK1A 3K6SB 2VZUA 1TTGA 3HC4L 3UTPE 1EZVY 3AXIA 3ILPA 4X5WB 2HG5A 2UZXB 1U3ZA 3CHXA 1QWHA 2RACA 4MD0B 2EDMA 2IAND 3GB7B 4KHXL 4ETYA 3FN3A 1RPUA 1Q9WB 1XR9A 2WUBL 1VIWA 4CKVX 1YEEL 4Y4HC 3FFCE 1FFRA 4N1EA 3PQYB 3L3KA 3T3ME 2B15A 1BVNP 1PW3A 1GHFH 1M2OA 3D85B 3O3DB 6PAZA 1FNSH 1JHLH 4UOZA 5AAMA 2ILLA 4PUBL 1YEKL 5DQ9A 1U41A 1MW3A 4Y2LA 4A2LA 4WCYL 3KJ6L 5IT2H 3ZMNA 3BI9X 4RQQA 5MERA 4Z95H 2O6FA 4HOXA 2JFCA 2D31A 3IJYB 1E0OB 2JJSC 1IU1A 4XC1H 1HL8A 2QPEB 3GBLA 3HUJB 4XNYH 3RY5A 3GHEH 1XGQB 5D1QD 4CADA 1IGFH 4UINH 4UQ3B 1FN4B 4LSDA 1U3HB 1UT1A 2XBZA 3HI1A 4L9DA 2IIJA 4AH2B 3FZUD 1QNZH 5IP4A 4GBXD 3O2VH 4M7JH 4CBZA 1NAMB 1JL8A 1R5VA 4WWKA 4A7GA 2X4TA 3GLEA 4NQCD 3DV4A 4ANUA 4GI6A 2NUPA 1M9WA 2YEZB 4KFZC 1YEIH 3FS9A 5B39G 4YXLH 5HYJE 3C08L 1LXMA 1FSKC 4OM1H 2WBJD 4AGPA 2FAUA 2G5BA 3ARUA 4XAWL 1PX8A 4ALAL 5I8OL 3CZSA 3KWWA 4JHWH 3ZTDC 3WNKA 3VGAC 1DN0A 1R3JA 3C5ZA 4N6RA 2APSA 5IOPA 2GCYA 1UM6L 5FV2A 4FQ2L 4Q9QL 3TA4D 2RCSL 4PB9L 5C9JB 3EHBB 2ZOTA 1KELH 3LNIA 3L3IA 3OB0K 3VFSA 4P48A 3WI9A 1D7FA 1N3NB 4OI7A 2O93L 2I32A 3S3SA 5IFAH 5I5JA 3AQDA 1LO4H 5D7JC 1S7UA 3B7RL 1MFDH 1R3IL 1NUGA 2EDXA 2IDCA 1JNNL 5DFVD 1KPRB 3L4TA 3SDXA 1DDHA 2AXJA 2GABA 1TEGA 3ZL4H 3HI6H 1Q4NX 2ESVB 2Y1VA 5HVFB 2K8MA 5EU7E 4MA3B 2KKQA 4IJ3C 3MV9B 4M1GH 4WJ5A 1BQUA 2EH7L 1OAQH 3CLFL 4OM0L 5CUSH 4YSRA 1WK0A 1FDLL 4KK5C 2UVFA 3O9WD 3D2TA 2ZWKA 3GM0A 3AG1B 4UDTA 4BA0A 4UT7H 1LLAA 2YGPA 4XMLL 1AR1C 1YMMA 4FP8L 1HSAA 4YBQD 4CGTA 4HUWB 2X87A 3JTTA 2W60A 1MRDL 2H26B 2IDSA 4QRRD 2X4QB 4BELD 1M6OB 3GPSA 1B0RB 4HH9A 2FJFB 3EH3B 2CHXA 2OL3L 5C0JB 3HNVL 2W0FB 3ZE0F 1QFWM 4ZMAT 1WA0X 4DKAA 2PO6A 1DVUA 2XJLA 3FB8B 3NJKA 4JFXB 4N8CL 4B5ZA 1DQLL 5L2JA 3OTTA 1G1YA 3IFOA 3SE9L 2FCBA 2HJFB 3FQRB 4N2CA 3VNZA 3UPRA 3T2OA 5JDSA 1UZ8B 1XEUA 4X0NA 2DS4A 3DYPA 4XWOD 2VQ4A 3SPVB 4Z5RA 3GYRA 4GRMA 3QEQB 1PKOA 2Z93B 3KLHD 3A3YB 3WMQA 2IXQB 5ISZD 1DBBL 1MG3C 4BFIA 3SDDB 1MQKL 1JTOA 3UP1A 5CNHA 1PSKH 4X6CE 2NY4D 5DLLA 4F5CA 4J3BA 4WI3A 6CGTA 1SRDA 4UAOB 1NFKA 3SYOA 1N68A 2Q8BL 5J0BA 5KYWB 3T2PA 4FLRA 3ZSSA 3K5SA 1N5AB 3KPRA 4UILL 1ET5A 1KTDB 4KKLD 4F1ZA 5KG9B 1D5IH 4HXAL 5CMAA 3MUHL 4X4YA 4KGJA 5D1XB 3FU6A 2QKSA 2Y36L 3GSWA 4N6QA 5EU6A 2FIRT 3RAJL 3A23A 4JCWA 1E67A 1EUUA 4HX1A 1IKFH 3QQDB 5K5YA 4C4KT 4IKNA 5FM5M 4QKXB 1HEZA 3EJQA 4TQEH 3BAEL 4HWZB 1KN4H 4R90L 3AM8A 1FFPA 4JFZH 2FECI 3BGFB 1R1CA 4WI0A 1JXKA 2ZAHA 5DJ2A 3OKEB 1ZHBB 4XGZB 3ZE1B 3ZLQC 2XYBA 2PPDA 3EH5B 5LKNA 3BCFA 1A47A 4I0CC 2NUTA 4UT9H 4AQZA 1S46A 1CD9B 3NFPB 3R1GL 5A7EA 2QFPA 1OWWA 5LAPA 4XBGB 2VLJB 4YHOH 4AE0A 3FSWA 1G5AA 4H20L 4BKLB 2VDPB 4ETQA 4K2UH 3FQ2A 4X5XA 1NLBH 4YHMH 4J3OH 5ICUA 3CFDA 2VZOA 2CNZA 2N7SA 3WO4B 3SDCC 3A21A 4JW3A 3TTSA 2AJSH 5B1JC 3EJZD 1BF5A 4RGND 2HJKB 2DQUH 4JFPA 4AQEB 1TITA 3F7YA 3CFTA 3Q8BA 1JG9A 1TCRB 4FADA 2YC1B 2B3RA 1G9MC 3W11C 1NWPA 4GFTB 3VGHA 5J56B 1RIVL 3MBEC 4UOQA 4JKKA 4D9RD 4DVBB 1PFCA 2DICA 1EK3A 3BUBA 1U8MA 5TD4A 3FYEB 4YHZL 5DEJA 5BMFL 3IDYB 4U1MB 5KJ7E 4U7KA 3U2IA 2FJGB 1NCWL 1KT2B 4ZD3H 3VD0A 4OCLC 1BIIA 3N40P 1ZGLA 3HHSA 3GSUB 2H1XA 3ZDZE 3FU7A 2K6ZA 4WO4B 2EXSA 3FT9A 4LDOB 5E6IA 1GL4B 1XMWA 5C8JB 1OOAA 1OZUA 2GBVA 3QA3A 2EIJB 2KLSA 2V8MA 5GISL 3T5WA 3LJ3A 2Y7LA 3SZKC 2L7EA 5IQ9B 1CFNA 3O3BA 2EIZB 5C71A 5AVRB 1QFUH 4WW2F 4YNYB 5EZLB 4WKZB 1KY6A 3O81A 2VC2L 4ONHA 4XMVA 5JHDB 5LLIC 3ECBA 4XHJC 1GAFH 5C1MB 1I1YA 4B53A 5T33L 2XRAH 1YY9D 3TBSA 3QQ9D 5E5MB 1ASOA 3GXFA 3IJHA 5B7EA 5DZAA 3T77B 2K4AA 1JZGA 1PNCA 3LS4H 5ADPH 5DK2A 4XBMA 7PCYA 2DH2A 5EO1A 2Z8SA 2CHZA 3JZYA 3K46A 4P5MB 1OP5H 3ZK0A 3TV3L 4EI5D 1G6RL 3C5SB 1KN2L 3Q8AA 5FKPB 1ETA1 5LHDA 4W9LC 3WKYA 2X5PA 2AJ3B 4IQHA 4N9GA 2VW6A 4J3WA 5AVYB 3QUYD 3MNMA 3VACA 2X41A 3INOA 4LL4A 3I3EA 2H6PB 1JV2B 1KPUB 2V7NA 3BOVA 1AKJA 2CA3A 3N6YA 1CFSA 2EAEA 1GRWA 3MROB 1YECL 1BXVA 3P3SA 4QR7A 1JF6A 2L7QA 3F12A 1RSYA 2CAKA 2BSSA 4YDJB 5JUEH 3KCWA 4Y88A 2YBRB 3WTVA 4J3XA 2HG0A 3AS2A 1NC4B 2E76C 3MLWL 3QJUB 4YZFF 3ARFD 4CMHC 1NPUA 1OP9A 3FO0H 5EU4A 3HG1E 3L1OH 2FB4H 4Y5XB 5B4MD 4LHJB 3WV0A 3Q01A 4IMLA 4PJAA 1WVZA 2EEXA 4N8VG 1HDMA 1OCZB 1BMZA 2D3JA 2X1PA 3IXTB 2X4NB 1RMFL 4JR9L 2Y6SD 4TSBH 3UAJA 5ENWB 2VDRL 4B9JA 3NPZB 3RTQD 1C12B 1RK1A 4P9HC 3TCXA 1P7HL 4KVCH 3AJ7A 1AFVH 3QDJB 2Y1AA 1M57B 2JKXA 3MRDA 3MV8A 2YIHA 5EPMB 5LGJB 2X4SA 4V1DD 5K9QI 3S34L 1CJYA 3LEYL 2RFXB 4XZUB 1AY1L 2B0SL 3RFZB 1B4JL 1P7KA 4XP9L 4P3CH 1BM3L 5J1TC 3QIUB 2BHYA 4XP5L 1MLCB 2MQ0A 1E9PB 1QSFB 4FQHB 4PVNA 2X7LA 3JV0A 1DFXA 2OS7A 2W91A 3PY9A 1DJWA 4JRYB 1D5ZA 1D9KB 1I9JH 4U6HA 1DFBH 4PGCA 5FA4A 3RBSA 4FERA 4X50A 3WN5C 2J6EL 3PLYA 3GZPA 2EIMB 2XNAA 4XVUD 3UTZB 1S7SB 4G6AC 4HLZH 2DLTA 1FG2B 4RZCA 5E8OB 3RZCD 2LAGB 5CJOL 1AGEA 1FE8L 1F97A 5A6LA 4PI2A 1NBVH 5C07D 2ALAA 3HRZC 3TO4B 1O7SA 4XP1H 4NI6A 4KKAC 5T5FH 1DVFD 4JMXA 4ZAKB 4GG8A 4U0QB 1LVEA 2V5MA 4YK4B 1S7RB 2QADC 4I89A 2VERN 5E9AA 1MG2C 5TE7H 4F2MA 5C0DA 3GXMA 2WXRA 2WXFA 1F0LA 4PRBA 3HOGA 4UOW0 4HK3N 4P5KA 5FYKE 4O00A 4FXGA 1NFDB 2ADGA 1KYOJ 4YPGA 4L23A 3EBIA 5LB1A 2A3TA 2F58H 3JWDH 3KPSA 1GMEA 4JX0A 4PAZA 4PU2A 5MHSD 3VI3A 1ETB1 4GRWE 3TNNA 3EGDA 3DUHA 4HU2A 5E1IA 3H85A 4P05A 2X6VA 3V4PH 4AQ8C 4ODXA 4ALAC 4MJ6B 4K5PA 4OF7A 5DZVA 4P49A 2VJXA 4OVVA 3E6HB 1U8QA 4RDBA 1RURH 5J9PB 4PJGA 5DRWB 5SWSB 3RVTD 4HUXB 4UTBL 4NP9A 4MZRA 4Z77B 2XN9D 4ZSOA 1W0VA 1N6QH 3G08A 2HJLA 2QDWA 4LSTL 1NFIA 4HISA 4XTRD 3ECQA 4ZMQA 4OD1H 1NGQH 4IBZA 1BDYA 4XVSL 3G5XA 1CICC 1RUAH 1KXHA 4KV5F 3RWEA 3GMPB 3KD4A 4PRDB 3V5DB 2ZXEB 4N1CA 4TNFA 5EN3A 3ZX1A 2E9IA 5DJDB 1AQHA 2MOVA 1EDHA 4JANA 5GSVB 4ONFL 4OFKA 1SNRA 4Y19D 2Z4TA 4ZMPA 2OLDA 4NC1E 2KPWA 3TA3C 5E2WL 3QJZA 1X7SA 4M61B 4NDMB 4X8JA 1X5FA 4R4BA 43CAB 5I66A 3PP3H 1MCPL 3WOVA 4YDLB 5SX4I 4PRID 1THAA 3O41B 4UIKH 2Y7OA 4H1LH 1HQRA 4LCWE 3MRLB 5DEZA 2UX6A 5ITBL 2OCCB 3A4FA 5KS9F 4APQA 1DSWA 1ZVNA 5DHVA 3L1EA 1I1AD 1Z9PA 3LQAH 3EYVA 1JI2A 4LSSL 3VH8A 4EKXA 4KY1H 2L8AA 3IFPB 1AD0A 1HS6A 1OK0A 2MHAA 5GHWL 2DIBA 4ZOCA 2OMZA 5GGSA 3GMQB 5L6YL 3WMSA 1LEGA 1BF2A 1AOHA 2ZYSA 2VZ1A 3VFWA 2N7BA 4DN3H 3NRFA 4HGKC 3W9EA 2NW2B 1Q9KB 4JY5H 1SUJA 4WK2B 3LXCA 2HLEB 4MNGA 1F3DH 3MV7B 4RRPG 1ZLWK 3QUZC 5AW2B 1UD3A 4HS6A 1LEIB 5EF0A 1J0JA 5C08A 3TV8A 4H13C 2CLZA 2XQYA 4BRVA 1I8KB 1UADC 3DDGA 4HALA 4HK0B 2WQSA 1SBBA 4HUNB 2BP8A 3EH4B 5C0CD 1QLRB 4GFXA 4NENA 1MRCL 3NMEA 3OPUA 5JXAH 2KZKA 2GFBA 3QUKA 5IVZB 4LLMA 1AS7A 2BP3A 2YWYA 3LN5A 4F24A 3LZOA 2JELH 2BY2A 2B39A 3KCPB 1GVIA 1AYOA 5EN2A 5EC1B 3RDTB 4RRPM 4ZXBD 4U6VH 1D2PA 5F7DA 3SPHA 1MEXL 1NBYB 4WK0B 1SDAB 4YHLH 4OD3H 3NJNA 5D2NA 4QXGH 1RSFA 2BIHA 4U7SA 2AEWA 4JQVA 4HIEB 4JO5A 4MYWB 3O8XA 1IGCH 2N01B 3NPSB 1CD0A 2JB5H 3VWJD 5I8CB 4IJTA 1A6UL 1PCSA 1NA8A 1IAOB 3D33A 3K8MA 3KPNA 3U6XA 3H9ZA 3B3IA 1R17A 2MH4A 2RQEA 3IFNH 4J8RA 1TR7A 5J4MA 1T2QL 2XWBA 4NQDE 1T66C 3GS7A 1WDAA 2CQVA 4G6KL 4P5TA 2DDQH 2UY6A 1NL0L 1AJ7H 3BHBB 1XF5A 4I7ZC 3LKQA 3L2MA 4FABL 4PJ5B 4XVOA 2CRYA 4ZUUB 1A6VL 3WCYA 2E9JA 1HK6A 4N2NA 4R7NB 2Z91A 2M2DA 3I9GH 1OGTB 3FTUA 4KRPD 3WL9A 4LHUD 1RIUL 2EDTA 4KROB 1DVXA 2WQVA 5IK3A 4OKDA 4WUUD 4A7GF 1WFIA 2PWEA 1SPDA 1KBKA 2VR4A 4KTDH 4M7ZB 3WIHL 3TEUA 3WFEH 4W68A 1T5KA 4M56A 3DPBA 4GIAA 1YEGL 4BV1A 2R1YB 1D2OA 1U6AH 2PMZA 2YSSB 1G7MA 3QUXB 1L9QA 4WHCA 1Q72H 1G7PA 4EBQL 2HKHL 4D2NA 1FNGA 5CWSA 3EJCA 5KUKA 2X4PB 4NO2A 2A6KB 2HXAA 3ZXAC 2AJXL 3LKSB 3NIDE 1IBHA 1SJHB 5ETUB 4OI8A 4R97C 2MOQA 5KN5B 5E51A 1ADQH 3RNQB 1BAGA 4W6XB 5ALCH 5C0RL 5LG6A 1FPTL 1INQB 2YN3A 3CXFA 3LKRB 2VUKA 1DSFL 1XF3A 2CO7A 3PRZA 3EGSB 4HUCA 4JFFD 4MVBD 3U4AA 4KZEH 4AI7A 3FMGL 3NJHA 4JHUA 3QDAA 2HKFH 3ABLB 3HMXL 3GRWL 3ULUF 3SDXF 2Z31B 2ISDA 3CSYA 4GS7B 3LKNB 2WQAA 5FDWA 3L4XA 3OB8A 1ZVSB 5EIIB 2C9QA 3F01A 1CBVL 2BIMA 3C8HA 4IOIA 4JUSA 4CVXB 4Z7UE 4JDEA 5CU9A 3L95A 5GS2H 2KZ1B 3L9RA 3ARBD 5J3HC 4AL8H 4N2AA 4B3VA 2PR9A 4MMYA 5SWQB 4X99A 1QUNA 2OI9B 5I0VA 1DBJH 2DBLL 3EHBC 2F5BL 5E2VL 4MWFB 4LEXL 1EBAA 4R0LB 1DVYA 5BZZA 4NUJA 5CD3B 3VTMA 4MMZB 4K5OA 2EXYD 5IBUB 3MJ7B 4Y2DD 4WK4B 3K2IA 3KNBA 2FQFA 4ELMA 3R8QA 1F58L 2OK0H 4XCYB 1LWJA 5FGCB 5DWPA 2ENQA 1I9IL 1T1ZA 4FTVE 3O6FC 4OGAD 3L9EA 4KMTH 1R5IA 4MD4A 1IFGA 1TZIA 3L3OB 3MREA 2QKIA 2O5ZL 3DRTA 3OR6A 3HE7B 4Z7VB 3MA7A 5F7AA 2AJUL 3V4VH 4H26B 3LH2H 5JHLH 4ZUTB 3KWTA 4MXWH 4UZUA 1HHIB 1A7NL 1T22B 3BXNA 4C56B 4QTFA 3MOAH 4KAQH 1IE4A 1M9SA 1OT1A 1U4EA 4LO9A 2E7HA 3GHBH 3GSOA 5DUMH 5C0NC 1EJOL 2IH1A 3ZGHA 4W9JC 5DMYA 2VXSL 4O2EB 4GUOA 3FUJA 4ZYKB 5F1IB 2I07A 3KL0A 3Q13A 4BQCA 3QI9D 1V55B 4XMXA 4LOEA 4ZFZB 3D50A 1P4BL 4LMQE 3JV4B 5F7LB 3R7RA 1N2RB 2DI9A 2R83A 2G3XA 3QXDA 4PS4H 5F1NB 3TN0B 2BSTB 4A2FA 3BDXA 1TZ8A 3HZYA 5DQDL 2YAHA 5E2UH 1M3IA 3UC0L 1WWCA 5LGHL 2ZG2A 4F7TA 3E80A 2X70B 1FLTX 1FO0B 5DUPH 2DQJH 1OM9A 4WHYH 2YPLE 3CK0H 1S6NA 1TZAA 5T5NF 3SY0B 1GKOA 2EE3A 4XPFL 3EJJX 2JLPA 4ZO8A 1E4XL 3A67H 3CXHK 5BXFB 4G9DB 3LZQA 3VXQB 2DD8L 3FULA 3SDDC 2MQGA 4Y9GA 2OMYA 3MBWB 2XTJD 1FIGL 5DR5H 4Z7QE 5DURD 4JZNA 4UBDC 1PVHA 4Q4IA 2OBGA 5D8JL 3D06A 2CDEA 1QW9A 5E7FA 1UOWA 3QAQA 4KVNH 5C0IA 2BIPA 2I9TB 3QYNA 1DN2A 3S8GB 1GIGL 2ZT9C 4RIRA 1IGML 1WE5A 3QCVL 1ET8A 3Q6FB 1E8XA 1DJGA 1IGJA 2AK4D 2DM4A 2DWXA 4M7LT 1KGCE 2OMUB 4N2LA 2HH0L 4RMWA 4YVUA 3DX8A 2MQCA 5I18L 4B0MM 2IBGA 2NLJB 3ALPA 4GW5A 4LDLB 3OAUL 1BXUA 5I17B 3SGKC 3AABA 1Z9SA 4ELDA 3DETC 1S78D 3OVUB 2EIEA 6TAAA 1NOLA 4PYGA 2IG2H 1JGEA 5E1HB 1S2EA 1TETH 2BX5A 3MLYH 4HWUA 2EUWA 2PTUA 2DOCA 4HKBB 2WVSA 1OKEA 4JJ5B 2CIKA 4DN4L 1TT6A 2WNXA 5DCCA 3DC0A 9CGTA 3CC1A 1MWAH 3DPDA 5IVNA 1AGBA 3V4UL 1XSOA 5C0EA 3IMRA 1P4LA 2A73B 3KYAA 1CN4A 3ROOA 3TESA 4L8BB 1GA2A 5TQ0H 1BVKA 4BM7A 2X12A 3DTXB 1M2VA 3KPPB 2DRUA 2UZIH 2O5NA 1QLFB 4LAJH 4X9YA 5FLVA 4E36A 4OKVB 3FF7A 4OAWB 3AU1B 4XN1A 3ULVE 3PGCB 2R23B 5FYLE 3WKQA 1HHJA 2QVKA 3FO2B 5FECA 3MA9H 1T6BX 3I74A 4JPWH 2DB8A 3BD5A 2A2QT 3C2AL 1F41A 1ZHNB 3PIQA 1A4AA 1RJCA 2GAZA 2XKNA 4ODHL 1X4ZA 2XWRA 3RLSA 4HHAB 1CDCA 4Z7WE 5EU7C 1IC1A 4NKMA 3TZVD 1EHNA 4HFUH 4OB5H 2GY5A 1E5YA 2EYTA 3WGVB 5GGQH 5AYUL 2C3HA 3BDYL 5HDBF 2AXFB 4G1EB 4I3RH 2WGXA 3QNXA 1UD6A 3UDWA 3BZDA 5IEKB 3QP3A 1IC5L 4IKJA 3VRIA 1RZFH 3R18A 4GAGL 3E9UA 1BIHA 3FRPG 2I69A 4FFVC 5CHNB 4YSQA 5JW5A 4ELKB 3ZOAA 1AQDB 5C2BH 4NS0A 1IGYA 1PD6A 1WZAA 2ZYHA 2IANB 2H2PC 4FQ1H 3KYOB 5DK3A 4K5NA 1CQYA 3C5XA 4MJIA 3ARWA 2CUHA 5HJ3B 1MUJB 2VDKB 4LQFH 4YUEL 4OZIE 3DA0A 3LHAA 4BFGA 2UV3A 2PNDA 4YR6B 5IB2B 3MNWA 3BP7B 1IM3D 1MELA 3FFOA 3KYNB 5JO5B 2PN5A 4U1SA 4FL4B 1C08B 3VI4B 4QRQB 4LCYA 1IQWH 2LV4A 3UBGA 1U21A 1KB3A 5HXMA 4IRSD 4M6OL 3PPEA 3BZ4A 1KIPB 3EYSH 3JV5A 3KW7A 4FE9A 2IOIA 4EIZC 1JDAA 4PJAF 1F42A 3UMNA 5DRZA 2XX1A 4EN3D 1SXZA 4OW6A 1FNFA 1YN6A 1R3HB 2JJSA 3DURA 1SEQL 4PRNA 3D1MC 2PCYA 5GZOD 1SVCP 4GBXB 1FGNH 3QDHA 4L8SA 4KKCC 4ZFGL 4W9CC 4HETA 4UT6L 4WDIA 1PEZA 2EO9A 1JNLH 4YL9A 2XWEA 1U8NA 3V6ZA 3VXNB 4G8IA 3QDGA 1EHLL 1PLCA 3GSNH 4S1DD 4C55A 2WBJB 2BDNH 4F7EA 2AJZA 1PTZA 4JFYA 4EDWL 2XHNA 3GBDA 1BBDL 2BNQB 3D05A 3MO1B 3QDMA 1H9VA 5ICXA 3O2DL 3TP4A 1L0XA 1MVFA 5BJTA 5I5RA 4D8PA 4PLOB 3OSVA 2Y22A 3FL7A 5C0BD 2AANA 1F00I 4E41E 4LGRB 2DBJA 4X6BA 5D7LB 2PLTA 4YHYB 1O6VA 2AJVH 2MTAA 1RERA 5L2KD 5T3XE 2W9DH 4JRLA 4HWBH 2R8SH 5FYKU 3IWVA 2GJZB 4R2GD 4QOKA 1BBJA 1FBIL 4IKIA 4OD2B 3K4DA 2OR9L 2G2NA 4KMLB 2A0LD 1R4XA 1MHHB 3WJMA 1T5WB 3N0AA 3UBXG 4P2OA 2AGJH 4Q7DA 1XH3B 5D7JA 3UTOA 3W39B 3NCMA 4ADIA 1OTTD 4TPRL 2ZCHH 4P59H 3V9CA 5L0QB 3RVWD 3KDMA 2FATH 2J3SA 3CZGA 3NGBC 4HG4K 2MNJB 5E08L 4XI5C 1Q94A 3O9WB 3HCVA 2A4CA 4WY7L 4YC2B 5I15L 1SOKA 4B9IA 5B38G 2K3TA 3MGTA 2YUWA 3MMEB 43C9B 1K4CB 4ANKA 3ARRA 4GQRA 3UAAA 1J8HB 1P4IH 2N0MA 1EFQA 1QLEB 1NCAH 1U2HA 3MCG1 4LEOA 2Q6WA 5SX4H 4PGDA 3VI3F 4N87A 4ZUWB 3GJFH 1TZGL 4UNUA 7TAAA 4FQCL 1CC3A 3FT3B 2YZ8A 3VB9A 2P44B 3VXTB 4DFIA 1ZANH 4Y9BA 3SO3C 1VERA 3NQKA 2ADIB 1ES0A 2V9QA 4DZ8A 1OQOA 5IFHH 1N5YH 4PJGF 1T7VA 4LP5A 1P69B 2YD7A 5FA3B 3HLKA 3FCTB 1ZHKB 1HSBB 3A4DA 1JZJA 3MRQB 5F9AC 4FG6D 1XMEB 1DBKH 3VYOA 4EUPA 3JUZA 3HS9A 1LGVA 5I75B 1I8MA 4G80A 1NJ9A 2BRRL 1N64H 2WHVA 4PGBB 5ISZB 2OJEB 1TZHA 1ZT4B 1H3WM 2X1XR 4XWGH 3G6JE 2WZ0A 4KUZL 4MXQD 3SJVB 4NHCH 3F7QA 3LPOA 5IHBA 5EB9A 1MREH 4BGLA 4GO9A 5EC2B 4M9PA 1RCYA 3NCXA 1XF2A 1S3KL 3E6FA 1E4KC 1FL5A 3QQ4B 4OZ4B 4WUKH 4WWKD 5GGRY 1HWHB 1FQ9C 3ZUNC 2R0ZH 3O0RL 1P1ZB 4U0RB 2IFGA 3THML 1C8PA 4WTZG 4CGUB 2A6DA 5D96C 1EQWA 2YRPA 3EYQC 4LPVA 5ESVA 2IPKB 1QSEA 2ZCLH 4HJJL 3LX9A 4H0GA 5L4JA 5C7XL 4U3SA 1W72B 2W07B 2CUIA 3ZDYE 3MRJB 3U7YL 2A9MH 1INDL 2XFGB 4GAYB 1TNMA 3P0YL 3L7FA 4D0BB 1FFQA 4EVNA 3BE1H 3NCJL 4WEBH 5F7NC 4TV3A 5FYKH 4XC3L 1S9XB 4LZKA 1OD7A 2QV4A 1XGTA 1E8YA 3PL6C 3C60C 2BY1A 4KGLA 3ZJAA 1G7IA 4OFVA 4FD0A 4IRZL 5EDSA 3K8LA 4GH7B 1NKOA 2J2ZB 3C09B 5HHVL 2E46A 1RJYB 1T0PB 2R0LH 4MQXD 3RE0A 2QVMA 3UJJH 5ECJE 3T2NH 1YQVH 3ARSA 1S9WA 4YSOA 3BT2H 3ULUD 3Q05A 1B6UA 1C5BH 1SFHA 1QASA 2V8LA 3BESR 4UM8A 5KSUB 1WZKA 3BQVA 3PWUA 4EEEA 1L6XA 1MRFH 4RGNB 3EGXA 2LU4A 5C0AA 1DEDA 3FCGA 4NRZB 1ACYL 3NTCL 2R56H 3AC0A 2BVUA 4PJ7E 3NA4A 2ZJSH 3SDCA 2XXGA 3CFEB 4N8UA 5ECGA 5B1JA 2ZKWA 1DO5A 2BSCA 4LHUG 1UXMA 3IF1A 1IIIA 2KLTA 4CU6A 3ZW3A 3TONA 1WC7A 1PIFA 4L4TE 3SBRA 1YMMD 3TBWB 5ID1B 3L3JA 1S7WB 1NGYB 2VXTH 3MBEA 2V5RA 4X6DB 3IMTA 2OQJB 1OTUD 1YO4A 4HIHB 4JAMB 1YN7A 1T5XB 3FO9B 5HHOA 5L7XL 3ILQD 4B0MB 2PO6D 2WVUA 3JWNH 3PCYA 1P84K 2G5UA 1A7PH 2O6DA 1H8NA 4NN6C 3RWHA 4LVOC 1PY4A 2Z8WC 5D7IB 4CAGA 3KWVA 4PRHA 1UH4A 2Y3NA 3FPYA 1YYLH 1A6TB 4LSQL 3B37A 4DO6A 4DZBA 1J7VR 5EF1A 2YMXL 1LD9A 3P40A 2EVFA 5I1AA 8FABA 3ZQ9A 3HEIB 5JQIB 2CIIA 4A6YA 4QRTB 3K4ZA 1BQSA 1L7TL 3D30A 1M56B 5ANME 1VGEL 3APCA 3BFQG 1QI3A 3VXOB 3ZTNL 4MB5A 3VD9A 4JLRA 3QG7L 5K9JL 1IARB 4L9LB 4HC1H 3GO1L 1BFOB 5BQ7B 3QXAA 1EZLA 3L16A 1KCUL 1P7QA 5E8DL 4K9EH 5BV7L 3Q48A 1N70A 3HS8A 4FNUA 3U1QA 4B9FA 2PW1B 2JTDA 2ZOWA 4PJCE 1WCBA 5EU6D 3FTSA 1QI4A 4AGNA 2QGBA 3WNIA 3FQ1A 4NJAL 1GGBH 3MRNB 4U2ZA 1E4WH 4NN5B 2KPNA 2F1AA 2GTQA 4HBCH 5DK0B 4AVHA 1QHPA 3A4AA 2CM6A 4WI4A 3P0VH 4GO8A 2ZOKB 4N0UA 2J20A 3ARFB 1MFAL 4J3VA 3ULVL 5FYLL 3L4VA 4U3CA 2WWMD 3C9NA 4LVHB 2GBAA 3BAKA 2WIIB 4H8WH 2YFOA 1LWRA 3MOBH 3MGAA 4L2LA 4BA8A 5ABDE 2OZ4A 1HZKA 2NSMA 2VDMH 3E8UH 3UOAB 4EI0A 5C3LD 2BIQA 4YDKL 1USZA 1C7TA 4NC1C 4PRIE 4XBPA 2R1WB 5T1DL 3HN3A 2XJKA 3ARPA 4MCYA 3JTSA 3RTQB 1J1XH 1GY1A 2NNFA 2BERA 4L8DA 4X0KA 4XN5A 1EXGA 3TO2A 5GGVL 1OPGH 3U36B 1CPUA 4QHMB 3S96B 1ZIAA 4UOW1 4NRXB 4J1UA 1EGJL 2NY6C 2F7QA 2IFFH 4OZHA 1AGFA 2PPEA 3ABZA 3NACH 4MBRA 4XZ4A 5C09D 4FXTA 2WTPA 3GBEA 3JT2A 2AF2A 1UZ6F 4JFVA 1WBYB 5F70A 5FWQA 2BOCB 5H35A 3K2KA 2NNXA 1KB5H 3W82A 2ZWSA 2DY2A 4OLWL 4C83B 1P6FA 3TASA 5IB4A 3IU4H 4IBTA 5I9QB 2HX8A 3WY4A 5KBNC 1VFBA 4YGVA 3KJ4C 4JFHE 2XV2A 2X4RB 2X4UB 1HCVA 3N9GL 4K3JH 2BS8A 3RZCB 1FCCA 4R96A 3WN5A 1WSST 2WLZA 3HE6D 4ELMF 3NN8A 1XDTT 1D5XB 2VDQB 1SEBB 5C07B 1DQVA 4LLVA 3BT0A 3MXVL 4QHUB 2B77A 4HD9A 4GS7C 1IAKA 2AKRB 4FZ8L 4XH2B 1EDYA 1VZGA 5MP6H 4AKOA 1BLIA 1OGAA 1YNTB 1CDYA 1RUPH 1VEMA 4QXTB 1L7IH 1K8DA 3TBVA 3HRZA 4OSUH 4UM9B 3HBPA 3VU1A 2OYMA 1TOXA 2ZPKL 4MXVF 5FF6B 3RUGF 1E6JH 2ESVE 2FIKB 2OI9C 2Z35B 2GEQA 4L5FE 5FHBH 3MV9E 3R06A 2A4EA 1SF3A 5AALA 2IQAB 5HVGB 4QT5B 4BE6A 3MYJB 4X80L 3FN0L 1P5UC 3T08A 1UFUA 3NUKA 2APXA 4B7IA 2EDDA 5CZKA 3NESA 5KSBE 3CBJB 4DW2H 1ND0A 2W0PA 3N55A 4PHZA 1WJ3A 2AV1B 1BZEA 1CFQA 1IFHH 5GS3A 3T3PF 1FFOA 3CN1A 2WC7A 3DX9A 3V6BR 4JY6A 5ICYA 2XPGB 3KXFA 2OMXB 1V8HA 2DQCH 3HZKB 1O9VA 4AQ8A 4U1JA 5CEZH 5BNXD 1UB5B 3CMOH 5IHZA 1FZMB 2D7QA 2X6CA 3LIZH 4BCZA 4HAFA 5ESQA 4GMTH 3A6CL 1F90H 1YG9A 3MLTA 5EFIB 1DVSA 4NQTA 3P77A 3FBQA 4BJLA 3QB7C 5DZ9A 2ZAIA 1AVAA 2Q7YA 4PVBA 1DJYA 4BGDA 3UAJD 4XX1G 1CICA 2DEYX 4I87A 1CGUA 1FZKB 1GGYA 3CZFA 4TRPL 5CF3A 1CT8B 4WUUE 3RGVC 1W16A 2AEQH 3REWB 1IEHA 3MV8D 4U1LB 5EV7A 1MCFA 3UJIH 1UXLA 3WAKA 3DXAA 3MKKA 2V17L 4BSVB 2FNBA 1ZA6A 3GMNA 1HZLA 3RIAF 2IDTA 3X3GL 1CLYL 1QFPA 1FV1B 5TDPA 1EAPB 3QRGH 4XNZC 5DO2C 3WUWB 3IVKB 1OCRB 4MAYC 3HI5H 2KQNA 3QZBA 1HJBC 1U8PB 1QWNA 2X0UA 4EIBA 4PRAA 3SB3A 4JN1L 2P42B 1BV8A 4Z8FH 3G5WA 3KPOB 3X1FA 5EUOE 1UH3A 1BLNB 1MF2H 2CUMA 3BP4B 5TF1H 3D0VA 2Z92B 3GBNL 3QC5X 4I18B 2WZPA 1G7HA 5DMGD 1QR4A 1B0IA 4HPYL 1DLHA 5E7BA 4NCC1 4K15A 3UTSD 4PJFA 3UYRL 2OL3A 4QXUH 5MI0B 3QWOB 3X1NA 2WZ5A 3DIFB 4P2QD 1ZKAA 4Q2ZA 5IV2A 1WUZA 2VRQA 5JLZA 2A6JA 3HMWH 3MBXH 1BPVA 2X44D 4FMVA 2JJUA 1G6VK 3L9YA 4PY7B 4ZFOB 1WZ1H 3ARDC 3BFWA 5HGHB 5KSAB 3WJJA 3AFLA 4GRLD 1RZ8B 3CN3A 1BECA 3PXJA 3QUZA 2TSBA 2LVEA 2BY0A 1L9MA 3KGTA 5F0PB 5E5UB 2A77L 3DI3B 2RIKA 8PAZA 4FFWC 3VTTA 4PREA 3P4MB 1JGUH 2QQNH 5AZ2H 3SE3C 2E9WA 4NQEB 4OJAA 2E6JA 1CXIA 4TYUA 1VEOA 4N90D 1H5BB 1NAKL 3BISA 4UB0L 4ZXBB 2LU3A 4AG4H 5HBBA 1HU8A 4HJGA 3ZE0B 4BDVA 2FGWL 4MJHA 4PJ8C 4J8QA 1NKGA 1VEPA 2B1AH 1SYSB 3H9YA 4IU2A 1HH9B 1BQHG 1GC1H 5LNDA 1VFOA 1T7ZA 1TJHH 3KHQA 3AS0A 4KJQD 3WNNA 3HPJB 3SKJL 4NQVA 1CTNA 1KIRB 2ZUQC 3ES6B 1BZOA 2E86A 3K2UH 1KTRL 3EDJA 5JHDE 4D0CB 2YBGA 3H2WA 3LZNA 3M6DA 3D0LA 1E42A 1FJ1A 2VLKD 2VWEC 4JG5A 3MUZ1 3VRJA 1BXAA 2WCPA 2DMGA 2WTRA 3TH2T 1J1PH 2GJ6A 2HT4D 2D2OA 3AMLA 2XZQL 3VSVA 1MY5A 2DQIH 3M45A 4LLWB 1QA9A 4QCIB 2QHLA 3HTLX 3ZHDA 2E4FA 1D7CA 5H4YA 1B2WL 3HC2A 3CFCL 2QQKL 1G5GA 3QZPA 4F15B 2P5EE 3IDGA 3D5OF 4KRPB 1XGUA 3FTWA 5G4NA 2E7LA 1I4FA 3MZTA 2WW8A 2XWTA 3M7FB 4TVPE 4KDWA 5D4JA 3X11A 2XTSA 1IC0A 1XGYL 1T1XA 5EG6C 4OJFH 5AW6B 3T71A 1JPSL 4DCQB 4Q8BA 1IILE 1OV8A 2EDWA 1A3RH 5LBGA 4U33A 5BO0D 2FX7L 2UUDH 4JDZA 2PW2A 3EO9L 5JORA 2M83A 3PV6B 2H3XC 3MCLL 4GW1B 4QKTA 5B8CC 1URIA 2MKWA 4G6FB 1OP3K 4WZ9A 5D1QC 2V7HA 1UZGA 2XVBA 1UOVA 3AROA 3ASOB 4DJMA 5B3JF 4NM4H 3KE0A 1F1GA 2CXGA 2BNUB 3MODH 3TX4A 3WDHA 3FZUC 2AEPH 1IB5A 3G6DL 4PGJA 4XE5B 2X1WL 3EZJB 2EDFA 3QPQD 4LU5L 2F18A 4HPOH 4R7VA 3RVXC 3SD2A 4PY8J 2R2EB 5HYQA 5HYSA 2B5IB 2F54E 2EUVA 3AUVA 1I75A 3NCFB 5IGXL 2R4RH 4G8GA 4JFEA 1RZIB 2YRZA 2WZAA 1TJGH 4PWKA 3BZFA 4HKJB 2WBJC 5DT1H 2DMBA 3I75B 3G6AB 3S4SA 5D1ZC 3NSDA 3QDJE 5BV7C 2G2RB 4K0OA 2CJUH 4WJG3 3HG0A 5AVTB 3LZFH 3FB7B 1EJFA 3BJLA 1DJIA 2Y25A 3PWJB 1CE6A 4FQQA 5IHWA 3CV5A 4DUXA 2A9NH 2LTQB 4XNXL 1A6WL 1G6RA 4AYSA 3EUUA 1BFVL 3ECVA 1T0NB 3AREC 4YGAB 1HHKA 3OWRA 2OTUA 3M17B 4Y2DB 1G9NL 4FKKA 2H0PA 1HCFX 4FJYA 5IREA 4H0LC 4KO9A 2OMVB 5AVUB 4WW2B 2F6AA 3G9AB 1ICTA 3H9SA 4IGBA 5DFVC 3MACH 4UTAL 3H42L 4XX1E 3CVHH 2YD8A 4U1GC 5AVZB 3NAAH 1ACCA 4XVJL 4WAFA 2DMKA 4E9RA 5HPMA 3F04A 4R7DA 2HUEA 1OSEA 5BO1L 5BVPL 3O6FA 4FKHA 3O9WC 1JF1B 4R7LA 4YDIH 2Q8AH 3LXUX 3WG7B 2VMDA 2VLRA 3QUMB 3RWJB 25C8L 3HHRB 4BZ1L 1UC6A 4NT6A 1F6FB 3BPLB 4DKTA 3UTTE 1GGCH 1H8OA 2NPLX 2DQGH 2VAAA 2YQBA 4HDIA 1SXSA 2D7TL 3RWGB 1IFRA 3EFFB 1XV8A 3HAEB 1A8JH 2QQLH 2V9UA 4QHLA 5DUJA 5T3XH 1NGPH 3SKNA 4C57C 2P26A 2MSPA 2A99A 2HPOA 2VIRA 3DSNB 4KJYA 1YEEH 1UKQA 1FVEB 1LK2A 3HJEA 4UDUA 2QL1A 3FT0A 5DJYB 2F74B 3PHSA 4IRJC 4XWOC 5I16A 1DBAL 3S37H 5CEXA 2DKSA 3KLAB 1F8TH 2J4WH 2ROXA 5D7HA 3F5WA 2Q86B 3KLHC 4AYMC 5SWSE 4GNKB 4WNQA 1KMGA 4JFOA 1MJ7H 4OT1H 4MD5B 1W91A 1SDDA 2UY7B 2NY4C 3FFCA 4XODA 4NAQA 5MEPB 3VG9C 2C4XA 3CFUA 5IMLA 1I7RA 1OK8A 5IMKA 1M7DA 3SGDI 1YZZA 1IBFA 1JK9A 3L3GB 2W9EL 2D7OA 4YBLC 5DD6A 3DGCR 1ETJA 4MNHB 5I19L 1GSMA 1I7TA 2GUOA 4X8GA 5GGTL 1QHOA 1T20B 2HVKB 2VSKB 4MGXA 3WU1A 4KDTC 3MRBA 2IDQA 1W8OA 1JZ5A 4OCYL 4QEGA 3P4NA 3U0PA 5SWZB 2IH3B 2JTYA 2EH8L 4GINA 2N3JA 2FT8A 5JW4N 4IBVA 5IQMA 4XAWH 5I8OH 1MXGA 5KUMA 3SGKA 2Y69B 2XN0A 3S9DB 3MC0A 1DBML 4U05A 4DPBX 5DS8B 4Q74A 2V2TB 3RPIB 4Z78A 4FFYL 1A14L 2GUYA 1UGNA 2CGRL 5AW0B 3QHFL 5HYJA 4EOWL 3L5HA 5A2FA 4EE2A 2XN1A 1MCRA 3B8SA 3GMLB 2YJLA 2EIBA 5JYMA 3KLQA 4R9HA 4ZS7L 4JG9A 3BGAA 3OLIA 1XF1A 1XHHA 3TIDB 4XO3A 1USQA 4PIRF 1UVQB 3D9AL 3MFGB 2E27H 1PG7W 3V52H 1TMQA 3CMGA 3EJZC 2A1WL 3QNZB 4OIIL 2XZAH 4UTBA 3ARGC 1W15A 5MEQB 2XPYA 2IVFC 4N0CC 2QV2A 3TEYA 1I8IA 3TC9A 1AZVA 1HKFA 2Y06H 5FS5A 3AT9A 1ZS2A 3OKDA 4L18A 5HHNB 2V9RA 3I2CL 3KBPA 5AD0B 2NXYC 3D3VB 1Y7VA 4O58H 4NQXB 4Q9CA 3P9LB 4HIJA 4M03A 4LAQL 3N2JA 4FZEH 4OLZH 1IT9L 3IRPX 3TJEL 5KYXB 2Q10A 2C3VA 4LIQE 3T6VA 1QQDB 1MRDH 1SYVB 2H5UA 4HGMA 2G60L 3QR1A 4HS3A 6PCYA 3II3A 4U6TA 4TULL 1YY8A 3CX2A 4F33A 2JCCB 2X40A 1HL9A 5I8KH 1IAIM 4AT6A 3RG1C 2DJ4A 2QMJA 1YQ2A 3C12A 3T6WA 3EXJA 3GI8H 1K3IA 4H40A 2JNZA 1ZDSA 3JV6B 3DGGB 5DHXB 5I1LA 3GQFA 1BREA 2ZUWA 5KVEL 1VKXB 1P9MC 1Z5LA 2M8XA 3BSGA 5HGAA 5HHPB 4J3OF 1YY9C 1QYGL 1OAXL 1R24A 3QQ9C 15C8L 3F7VB 3V6OE 3V0AC 1WT5C 4KTEL 4Z1PA 3QXVA 2MCMA 3FRUB 1DBBH 4Y8AA 1QTSA 3FQTB 4H0IA 2R59A 1VACA 4QJ3B 5T1MB 2OR8A 1A7OH 1FHNA 4H2CA 3EFDL 1F56A 1HHHB 1BGXH 4EI5C 4L4JA 1ZGLM 4DQOL 1YAIA 4IRSB 1Z9MA 5HI5D 2CLRA 3QUYC 2AAVA 4PB0H 1RJZB 2VDLL 4LCVA 2H32A 4MNQA 3E2HC 4PP1D 1HHGA 3RL2A 3SCMB 4EN3B 4WW1A 7FABL 2I60L 5J7CC 1MZYA 2ICEC 2YXFA 3E0GA 5D6CB 4XMZA 4BFRA 1T03L 5INCA 4KI5D 5KS9B 1LJMA 2OM5A 2XQYK 5EO9B 1PQZA 5IQNA 3FB5B 3T09A 2BOBB 4OCRL 5EBLA 1QFWI 4BSWB 4WV1A 3WD5L 1BQLL 3RRQA 4ZOAA 2CKBH 4JO3H 4O2FA 2QPFA 4N9OB 4OZFH 3PUCA 5LN4A 1IJNA 4QY8B 5E94A 4K3EL 4N2HA 4OZHF 5B4MC 2VLLA 4PJBF 4FLQA 4RNRB 4LPCA 2BCMA 2NY2B 1MI5B 1MIEL 2MCPH 1OAYL 3D09A 3WFBH 5JMRA 2Y6SC 2C1OB 2J8UE 1E27A 3HNTL 3NIGB 5CJXC 2IQ9L 5JA9A 4IEFB 1QHQA 3F8UB 2ZUXA 5L2KB 3L7EA 1YRKA 1CLOH 1A0QL 2DQEH 4IDLA 1J48A 2X28A 3RTQC 4GEJA 5EOTA 4URTB 1KJMA 2P24A 3KMDA 1W0WA 3QEUB 4R2GB 4FYSA 5IW1B 2X88A 1ZJAA 5L8KB 1JPGB 2AABH 2EDKA 3GUTA 4QUOA 5EA0H 2P1YA 3NH7L 4A2DA 3BSHA 1DL7H 3DYOA 3APNA 3L6FB 5GQBA 5EULV 3LS5L 4ISVA 2PCFA 4TVPL 4L3EE 3MXWL 5C0GB 5I76B 5D4IA 4MTMA 1GKEA 2C9AA 2J7LA 2C4FU 3BAJA 1ASQA 5D71H 3U79A 3V5KB 3VMOA 3WN6A 4NN7C 4X4XA 4UQBA 1U91A 1SXBA 2HYMA 4XPTL 1WTLA 3BD4A 3ILPB 2HG5B 1NLDH 1JHKL 1NGZB 4UZSA 5DVPA 4TLUA 5ABAA 3RY6C 1Z3GH 3STZA 1P5VA 1PZAA 4MJID 1XR9B 4KO6A 2AEOA 4DNLA 4D3CH 1TKWB 1L0QA 1DVFC 3C2SA 4I3SL 3WIHA 4LPWA 1OAKL 4FLOA 5DQ9B 1NAMH 2VSDA 2G75A 4FYTA 3DX6A 2O6EA 4IBQA 4RQQB 5MERB 4Z7VE 5C2UB 4PWHA 4PG2C 2D31B 5DI8A 3K74B 3B9AA 4L1SA 5D7SH 3X3FL 4R7XA 4CADB 5DS1A 2FL5A 3CTTA 4AMKL 1N7MH 1BXXA 4JO2H 3HI1B 3WFDL 3I6LD 3FN9A 1BA9A 2BVQA 3DX1A 3TLRA 5E4IA 5AW4B 3RWIA 1CFTA 1R5VB 5B39A 1FNEA 2X4TB 4JG0H 3KEDA 1YEFH 3DV4B 3N5AA 1SLUA 2NUPB 2D9CA 3VFPA 3HMXA 3GRWA 2IO5A 4A2MA 3RVTC 3QDGD 4HCRH 5E24E 4APXA 1YECH 4I77H 3ML8A 3SQRA 5LG1A 1E4KA 3QEGL 1N4XL 4XTRC 2G5BB 5DMIL 3W0WD 5T3ZH 4FQJH 3KWWB 4DQAA 3D18A 4ABQA 3DLQR 2RQ8A 1AANA 1QWUA 1DN0B 3QDMD 3SIKA 1R3JB 3C5ZB 2R0KH 2DQDH 1XSJA 3TWCH 5HGDA 2VR7A 5IOPB 1G9NC 1HEJC 3PWLA 2GCYB 1F1DA 2CO6A 2FT6A 4L5FH 5FYJU 3LHPL 3BKML 1J9SA 5T1LD 5EWIH 2FGZA 2NY1D 3L3IB 2NCMA 3VFSB 2FSDA 4CUCA 4FXKC 1NCNA 4PJFF 3HG1A 4QOKD 3KPTA 2ZWLT 1S7UB 4WEEA 3MRIB 4GJTB 2AV7A 1JZDC 4AEHH 1XH0A 3V0WL 3SDXB 1XAUA 4P4KC 3K7UA 1H6TA 1DDHB 1HXMA 1PLAA 4P2OD 5CCGE 1AR2A 1RZQA 2R4SH 4TUUA 4DGVH 1I1AC 3ZYOA 1YJDL 2KC0A 4ONGL 4WJ5B 3EYFB 3US0A 4XP9H 3D39E 3G5VA 3FU5A 3AWEA 5DZOA 4NZTL 1T2JA 5GS1C 3T6ZA 3QFJE 4KU1A 1TNNA 3OZ9L 4UDTB 5F6HI 3BYYA 4MCZA 2I9LA 4HYTB 3L4ZA 1X5MA 4Y4KA 1VGKA 1YMMB 2YOAA 3DVGA 4Y4FC 1HSAB 4WFHE 4MX7A 1AQ8A 3JTTB 1A4CA 2W60B 3NZ8A 3VH8G 1XF4A 3X12A 3OSKA 3GM8A 5MI0C 5CO1A 3QFGA 1NIDA 4HH9B 1AR1D 3ZDXB 3SE6A 4QWWD 4TQHA 2ZWNA 1V27A 5HDQH 4BZ2L 2JSFA 5L2JB 1JBJA 1JIBA 1COBA 3IFOB 1CU4L 1CS6A 1HXYA 5EUKA 1FP5A 1OWRM 3UPRB 1J1OL 4K8RH 5JDSB 2DTMH 4KQ3L 5DD3L 1HOCB 4AW4A 1N10A 2NXZB 4JRXD 5HHXH 2NCEA 5IW6A 4AY0A 4Z5RB 4GRMB 1GPOL 1I9RL 1MVUB 2YOCA 4BFIB 2JK5A 3NCBB 2D7PA 1YYML 3CFJA 5I1EH 5CJQL 1NEUA 5CP3H 1DE4A 1OY3B 4EJ1C 1KZQA 2IADA 1FCGA 3FSZA 4HIXH 1WS8A 1INEL 1HC1A 2DIJA 4ADGA 5DHEA 3KPRB 1FYTD 1NC2A 4KK9D 3ABMB 1A2YB 1KCWA 4XCNB 5CMAB 4UAHA 4X4YB 4GG6E 2UYLA 5K9OA 5FLUA 3GSWB 3FSOA 4JPVH 1UCTA 2WLMA 5EU6B 4HX1B 3VWJC 2YRLA 1WAAE 1HEZB 1B4LA 2VDPH 5FV1L 2FQGA 4E9LA 3RPBA 4ODSL 5JHMA 1U36A 3JYBA 2C5DC 3RIAK 1FFPB 5FYJH 4DEPB 1KWGA 5EBMA 3GMRA 1LO2H 4WI0B 1WISA 5DWUH 5CINH 2ZSVA 5DJ2B 5AOJA 2F5AH 3NJLA 3OGOE 1TQSA 3BKYL 3M88A 2NUTB 3MJ9H 2IV9A 3KWXA 3LH9A 2P5WE 3FAWA 3TM6A 4G7VL 4ETQB 5JW4R 1KG0A 4TSAH 4X5XB 2CPUA 2X2HA 2OCJA 3O11B 4X83A 5FOBA 2W0LA 3CFDB 5GSRA 1G1KA 4OCNC 5TH2A 5C0AD 2ZKXA 1SN0A 4JFPB 4M43H 1DANU 3F7YB 4TN9A 2DEXX 4YFLI 1AO7E 2WAQA 4AKPA 5IM7A 1OAZL 3SDCD 1Z2KA 1FAKT 1EO8L 1SY6L 2FEEL 2WNGA 3QQXA 1U8MB 2BP0A 1PG7X 4AEIL 2JE8A 4XMTA 1HH6A 4LCWA 3MBED 4OI9A 4F8QA 4W6WB 4JM4L 1BIIB 1SUHA 1ZGLB 3HHSB 3FU7B 4YSTA 4FFZH 3WY1A 4UWQB 3FH8A 4B60A 3DVNA 2BNQE 3QVAA 1IEAA 5KVDE 1AXSA 4XBEL 5E6IB 1NMCB 3HBGA 1ZWIA 4WLCA 1XXFC 3IB4A 3UTQB 3DJTA 3QA3B 4PRHD 2VZVA 4MVBC 2NX5D 1NIBA 1Q0YL 5D7LE 4F8LA 5CZVH 4W9EC 1CFNB 3O3BB 5D93C 4P23B 5LBSH 1KCBA 5J57B 4ONHB 3ECBB 4BK4A 4GKZA 1I1YB 1IM9A 4OLXH 3S36H 1GGIH 2NY5L 1UH2A 3A6BH 4Y5VA 3VD5A 5E8NA 3TBSB 4Z7OB 5E9DB 3IJHB 3N85H 4Z7OF 3N0PB 3ARBC 1QVOA 4G42A 4N90E 3SGDH 1P7QD 5DK2B 3UAFA 5EO1B 3FSAA 1L0YA 2FX8H 3X2QB 4HJSA 2CDFB 3PDOB 4I0PC 1KXVA 2B16A 3BVUA 4M8UA 1EO7A 4N9GB 4PW3A 4Y2DC 5DEFA 2R2BA 3POCA 1KV3A 2ED7A 2Y2TA 3C6EA 1J8HE 2XPZA 3W9DA 1IKNC 2VN4A 2UXGA 2V7NB 1AKJB 4CBPA 1P5UA 4UT6A 1CFSB 2FTAA 1SOSA 4OGAC 3S3DB 3ZTCC 2VXUH 4ATWA 2DTSA 4UV4H 5IVXE 3CE1A 1ZLSL 4ZW5A 4J3OD 1L3WA 3F12B 3GXDA 4BH8A 4A55A 2BSSB 5J1SC 2PYEE 2F68X 4HFWA 2BSRA 3ENEA 3VGFA 4F8NA 5ADOH 1NFAA 1RLWA 5EU4B 5IWLC 1JZHA 3FU8A 1E3XA 1TIUA 3O2DA 2FD6L 3GZOA 4N8VA 1E2ZA 1KBVA 5DJ8A 5FO8B 1X3DA 2C8NA 4IMLB 3T3MF 1I3UA 4PJAB 4JHAL 3QI9C 4YDMA 5J11B 2NT1A 1HDMB 3NFSH 5HGGS 3DUUA 3DBXA 3IJEA 5CN1A 1UT9A 3AY4C 2DIAA 1MJ8L 2EILB 4OF8A 1D6EA 1OCWH 1UWGL 4I88A 3UFIA 3ZYZA 3TF7C 1RK1B 1R6VA 4MS8D 3SJVE 1H6FA 3KR3H 5LWYL 4PV1C 1I8LC 3AAZA 4NSKB 3MRDB 3MV8B 4U31A 5I6LA 3NZHL 2X4SB 2FE0A 4K5MA 3UJTH 2JQZA 1P7KB 3HS0A 4AQ1A 5I8EA 5BRZE 1CLZH 2GHZA 2XDHA 1BEYH 2XTJC 4Y89A 1EAOA 1Y18A 2ZX5A 2X7LB 5E5LA 2H41A 4EBQH 1D5ZB 4U6HB 3H7BA 4NFDA 4PGCB 3QXTA 5FA4B 2YSTA 2WO2B 4HQQH 5MENA 4MAYA 3CQPA 2NY3B 2WYTA 2BJMH 4LDEB 1XIWC 5IESH 1RAMA 1W0YT 1UACL 4M6NL 4M5ZL 4RZCB 3EO0A 4MJ5A 1AGEB 4LB8A 3KYKL 2J88L 1VRSA 3ZHFA 1YUKB 3UH8A 3IGLA 1HL4A 1GGUA 1KIQA 1WZMA 3SOBH 1S78C 3IAPA 5DD5L 4GG8B 4CC1A 1PPIA 5DLMH 5ESAA 4LSRH 3F3HA 4O02L 4XN2A 2ZCKL 2L7UA 4ZW8A 4F2MB 4V2CB 2R69L 5C0DB 2PWHA 3HZVA 4P06A 2FBJL 3ARDA 3KPMA 4PRBB 5GRUH 2Y7NA 4DOHB 4P5KB 3SE8H 3DOHA 3EOTL 4FXGB 3QNYA 5AW3B 1URZA 2ADGB 4YPGB 5EIVA 1KF9B 3Q2CA 3DV6A 3NOIA 3KPSB 4D9LH 4RBPK 3TNNB 5HHQA 4WSGA 3AU0A 3EGDB 3BQUD 3SE3A 2FQEA 3QJHA 3QR2A 5JPNC 4Z7UA 4WHDA 4UIMA 3ZMEA 4Y16C 4ODXB 1TG8A 4X9GA 2CWRA 5E1AA 3D07A 1U8QB 3BP5A 1WD8A 4H25A 4PJGB 1QFWH 3IJSA 3WDIA 2MPAH 2NQ3A 3T4AC 1VZHA 4OFDA 4ZSOB 1W0VB 2F8OA 3VDCA 3G08B 1BQKA 2HJLB 4PJ8A 1NFIB 2JVUA 2RBLA 3NG5A 4U6YA 5J12B 4BK8A 3V7AG 3TZVC 4F2FA 4AYFA 1A7NH 3G5XB 4KUCF 1TTBA 4AQOA 4FTVA 3RWEB 5I1JH 3V55A 2ITDA 1MFNA 3X1GA 4K4KA 2BW4A 4ZX6A 5JW4Q 4P3WA 4JANB 1Q1JH 4IRZA 1KJVA 3FKUS 4M6MH 1JFQL 1DQTA 1VADA 5I66B 1X4XA 4X8JB 2VH5H 3TYGL 2PR4L 1P4UA 3MLRH 1KV7A 1YJDC 1OE2A 1S7VB 5DQDH 4OF3A 2QBWA 1JXJA 4K71B 4X6CF 3DHJA 2Q1EA 2AQ1A 1HQRB 2W8CA 4UU9A 2VDOL 3ZTJH 3BUIA 3VGEA 2WQXA 4OFYA 1KBWA 2P8LA 1EH9A 2E75C 5F72S 4APQB 2AHIA 3G04A 2H8PA 5DHVB 3BWUC 3VH8B 2AITA 3EYVB 3I9PA 4TUOA 1ZT1A 4J39A 4RMTA 1AD0B 3SDYH 2MHAB 4LSVH 2HFEA 1A21A 3IJ7A 3S37X 2OMZB 5GGSB 1FF5A 3NJFA 4AIEA 1AH1A 1LEGB 4AQAA 2WZPD 3VFWB 4WFFE 2Z1PA 4ZOBA 1AMXA 3W9EB 5I5MA 1MFEL 4ACPA 2CGYA 4RRPA 4XAKD 4AGMA 5F6IB 5IJVA 2VM3A 4NKQB 4XCFL 1RULL 4BSJA 4HS6B 4NWTL 5DD1L 1IGTB 3FT2A 5B8CA 3UIYA 5C08B 2XA8L 5F7BA 3VG0H 1JK8A 2CLZB 3MUY1 3QUZD 1FH5L 1QUPA 3VSQA 1U9KA 2BP8B 4HWEH 4NENB 2IWEA 4BKTC 4S1DC 3U7WH 4UV7H 2GFBB 3QUKB 1Z9OA 2FO8A 4LLMB 2MTPA 4NNYA 1ZRUA 3LN5B 4ZPVA 1X5KA 1QKZH 1H6EA 1ROCA 5ILTL 2BPBA 4JO8A 3ZRFC 1N59A 1S9YA 2VDNL 3FSVA 3NABH 4HV8A 5EN2B 4P2AA 5IEHA 3IE4A 1PLBA 2D2CC 5D1ZA 3BUPA 3ZSTA 4NKOB 5F7DB 3L3DA 5F96L 1KC5H 1MHPL 3OL2A 4ES8A 3V4UH 2NTSP 4ZMVA 4F9LC 1MNNA 4JJHA 1LO5A 4F9PC 5I73B 2WYHA 4EAEA 1YEDA 4AGOA 3OKKA 1NINA 2ZF9A 2R29H 3O8XB 1LDPH 1RQ5A 5GGUA 1MCDA 2AJYH 5AZEL 3UG5A 3AREA 1T3FA 3ZDZF 3U1SL 4GQZA 3KPNB 3MRGA 2DQTH 3PWPE 1EO5A 3B3IB 3OMNB 3V8CA 1SJMA 2CO1A 4J8RB 2X3AA 4DK6A 4DAGL 2XWBB 2DM7A 2NNCA 2DLFH 1G43A 4YLQT 1AE6L 3RVWC 5CZXC 4OZGE 1MFCL 2R2CA 4P5TB 4DK3A 1U3YA 2UY6B 2J1ZA 2J5LC 2GJ6D 1QW8A 2Z6FA 1XF5B 1A3ZA 1T66D 3LKQB 2H6UA 1J9RA 4JFDB 3PABA 4WTQA 5FM5O 4GLRI 3IJ9A 4J3UA 3PP4L 4PBDA 2Z91B 3BWSA 3RVVD 3WL9B 2IPTL 12E8H 4A04A 3B5TA 3QCTL 4G82A 1ORSA 2FZ3A 2X89A 1TPXC 2VMCA 4QRRA 1G7QA 4AYBA 1FRGL 5A2AA 1DJSA 1RU9H 2C34A 1XQ4A 3O4OC 4N1HB 5AAMC 4L0PB 1NCCH 1XEDA 2UVEA 5D9SA 3DPBB 4G5ZH 5E2TL 4G8AC 4PGEA 2B1HL 3CPUA 1EGJA 1UB6A 3LD8C 2WP3O 3ETTA 1G7MB 5H94A 4KZDH 4CSZA 2FUTA 1G7PB 3U25A 4AYID 1FNGB 5CWSB 3U9PL 35C8H 3L3HA 4IRJA 1WEJH 3UC2A 4NO2B 5FK9A 1DLFH 3WFCL 3P2TA 4MXQC 4ODUB 3CLEL 1CE1H 2WUCL 3KAAA 2IGFL 1W6WA 1UUSA 1KY7A 3EXLA 4WWKC 2NY5C 1OANA 4XX5A 1XF3B 2CO7B 1BZQK 3B6SA 4G8GD 4KI5E 1JVOA 4MDJA 5H2BA 4NJ9H 4L37A 4DP9X 1E65A 4R4FL 5L9DH 4WFGD 4N22A 1WIPA 2OPCA 4RETB 3CSYB 5I1IL 3O3AA 5BZWB 5FDWB 1E28A 4LCUB 4HZLB 5I6XB 1HINL 4IOIB 1FVCA 1K72A 2J12B 4JDEB 1KCRH 5MEOA 1P6WA 1KJ2L 2B4CL 3L9RB 2Y0SA 1MDAA 2V33A 3P54A 3CZNA 1AZBA 1QUNB 1QD0A 1CDJA 1U8JA 3X13A 3EJYD 4JQIL 5KOMC 3WNOA 1TTRA 3DX2A 3PNWA 3N91A 1XZ0A 4NUJB 1EJ8A 1XCWA 4H7VA 1EDQA 1C1EL 2DI8A 4ELMB 4MQXC 1NUNB 4PV9A 4S2SA 4KKZA 2FBOJ 2LGNA 3W81A 2EIDA 3WUZA 3ULUC 2E9BA 4IGBD 3H9SD 1YNKH 1T1ZB 3AITA 4AC2A 1VESA 1FBIH 4E41A 1R5IB 2OXGB 2WQRA 3K72A 1TZIB 4J6IA 4MD4B 5TDNA 5IQ7H 3MREB 2QKIB 2DIEA 2O5XH 3S35L 3DRTB 3OR6B 4B3EA 1R19A 5DMKA 3V10A 2K7PA 3MA7B 4AJ0A 2D3VA 1HKLH 3BLKA 4HT1H 3O6FD 3U46A 5TQ2L 3BXNB 3N42F 2IWGA 1FO0H 3VD2A 3S3JA 1OSZA 3ARGA 3GSOB 5E8EA 2IH1B 2JQMA 2N7AA 3BPOB 1NCDH 5CCKH 2DQHL 2ZXAA 2I07B 1T1YA 1HWWA 4ERSL 4Q52A 4XNMA 4G7RB 4JGNA 4JZJC 4H4NA 4H8VA 3LCYA 4NQEE 1ZD6A 3FUEA 4MRBA 3QXDB 4DGIL 4ZW3A 3ILQC 4Z3TA 2PO6C 3HZYB 1TZGH 3MJ8A 4FQCH 3KGRA 3WSQH 1MFBL 4F7TB 4HVBA 4PW9A 2CJ3A 2Z7ZA 2L4OA 3UTPD 4AC4A 2WB7A 4QYOA 3D2UA 4GRWF 4KY2A 1SOQA 3ZVVA 1QBML 1U93A 1CBJA 5BOPA 4KXZI 2OMYB 3BLBA 1BZ8A 1EA9C 3FFCD 2LU7A 2OP4L 1WA2X 5DJAA 1CGWA 4AZ8A 5HVHC 2WNKA 5DHMC 2VXQL 2CDEB 1ZK9A 5EOQH 3MLXL 1P9MA 5C0IB 1N6UA 3C75A 4O5LH 3AXLA 3QXUA 4PH8A 4YHNA 4RIRB 3MRCA 1WT5A 1NUDA 4FEIA 5J1AA 2MPVA 3FT4B 1IGJB 4PJEA 4I48A 1MPAL 3DX8B 3R0MA 5DVNA 4AV0A 3APMA 4EI5A 4V2BA 1NOFA 4GW5B 4KPHL 2CKNA 2ERJB 4AXWA 1Z9SB 3G6JA 5E2JA 3AM8C 3QUYA 5GS0H 2EZ0C 4DEPC 4NP4L 3TT1L 3VXUE 3BVWA 1JGEB 5BVJA 2FLBT 4JNXA 3P73A 3RL1A 3DJ9A 4KBPA 2DN7A 2CE6A 4L8CA 2CIKB 5KSVA 4PRPE 5HYJD 3UXFA 5F9OH 2WWMC 3AADB 4HS8L 2EADA 4N68A 1Q0XL 4J3OG 1AGBB 4XOAA 1BOGA 1P4LB 2ZX8A 2WXNA 3S97C 3VXME 4FYRA 3ROOB 2ENPA 4G6MH 5J8OA 3BUQA 4IU3A 3QG6B 2ATAA 4DKEH 3LVTA 1QTYT 1BVKB 4PWEA 4RGMC 4NKIH 4N8PA 5CAYB 3VSUA 1VDGA 3Q1SL 1HHJB 1ED3A 3D6GA 3L2LA 1ZSDA 4JL2A 5FECB 1NWOA 5CJXA 3FCUB 3PIQB 2GAZB 2XKNB 3FQXA 4W9FC 1IBGL 1X4YA 3CBKB 3FH7A 2ZUUA 1MJUL 2B2XL 5JPMC 4I4WA 1KEGL 5FB8A 2EP6A 4NKMB 3H3PH 3DX7B 2EYTB 1SHXA 2GTWA 1B3JA 3IFLL 4M5YL 4V1DA 2VDKH 4KRLB 3REVA 3V0HA 4P9MH 3FHEA 4GAJH 4NZDA 1XL6A 5TFSH 2YAMA 3FRPA 4PJ7A 3EBHA 2VXVL 1BVOA 4PWFA 1PLGL 4E9SA 1CVSC 4F7MA 2XA3A 3VCLA 3WIIH 5JW5B 4WGWB 2NR6A 1BQRA 4L4TA 1ZVYA 1UTDA 4LVNB 2WXJA 3U6XS 1IGYB 3H2QA 3HE6C 4YLCA 1TENA 3MFFB 2FK9A 2FUQA 4MJIB 3AACA 3G5YA 5F9JA 3DOIA 1KYDA 1UURA 3TVMA 3QZMA 3WXVH 1U92A 3WTYA 3N1QC 4HXBL 4KUCD 3RY6A 2A5UA 3GEWB 3MNWB 4HHWA 5EOCL 2GJJA 4Q9BA 4PJXB 1LILA 3JZ7A 3NCEB 3SGEI 4U1SB 1DVFA 3QEHA 2BVPA 4LCYB 2NNAA 3QG7H 4ZUVA 1CDIA 1A3LH 1G1OA 4DKFH 1JPFA 1FYTE 3F6IA 3ZT6A 1KTLA 3BZ4B 2P5PA 1NGWA 1TSHA 4RX4D 5ANMA 2EKJA 1U8HA 3MOQA 4DP6X 5KVDH 1YN6B 4YXHH 3DURB 4OF5A 3BKJL 4PRNB 4LOVA 5IJKC 1QG3A 3RX9A 1EFXD 3GDBA 4OCWL 1U8NB 4JL1A 2ZXGA 5TGBA 4OV5A 4F8TA 3GIZH 3WO3B 4G8IB 3QDGB 1AGDA 2AI0L 1E5ZA 3MLUH 4PJCA 3W56A 4Q6IA 4F7EB 2AJZB 3GKZA 4C4KO 2F61A 4JFYB 4PJ9C 4RA3A 1PF3A 5CGTA 2GTZB 5IUCA 1P7BA 1QBLL 2XN9A 3QDMB 2O5YH 1FSKB 5HI4D 5ICXB 5BJTB 1G9EA 4D8PB 2FO4A 3T1FA 3ET9F 4MD0A 2IBZY 4FCAA 4NLHA 3UAJC 2C4FT 4S1QL 4X6BB 3VGAB 2BIIA 3DTDA 2NY1B 1MKFA 3QCUL 4BUHA 1KJ3L 5BS0E 1BBJB 3AS3A 1QLEH 1JZ7A 4ONOA 4OTXL 1AZCA 3UBXA 1ZTMA 4Y19A 3WIFA 2E7MA 1QPKA 1AHKA 3WJMB 3NIDF 1FNLA 4YL4A 4P2OB 1N0XH 5D7JB 3MLZL 1KNOA 3HN5A 4PRIA 3DSFL 4PTTB 5FO9A 1H6UA 3IMBA 3KDMB 2MCG1 1W8NA 4B5EA 4P4KA 5B38A 5SWZE 1V7ML 1Q94B 3HCVB 3F7RA 4HLZG 2OSWA 3WTTA 1JGIA 3UAEA 3MGTB 3DVIA 1I1AA 2HCZX 4IJ3B 3EBAA 5DMGC 4BZ1A 1NAMA 4YPJA 2HB0A 4ICWA 4KKBD 1JYVA