4L05A

Cu/zn superoxide dismutase from brucella abortus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
ESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Immunogenic Insights on Cu,Zn Superoxide Dismutase Pathogenic Virulence Factors from Neisseria meningitidis and Brucella abortus.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 34
structure length 154
sequence length 154
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4l05A00
3KM2A 4A7GF 1OALA 4FF9A 1OAJA 1SDYA 2APSA 1IB5A 2WYZA 4A7QA 2C9VA 1Z9NA 1JK9B 1JCVA 1EQWA 1SXCA 2C9SA 1BZOA 1ESOA 1YSOA 2WKOA 2ZKWA 1TO5A 2WWOA 3GTTA 3GZQA 2Z7WA 3SODB 1U3NA 1SDAB 3ECVA 4U4IA 2AF2A 3HW7A 3CE1A 1E9QB 1F1GA 1IBHA 3ECWA 2AQSA 4OJAA 5CU9A 1SOSA 2Q2LA 1TO4A 2R27A 4BD4A 3HOGA 1RK7A 1SXBA 3KBEA 3MNDA 4BCYA 3F7KA 1PZSA 2AQPA 3QQDB 1PU0A 3MKGA 2GBUA 1S4IA 3K91A 3CQQA 3RE0A 1CB4A 5KBLA 1PTZA 3S0PA 3KH4A 1B4TA 1IBDA 1HL5A 1CBJA 1COBA 1SXZA 2SODB 3L9EA 1UXMA 4N3TA 2VR6A 1N18A 3QQDA 2WZ0A 2ZKXA 1Q0EA 3ECUA 2WKOF 3LTVA 1IBFA 2GBTA 1UXLA 1FUNA 2GBVA 2AQQA 2NNXA 1HL4A 3GZOA 2C9UA 2XJLA 1XTMA 2WYTA 1SXAA 1OZTG 2VR7A 3CQPA 2AEOA 3HFFA 4A7GA 4A7VA 1OZUA 1B4LA 1F1DA 3PU7A 2JLPA 4A7UA 3GTVA 1YAIA 3GZPA 4N3UA 4OH2A 1OEZW 1XTLA 2K4WA 2Z7YA 3T5WA 1KMGA 1BA9A 2AQRA 1E9QA 2V0AA 3KH3A 1E9OA 2AQNA 1F18A 4B3EA 2WZ6A 1Z9PA 1MFMA 1N19A 4A7SA 1DSWA 2ZOWA 3F7LA 1IBBA 4BCZA 1SXNA 1F1AA 3H2QA 2E47A 1SRDA 1E9PB 1P1VA 1SXSA 2Z7UA 5KBKA 1DO5A 2Z7ZA 4MCMA 1AZVA 4L05A 1EJ8A 2XJKA 1QUPA 1E9PA 2ZKYA 4A7TA 2LU5A 1SPDA 2WWNA 2JCWA 1L3NA 2E46A 3H2PA 3KBFA 2VR8A 3L9YA 1XSOA 3KM1A 1YAZA 4MCNA 2WZ5A 5KBMA 1E9OB 3GQFA 1JK9A 2AQTA
chains in the Genus database with same CATH superfamily
3EUUA 4EDXB 1S7XB 2APSA 1PW3A 4PJ5B 5C08E 4UTBA 3IGLA 1RJLA 4FC3E 2F58H 1G0XA 1EQWA 2VQ4A 1YJDH 3JYCA 1YSOA 4N2IA 1WA0X 3KYMB 4XB3A 3DROA 2VJ0A 5CAYB 3TVMD 3U1SL 2ARWA 3GSUA 5AD0B 2PWEA 4J28A 2ZUXA 3STZA 2WLMA 4FLOA 5I66B 1T4KB 4GNKB 5CEXB 4O00A 4KK8D 1RERA 3VFWA 3EF7A 3DNKA 1JF6A 4JJ5B 4FFZL 3NESA 1JZ4A 1CF8L 2OV0A 3WJLA 2JWYA 5JHBA 4I5BA 3H9SB 3S5ZA 2VDQH 2A6JB 4FMKA 1BCIA 4K3GA 5E2UL 2VDOB 3TIEB 3FMGH 2ZP0T 3LX9A 2IWGA 5ESQB 1IM9A 4NO2B 3MLZH 3DDFA 4GP4B 4GLRI 3FCTA 1CICB 1FRGH 2UYLB 2PP7A 3HFMH 4MJJA 5DVPA 4CC0A 5JW5A 4ODXB 2ORBH 4NBYB 3NCFB 5SV4A 4OIIH 3NACL 4XH2B 4BSWA 4WI0A 3RX7A 5CSGA 2DS4A 2AMUA 5C7ZA 2X4SA 4XOBA 5EU7E 4HOWA 3QUZD 1VZGA 1U8LA 4JUTA 4Z3FA 3NCBB 3BP4B 4IJ3C 1ILSA 3QHTC 2HT4D 1DBKL 2MTPA 4JREB 3SQOL 3OJDB 4CN6A 4GSDH 4Y9BA 5IQNA 4ZFZB 3FQYA 4AKOA 4DNLA 5J6HB 3KBPA 1LXMA 4KXZH 1CFVH 3LH8A 1OOWA 2H45A 4EZJA 1AXSA 3CV5A 2J8OA 1MAMH 3OLDA 2VLKB 1I8KA 4MBOA 2X10A 2NMSA 2VMEA 5D2LA 4OI7A 1WBXB 4P9HH 1JFHA 1U3HD 1Y07A 4NI6A 4P2OC 1FH2A 1Q0XH 3HI1A 4XP9H 3CMOH 4F8LA 1DVSA 4NZUH 1T2QL 3FKUS 1XX9C 4OUUB 3HUJB 2B4CL 5DWUL 2VLJB 2X3CA 5CJXA 4JM2F 4N0FA 3E7JA 3JTSA 4HV8A 4YSDA 1PQZA 1DLHA 4K7PH 5FM5O 1T3FA 1E9PB 2EDQA 2VDML 2X89D 1ZHNB 5DJCB 4KDTA 4UQAA 3UX9B 3F84A 5I1AA 1YYMH 4RGND 2D73A 5KVGH 5A3ID 2NY3D 3ZKXC 4ZMOA 1C7SA 1VAHA 3CVHB 3MLYH 4ZXBD 1EGJA 2P5EA 1B0RB 4JL1A 4DOHE 3IFOA 2D0HA 1M42A 3I6GB 3PPEA 1SPDA 4JVUA 3X14A 5GZOA 4G1EB 1MZZA 1J86A 1FVEB 3INOA 5E5LA 4POUB 5CSZA 4JY6A 1NSNH 3G9AB 4Y19E 4LCWD 5GS0D 3EUDA 3EHBD 1OO2A 2ICES 4Z7WE 1CD8A 4BELD 2N7SA 1B2WL 3QUGA 4RQQB 4XOAA 4L1HA 4M7KL 1KFGA 4U3CA 3MNVA 2WO3B 2OSWA 5C0DB 4D0DA 1LP9E 1XIWD 2ZG2A 4X8CA 1FVCA 5GQBA 2CLVA 4P2OB 4O9HL 3CFEA 2VSCA 1B9KA 3HRZB 4W4OC 4X6EA 3VRLE 2QSQA 4BUGA 1W16A 1EEQA 1L0PA 5HVWA 5L2KB 1T03H 1OARH 4R2GD 5INCB 2UY6B 2GHWB 5D5MF 2HLFD 3BWUC 1I1CA 3O2DL 1A5FH 1H3TA 3C8KA 2FT7A 3HRZA 3GSNH 4FQ2L 4M61A 4X6EB 4DJMA 5I75B 2PW2B 2IH8A 2N3JA 2DQMA 5CLTA 3HG3A 4JQXC 3MRBB 3TA3A 1JF1B 1V7NL 3BAXA 5EU4A 4CBPA 1YEEH 2VL5B 4LEXH 1WHPA 2X9YA 5HD8D 2AK1L 2FEDC 5HYJE 1VESA 4KH2A 5KS9E 1BREA 2BVEA 4N9GB 4XNZC 3O45B 4LHUA 3WEXB 4B9IA 1B0GA 1CFSA 3BLBA 1CK0L 1CICC 1RZPA 1SHXA 3ARGC 4YHPA 3OR6B 3KYNB 3WFCL 3BPLC 3S3SA 4M1GL 3PGDA 4LBAA 4YR6A 4F3FB 1WITA 1V7NH 3GD1C 3OF6A 4H8WC 4N2GA 2KPWA 3MR9A 3NZHL 1SOQA 2J8UE 2JLPA 4Y8DC 1E8YA 1FZKA 1S7QA 4PWGA 3CX5K 3NBNA 5EZLB 4D9QD 3LKOA 4QHPA 3ESMA 2FATL 4J4PC 4XNQA 2ZCHH 3KJ4B 1S9XB 2AXFB 3HS9A 4FQXA 1N59A 2VXUL 4UI2A 1P4LB 2DQUH 1F56A 2J6WA 5ID0B 4L5FE 4G9FE 5IHZB 5CIPH 4F7TA 2DWTA 2IAMB 1DBAH 2WAHA 3DX6A 4Z78A 3QNYB 4N8PA 1CBVL 1DCLA 3WIHA 2DI7A 2CBPA 4O9HH 1MCWW 4IMKA 4PJ8C 1M7XA 3V9EA 1BVKB 3CDYA 3H3BC 4GEIA 4D3CL 4HG4J 3W82A 3MOBL 1A6UL 4HAFA 4LSVL 4CRPA 2FNBA 5D8JL 1LVEA 1F6LL 3SDDA 3B2XA 1JG9A 1QBML 1QATA 3ARDC 1CD1B 3RIKA 4B27A 3WDHA 1UXWA 2R23B 1IGIH 3FT4A 5I6LA 3PABB 5CBEB 1MXGA 5F9JA 4Y19A 4PRID 3LPFA 5EOTB 2J4WH 7TAAA 1IV8A 4X7TA 4Z7WA 5GGVL 4APQC 43C9B 3G5YA 3QXTA 4XMPH 2P42B 1BVLA 3V5KA 5J89A 3N06B 4PJHA 4CGTA 1WBZA 1PIGA 2RBLA 1HE7A 2V9UA 1G9NC 3CZUB 3OKKB 2W9EH 3P11L 3AABA 3NMEA 4XNMA 5KBNC 3P3YA 2FO1A 1TQBC 4L3ED 1I1FA 1SXCA 4JFFB 1MFCL 1C08A 1SDDB 4UM9A 4AJ0A 1DJXA 3VSTA 1J8HE 1UFUA 2BZ7A 3D08A 4BQ6A 1RUAH 3FT3B 3MOAL 3PAUA 2BJMH 1JPEA 4FQJL 4MQSB 5KVDL 2AXGB 1X5YA 1HEZB 2EADA 5J9PA 3ML8A 2YO3A 3FO9B 2XTJB 4UWQB 3ABKB 4OM0L 5HDWA 4I1RA 4WW2B 1E8WA 4JRFA 1OGTA 1EHLH 4NKOA 3NSFA 1U4EA 5C8JB 3CQFA 3HE7A 2QQQA 1PVHA 3EO0B 5AW4B 3RTQC 4OD1H 4BK4A 5I1CL 1TUPA 1TXKA 5DGQA 4D8OA 3IWVA 3NJVA 5D1QB 1UXMA 4JS7A 3NZ8A 3TO2B 2BW4A 4UQEA 4HPHA 3KPRB 3L4VA 4YPGA 4ZD3H 2EDTA 4XMLL 4PJBF 2Y7SA 3OKNB 4HXBH 4L3CB 4N0UB 5LBSH 4MMZA 1I9IL 3MLXL 4IJTA 5IQLA 5AD0A 5DVMA 3O8XA 3QCVH 5F1SA 3RY4A 4NJ9H 5DA4A 5HYJB 3L7EA 5IG7B 1Z6JT 1ED3B 3UTTB 1DANT 2OA9A 5AAMA 1FE8H 4MLSA 3H6AA 4CSTA 1NL0L 4N4YB 1T6VN 3TJHC 3WMSA 5IMOA 1TZIB 1E5UI 5I18L 3DC0A 4U1GC 3WKML 3FXIC 1EZUA 5LLIC 2PPDA 3GMRA 3H4FA 1J8HB 3SO5A 3C5XA 5EDXA 3G6JB 3L3JA 4JFDD 5CEYA 3VRLF 1AZZC 5DVLA 1MFUA 1Z7JA 3B9DA 4NNXA 2WINA 3W37A 5EORH 3PAYA 3RX8A 3OKEB 2J5LB 3SCMD 1B90A 2R1YA 1F6FB 1VACA 3I75B 3X1BA 5L8JB 3DOSA 3X1FA 2QEJA 4AEIH 2J7LA 1BIIB 1MIEH 1BEYL 3MV9B 1JHLH 2XYCA 3TT1L 1VFAA 3R0MA 2MKWA 4RAVB 4B7LA 5MENB 3NJXA 4BCXA 4NUQA 1QSFD 2XU9A 4HULB 5E6RB 2OR8A 1U3YA 5AALA 2QMKA 1E5YA 3X13B 1AI1L 4LCUB 4RNRB 1A7RL 1QMUA 4YDLB 1BMWA 4Z7NE 1Z0MA 1PEWA 3NH7L 1NC4D 4HPYH 2WNGA 3V52L 1RZJH 4NN5B 5E99L 1OAZL 1P5UC 3IAPA 3BAEL 1NBQA 2R2HA 1HHJB 3CZNA 4NC1C 1J0KA 1R5WA 2HT3C 4HP5A 1JMXA 1QVOA 3NIGB 5JXED 5IBUG 5D1QC 4PGCA 2EE3A 3BWSA 4I5BB 4J3WA 3W0WE 3WKNA 5AL8A 3QO0A 4X5QA 3TYFA 2VLRD 3HW7A 4H44C 4HPYL 1XH3A 4DZBB 4UM9D 4WJ5B 1UUSA 1ZY9A 1DANU 5ALCL 1WHOA 4FA7B 2DM3A 1JWUA 5E2WH 5C0AA 3VI4A 3ARPA 4I0PA 3QO0B 5ITFB 1AR2A 1KIRB 3BEVA 3BDXA 3C2AH 3HNSH 4X50A 5C0IA 3IU3A 1MIEL 2XBZA 3RDTB 2XKUA 1G9NL 3EDEA 3WFBL 1OWRM 4V2BA 1KXVA 4QWWC 2AK4E 4YDLC 1DQKA 1TQBB 3SE4C 5FHBH 4QOKB 2OSLB 1PX4A 5AKVA 4L8CA 4CW1B 1FFRA 5FO8A 2KLTA 3O9WB 1IGFL 2V5SA 5DMKB 3EJCA 5MHSE 1UWGH 4WUUB 4LLYA 1QLEB 1HQRA 3RKDD 3QI9B 1GTNA 3VAEA 3HNVH 1MHHA 1PZBA 4PS8A 2CM6A 3ZMEA 4CILA 3KPSA 4NPJA 5HJ3B 1MNUL 3LKPB 3BT2L 4IKLA 1XTLA 4HUCA 3TYGH 3FOMA 4N5ED 5I8KL 4JN2A 4UDUB 1PY4A 4WU5B 5DF0A 4MHHI 4NYLB 5AKTA 4R3SA 1AGFB 3QXDA 4KO6A 2QPFA 4IEFB 1HHHA 4DP4X 5I6OA 3MV9D 3TTSA 3FU9A 4HWBA 4YHIB 3VDBA 3TWYA 5FOBB 4OCYL 3VGAB 5KYWB 5IUCA 4JN1L 3HMWH 2WQVA 3B2PA 4N8VA 5I5MA 2EXWD 4BZ2L 1N3NB 2OTWA 3O6FC 5F70A 3ZDZE 1Q1PA 1RUKL 2BDNH 5FO7B 4IBQA 1JVOA 3MUGB 2WXRA 1KXTA 2EYSB 3OZ9H 5F1OB 2LLGA 1G43A 1GS8A 4KH9A 3HPJA 4KAQL 8FABA 5KYWA 3CXHJ 2D7MA 4JZOB 2VZOA 1Y6NR 3ASOB 4U1LA 1KACB 4JHBA 1N4XH 2Y07L 3RWFB 4B5EA 2NY6D 4ADJA 3MJWA 2EDNA 2YKLL 4F7TB 4WUUE 1RMFH 4A7GF 2EACA 2N7AA 4TUKH 4ZS7L 1E3XA 1QG3A 1PZAA 5PAZA 1S7RB 3GF8A 4MKMA 4XCYB 2ISDA 1BJMA 1JNLL 4K07A 3SKNA 3C5ZB 4Z7OE 4XNDA 3QDGA 5IVZA 3T4YA 1NMBL 2W8CA 2BSSA 1AS7A 1OANA 4LDEB 4X7SH 4YDNA 2Z4QB 1LK3L 4GAGH 4U1KB 1ET7A 1V3JA 3CFKB 3VFUB 2HTKC 2G4GA 4N8UA 1JGLL 3WS6A 3MRHA 2WLIB 4U6XA 3S5LB 3V0VA 3GXMA 4KVNH 4LSPL 3LZRA 4HMCA 1UB6B 2Z4QA 1Q0XL 3S2AA 2BP0A 1MRCH 2DWEA 1A7NL 4PLJD 1SUHA 1PTZA 1TTCA 3AWEA 1NC2A 4JDTH 2Z91B 2NY1C 4W4NA 3L5IA 5ERWB 2ESVD 3BH9B 4L5FL 3V6OC 4BKLB 1ICTA 5D8JH 3GSNB 1WSST 2QBWA 4X8JB 4LNRB 1GGCL 5EN2A 2IDUA 1WP6A 5D93B 4ZOEA 5JHDE 1MI5D 1F42A 1NQBA 1IQWH 1UWGL 3QFGA 1VZHA 2RCSH 5JDSA 4B96A 3CC1A 4MZ3A 2GHZA 3OZLA 3TBTB 3NFSL 4GG8A 1KPRA 3PWLB 1LHZA 5GZND 4MKTA 2ZUUA 4S1SL 5EF1A 1JK8A 1WH0A 3OJ2C 2VN7A 4WWID 3ARVA 2WZAA 3NFSH 4J5VA 3STZB 4L4VA 3U4BH 3TBTA 5HHME 3H0TB 1PDKA 3FFDA 3GHEH 1S8DB 1IQWL 4MD5B 5HDQH 3OHXB 5JHDB 5IR1B 1BX2B 1NGWB 5JHLL 3CZFA 1FSKC 5AVQB 4HIIB 3GLEA 2OW7A 3ME0B 5SWZD 1T89A 1KJ3H 3CN2A 1PYWA 5CSBA 3EGXB 4HS6B 4JGJA 3HC2A 3TV3L 1XBDA 3RILA 3S4SG 1D2PA 2EH7H 4JAMA 4LLQA 1JGUH 3GHBH 1JZ8A 1MRCL 3BVXA 3E9UA 2FJFA 2BHFA 4RFNB 4W9IC 3O2DH 2WXFA 4OGAC 5IMLA 3K72B 4XNZB 5FLUA 3NABL 3W9EA 5CCKL 5E1IA 3ZZQA 3JTBA 2ZZUT 1P2CA 2XZAH 4F9LC 5E00A 2IBZY 3HCVA 2LFGA 2P3YA 4N2LA 3VJ6B 1QFWI 3DURA 1N8ZB 4R90L 2ZOOA 4M1CC 2FLRT 3DRTB 1KCKA 3MRQA 3VXMD 3UJJL 4A7QA 3CUPB 1IVTA 1FP5A 2W80C 3P0GB 2ZIDA 3Q01A 3MX0A 4I0CC 5JQHC 4IRJB 3ES6B 5EUOE 1G9ML 5LCVH 4Z7UE 5HHPA 5LN8A 4GMTH 5IT2L 4UV7H 5J1AB 1RIVL 3CDCA 1K6QH 1L9RA 3UOAB 1KLGB 4Y8AA 2YPLA 2J55A 2VISB 4KAQH 4XBMA 5A2CA 4WI9A 1MI5A 3ZUCA 1CICD 2A9DA 4ORGA 5FUOH 4N87A 1SYVA 2A2QT 3DOIA 3RWDA 4YPGB 1QSFB 1X7QA 3IMRA 3MBED 4BZ2H 1JV5B 4PJ9C 3KR3L 4BZ2A 1LTXA 1NEZG 1P84J 5GRUL 1IEAA 2BVPA 4HIPA 3FQNB 4WW1B 4WTQA 1F4WH 3REWB 2O5ZH 1FYTE 2GAZB 4UBDD 4AZUA 1H3VA 3D0VB 3ULVC 1A4KB 1T1XB 1OPGL 2NUTB 4JY6B 1NM9A 5BO1H 1JV5A 3HN8A 4PREA 1ORQA 5CEXA 3D85D 3S88H 3TL5A 5GPRA 1EH9A 3S37H 4B5ZA 4NPKA 4N6RB 3UPRA 4XHQA 4WHYH 1B9ZA 4ELMA 1CFQA 1WBYB 3MRIA 1OEZW 1WWCA 2CIIB 1NGZB 4BEIA 3NGBC 4HEPG 5DHVA 2WLLB 3TOPA 3FT2B 3H7BB 2XV6B 5FKAA 1MH5B 5IREA 1MHEB 1OP9A 4Z18A 4HF5H 1N5YH 2OZ4A 4XBGA 3MMEA 2P8LB 3I50L 3Q6GH 1GCYA 2CRMA 1LWJA 4ANVA 43CAB 2MFNA 4CW1A 5IW1B 1QZNA 3BWZA 3DV6B 4O51A 3QRGL 5C86A 5D1ZC 2WKLA 1HWWA 3JTTB 3KLDA 2OYKA 2H1PH 3HNSL 5FK9A 4DP9X 1EUTA 2E8YA 4A2LA 4WV1C 1I7ZA 3AACA 5TJWK 1KSRA 5L9DH 3NVQA 4M56A 1JPSH 5DJ2B 5DZ9A 3WDIA 4PJCA 5DJXB 2ZWSA 4X7EC 4KNQA 2CJUH 4NQVA 4AIOA 1M05B 4IDJL 2G60L 2NUPA 5FYJD 3VE0B 4O2EB 1UUNA 3KXFD 5F6HI 3HAEH 1KGCD 2GEEA 2KH2B 2P28B 4LRNL 4MS8C 5CJBA 2AJ3A 2DYPD 4IGBA 5GGVH 1FNGB 1R4XA 1KTRL 1WA1X 2MQ3A 2IPTH 3K0WA 1T7XA 2Z9TA 5FR3A 4U1GB 5J6GA 2A77H 3QS2A 4LVNB 4Z7UA 4ETQB 3FFCA 1JWUB 3V10A 5IBLD 3L3IB 1XXDC 4HKZA 3WSQL 2NNCA 3C09C 1EEZB 1ZVYA 2YPLE 2ITCB 2X6MA 2X6UA 3N1PC 4ZW5A 1R3HB 3FBQA 5ESAA 1MI5E 2XN1A 3LYRA 3QP3A 4OJAA 3VXUB 1AI1H 2Y2YA 1WFUA 3QHFH 1JVKA 1AFVL 4CJ1A 5C0RH 1KBBA 1X5IA 4JQIH 2DTML 3O2WL 5JNYB 1WS7A 4LPUA 2EYRB 2VWEC 1COBA 1IGCL 3PP4H 3GRWA 2YQ2A 1HL8A 1TPXB 1ZWIB 4WFFE 4X9HA 2J88H 1Q90A 3OJVC 2X4NB 3UZQB 5F9OL 4DPAX 4JRWA 4DH2A 3DK0A 4AMKH 4FKHA 2GBVA 4GKZB 5EU6A 1FVCB 4P23D 2Y06L 5TF1L 3GBML 4BSWB 5ICZA 3PHQA 5FEBA 3R06B 2Z65C 3BAYA 3OKYA 2C3VB 3AB0B 2Q3ZA 1EZVY 3IS0X 3MRJA 3SPGA 3BFOA 3BPCA 4H8VA 4F33A 5TDNB 1E5CA 3RURA 3HB3D 4PJXB 5DVKA 4KK8C 4J8RB 3NQKA 1XR8A 3PQYB 1FQ9C 4HWZA 4PAZA 3LH2L 3SYQA 2Z3FA 3GI8H 3ZE0B 2H32A 3CVIH 1TQUA 4JKKA 5E1AA 3DA0A 3BZ5A 4J6RH 4AVKA 4B50A 3UEZA 4IKJA 5AZEH 4WUKL 3EG9B 1YJDC 2BFVL 2W60A 3PCYA 4N86A 2VSKB 4IRJD 4FKKA 3S5LG 5EEUA 2WBJD 5GGUB 4XMXA 4PR5B 3TGXA 4DKEL 5I73C 2QQNL 2NCMA 3ZHKA 1XF2B 2LU4A 3M8OL 2R0ZL 3RPIA 4FNSA 2XG4A 3DTXB 5D2NC 3RPKA 4A2HA 4Y4FC 4D0CB 2A83A 3R7QA 1PLBA 3K46A 5I8CA 2DTSA 4QXGH 2B39A 4BK8A 4U1LB 4EVNA 3QUYA 3BPNC 5LGJA 4JBSA 5DTFB 3G6AA 1FC1A 4J3VA 3DUUA 4WNJA 5CGYD 4Y4KA 1GY2A 3X1EA 1J88A 3FQ1A 5IBLC 4OM0H 2A83B 3E3QC 4NQCE 3BPNB 1FGVH 3LQZB 4OKVB 4PB9L 1URIA 1XEDA 1MJ7H 3DX7A 1G7IB 1OV8A 5TQ2L 1S8DA 3VM7A 2JB5L 1BX2A 4H4NA 1DHKA 4GG6A 2B1AH 3BO8A 1RJZB 2R8SH 1AXIB 3QH3B 4MQXD 2G4EA 2DY2A 2JJWA 3KJ4C 4GMTL 3T8VA 5DR5L 4YLCA 1IT9L 4KK9C 4EI5B 3V0HA 2X42A 3O0RH 4X9BA 5L4JA 2EKSA 1S78D 3IJYB 4XC3L 3T6QC 1WDAA 2DWXA 3RL2A 5EN3A 5T3ZH 3DMMB 1XB3A 1KN2L 4WFHE 5ESQA 4UTBH 4X7TB 1BZ8A 4H2AA 3VXTB 3GLAA 4P57A 4WGVB 4PG2A 4AWJC 3CQQA 2H4EA 2F54A 2KHAA 2VAAA 4YDIL 2WAQA 5DXWA 5B38B 4XH2A 2WXIA 1B4TA 4U31A 3HB3C 2LAAA 3C5ZC 1JGEB 5EU6E 1ZLSL 1OB0A 1YMME 3EYOA 5C09B 4IU3B 3Q2CA 5KSBF 5AOIA 2EO9A 2SEBB 4L3EE 1EAPB 2X7LA 3INUL 3QDMD 3A67H 3BIKB 4C4UA 3QIWB 3R0NA 1TQTA 1NUGA 2J1WA 3IDGB 2WSKA 2C1OB 5B21A 4NWTL 2BZCA 4LHUB 1I8MA 4MNHB 2B1HL 4XXDA 1LQSR 4KKPA 2ZUSA 1KJ2A 4ZW6A 3CLFL 5G55A 2DYPB 3APNA 3I3DA 1BFOB 1U8HB 2DH2A 1F0LA 4XGZA 2HVJB 1IIIA 3T5WA 5JW3H 1BMZA 1AKJD 1FRGL 3SY0B 3HFML 1L9QA 4K5NA 1UT1A 3NZUA 4LSTL 3RVUC 1BLNB 1E9OA 3ZE2B 2ZYIA 5IOKA 2VZSA 3I50H 3Q6GL 3B2UD 4FG4A 1SEQL 2AITA 4HT1L 2DDQL 2IGLA 3QARA 1ZA6B 4HV8B 4JPWH 5EO0A 5ICXB 2AC0A 3BKMH 1DSFH 4ERSL 2BC4B 1EXUA 1T0OA 5IMKB 3SY6A 4U1NA 1SVCP 4HLEA 4OCMC 5DJ0B 3EJSA 1EMTH 3LNHA 4OGXH 1QLRA 4WVRA 4D7PA 4MCMA 4R7LA 4JKNA 3IJ8A 1J05A 4E0RA 2V2TB 1IL1B 2RJMA 4RLDA 1USZA 3BLKA 3AAZB 3UPRB 2XCMC 1UACL 4K73A 4Q9BA 3T0AA 5BZZA 1PF3A 4NO5A 5DMJB 2XWDA 4HUWA 3L9RA 1FH5H 3RWIB 2DPKA 1UH2A 1QFOA 1I8LA 1HHGA 4IRZA 1RHFA 1U41A 2NY4C 3BH8B 5EULV 1ASQA 4GT0A 1J0JA 1MHCB 1GGIH 4TQEL 4LHJB 2C34A 1T1ZA 3BHBB 1P7KA 1ZT7B 3VFVA 3OKEA 4MNQB 4P2OA 1HOEA 3FOMB 5B39G 1O6SA 1NBCA 1UTDA 4FQHA 4JFFA 3KLQA 4Z7QB 2AEQL 4Q52A 5EBLB 3SODB 3CJJA 3QJUB 3VFPA 2FHCA 3QYCA 4CVXA 4PGEA 4GI6A 5KOMC 4ELKA 4OUUA 4P5TB 4XVUD 4L3FA 4KDTC 4HIXL 3OWRA 2F54E 2LTQC 4BCYA 4JRXD 2EAEA 5F7KC 4EOWL 3N9GL 1R33A 4OLVL 3SPHA 4RZCA 2OJEB 5DJYA 5B1AB 4RFEB 1WUNT 4ONGH 1A6AB 4K7FB 4F7PB 2G9KA 3KLAB 2GK0B 2PCYA 4KJQC 1XL6A 4P2RA 5LGHH 2WM0A 3FQXA 3B9AA 2F5BL 5E51A 2MCMA 1GGIL 3X14B 4OLUH 3RWJB 4LLMA 4G1EA 1K8IB 4F2FA 1LGVA 1HL4A 4ZO9A 5DJYB 4FG6D 3DARA 2B77A 1PJ9A 5C09E 3VD7A 3LRSB 2N7BA 4P4KD 4N0UA 2QQNH 4Y19D 5KW9H 3DHJA 4P5KB 5HHOA 2GJZB 1WTLA 1NFDF 3PL6C 5F0PB 5F7MC 5FFOA 3RWJA 5B7EA 3IJEB 1I7RB 5D6CB 5KANG 4HPOH 4NENA 2CLRA 4M5SA 3QYMA 3D6GA 1A65A 5F7WC 1D9KC 4WK0B 5T1KD 4I77L 1WK0A 3VDCA 3NCCB 4U7KA 3O3EA 4FX5A 1H8OA 4LP8A 5F6HJ 4JPWL 1H0DB 4JQXA 5INCA 4JFOA 2EABA 5E4OA 3U9WA 4KZEH 2WLZA 1P4IH 4TS6A 3U4BL 1IGFH 4JO3H 4KK5D 1X5GA 3NACH 3SPVA 3WFDL 5AG9A 2E5EA 1O7DC 2VQTA 4M61B 1QRKA 4N22A 4DEPC 2P8PB 3NIGE 3SYPA 3L81A 4YSEA 1OLLA 2NNRA 3OG6B 3GSWB 1CICA 2OSXA 2UYLA 1RZIB 1V05A 2UVFA 3PP4L 1NJ9A 1T7ZA 5B1JC 3VI3A 3PGFH 3LEVL 4PJ6A 1TTGA 3M1BB 3QUXA 2H9GA 4QGTA 5DUPL 3KPMB 3QFJA 1KEMH 2YEVB 1AFVH 3UTQA 3EJZC 3BQVA 4CVZB 1MG2C 1PKOA 2FQDA 2WCPA 2RB8A 5CXPA 1D7CA 2X5PA 1MFAH 1YMHB 4OGAD 5ALCH 5I0XA 5IHUL 4P07A 1NLDH 1UXSB 1X5XA 2XV3A 1Z5HA 2IDSA 3IDMA 5EPMA 4KQ0A 1QW9A 2BXYA 3BSZL 4L5FH 3BZ4A 4Q0XL 5CNHA 1OL0A 2A6KB 2AJXL 3GLDA 2DBLL 2D4FA 3KCPA 3ZBMA 2C9RA 4M3HA 1FAKT 1FNFA 2R15A 3RWHB 4XXCC 1CFTA 3ARQA 4LVOC 4UTBL 3IJ9A 1FLTX 4HKJB 1AKJB 1ORSA 3ARTA 3NSXA 4HSAC 3SDDC 1G4MA 5A1AA 1J9TA 1WAAA 1W8OA 4W68A 3L5XL 2HRPL 4QR7A 1ZMYA 3CZJA 4BFJA 3EDFA 5GGTH 3CVCA 3QUZA 1NMBH 4MAYB 3BXNA 2EIJB 4APXB 3QWOB 3QORC 4UT9A 2WP3T 2AEIT 3ULVD 2XXFA 1BQHG 3TZVA 3NZ8B 3TO2A 1P5UB 1XQ4A 4APQA 1ILUA 2I27N 4M93B 1GMEA 4PM1A 3KGUA 1J8RA 4NOBA 4PJGA 3BN3B 3VVWA 1K3IA 3MBEC 3ETTA 4KRLB 3P77B 1ACZA 5DURD 1ZKAA 2YN3A 3NRQA 4PRBA 2B1OA 3OXRB 2E8ZA 4HFWA 1YVLA 1NMCB 2DQFB 4PJGF 1WJ3A 1R3LB 4JPQA 5K5YA 4NC1E 4YLQT 4F7CB 3FB8A 3LEYL 3UCRA 1MFAL 3TCLA 1AKPA 3DXAD 2FSEA 4OD2A 2FX9H 3OJDA 2UWEA 3G9VA 3IEAA 3NPSB 3ULSA 1OK0A 1YNTA 1C08B 2OMUA 2I69A 3OV6A 5I24A 1KGIA 2FZ3B 3BQUA 5B38A 4POYA 1TTAA 4KY2A 3BPOC 3VCLB 3BP6B 4ZMZA 3TH4T 1OAUH 2EE2A 5JIKA 4ZUVB 1CT8A 2A9ML 3S98A 2QADB 3KHOA 2MQCA 4YHOH 9PCYA 3WFDH 1XGRB 4MDRA 2Y7NA 5CJOL 3BP7B 1A6VL 1OHZA 3EZ8A 4UUJB 3BD3A 5FYLH 3A4DA 2HTLC 2FJGA 5LXGH 4Y1AD 3DX7B 3FF7A 2NTSP 2UZIH 3LN4B 5AOJA 3M1CA 4PVMA 5FYKU 1MW3A 4N0CC 3PWLA 4Q4IA 3RI5F 3VB8A 1K9TA 1R3IL 3N5AA 4ESKA 5L6YL 1AGDB 4WY7H 5H2BA 4PJ7E 3QJQB 3NAAL 1OHQA 1CFNA 4L2LA 3L3DB 3QIUC 3B9EA 2R7EB 4OTXH 1HXYB 2BIMA 4G7SB 2CXGA 5KSAD 4JGUA 2QGCA 2NYYD 3B9KD 4P5MB 3DV4A 3VYPA 1NEUA 1MF2H 2PXYA 3KLSA 1IM3D 3PNWA 4HKBB 4Q6IA 4HX1B 2C7UA 3ULUL 2O6PA 4DVRH 2QSCH 1WICA 3VW3H 2OZNA 2EDYA 3SDCB 4ZUSA 1X4YA 1XH3B 2B3RA 1JRHL 2VE6B 1GYVA 4QHKI 2QQLL 3BYTA 1U93B 4IBVA 4UMSA 5KAQF 3VXRA 3N55A 5E8OB 2QZQA 1T5KA 3U46B 4KROC 4AENA 2OQJB 2G5RA 2Y25A 3FT0A 1T21B 1HCVA 4UNTA 4JPVH 2NW3A 2GUOB 4E41E 4L8DB 1U93A 3VYOA 3ILDA 1WFMA 4OCWH 1AGEB 2CJSA 2IH1A 5AZ2H 3JWDH 4X6DB 1GGBL 1W91A 3L9EA 5JR1H 5D7KE 4X4KA 3EO9H 4L4TA 5MEPB 1N64H 3C5JB 4XAKE 4LT7A 4AQEA 4B9PA 4FMVA 5EEXA 3QEQA 3P4OA 1HYSD 1S7VB 2Q9OA 3MOBH 4L9DA 3FTYA 1JSYA 4LMQI 5TDOB 3SQRA 2BMKB 5E6IB 3MKKA 1GAFH 1MAJA 1MELA 3NP4A 1CDHA 3ILPB 1HINH 3B3BA 2CDEA 4U6VH 1L9MA 5BVJB 5IFJA 1X7TA 1WZ1L 5DRZB 4ZMNA 3CSYB 2A0LC 5AYTA 5IB3B 3ZKQD 5CP7A 1EEZA 3UFIA 1FDLL 3W39B 4GW5B 3N43F 1TEGA 5K33A 5LGKA 5J3HC 3FQNA 1H8NA 3VGHA 1W8NA 1D5BA 1YNKL 4JJHA 1GZPA 2B14A 1BXUA 3U79A 1B0IA 1KXVC 4N8VB 4HH9A 1T6BX 2VJXA 5L8LB 4LRIA 3N44B 5D2LE 3IMUA 3CVHA 4JQVA 2QKIC 1SM3L 3LRSA 2CUIA 1CGXA 1RI8A 3ETBF 4X80L 1NFDB 3MV01 3SO3C 4LEOA 1NGXA 4Z0XB 1ULVA 2CM5A 2R0WL 1FVEA 1AC0A 4PJDE 1QI3A 2ENQA 5DJDA 2KI6A 5JW3L 1YHPA 4O4YL 4LK4A 5GGRB 5L88H 2J2ZA 1CYWA 2EEFA 2ESVA 5E2JA 3CD4A 4K94C 1AGBA 2PW1B 4PS3A 5DURB 4W9EC 1XSOA 3QA3A 4GXFA 4QTHA 4JRYE 1KWKA 1KCUL 1P2CB 4O2FB 1A7PH 4RIRA 5F7YC 1ZHBB 2ZX6A 1LWRA 5IQ9A 2ZOLB 3FO1A 5I1CH 4G1MB 1TPXC 2H32B 4F8QA 1IBZA 3QA3B 1PAZA 3ERXA 4IMLA 2VSMB 4Y9CA 2EYTA 2KL6A 1A4CA 3F58L 2ED7A 4ZFZA 3KYOA 3V4VB 4S10A 2I5YL 1DQLL 4KPHL 1JP5A 2Y36H 3O6FA 5IB5B 4IBSA 4DN3L 5TGBB 4ALAH 3K6SA 4EZMA 4DAGH 1ZXKA 2GTZB 4WO4A 1NCDL 1NUFA 1NZRA 2JTYA 5T3ZL 4L4TE 5KVGE 1KCLA 3BAIA 3A22A 3OB0K 4P3CL 2VRKA 3N04A 1S9YA 2QQLH 5D7IF 4JY4A 3QEQE 1LEKB 1HCZA 3X3GH 3JWNH 3OX8A 3PHOA 5C0BE 4MXQD 4O02B 1NAKL 3RKPA 3EXLA 1FC2D 1X4ZA 3KJ6L 2AV7B 4MNGE 4DP0X 8FABB 1AS8A 3KL0A 3W9DB 1IU1A 3CBRA 4XMPL 2J57A 4X4MA 4LLAA 2FX8L 1MRDL 4NB7A 4NENB 3TEUA 1EAJA 2PLTA 4PWFA 5KSAC 5IM7B 3FRUA 4N1EA 3WFHA 4LKXB 2YA1A 3RZWA 3GIZL 3N3EA 4DK5A 1T2QH 1HSAA 1KCWA 4JQIA 3ZTEA 4G8FB 2AV7A 2QTEA 3QORB 3W9DA 3D51A 4M8RA 5HYJA 2FX7L 3FQWA 3KBHE 3IGUA 2FJUB 3LIZL 4GIAA 1HHKB 4PGDA 2N1KA 3AQXA 3EDDA 2E59A 2Z34A 5C0BB 5I26A 1GYWA 4NLAA 3O81A 3K6IA 1PEZA 4YXKL 1IGYA 2VM9A 2B16A 3UO8B 2EKSB 3IJYA 2OZ4L 2ZYRA 1I8UA 3MO1A 3NG5A 1YYLH 2PP8A 3IMSA 4UINL 4U6HB 4QXGL 1UZ6F 3UPAA 1BXVA 1MFMA 1RQ5A 2A74A 2LT9A 1N19A 4LEEA 4NT6B 4ZSOB 3V6OA 1ETB1 4ACTA 4F7MA 3VRIA 3V79C 3AMKA 3IPFA 2VUYA 2YUXA 3MV7A 3ARFB 2FATH 2FQFA 1AO7E 1VACB 2IC2A 4KJWC 3ROOB 3IU3B 4BKLA 3GSVA 4XMVA 3WE6A 2E75C 3KL3A 3JTTA 4A7TA 2BW5A 3GIVB 3AROA 1BPLB 3IFNH 2D7TL 3CNKA 1BBDL 4CADB 4TYUA 4KKCC 1N7MH 4EIGB 5E9DD 3S2CA 3RB5A 1MNNA 2X44D 5E1AB 1MQKL 2VL4A 2ZSVB 2X4SB 2C1OA 2R83A 4P23B 2PCPA 1I8MB 2WV3A 3L16A 4X0KA 1F90H 1U95B 1QUNA 2VXSL 5KG9B 1JK9A 1BBJA 1DE4A 4QNPF 4EDWL 4ZFOL 4CMHC 4BFEA 3L4CA 4BIKA 1L9NA 4I9WE 3VFNB 2WYZA 1HHIA 1YEEL 4KRPC 2CBTA 4YDMA 3U7WH 3MCLH 3C60B 3HE6A 4E9WA 1JXJA 1Q4NX 1E4XI 5BQ7A 2HWZH 3P9MB 5KVEE 5FGCB 1KELH 4EI0A 4NN7B 3I3BA 1PDKB 3PFQA 5H94A 4PBVC 2VDLB 1BF5A 5KYUB 1OGAD 1RY7B 4XN9A 2DBJA 1Q38A 3P9LA 4H25B 3ME0A 2DTMH 3O2WH 4QHMA 5C0GB 2BNQD 2AJZA 3DETC 4U1MA 5D9SA 3EH4B 3U0TA 1MCPL 4XN7A 1TIUA 4TNVF 4U1NB 4FG6C 3VH8A 1ADQH 4MYPA 3Q5TA 1CCZA 4FL4B 3K91A 3AQDA 1G7IA 1E4XL 4GMSL 1YEGH 1A4JB 5I71C 1CL7I 4M7KH 4MNGA 1TT6A 4OLXH 1KDJA 1HZLA 4JZNA 1P0SE 5SWQB 3OAZK 4X4ME 1RMFL 1O5DT 3FTWA 4QO1A 3O41A 2GJJA 3VRJB 5K1VA 3V95A 5IJVB 2VM3A 3A4AA 1BD2E 3FZUC 5GXBB 3TEZA 4YH6A 2P5ED 2CKBA 3ECBA 1KC5L 2BVYA 4X6CA 4EZLA 4K71B 2OMTB 1I7TA 1INDL 3WENA 3VGEA 5I76A 3DHMA 2DM7A 5F9JB 2VH5H 1FG2A 1QLEH 1SEBB 3CH1A 4WFGE 4XXWC 2YUVA 5DEFB 5INDB 3BKCH 4BQBA 5CGMA 5K9QI 2VJ8A 1BW8A 2QLVB 3QG7H 4K3HA 5HSFA 3EF4A 4DEPB 3OGCA 4OQTA 4FQCL 3BUTA 1FG2B 1OM9A 3MV7E 5GZOD 3QNZB 2YPVA 3FHEA 1N5AA 2CCWA 3QZBA 1N8OE 3K3QA 5I1EH 4WIQA 5T1DH 4LCIH 2D3VA 1G6RB 1P4IL 2WXQA 2EC9U 4XPAL 5C07A 1J0HA 3OPUA 3IFLL 1DUZA 4NRZA 1E40A 3FUFA 2BVOA 4F7PA 3VWKD 1Z9MA 3AM8C 1HILB 3IWUA 1U8CA 1UEMA 5AAWA 4KX8A 5IQOA 3MI6A 2PXYB 1K8IA 4QHLA 3QUMH 4HX1A 4M8QB 5FO7A 4NIKB 4JPSA 2YAPA 2WVSA 3HBZA 4OJEH 3KDMB 2X28A 4ZDHA 2B8OT 1YEHH 2ITEA 3A6CH 3KYNA 4JDZA 5CILL 3LKRA 4J3OF 3S37L 4JZOA 4QKXB 1N6QH 2X2YA 1OTSC 1BVZA 3IDXH 4PLOB 1UYWH 2Z31D 2ROXA 3E6FB 3I2CH 4OIFA 5J11B 5LJYH 2JB6B 2X70B 4WO0A 1JI1A 4XI5D 3O4OB 4GJTB 2F61A 5K9JL 3CFDB 5EUKB 5ESAB 1ASPA 1FFPB 2CUMA 3NCMA 1MWAL 3S8WA 3HC4H 3LPWA 1NBVH 4JO4L 1QFWH 4PTUB 4XMZA 2O72A 3AWFA 2HB0A 2W9EL 4KUCD 4N0RA 2BSCA 3BQUD 1MZYA 4HUNB 4LLUA 4YE4L 3RNQB 5C2UB 3PNRB 4TNWF 4GRWH 3L17A 4FXKC 1HK6A 4UT9L 3C5JA 2CHDA 4N2FA 3ZR5A 3UTSE 4Z9KB 1IBDA 4NDMB 3F01A 4AYSA 1B3JA 1GJIA 1A14L 5FO8B 2DWEB 4WK2B 2E7BA 3E3QE 3QIWC 4MZIA 5CN2A 3ZT6A 5IFAL 1OAZH 1EO5A 4Z76A 4RA3A 1UG9A 5EOTA 2A6IB 2WO2B 5ID1B 3FH8A 4X6CE 1HQRB 1R3KA 1ZPLA 2C3XA 4FNTA 1MCLA 5T3ZD 3F7VA 1A7RH 1DEEA 4XZ4A 4YVUA 5J11C 4ZO7A 5IV2A 2JH2A 1G1KA 3EZJB 1PZ5B 2A5UA 2IDTA 3K1KC 5DJAA 1OCCB 3MPCA 1BM7A 4PRDB 4MNQD 2EDLA 3NIDF 4MJ6B 4ATWA 4NERA 4WSKA 4DPBX 1XGQB 4FTDA 4XPBH 3WU1A 4R0LA 1BFOA 1XMWA 2FEJA 1BZ7B 2VLRB 4Y2OA 3KPPA 1AKJA 1ZRUA 2C7FA 3DX0A 4TQPA 4JRXE 1KEGL 2IIJA 1ZEAL 2WLYA 3SGDI 3NDZE 1QYGH 4XBEL 4P5TD 3ISYA 3UJIL 1XGQA 3KPSE 3OHXA 4H8WH 1T0MA 2EDOA 4S1QL 4YDKH 2VXSH 3FN0H 4NKOB 1A2YB 5CMAB 3VD3A 2GIMA 5KSUB 1EEUA 2Y5EA 5DGRA 4JR9L 5ALBL 5IB1A 4HALA 4HOZA 2B20A 4Z8FL 1NUDA 3E2HC 2R4RH 2F53A 3UBGA 2NY3C 1CLYH 4YZWA 1P5VA 4OCRL 2DJ4A 3LD8C 4RFOL 5FDWA 3REWA 1XGPA 4G6JH 1LNUB 3ZK0A 1FDLH 3F85A 1HKFA 5J13C 4OSUL 1GYUA 1PD0A 3Q8AA 1SJMA 3H3PL 3KWWA 2L04A 3L9RB 4QRRA 4Y5YA 3TBCA 4AVHA 2ZWNA 3IFOB 1YC7A 4GSXA 3V4PA 4PY7B 1YEKH 1MHCA 3ZGHA 2VDNH 2QPEB 3OC8A 5HTSA 4QRPA 5E8DL 1A1NA 3L2NA 3LB6D 1XF4B 3SDXB 3I02A 1GRWA 2DQGL 3VCLA 3W11C 4FP8H 4JK0D 1VGKB 3QI9A 5AVTB 1UASA 4KU1A 4XE5B 3NFNA 5AW0B 1AVAA 4TF4A 1F11A 4OZHB 2V7HB 4OLYH 4D7BA 3JVFC 3QUYC 4JB9L 2IQ9L 1MCJA 3PWPD 4WQOA 3AG3B 4DW2L 3FHQA 3IU4L 5BV7H 5IVXB 5I6MA 4TVUA 1RUPH 4Y4KC 1KJMB 3QDGE 5DD5H 1JGLH 4YC2B 5HHXH 4NAQA 2YPVH 3HPLA 5IFHH 3EYUH 1FORL 1PKQA 1KF9B 4JFPA 4UNIA 5EZIH 1FSKB 3IKCB 1CF1A 1PZCA 1S3RA 1KTDA 4Z95L 4JDVB 2A73A 4XN2A 1H6FA 3EYUL 4N0FB 4LBEB 2YN5A 4N2AA 3BOVA 1JNLH 2VYRE 5D7LE 4QYOA 4DETA 3S96B 4F58H 4TVPE 3MV8D 3QDMB 5F1NA 3UC0H 4IK7A 1JGDB 1VDGA 1U8HA 5I1AB 2XQBL 1MWAB 4K5MA 2A73B 5KJ7E 2FUQA 3B6SA 2WOYA 3LSOB 3SY0A 3IF1A 4YHPB 3OSVA 4DTGL 3ASNB 1X4XA 1MLBB 1UA3A 5JHDA 2VMFA 4DCQA 4ZMQA 3MRKA 4FQPA 4NN6B 1JZ7A 5HI4D 4LB8A 4BA8A 2J1ZA 4MMXB 4BH8B 2DI8A 4H1LB 1IGJB 2WZ6A 3VFMB 3TZVD 1KPUA 2UZIL 4J3UA 2HH0H 4WCYL 1QWUA 2YWZA 5IJVA 3C5ZA 1KGYE 1VA9A 3FB6A 4HMDA 1DQJA 5JLZA 4ZOCA 4KX7A 1A6VH 4L4VE 4HKXB 5IEKB 4HJIA 1R46A 1AZVA 3ARDD 3CFCL 1I1AA 3BVVA 2W5PA 5T1DL 3LAFA 3IGAA 2JI3A 4PBWD 1W0YT 3H42L 4Z3JA 3BAKA 4LSSH 5C2BL 1KIQA 3LS5L 4JFTA 2EKJA 2CK2A 3AB0C 2OL3B 3MJGX 2CHXA 3WBDA 3BVUA 5F9WC 4PJ5E 5C08B 1PFOA 2BP0B 4RDQF 4WV1B 3DGGA 4NKDA 3CSBA 4OZ4A 3ARBD 3BE1L 4XX1E 4HZLB 5H94B 5ABAA 2G5BB 2ATKB 2M83A 4H8WL 3RU8L 3WHXB 4LNRA 4YBLC 4XP4H 2OMXA 1KGUA 1SLXA 4MA3A 4F57H 2OX5A 1XDTT 4GSUA 4EI5D 4AMKL 5CM1A 5JXAH 3NRPA 3SDYL 1AYRA 3QEHA 4X99B 5HYFA 1P69B 3WFBH 4AV5A 5LXVA 4O58H 3D06A 2VABB 1CE1L 1CZ8L 1U8CB 1YNLL 2Z64C 3QG6A 4Y2DD 2ZOUA 2VZ3A 4N6QA 1H3XA 3LNGA 3D4YA 3MNMA 1HU8A 2OXHA 3EADA 1A6ZB 2CJ3A 1OE1A 4HH9B 4Q74A 4GP5B 1JNNL 5EC2B 5DLLA 3BGFC 3AG2B 2CAKA 3GJFA 2R7EA 1P4LA 5CP3H 5GRZA 1E5ZA 4C56D 4D0CA 3JWNE 2G9HA 1UKSA 3DJRA 3PE9A 4N68A 5IROA 2XPYA 3C60C 5IR1A 2BIOA 4PJ8D 3G08A 1MEXH 5H37H 1M7DA 3L5XH 1AHMA 3ECUA 4HC1H 3I6LD 1IBFA 1MJJA 1NPNA 1JGVL 4YAQA 1IQDB 1HH9A 2ENSA 4P23C 3FHAA 1EBPA 3MXWL 3WIIL 2FJHB 5D7IA 2X4PA 5E99H 1IKNC 3U36A 1N26A 4YX2H 1IIKA 2G60H 4OAWB 3ETSA 5FS5A 2JE8A 1ZS8A 4EXKA 4OD2B 5I8OH 5LBVA 1NAMH 2ZG1A 3UBXI 4HU2A 1CVSC 3FUEA 3CXDL 5HY9A 3Q7JA 2IPKA 3OR7B 2AQNA 1SHSA 2JKNA 1LDPL 3OKKA 1PS3A 5B7FA 3Q05A 4IS6B 5DK3A 1X5ZA 2I07A 2YD4A 3S8FB 5CZRA 4JUSA 1UYWL 4MS6A 4CKQA 3DMMA 2XTJD 3QJRB 4HZ1A 5EOCJ 3QEQB 5C9JB 4DPCX 3NJMA 3HAEA 4OJCA 3IGKA 2HXAA 4PRPE 1BM3L 3NEEA 1HWHB 4LL9A 5HGDA 2AI0H 4PRIA 2GABA 3SIKA 1SMOA 5I6XB 2G5UA 4WY7L 5LGYA 4OGYH 1CFVL 3HS0A 5DD6B 2XKNB 4AZ8A 4J1UA 1JI2A 3UG5A 2X05A 4AVIA 4NQQA 2D3JA 2VLLB 1HI6B 1C5BH 4KKBC 1DBKH 3MUY1 3PL6A 4PJ5A 2WJ7A 4PRHD 3E6FA 4UINH 1CXHA 5C6TH 2Y3NA 3HG5A 3ELAT 3HMXA 1W0WA 2DF3A 2VQ1B 1QPPA 3G6JE 3L9YA 5C0EB 2Q7AA 1JPTL 4OLEA 3OHMB 3SBQA 3K2UL 2HJLA 3QR0A 1HXYA 2PYEE 4LU5L 4IHBA 4L8BA 1C5CL 1JN6B 4W6WB 4PJCE 3HZKB 4ZX6A 4PVNA 4NPYB 5H4YA 3THML 4YPJA 1YY8A 3MGOA 2UZPA 2FX8H 4TVPH 15C8H 4NUJB 1K3ZA 3TEWA 4OD1L 4YXLL 1NAML 4LL4A 1JS4A 3KDPB 4FZEH 3RVWC 3VXMA 1Q0YL 1TZIA 1X9QA 2J2ZB 5B1JA 3BRGC 2VNCA 2NY5H 2C26A 3HZMA 3ZZSA 5C9KA 4YIQB 1OTTD 4EOWH 2DRUA 3M7FB 2IFGA 1S5IL 2YWYA 3NJGA 5DSCB 1YDPB 4A63A 3KS0J 5EBMA 4J12A 4X5RA 4XNXL 4DFIA 4XBGB 3VGBA 1YQVL 1N18A 3MCKA 2ADGA 4ZFQA 1OSYA 3ZTJH 4LP4A 2E7LA 3W9EB 4PTTB 4I8DA 4LOEA 5EEYA 1ETA1 4YL4A 2FYYB 1BIIA 3RDJA 3I85A 2FSEB 4IDLA 4F8TA 5BXFB 2ODIA 2Z93B 4XBPB 2K45A 3WUZA 5C0BD 1MCNA 3V7AE 3VGGA 3KLHD 1KYOK 3ARWA 3GMQB 2PO6D 4AT6A 2V8LA 1N67A 1JNNH 4ZK8A 3O9WA 2Q8AH 3WLWC 2J4WL 4LEBA 5BVJA 5E2TH 3QEGH 4YSSA 4MS8D 4QRUA 5D1XE 5KBDA 3QUZC 5CCHE 1PJWA 1FH5L 1NC4A 1H6TA 3BESR 4O4YH 1G5AA 2Y6TE 4NKQB 2YXVA 3QDHA 4NC2B 4JFWA 4QHMB 5GSRA 5C0GA 2AJZB 4WFFD 2H6PB 3RX5A 3ULUE 4NZDA 1DSWA 3ABLB 2WXNA 4DGVH 4QRAA 1TOXA 2ZOWA 4Y2DB 1L0QA 4CN4A 5CZKA 3VYNA 4FCHA 2EUXA 2WC7A 1CPUA 1G84A 1O7SA 4N5UA 5F0LB 3S96A 4P46B 3G6AB 3ULVL 1MQKH 3WJLC 5DUPH 2OTUB 4PRHB 4KO5A 5HDQL 1RLWA 1PNDA 1HJCA 2VRAA 5JTWA 4Y2DA 4OFVA 4RAHA 4EMZA 5TPWL 2WOBA 2ZCHL 5JOPD 3IAGC 2PXYD 4ATTA 3BVNB 4NGHH 2DMBA 4LSTH 1GKEA 1NFKA 1JYWA 1T66D 3QPQD 5ANMA 2Q87A 4LGSB 4G6MH 4IBYA 4QRQB 1CI3M 1KXTB 2EYSA 2OMWB 2V9TA 5KVFH 2HP4A 3T3MF 4Q6YA 4G8EA 3QIBD 4PSPA 2ZYSA 3IDJA 3VMPA 3EGDB 4HYTB 3ZHFA 4I9WD 1SY6H 3W1ZA 1F11B 4WAFA 4KTDL 4OZHA 2IWKA 5ANMB 1BGXL 1EXHA 3L54A 1NDGA 3GUFA 4PLNC 3N85H 4W70A 4ZMTA 1FWXA 2BNQB 3FYIB 4LEXL 4G8EB 4GG6E 4TNFA 3DBSA 1IAOA 5I1HH 4PGBA 1UWXK 4U1IB 4MSWB 5DI8B 3KPTA 4HIHB 1RKRA 1A5FL 2KZWA 5A6IA 2F54B 2VAAB 2WLJA 2AQPA 4NO3B 2JQMA 5CJ8A 3SPVB 3MU3A 1SY6A 4OCWL 3O3DA 4WNQA 1OARL 4YBHA 4TSBL 1CB4A 2QGDA 3NJIA 3ZQWA 3FB5B 1IZJA 4RDBA 4ORZC 3WY1A 5CJXC 4EIZC 3QIUA 3MRRB 1HZHH 2V2XA 4UM8A 4GQ9L 3A6BH 1JZFA 2Y4SA 3S35X 5KZCB 2Y6SC 3WXWH 1OB1A 5D7SL 3DWTA 1NLBL 4IOFD 4P3CH 1AOZA 3FNKA 3GZOA 3QR1A 2IDCA 3ZDYB 3M1OA 1KIUB 4QRFA 4CVZA 4F91B 5JZ7C 2K3HA 2WXPA 3P73B 4XN4A 2NY2B 5DR5H 5AFAA 1SLWA 4I3RL 5KYUA 8CGTA 5IFJB 3QC6X 1PG7L 2Y1YA 1JWMB 3HMXH 3WTUA 1EERB 4GKNA 3ZN6A 4L3EA 2YAFA 2VDOH 1A64A 2K4WA 4ZTPH 1J12A 4FHKA 3WKPA 3WELA 3COOA 5D6CA 3DECA 5EEZA 1ZDSA 3ZDWA 3AREB 3SDDB 3VXSB 5AB1A 5GRYA 4KUCF 4FYQA 3VXPA 4BFRA 2YEQA 1M53A 1I9EA 3I74A 2LV4A 1OTSD 3CHQA 3QJHB 2AK4B 2VW7A 1ZLVK 1A6WH 3I6KB 2IPUK 2QGEA 3HLAB 4XPGH 5DHDA 3VRIB 2P5EE 3HE7D 4ZUWB 3CMOL 3PL6D 3VFGL 2WZPA 3SOTA 4APQB 3DPBB 4M7LL 2MTAA 32C2A 1RIUL 3EYFB 2ESVB 4TPRL 1ES0B 3QNXA 4N8CL 3EYVB 1GMIA 3GK8L 1L7IH 4EUPA 2O6DA 1HAWA 4NHCL 3TA3C 1V3KA 1FL5B 3JSSA 4R83A 4RIRB 5LAXB 6PAZA 5ICZB 1ZSHA 3R06A 3QDJE 5T3ZE 3OR7A 3TWCH 4M48L 1NBYA 5E70A 2NX5D 1RPQA 2ZSWA 5E7FA 2OL3H 2X2JA 4OZHE 2CGYA 2K6WA 1IKFH 2ICEA 3EJZD 4KBPA 1Z9NA 3EYOB 1NOLA 1TJXA 1NFAA 2EE6A 1H3PH 3G5YB 5SWZE 1SJEB 4HFUH 1A7QH 2YRZA 1T22B 3L4UA 1IC1A 3QJFA 5FCUH 2YD8A 2UXVA 2BY3A 4GW5A 5TTRA 1WO2A 4NQSB 4LRIC 3BKJL 3RFZA 4JPKH 2DZEA 2KQMA 4MDIA 3SGJA 4AZ8B 4JQVC 4J4PA 1XCQA 4QTFA 1EEYA 4WSJA 4FQXC 1I3GH 4QHLB 1MSPA 1H3WM 4YSRA 4PCYA 5F88A 1HWGB 4LVOB 4UCFA 5SWZB 5ICYB 5J5EA 2X87A 4JDZB 4L4VB 3LKRB 1IGTB 3MZTA 1AHKA 3A6OA 3FSAA 1EEYB 4IMKC 2D31B 5FYLE 1R24B 1U3HC 4MB3A 2ZPKL 2X9ZA 3LNIA 1MIML 4OCXL 4PWHA 4RISH 5EBGA 1Q0EA 1SYVB 3VFTB 3ARDA 4H20L 4Y7OC 5DFVC 4R5VA 1TVHB 1YJDL 1LD9B 5FYKH 2F58L 3GMPA 2J8UA 3J27A 4HLZH 3F7QA 3KNBB 3UG4A 3V6FA 3TPUB 4ABUA 1NBZB 2R0LL 4P5MA 3BMWA 1KV3A 3H9HA 3ZDYF 3VM5A 3WJJC 2IBBA 4FNLH 3VXMB 1GZQA 3CIQA 4A66A 3VO0A 1AIZA 3Q43A 3MRMB 4M1DH 3ZMRA 1MJUH 4FNQA 3WN5C 5T3XH 3T77B 5IB2B 2H3NA 3HAEG 1FAIH 4IDJH 3OMZA 5DEFA 1F18A 5INDA 1WTGT 4TVPL 5HHOE 1PLGL 5E5MB 1HL9A 3R1GL 5E08H 4PIRF 3JQOB 3HZVA 4DWHA 2OQJA 2JKRM 2UY7B 2OPCA 1BXXA 3MRNA 2BP5M 4W9HC 1Z5LA 2P5WB 3RTLA 2PYFB 5K9KA 1A4BA 5GS3A 5FKAB 4EKJA 1CGYA 4XZUA 4NRYA 4WRLA 1DQMH 4XP1H 3IDXL 4BZ1A 3C9NA 3ALXA 2P47B 1QRNB 1JGIA 2H47C 2JSFA 2VQ1A 1OCOB 5KYXB 3NCYP 1XD0A 2IXQA 2EDMA 4QCIB 3TF4A 1ONQB 3F8UB 4XOEA 3Q2VA 1VKXB 2WGNB 2GG1A 5DT1L 2R2HB 3HE7C 3IDIA 4GEJA 1G6RH 1GH7A 5F72S 5DEZA 3DVNB 3DTUB 2VXVL 3H85A 4JHAL 4QY8B 1I7ZB 2LABA 3NIFF 3UBFA 3MA9L 1AP2B 1WFNA 4OUOA 2XETA 2X1QA 4RFEA 5E7BA 3GO1H 2A9MH 3VI3E 4DZBA 4ZNEE 1L7IL 4WW1A 1A3LH 3IAQA 4MMZC 1I53A 2NY2D 3UTPD 4ZQTA 2BFVH 4N8CH 3QO1A 2WKOA 4R8WL 3TO4C 2AJYH 1A2YA 5CMAA 4YEEA 4FE9A 5HVHB 5AAMC 2XUWA 4J6RL 3VFGH 3ZE1B 5KSVA 2X41A 1KJVB 4XVSL 5GZNA 1LDPH 3GI8L 1CDJA 3U0TB 1FZOA 2EIMB 3GDBA 1Z3GH 5ICXA 2FBJH 2Q8BH 1I3RB 5EOCH 2AJVH 2P8MB 4TV3A 2YS4A 5I0VA 4GW1A 5GRUH 1U30A 3MLTB 1ECYA 4DT2A 3B9VA 1G7JB 4OJDH 5BZDB 5T3XD 2ADGB 1OAXL 4KC3B 1B6UA 4J3SA 3N9GH 4OLVH 2TRHA 2XQ0A 1X3DA 1ZV2A 2IFFH 2VDLH 1M9SA 4RGOL 4I3SL 1W6WA 4ILDA 3ZMNA 4CC4C 1BWWA 3US0A 1AGEA 4ZTPL 4EJ1C 1WGOA 1GGYA 5BVPH 4NUPA 4BE6A 4E9XA 1WEJL 5FYJU 3TS8A 4NO5B 2BH0A 5D5ME 5K93A 4L2YA 5CJ5A 1R3LA 2MH4A 1V3MA 3FB8B 4WTXA 3HE6C 4X0KB 5KSBA 4AH2A 2RGSA 1HOCB 4DGIL 4NO0D 4HZLA 3RWGB 2JLLA 3IMTA 3L7FB 5AW7B 4QOKA 3UAFA 1QSVA 1W8EA 3D2UB 3N42B 1KDIA 2NQCA 1IFHL 3LPGA 1RJCA 2O6EA 4PV1C 4R90H 4AGNA 5CHNA 4LARH 1HCYA 5DHXB 3NJFA 4PJ7F 1OD9A 3MUHL 3L5WB 1T3FB 3BZFA 1GS6X 1IC4L 4XTRC 3VX0A 1R5VB 4Y16A 4EE2A 2OTUA 4M5ZL 4PRHA 2FWOA 1FI8C 3MROA 1QHPA 5I1HL 3ZZLA 2VERA 4UZGA 3LN4A 4KMTH 1KY7A 4R7NA 4F3FA 3LN5B 5JPMA 3RWFA 3UBXG 5JHAA 2FE0A 5KSUA 2F53D 2ZKYA 4LCYB 1RHHB 3OX8B 3PHOB 5FOBA 3VWKB 1TZ8A 3GRBA 1SJHB 4AYDC 3BKJH 3DVGB 4E9TA 3P0VL 4FI6A 3JV0A 1A6TB 4XXWA 1RK1B 2DYSB 4PIBA 2NY6B 2NLJB 5BMFL 1JPST 3DX9B 3ARUA 4Y4KB 5FCUL 1A6PA 1F13A 3RVXD 2EICA 1TJIL 2HSIA 4EUPG 4MRCA 2BSTB 4HFUL 1TLKA 3HB3B 3TFKC 1IC7L 2WB1A 2EH8H 2B1HH 4MJHA 3GS7A 3ARSA 3OAWA 2YC1B 2A1WL 4JKWA 4XOCA 2BWDA 2QVIA 4ICWA 4F7CA 4IMLB 4F8NA 1JNHB 2J44A 2R4SH 4FCAA 2EUVA 1TFPA 4BFKA 3FB7A 2AAAA 4Y4FD 3V4VA 4C47A 4RBPH 1M1XA 1CGTA 3DKHA 3L1EA 2K9FB 1I31A 4ODBD 4G2AA 1EVUA 3ZQXA 4WEMB 4HOMA 5BO0D 4YGVB 5FM5M 1VFMA 1ZVHA 3LRHA 4X7FC 1DJGA 1SOKA 4BRVA 4KKBD 2VDPH 3F6LA 5I1JL 4XCFH 2I60H 3CMGA 2QV2A 5KSBE 2NCEA 1CYXA 1JUFB 1PG7W 4OLZH 3RPIB 3ARGD 3RGBA 3D3VE 1XF5A 1MFDH 4QOKE 1ETZA 4RRPM 1ZV5A 4KRPB 3RGVC 3F64A 3QDME 5TE6L 2GI7A 1U8NB 4A04A 2XIBA 4PRDA 3ZXAC 5DC0A 3VTMA 2OS7A 2BIQA 2YLKA 3FU6A 1YAIA 4D9RD 5HPMA 4K3JH 2YFOA 2VLRA 4HIIA 4LESA 4AXWB 4M02A 4DAGL 3UBXA 4LGPB 4DEUA 1WGVA 2Y9RT 3U2JA 4YO0B 1SJVA 5AW8B 2IV8A 2JTDA 2CIKA 2Q20A 4G6AC 3MLYL 4PRHE 1SQMA 4XVTL 3HLAA 3GXTA 1R1CA 4FP8L 1T0NB 2FWSA 1YPZE 4F8OA 2NY7L 1OTTC 4LLUB 3E6HB 1BVNT 3RNQA 4PMEA 1E4HA 1RUKH 1ZPUA 2BDNL 2L4OA 4G8GD 5AUMB 1RULH 3ELQA 4TUOA 4WWKC 3RY6A 1X9RA 4PJAB 3T3PE 4J6IA 4EI6A 1JCKA 3BPLB 4RRPG 1EV2E 4GUPB 1KGWA 2O5XL 5LAXA 3D30A 2LQRA 4R5XA 4XN5A 3WS6C 2X3BA 3M8OH 3WJMA 4N20A 4DUVA 1IKOP 4L9LA 5EB9A 5IEKA 1MLCB 4U6YA 5DDHB 4CL7A 2N56A 5K69A 2BNUA 3WGVB 3ZO0A 2WWNA 2QQKL 4ELMF 2WN2A 4HCRA 3EH5B 4LCWB 1P4BH 4Y4HC 1U2CA 4PBXA 4M3KB 2AXHA 1JPTH 2IH1B 1UKTA 2VXVH 2AQTA 2DM2A 3CDFA 4FG0A 2GSIB 3SYAA 5HHPB 4ERSH 5D1ZB 4HHAA 4I1NB 4L4TB 1TU2A 1XIWB 5HI3C 3RVXC 4I1PA 2CNZA 5E00B 2YARA 2C9SA 4OFPA 3TPKA 3T6WA 2EDFA 4X0NA 5C6WH 1PZDA 2BRRL 1EWHA 4G8IB 4PG9A 2H6OA 2XY2A 3DX8A 3P9WB 4C83B 3MRQB 4E42B 1QSFA 1X7QB 3QPKA 5IVNA 3FO2A 2PWGA 2ADIA 1AD9A 3DIFA 2CU9A 3MODL 3OKLA 4ZAKC 3CFBB 3O11B 5F3BA 5FHBL 1HCFX 3L4TA 5DQJA 3QJZA 2ZG3A 5HJGA 3SE8L 1WZ1H 3DX8B 3R1GH 3MLRL 1BFTA 2DIAA 1G6RA 5E6SB 3WLWD 5C07B 2BWQA 2JNZA 3T3MB 3EDKA 2JIXB 3QUKA 3UYPA 4X4XB 5GGSA 1T89C 3BUIA 2BO0A 3O8XB 1YEDB 2W0PA 5T3XL 1QSEE 3N40F 4EO5A 1GAFL 3QDAA 2KERA 4P57B 4AIZA 3LNDA 1CC3A 3TLRA 4L8BB 1QLFB 3H9HB 5DHVH 1LLAA 3FRUB 4PEEA 4AUJA 2XV0A 2EVJA 5HPOA 3MOQA 1IC4H 3CFQA 1GOFA 4H26B 3WIFB 2X2IA 3MRMA 4YBQC 4S0TD 5F7AA 1B4LA 4JM2C 1WD8A 3PU7A 3U2IA 3X12B 1M57B 3FL7A 4U33A 4R96B 1FGNH 3B8YA 3CC5B 1MUJA 2ED6A 4MCYA 4X6CB 5T1KB 4F9LA 5GISL 4G3YL 5E94B 1IFHH 4G8AC 3FULA 1NMCC 1U8QA 4WDIB 3OKDA 4ES8A 2YBRA 4X98A 2H2PD 4NHUB 2ZX8A 3X12A 4W1TA 4NZRL 2ADFL 3RVWD 4AM0Q 4QIRA 1G7QA 3FTGA 3QPQC 2EUWA 2LHAA 3EFFA 1V8HA 4GLRH 4MSWA 1DQDH 2IAMD 4TNWK 1RZKL 2CK0H 2QPUA 2R2EB 5HHMB 3FBKA 4J2XA 4HJ0C 5IGXL 4P46D 3MJ9A 2JFCA 3ZDXF 4HKXA 3VD0A 5DMGD 3HNTH 1YNLH 2PTVA 3VNYA 1SXSA 4ABWA 1K5NA 2V8MA 3HI5L 5LBSA 4W9KC 4K5OA 2M26A 4X6BA 1OAXH 4BFNA 3RJQB 1T5WA 4DGYH 2AEPL 2YZ8A 4IU2A 4KHXH 4DFHA 2JELL 4MJ5A 4X4ZA 3V6OE 2P45B 5IEHA 1CURA 1S7UA 4LHUD 1EK3A 2H8PB 5EOCL 3RL1B 1IKFL 5KG9A 4ENZA 1JZIA 2R2CA 1ECZA 4QYOB 5I8EA 3Q3GA 4WO4D 3GM0A 1RZFH 3GXPA 3W38A 3LN9A 5IBTH 3QJTB 4H88L 4M6MH 5LXGL 5DJ2A 4F2ME 4MQTB 3X17A 1HTYA 2H6PA 4K9EL 4TN9A 4B3VA 4XPAH 2DYRB 2GK2A 5DS1A 3MGTB 4XNQB 2NT0A 2HFTA 3GZQA 3CFJB 4FQXD 1P53A 1YEWA 5BW7A 5I8KH 2KQNA 5HHVL 2E4TA 4MA7H 3EXJA 2OTWB 1BD2B 3ECWA 5I30H 2CBMA 4Q8BA 3GYRA 4MA8L 3ZGIA 5B8CA 5EV7A 1S9VB 3GB7A 2DJSA 4KKLD 3SGDH 3U6RB 4UMGA 2ZCZA 5J8OA 3RG1C 2HRGA 4HKJA 3SJVD 3B34A 1F3JA 2JI2A 4OCNC 5GGVY 1O9VA 3VVVA 1CBJA 1S9WB 4UOW0 2D7QA 3ZE1E 1UD2A 5D7JC 5F9OH 4DTGH 2W95A 5HGHA 1NCIA 3TA3D 4PJXA 3K2MC 4ZO8A 5GGRA 5HYQA 2AHIA 4Z23A 1BVLB 3P4MA 2OMTA 2V37A 1DBMH 2YC1A 4PJHB 4WV1A 3L3OC 2W9DH 4A7GA 1MCWM 3MSPA 2VC2B 5CLYA 1MPAL 1AZNA 2ZSWB 3UMTA 4XNMB 1JYXA 5E2WL 1NLBH 3V4PB 3W11D 1A02N 3FO0L 4PRBB 3C2SA 1I8AA 4G1MA 1B88A 1KB9K 4LSQL 3T9WA 5T5NG 3OKOB 4ZRGA 2X4OB 3H6JA 2OXGA 3GLZA 3TCLB 4F7KA 4KI5C 4N2KA 5DD5L 1FN4A 2XI9A 4IW4C 4KQ4H 2R2BB 4PLJC 1VCBC 3ALPA 4D9QE 2DQJH 5TFSH 4EVNB 5I6XC 3A23A 5IROC 3AJ7A 1ZT4B 3S34H 1PZ2A 2L3BA 3B56A 1QW8A 3C60A 4XC1L 5E8PA 5BZXA 2NNAA 5EC2A 1XFPA 4FNPA 1OW0C 3V0IA 1M71B 2GTZA 3VQLA 4NZTL 4DQAA 2QADC 2BRQA 3ZDXB 3DOHA 3EFDH 4JG5A 4NQTA 4F27A 2ED8A 2K7QA 1GYCA 1TZHA 1ZHNA 2CLZA 2A9AA 3LB6C 5DHYA 1UD6A 4JDVA 1PD1A 3QUZB 2P5EB 2IEPA 5HI5D 5D5MB 3QGVA 5KVFL 2BOLA 4O58L 1BAGA 4F2MA 4UANA 3QYNA 2V0AA 1QNZL 3T0BA 3ZIYA 2QFRA 1BYOA 3H7LA 3UP6A 1SDYA 1DZ0A 3D9AL 5F3HB 3UTSB 2XN9B 3HZYB 4NRXB 1J0ZA 4B7IA 4XHJD 2NQDA 4OFDA 2AGJL 4XWOC 3OAUL 5G4NA 1EJFA 2EXYC 5LB1A 4KZEL 4BM7A 4WFED 3HG4A 3TNMB 5I2IB 3VXTA 4HEME 5CEZH 2DQ6A 1SDAB 1A9BA 4HJTA 5EWIL 3WKMH 1MFNA 3GS0A 1J11A 2UUDK 4L9LB 4PV8B 1LJMA 2NXZD 5LO7A 2A74B 2W81C 1JJUA 1SLVA 3I75A 1G7HB 1PU0A 4JDEA 3FB6B 4M6NL 3S88L 3T2LA 3IM1A 5AVRB 1KYDA 3G6DH 4UQ9A 2K3TA 5DJZB 4AJWA 4WFHD 4WI8A 3IE4A 2P46B 4IM8A 1FYTB 2UXFA 4OGQC 1OF2A 2YOAA 4TM9A 2XN2A 1A6WL 5D2NA 3RUGB 3EH2A 3OXSA 1L7TH 4K71C 2MRYA 1FO0H 3F5WA 5JQIB 1G7MA 4QOKD 3HS8A 1E6OL 1T22A 5EZPA 4AXWA 3AXLB 2XBDA 3QUMB 1MG3C 5I0DA 1JK8B 3UTZA 2DQIL 3RDTC 4ZX4A 4NUMA 3TC9A 3FUJA 5ETUB 5GRJH 1MVYA 3I3EA 4MDIB 2GI0A 4JG0L 1INQB 5KEZA 3NIGF 1YN7B 3HE6D 1P7QD 1BHGA 5EO0B 1AHWB 3QJOA 5E9NA 3CLEH 2ARJQ 3A5VA 2VXTL 3KDMA 4CDGC 4HIXH 2X9WA 1E5AA 1KXHA 4HIEA 3HC3H 3MLVH 2CG9X 1ACYH 3BDBA 1KCSH 3D05A 4FQXB 2DQTL 2Z1PA 3HI6L 3IN2A 4HK0A 4JFEE 5I19H 4XGZB 1BYPA 2A0LD 1NPJA 4IHOA 2Y5TB 3TEXA 3DX6B 4P5TC 3OKNA 1MFDL 1YECH 1FLRH 2TAAA 1U6AH 3A6BL 2H6UA 3IPEA 3ZSSA 3VQ1C 1K85A 4J8QA 5I15L 2VDMH 4OF8A 1T80A 2J5LC 3VGFA 2H26A 4FXKB 3ZR6A 4YSOA 3MJ6A 2WKGA 4JRXA 3IDNA 4S1DD 4JFED 3NPSC 5DD3H 3RWCA 3VSUA 5HHNA 4B0MB 3BVNA 4MJIA 5JXEA 3SE3A 3BISA 1NKRA 2GSIA 4LHQB 3N1QC 1J1OH 3O4LB 4Y5XA 4WWPA 3MBXH 4PG2C 4L8CB 3LH9A 3MHZA 1DVYA 4DKAA 1RJYB 4EEEA 5C92A 1U8LB 2IDQA 1AE6L 3CN3A 5IB2A 3LXAA 3O9WC 2YGOA 2A7BA 4PY7A 2XQYG 3FTGB 3GQFA 1L6XA 4LLDB 1UVQA 1JERA 2Z93A 4MD0A 1S5HA 3PWNB 3DETD 4GKLA 4WKZA 4D0BB 3F7PC 2G2NA 4FABL 1SY6L 4PJXF 1DZBA 1ZTMA 2ZWZA 3T08A 4AUUA 2ZONA 2YPLD 3ZT5A 1RCYA 3L45A 5K9OA 4Z0BH 1P7KB 1ZT7A 4CVUA 2YGPA 3GC3A 4OSUH 2CRZA 1JYNA 5LKNA 2YMTA 1WZAA 5BMFH 1ODUA 5GIRB 4Z0BL 3RFZB 3P69A 4KKAD 4G6FB 5J9PB 3SQBA 1XH2A 4Y2DC 2GAZA 5I17A 3RE0A 3FPYA 5D2NE 2XA3A 4UM8B 5DJ8A 2DOCA 3KZ8A 1BLIA 3O0LA 3KWTA 4FFVD 3GJFB 4QXWA 3G6JF 5T33L 1FNGA 1ZGLB 2RTTA 4P5KA 5AW2B 3FFCD 1IBYA 4WO4B 4HWNA 4OF7A 1FUNA 3HHSA 3B9KB 5ICUA 2HFFA 1TJGL 1A6TA 1EPFA 3OKDB 3ROLA 3WNKA 3HR6A 2XQYA 1N6UA 5EU3A 3VGAC 3UGXA 1UB5B 1NC2D 4KWUA 1NH6A 1S7XA 4C58B 1AO7B 3ZL2A 1N59B 5JW4R 1ROWA 4PRAB 2YXMA 4V1DA 4WW2C 2HG5B 5D7IB 3U6RA 4CBZA 5J7CC 1NAMA 3WOVA 1TJHL 2CE6A 1RZ8A 4HDIA 1XXFC 5FYJE 4IBUA 1C8PA 3NFPB 1FL6A 3VWKC 1RULL 3RNKB 1ZVSA 1D6EB 1E30A 2NY4D 3MRGB 1PFCA 1T4KA 3N41F 3VXQA 1AXTH 1KIPA 1CLZL 2B2XL 3MRHB 4HZAA 4H1LG 3NSCA 2D7NA 4GOSA 3E38A 3TBWA 4PJFE 4J3BA 2F7QA 4BQ8A 4X5PA 2CGZA 1JHLL 5EIIB 3CLEL 3IGAB 7PCYA 2DAVA 1WCBB 5KOVC 1UA6H 2B1AL 1ZS2A 4MVBD 4NO2A 2VL5A 5I8EB 1Y0LA 3FT1A 1EGJH 2BIHA 4ZSOA 4F7MB 4U1JB 1FYTD 3RHWK 3NOIA 2BOBB 1XR8B 2E7CA 3BW9A 1DFBL 2I85A 3N91A 4Q97A 2E3VA 5GS2H 1WBZB 4YXLH 4J1UB 1XAKA 4I2XB 4RMUA 2NSXA 3B7TA 4ZPVA 1IJ9A 3KCPB 5I16A 1NBVL 1RXLA 5CLWA 5EO9B 2CO1A 2OMXB 1WS8A 4GG8B 3AADB 1AZBA 3JBG7 4D9LL 1JWMA 1LEKA 2QL1A 5AWNL 2DJUA 3B1UA 4M8VA 4WI6A 3VXUA 1JTOA 2QKIB 3ARRA 1ACCA 1HEZA 1QVOB 4GKSB 1BZ7A 4Y2OB 1D2OA 5F1NB 4AYEC 4PLKD 4XCEA 3LIUA 1FZJA 2BS71 3CG8A 5LUMA 5FYKE 1P84K 2I9TA 1LE5A 3SKMB 1MCFA 2ZCKH 5CEZL 1PIFA 3LS4L 2R29L 3GSXB 3JTSB 2VR4A 4GUPA 2HFEA 3CBKB 1F5WA 3HKFA 3MRKB 4X6FB 1ZLUH 4ZQKB 4LFHG 5FOJA 4HFWB 4S1RH 1CFBA 2DQHH 3N6YA 5F2FA 3WS3A 1HNFA 3ARGB 2DKSA 5F7DA 1VRSA 9CGTA 2O4EA 4LASH 4E5XA 1HVXA 2HCZX 5HVHC 1BOGB 1CG9A 2ICEC 4N0UE 4BRJA 3EOAA 5D72H 3MCYA 1WFTA 3MLZL 3PJNA 5I2IA 1RZ7H 3GIZH 1BIHA 5BQDA 3SKOB 5E2UH 4PI0A 3WFEL 3QUXC 1DDHA 3JV4A 2OMWA 4AGQA 1ZD6A 2ZXWB 1VSCA 4PI2A 4BK5C 4JFHD 4LL1A 2EEAA 2NYZA 4YDVB 4TULL 2IALA 4OZGE 5B4MD 3LIZA 1NCCH 2MHAA 1AXSB 3P2TA 1FORH 2DWSA 4JRYB 2ZICA 2AQRA 3EJPA 3CDZB 4LVHB 5D7IE 1MHPH 1F4YH 3HJEA 4GRLB 1ET5A 1OAKL 1YLBB 4WGWB 2R0LH 1SYSB 3KEHA 3E2HB 1M9WA 3QXAA 4RMRA 3F5WB 1Y6KR 5AYUH 1U3HA 4AVJA 2DLEA 2ZX9A 5FYKL 3WG7B 2I5YH 2FD6H 3HE7B 2XFXA 4FQQB 4UQ3B 2FGWL 4MD4A 3WKYA 1F4XL 4BFIB 4DP8X 3CGTA 1AXTL 1NLDL 4WWNA 4AQAA 4E2OA 3GS4A 2QV4A 1FCCA 2G3XA 2IAAC 5TQ0L 4GXVL 2R56L 3Q9QA 2JKIS 3MLWL 2PF6A 3RQ3A 2DW5A 2VZTA 4DGIH 2XZCL 1MFBH 4R7DA 3BP7A 1OB1B 2XNAB 1J8SA 4UQDA 3TZVC 3V5DA 4BQ9A 3MJ7A 4FRWA 4R7VA 4QTIH 3ZHLA 4L1TA 2DKUA 1WIPA 3KNBA 3V6FB 3OGOE 5DC4B 1YAZA 1E9OB 1J1PH 2H0EA 4JFZL 1TFHA 2VB5A 3WN5A 5GJTH 3S35L 4HA1A 1JGDA 2IMMA 3UZEC 5JW4Q 2UXTA 4JO1H 3KWUA 1KB5B 4U3SB 5AB0A 2C4FT 4NNYB 3GSUB 5ENWA 2WK2A 1C7TA 5FO9A 3NUKA 1U8QB 4WDIA 4M1GH 3AZUA 1UC6A 4X98B 3IDJB 5IMMA 2W0FA 1MFEH 1WAAE 2ZX7A 5DJ0A 4B41A 5AOKA 4X80H 1EJ6A 1E9QB 2O5YH 3GEWB 5I18H 4KKRA 4FTVD 4RMQA 2ROYA 4L8SA 5I76B 1TQCC 4C56E 3B37A 3BQUC 1UWYA 2YOCA 4UZUA 4XAWL 2QHRL 3I6KA 4YFLI 4FMFA 3CFCH 5J12C 3VJ6A 5HYEA 1O7DE 1T1WA 4R26L 2AW2A 4XMLH 3VX1A 3SDAA 4NNPH 3FT4B 3IDYB 4TKWA 3BUBA 2L7JA 3MA7A 5B3JF 3QFDB 3K7UA 3MAWA 1HOCA 3SJVE 3GBNL 2EINB 2YHGA 4XPHL 1EFXD 4LLWA 2WYTA 4PV9B 1E67A 2AEOA 3TO4A 2Y7QA 2I24N 1B0GB 2UWEE 4ZJ9A 5KYYA 5IESL 3EOBA 3QFDA 3CHOA 3IS1X 1MVUB 5FUZL 1DEDA 3AWGA 5KAQG 1RUQL 3MNZB 3KPRE 5IFAH 4PGCB 4MDJA 1GZPB 3EO9L 4MA3B 3VQMA 4A67A 4XO9A 4K55A 1W0WB 4ZODA 3V4UH 1VCAA 5L4MA 4Q6IC 2IBGA 4UV7L 2L7EA 1E7VA 4FEIA 3AS1A 1U33A 2UZYB 3MNZA 4H8PA 2NYKA 2W0KA 4FXLA 3D25A 3GXIA 4QXVA 3VXOB 4LKCA 1NGWA 2CXKA 2VZVA 3QJXA 1IAIL 1UZ8B 5K39B 1Q94A 4I0PD 2CBQA 1DBJL 1ASOA 5H37A 4P0DA 2B7DT 2ZNWA 4GS7C 4K7PL 2P9RA 2JKSA 1ZSDB 1HHGB 1CD0A 2IADA 2RA1A 1HZHL 1LYQA 4FYTA 3O8XD 4PJ7A 5E5UB 3F6IA 5B7MA 4HUMB 4XP6H 4ELMB 5DQDL 1XWVA 2VXTH 4HS8H 4OJYA 4G7YH 4NWUH 4LQFH 3ULUH 4ZUUB 5FKPA 3LMJH 3OD3A 1TQCB 3TBSA 1JZ6A 1PMYA 3MRGA 4OTXL 1UURA 3FCTB 3K74B 4Q9RH 4D0DB 1S7TB 4N2CA 1D6VL 2EYTB 3ESVF 2EDRA 2PO6B 2X4PB 3U36B 2PPCA 2OI9B 1GZQB 1Q9WA 4XMUA 2A6IA 2UVEA 2EE0A 2V3DA 5ID1A 4N5EC 3BAJA 3VXRE 3CFKA 3VFUA 5GJSH 5ANME 5IQ9B 1HKLL 4HD5A 3H3PH 4QAMB 1AGCA 1D5IL 2OMNA 5A16A 3GHEL 1XZ0B 4BZ1L 1JHTB 1AD9B 3CHSA 1DL7H 3QJSB 5FYJL 4AEFA 4XZUB 1H5BC 1I4FA 2OM5A 2V3FA 5TH2A 4G8GA 4U05A 2SODB 5ICYA 4LVHC 3U25A 2KMWA 2FIKA 1HSAB 1KJMA 2VLLA 1P6FA 1HI6A 1KIUA 2QKIA 1TQSA 3VU2A 5DLML 3WD5L 3LY6A 3IN0A 1T1YA 3Q8EA 4YR6B 4DK3A 3D52A 3BEWB 4I18A 2LFEA 1ZLSH 1RZ8B 5HDBB 3D0VA 5J1TC 1G7LA 5F44A 1CGVA 3FTZA 1SNRA 4M5ZH 4PVLA 1RJZA 2OP4L 2XDHA 4JDTL 4UOQA 2VDNB 1X5KA 5KS9A 1IM3B 4M9OA 3GZKA 1NBZA 4V11A 2COQA 4Y89A 4EN3B 3EH1A 1H6EA 5ESVA 3U30C 5D55A 1HINL 1OCRB 4M1CD 3CSFA 4GXVH 1S2EA 5EF0A 3OB0H 2HJFB 4N24A 4ZYKA 3M6DA 4W6YB 4P48A 4Y5YB 4NHUA 1ZWIA 4CU8A 4PS4H 3GSWA 2OKMA 3EGDA 1RZIA 5IZ7A 5A40E 4NNXB 4NJAL 2FL5B 4MCZB 3HHMA 2N0KA 3KHQA 3OLEA 1E6JL 5L2KE 3VXUD 2UY7A 4E9YA 2VDQB 2R1YB 2VXQA 4MAYC 3CFEB 3OF6D 1FFOA