4L0DA

Crystal structure of delta516-525 human cystathionine beta-synthase containing c-terminal 6xhis-tag
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
500
structure length
496
Chain Sequence
PLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQMVFGVVTAIDLLNFVAAQERDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystathionine beta-synthase
publication title Structural basis of regulation and oligomerization of human cystathionine beta-synthase, the central enzyme of transsulfuration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 160
structure length 496
sequence length 500
chains with identical sequence B
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4l0dA03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0dA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0dA02
2CLLB 2CLHB 3I8NA 1KL7A 3IAUA 3GBYA 3R0ZA 4D9CA 4OREX 2QR1E 1E5XA 2CLEB 2EGUA 5DW0A 1TYZA 3PC3A 2ISQA 5I7RA 5K23C 3FCAA 3L31A 1QOQB 3VC3A 1VB3A 1OASA 1A50B 3FHMA 3ZEIA 2CLIB 1K8XB 2BHSA 2GN0A 1TJPB 2PFIA 1BKSB 1KFKB 2V03A 4UUUA 3AEYA 2CLMB 5LXQA 2PQMA 3K2VA 4P1OA 1C8VB 5C3UA 2CLKB 3V7NA 2EFYA 2TYSB 3DDJA 4IYSA 3LV9A 2RC3A 5J43A 5B3AA 4LI3X 5J5VA 5K24C 1WTCA 3TBHA 2RHGB 1V71A 5I7AA 2ZY9A 2QRDE 2YVXA 2RH9B 2DH5A 3PC2A 5D85A 1F2DA 3KXRA 1BEUB 3PC4A 2DH6A 2NYEA 5CGQB 4D9IA 1J0DA 3DKIA 3PR2B 5K25C 4I1YA 5EY5B 1FCJA 1A5BB 1JBQA 5D87A 1UINA 4D9FA 1J0BA 1Y7LA 2P9MA 2ECQA 5D86A 5B55A 1K3UB 2O2EA 3KPBA 1O58A 1K7FB 3K6EA 4HO1X 3SS9X 4D8TA 3BM5A 5D84A 1PBJA 2ZR8A 1KFBB 4GQVA 4ESYA 2GN2A 2C2GA 3HMKA 5HBGA 2OUXA 4IY4A 2TSYB 4DQWA 1Y5HA 5B53A 2ECOA 2WSYB 2RIHA 5DBEX 2QLVC 4L0DA 3R0XA 5I7HA 1WBJB 1YAVA 4D96A 2O2JA 1KFCB 1K7EB 1TTQB 3KPDA 2ZSJA 1VE5A 3OI8A 4D97A 5IIPA 4JBNA 4XUGB 3IQHX 4D9MA 1TDJA 3FWSA 2NYCA 1D6SA 4JBLA 5KZMB 1TZ2A 1KFJB 3VSDA 4FXSA 2JC3A 2UV6A 1V7CA 4GQWA 3DWIA 3X43A 5I6DA 1WKVA 3AEXA 2J9ZB 1A5SB 2O16A 5B1IA 3IQIX 4ESYB 2Q3BA 1CX9B 2YZQA 2CLFB 3SS7X 2YVZA 3FWRA 3IQGX 3LHHA 1X1QA 1WDWB 4O9KA 4IY0A 1J0EA 4HPXB 4ZU1X 4COOA 1J0AA 3FNAA 4AECA 4D9BA 2RKBA 2QREE 1QOPB 4GQYA 1TZKA 3L2BA 5DW3A 3ORGA 5JISA 5KINB 4IL5A 5DBHX 5K22B 1V8ZA 3SL7A 1K8YB 4HT3B 4L27A 4NOCA 2UV7A 3SPXA 4ZQCB 2BHTA 1A5AB 4D92A 3T4PA 3FV6A 1XKFA 2QH1A 4LMAA 3KPCA 2OOXE 2CLOB 4HN4B 5KS7A 1VE1A 5E0KB 4D9GA 4FRYA 2Q3DA 1FUYB 5IW8A 1CW2B 2Q3CA 4F4FA 4ZU6X 4NU8X 1K8ZB 2D4ZA 5IWCA 1UBSB 4D9NA 3VSCA 1PWHA 4L3VA 1TTPB 2C2BA 3RR2A 3L6CA 4D8UA 5T6MA 5BW6B 3VBEA 2YVYA 2D1FA 1KFEB 2EF7A 2YZIA 4D9EA 1Z7WA 3LFZA 1P5JA 3TE5C 3DWGA 5IXJA 4OFXA 2ZPUA 4HG0A 2EMQA 5CVCA 4IY3A 4AIRA 5MMZA 4Y6GB 4H27A 3CEPB 4P1GA 3L6BA 4D9KA 2UV5A 2J9XB 4NEGA 4KKXB 4IY2A 2J9YB 1K7XB 3LQNA 2OOYE 3TDHC 1M54A 3OCMA 2TRSB 3VSAA 4WX2B 5I7OA 4LMBA 1TZMA 4L28A 4PCUA 3X44A 1Z7YA 4HPJB 1C9DB 4D99A 1TZJA 4QYSA 5DVZA 1O50A 4D8WA 5JJCA 1J0CA 3OCOA 5B1HA 5B36A 1PWEA 3L6RA 1C29B 3FGPA 1RQXA 2GN1A 3KH5A 1UIMA 3HF7A 2QRCE 5I7WA 2RIFA 3T4NC 2UV4A 1PVMA
chains in the Genus database with same CATH superfamily
3I8NA 4JOCA 3P45A 3KP1A 3U4GA 3PITA 4PRZA 4LK2A 2PXAA 1GY8A 1U4OA 3GCWA 4LGCA 4QRIA 1I0ZA 1RRCA 2W48A 1PJRA 4ZPJA 3CEHA 4KMOA 3FNIA 2GN4A 3G2MA 1ZUIA 2R8PA 4AI6A 4PAMA 2X7HA 2Q7DA 4II2A 1XJCA 1ZEJA 4G0MA 5C81A 3AVYA 2YFHA 3CX6A 3W6ZA 2MYPA 5KOIA 3D6NB 2HEIA 3MINB 3TOVA 1ZK2A 3K0KA 2WAMA 3ONWA 3KC2A 4NESA 1AQLA 1T2FA 5HQ3A 4K6OA 5B7PA 3F8TA 4LV5B 3QEMB 4X93A 2XYGA 3WTCA 5CNKA 5M5BA 1EXWA 2PH5A 4I9NA 2Y6VA 3SCZA 2YDXA 5ABPA 4FSDA 2QRUA 1XTSA 2PX0A 2X4GA 1T5BA 3W5DA 4R9UC 2C1XA 2YJ3A 4BN0A 4OLFA 1O0BA 2M1ZA 5CTAA 3OO0A 5FYQA 5IDVA 2BHRA 3RUAA 2DUMA 2ZJ1A 2X4IA 3TINA 2OD2A 3FMPB 1GTJ1 1L1EA 5CFNA 1G3UA 1TA0A 2IOFA 2FRXA 3F2IA 4QBTA 4C5BA 3I6QA 1N2JA 2C99A 4M0DA 4R68A 3F5SA 3PQ5A 4QJ4A 5DT9A 4F93B 3A8TA 5C51B 4DNXA 1UZLA 3HH8A 1V9CA 4BWFB 1XI2A 4QTXA 3S5UA 3OIWA 1CQPA 3JYHA 3RSZA 5LP6F 2ZUWA 1P7CA 2GCOB 3HBJA 4E1AA 2QZPA 4AT1A 1MB3A 3H75A 3RLIA 1YONA 3CLKA 2QD5A 3DBOB 4EG0A 4F6RB 2PX8A 1IM2A 5G1PA 1XEFA 1K6XA 2OO5A 4DIOA 3IP8A 4FBMA 3GYBA 2V7TA 1EQ2A 1LRKA 1RAAA 1RWKA 2XGSA 4P38A 5J43A 10MHA 1QZUA 2IHNA 4MYHA 2R1TA 5F1PA 2PX4A 4YJHA 5LL6P 1IEWA 2NZ2A 3OE7A 4OV6B 1UJCA 2VDKB 1Q7EA 3LYAA 5FWAA 3V3KA 1SA0A 3QOWA 3OT5A 3VKHA 1Q7TA 1NSFA 1O89A 1UFOA 2X0KA 2ZB2A 3NBUA 3TBHA 4D44A 1WSAA 1UDBA 3O3OB 1T9DA 4JC4A 3HKDB 4PC1A 2QVXX 1OI7A 3PEVA 5DI3A 4BB0A 3HFGA 3OLYA 3Q98A 1WPGA 1XXHE 3OO1A 3BE4A 1LPBB 1VDMA 3S4YA 2XNHA 2AKYA 3EVAA 3PHCA 2X8AA 1I7NA 4J07A 5EMLA 1DAOA 1T0IA 2X58A 1CS4C 2CUZA 2D5BA 2ZT6A 1MB2A 2QM7A 2FHPA 3BWEA 3PXAA 3AGPA 3UC5A 1W1IA 2AG6A 4Z8YA 1KERA 3FWZA 3F71A 5EHXA 1XZIA 5D3MB 5B1SA 2XA1A 4EUFA 3IUSA 5AHXA 4M0EA 5CGQB 4IM7A 2BZSA 2DFKB 3ASYA 4WY2A 1HO3A 1D03A 3QWIA 4IJWA 2WWGA 2NU8A 3FGOA 1Y1SA 5DHFA 4LY9A 2ID9A 1JHVA 3DE3X 1VKHA 3KOOA 1W35A 4FTWA 4I1YA 3EZNA 3TRDA 1TT5B 1S02A 5C7YA 1USIA 3ZKAA 3PX2A 1TFRA 1SY7A 2YQZA 2VJQA 2IUSA 3K0FA 1PF7E 4R2KA 1JB9A 2I54A 2NVOA 1XDBA 2OL4A 2DERA 3A2KA 3UMSA 5DSXA 1FW6A 4TYQA 2EZ4A 2P9MA 4KNVA 2HRBA 2UZ4A 3TO5A 5TDHA 4ZMRA 4TTSA 5F76A 2AMVA 2G5TA 4NBVA 3HSYA 1OROA 3ZIAD 2X2OA 4ZO9A 4LJRA 5E6UB 3AOGA 4LJ6A 4IIFA 2OCYC 3KZNA 1QC5A 3IEUA 3EGDA 4JLBA 5TRTA 4MDHA 4M1YA 4MROA 1JAZA 1QH8B 3ZBUA 2FZCA 4PG8A 1J8VA 5J4KA 3KEMA 3OP4A 1RYBA 2GM5A 4KE9A 1HDCA 1NRXA 1PT9A 4B6PA 3TW0A 5IC4A 3TDNA 3WL7A 3WTBA 1TAUA 1H2YA 3K1AB 3LSYA 4KXUA 3BJZA 3GLIE 1KDRA 3RTBA 2HXGA 1ABEA 2XUZA 1AUVA 3AUUA 4HDMA 1ZMXA 5D01A 2JBAB 3WP1B 3KLNA 4N9WA 4F4HA 1GUZA 3FN4A 3RCBA 4K5QA 3VR5A 3ZVKA 3LPDA 1RCTE 1G60A 3BMXA 3ET4A 3ZQUA 3HCWA 2FPPA 4D81A 2I2CA 1PYOA 2HGSA 2Y27A 4M6WA 4TTAA 3A2MA 5KU7A 2QQ5A 1GPLA 3DD5A 3FR8A 4WN9B 3ZI4A 821PA 2X6RA 2AJBA 2ZAMA 4V0QA 5TR9A 5BV7A 1XTZA 4RHCA 1V95A 3QSYA 4FYHA 2JFYA 2Q3EA 4Y9UA 3UV6A 4P83A 1UPTA 1XAJA 5MFZA 4DSNA 5FBQB 3NC4A 2O1WA 2IV2X 3ZE1B 2GT1A 1VL0A 3ROEA 4F12A 1DCTA 2HMSA 1CUVA 1RRGA 1HT1E 2B61A 1KR5A 1Z88A 2J46A 2FZ5A 4UVEA 4C7BA 1RQNA 3KR2A 4NFHA 2WDZA 4R6WA 3DBLB 1TCBA 4L9SA 3GFGA 1CB7A 4S0ZA 1X42A 1NOIA 1CYDA 1E66A 1XVIA 3QKUA 3R5FA 3BD6A 1DKUA 1USWA 5D1NA 2VUHB 3D0OA 1QCYA 4ACBA 4CMKA 1KEEB 1T6XA 1Z74A 3ILHA 1YOVA 1ECFA 3O4FA 4MB0A 4PPFA 4RJLA 5D8DA 1KO4A 2V96A 4NE9A 1OCEA 1EE2A 3QF4B 4I7EA 1XOIA 1E8NA 2PLNA 3MWYW 1MAVA 2F43A 3NV7A 4HLNA 3RS7A 1WUIS 4CM6A 1PLKA 1L5RA 3N8GA 1JIUA 4JJIA 4P4TA 4EM6A 3DZHA 2QUKA 4QNMA 3RUCA 4BQFA 1JFRA 2EG9A 3OVMA 5AJUA 1UIRA 2ZJBA 1NJGA 4J0JA 4PR3A 1ZH8A 1X0XA 3JARB 5MGBA 2HHHB 5AW5A 4ZJUA 1V39A 1NT4A 3T1YB 1OX6A 3CG4A 3HKCA 4HD8A 1HNXB 2XEDA 5E0OA 3FROA 4KN9S 5B3LA 1VMKA 1Q7GA 3OZ7A 4GT1A 4TXJA 3C5HA 3G0IA 4AMYA 2G9UA 1VA5A 2OEPA 3L84A 5IK2A 1N0WA 2YZ7A 3ABSB 2GFQA 5AUQA 3ZE2B 5JD6A 3BIFA 3H11B 3ZJVA 4YMLA 1DBPA 3VSDA 4E46A 3I4CA 2P0EA 3E15A 2BMFA 1CFJA 4LC9A 1UFKA 1AU9A 2OQRA 4R2IA 5ALFA 2PL1A 4OYLA 3SX0A 1XMSA 1RPZA 4BFXA 4MUGA 1GAWA 1GPAA 2EW1A 3K09C 2UVQA 4CLRB 2CZGA 2EERA 4TZTA 5B7QA 4X3OA 2WOOA 4UVHA 5JBQA 1GKYA 1YQWA 1YRAA 4RM2A 4CV0A 3JQAD 1I5RA 2XRFA 2Q6IA 1POWA 2KBFA 3FTQA 4M9ZA 4TMVA 5EP2A 3TQFA 4ESYB 1EVZA 1Z13A 2XB6A 3IP5A 5AVYA 1IN7A 2XWPA 5FF9A 5FULA 4FP9A 3CWQA 1A27A 3V6MA 3JATB 2XF2A 1UXKA 1XAHA 3SXUA 4MAMA 1R10A 2JAPA 3CMCO 4PONA 5H82A 5ILGA 5IM5A 3LUCA 5CVUA 4MOWA 3TLAA 2C7VA 4BJ5A 1FYDA 1SUDA 1Z4MA 2IE8A 1G8MA 2ZJ7A 4KO8A 3Q7PA 3M5PA 4C7XA 2V9CA 1T5DX 4JSTA 3WQRA 1NVMB 3GCZA 2QTVB 3Q40A 4PGAA 4Q3BA 4PO8A 4WV3A 3SHQA 2Q07A 3CX7A 1UWLA 1OUMA 3H1FA 5DJ5A 1B6GA 2P7HA 3ORHA 4NZNA 2CSXA 4ALNA 1N2CB 5LYJB 2OD7A 1N2HA 5IH3A 2QV0A 1U8EA 2ZG6A 4HN9A 1QS0B 4JIGA 3B5EA 2O3JA 3AF2A 3SJ7A 4GECA 4BQEA 4KNYA 4LOKA 4NIMA 3O2SB 2BEKA 4FWBA 4JL6A 4JBIA 3VZPA 4S1VA 4W99A 4F72A 2O59A 1YAJA 1RYYA 2YCBA 1QQ6A 1ZJ4A 3N74A 3IDOA 3QG5A 4OAQA 4X3PA 4XLZA 1QIGA 5GAJA 2PZAA 4MV4A 1QPGA 2OILA 1Y1LA 1OLSA 2CHVA 1QM5A 2IY7A 2PFGA 5A3JA 1AO3A 4REQA 4BXOB 3FCXA 2RSLA 2XDQA 5CEFA 4CFZA 2MYNA 2J0UB 5I3ZA 5CIYA 4Z3KA 2CE7A 2JRLA 1NLUA 3BGWA 2DVMA 4QAJA 4Z1OA 4Y2VA 3C3JA 4N7MA 3LPCA 4I4IA 1YR3A 1UMDB 2ODWA 5AK0A 4L6AA 5BV8A 2O0JA 2PH3A 4X71A 3TRJA 4LAFA 3AVVA 3B70A 1LJLA 2NYUA 1XB2A 4L27A 4NOCA 4MEJA 4NOJA 2AFRA 4R1NA 5CLQA 4ENPA 3HACA 4EG6A 2UV7A 4IV0A 1VI6A 1GA1A 1P4RA 2Y6UA 3DKPA 2P9TA 1WXFA 3Q11A 1PJZA 1X7ZB 2IYPA 2Q27A 3QTTA 4HYTA 5TE9A 3VJLA 4C03A 3NTUA 3OA2A 4GMGA 4E5UA 3UFBA 3VJMA 4YUWA 4JJAA 1N1DA 2RJOA 5IJWA 3ZXIA 2HB6A 2QGNA 2V9PA 4P36A 3QM1A 4JI6B 5DYNA 1O8BA 5C80A 2ZEJA 4ND8A 1AD2A 1X15A 3HY3A 3FOBA 3KOWA 2AVNA 2UZIR 4P82A 4RQAA 2JH9A 2WFZA 4LSGA 5EWMA 4AUKA 4UTPA 1ONSA 3EXEB 2PEZA 3G0BA 4OI0A 5AM5A 2RG7A 3FFBA 2GLTA 2C31A 2D62A 5I7EA 4JC8A 3QW4B 4BVGA 4Z4QA 5DLYA 4DRXA 1AGRA 3C4QA 1CS0A 5EE1A 4AU1A 5C1BA 3N39C 1P9OA 1J2RA 4KHPB 5AK3A 3M4XA 4RELA 2YFKA 3A2LA 1M3SA 4RZQA 4HB0A 4B82A 3OJXA 1T1JA 1HQCA 3KPYA 3HFRA 4LTDA 1X19A 2FUG1 5DHSA 3UT6A 4EEXA 3O6VA 2H8KA 1FSFA 1OZFA 1P7PA 3PF9A 2QTHA 2CMHA 2XQVA 4YV0A 1FIUA 4EYOA 1NN1A 2C2BA 4ZGGA 2HXYA 3DL2A 4KBYA 1B23P 4NFSA 2BCJQ 3MAAC 1BH6A 1WXIA 3KKNA 4ZAGA 1J7KA 5T6MA 3H9GA 4YQYA 3EVDA 3U17A 2OP0A 2GPYA 3VR1A 3WYNA 1HNWB 1E2BA 1MX5A 1GPJA 4V02A 3MRTA 1DFHA 1PV1A 1KZ1A 4OXKA 3IQWA 2H2IA 2JLVA 2YZIA 4BO7A 3RWBA 1U9YA 3RYHB 2VYCA 1XMIA 2X0FA 1FP1D 1Y89A 1YBHA 2CD9A 1ZMRA 3HXKA 4TTQA 3E2PA 1CQWA 3Q8XB 4P9NA 2PQ0A 4FFBB 4M88A 5L53A 1TX4B 3L8CA 1QGYA 4W1SA 1EP9A 3I9FA 3ESCA 2QD4A 2VT2A 4BYMA 4IINA 3T52A 3TW4A 3BK1A 2FN8A 3CO0S 3EXG2 2HEGA 1XDWA 5K6AC 4G5OA 1AK9A 2IU6A 2Q46A 1XF9A 2IOQA 4ND5A 1W4LA 2ZE5A 5ELMA 1Z5ZA 3C6BA 3OZFA 4EVIA 1T4DA 2BEUB 3EVCA 1QDEA 2N47A 4FOLA 3AJ9A 4OQFA 5E9AA 3JY6A 5J47A 5K0SA 1C9EA 1Z3IX 1XO1A 1NNUA 1F2UB 2YWEA 1QVVA 4HDOB 3T7AA 1Z4QA 2PYZA 5TQVA 3B1FA 1BZYA 2VC2B 4QXMA 4IWXA 4C4SA 3SOPA 2IUEA 4UZSA 2FJPA 3NO4A 2VJLA 4DLRA 3F6EX 1JSRA 2GKSA 5ARCA 3A1UA 5BMOA 3FTPA 2I78A 1TM5E 2J9XB 2Z98A 1OLXA 3GJYA 5UKDA 2XE8A 4TMTA 3CVUA 2R97A 5WRFA 3KWJA 3ZKWA 2ONJA 2XZTA 2ATVA 4JLDA 4N6OA 1K7XB 2QI9C 4CQLB 1MN6A 1TLLA 4A0FA 2XTJA 3ESDA 5AIAA 3M6IA 3U62A 4HGPA 5L6MB 4ND2A 1OX5A 3ZK7A 3DM5A 5L3QB 3OLXA 3LCRA 2QT9A 4AUNA 2YX1A 3EWIA 1L9KA 3G2OA 4V39A 3DVRX 5AOBA 3FBGA 4C88A 5HQTA 2QNRA 2CEAA 5TEVA 3VSAA 1GQOA 1YASA 3WX0A 2P8JA 3MZ0A 3CJTA 4L28A 4HDNB 1DIGA 1U7OA 2A35A 1GCOA 3KL4A 1FYFA 1KVQA 1R8YA 1KO7A 2B8NA 4N0QA 4D1YA 2JFVA 3QOFA 4F2GA 1BE8A 1Z7YA 3GUUA 3M1IA 1P2DA 1JDZA 2R79A 2WSBA 1ZCZA 3CY6A 3JYQA 3COYA 3LUGA 3OEED 3QELA 2VYVA 2MSNA 3EDRA 1ISGA 3TI7A 3WHPA 2DKNA 4HNTA 1IXZA 1JT2A 2GJAA 4TTJA 4BX9A 3C1TA 5TB5A 2PXHA 5C8DA 4YQEA 1A8IA 5SY6A 3BJRA 3PVCA 2CV1A 2ZBDA 1SVWA 3JD1A 4OU4A 3OJOA 4P54A 5AO9A 5I4CA 4Z7OB 2YNMD 2P79A 1NPYA 2QX4A 4PAWA 2X15A 4AYWA 1B0AA 1JDUA 3H2SA 1ZD1A 5DHUA 5B36A 1Y81A 5D5HA 1ZUD1 1O97C 1SVSA 2VF2A 2OWDA 3TPZA 3FOFC 1E7RA 4UFPA 5K8VA 2J3MA 1VJGA 3IP9A 2QUBA 2W6PA 4JASB 4JGBA 1JYEA 2LRHA 3NATA 4PTYA 5K51A 3GT0A 1E1MA 3QX8A 5C46F 3V55A 2FFAA 4A73A 3JR7A 4RUKA 3UYKA 4WLVA 2VTDA 4A5SA 1L7OA 2NYAA 4CKBB 4BBPA 3KCQA 1UQRA 2IEIA 2F3QA 4CZ2A 5LMUB 4Y2RA 4ZYTA 2IH4A 5JJIA 1SZPA 1E3IA 2NZWA 4DUZB 3WOVA 4ER5A 3UFXA 1YRLA 1JVNA 2HOQA 2DHDA 3KEFA 5KYGA 5EIXA 3ZBPA 3IE1A 1P31A 3ANYB 1FL9A 4OJNA 3DJFA 5DW0A 5I9TA 5IYZB 2F9MA 4YB8A 5E2IA 5C1PA 1ATIA 1ZGHA 2GK3A 4IIVA 4BNXA 3U4DA 1YHZA 5EJAA 1W48A 4JUCA 4HWGA 2DPHA 3AVPA 1Y6ZA 4DCUA 2GEDA 5CAEA 4Q4CA 4X45A 2IF2A 3WIBA 3PBKA 4Q16A 1OXBB 3GVPA 3PHIA 3QXSA 4NU5A 4QDZA 2L42A 1G59A 1J1UA 2VWGA 1QDLB 4IXMA 1XD2B 3TKLA 4QRHA 4FR2A 5G4KB 4BCBA 4RJTA 1I2ZA 5K3EA 3HKEA 4RDCA 1HDIA 2R62A 2ZRFA 3DDHA 5AKGA 2JCXA 1JG4A 2YYAA 4P32A 3V1KA 5EE3A 3ZS9A 3OQ1A 1EM8B 1V96A 3S8EA 1HORA 4JUIA 4PG4A 4UZEA 3RB8A 2YQ5A 3WLFA 1ORTA 2B92A 3R1IA 3L4JA 1FDOA 4PFJA 5EE0A 3HU2A 4RIHA 4RE6A 1KQFA 4QNRA 1DRVA 2BEWA 2PJZA 3PS9A 2H5IA 4MKIA 1FDIA 4PHTA 5CA1A 3QYAA 1KC1A 4WXPA 4TVOA 1RJ9B 1X1DA 2W6JA 2P91A 5KSYA 2Q62A 3GLFA 3HFJA 2FPOA 5HF6A 4M87A 1IFXA 1L6RA 6Q21A 1M76A 3W2TA 4DMHA 1YCFA 4TTPA 3VDMA 1ZA2A 2ZREA 3UMFA 4Q7KA 1GAEO 3S0JA 4ROSA 4XWKA 4RKYA 1EIWA 3PD1A 3B3FA 1Z4PX 2VNAA 1Z17A 4D6PA 4I1RA 2QMEA 3B13B 4JYCA 2GJKA 3G2KA 2BMJA 1M2WA 3AESA 1YS2X 1V6CA 3FB1A 4HX2A 3TQTA 1RWBA 5E4TA 3RHSA 4F5ZA 4C0JA 3ZJTA 5E4JA 3F98A 1P9LA 1ZN8A 5HJEA 1ACLA 4S3MA 4ENRA 3OE5A 1H8ED 1CUCA 2V0GA 1ZSVA 2BKVA 1QAOA 2ZQYA 3GWGA 3ZNPA 3GDOA 4BGUA 1BFKA 2YWXA 3DKVA 4R2HA 3RBVA 3LCCA 5BXYA 2XNJA 4FDAA 5AKLA 1L4MA 5DYIA 5JC1A 3KJXA 1ZHFA 2XB2A 1GGKA 3AHIA 3WGQA 2DH6A 5AD1A 3OQNA 5C4GB 2OO3A 3G2NA 3VNSA 4ENUA 2VHYA 4ZU3A 1Z56C 4RY9A 1V1MB 1X7XA 2J32A 1GG2A 3VJKA 4I5EA 2OPHA 4BLTA 4DJTA 3DKIA 4RJJA 5JS2A 1JLLB 1AQNA 4CNBA 1XL0A 5AJYA 2RGXA 3HY6A 5J59A 4WBSA 4UJ5A 4N0MA 1JBQA 1BXZA 1EZ4A 3ND6A 3FVTA 1C1HA 3BJIC 3I4FA 2K5UA 4UHKA 4ZT6A 4ZYWA 1UINA 2JAOA 1K75A 2ZAGA 3X1JA 2HNKA 2BFPA 1C1YA 4WL0A 2QJWA 2HHJA 4EPTA 4G0YA 1FRVA 1J0BA 2UKDA 3OOSA 2I76A 4P08A 4RSRA 1NP3A 4RTNA 1Y7HA 3I32A 3AHHA 1D1PA 3GEGA 2QX8A 2ZUCA 1TIKA 1QHHA 1T3TA 3FFXA 1R4NA 2CW5A 2H5LA 3G49A 3EC7A 1C5KA 2ZVJA 3HYSA 4DNPA 3PJFA 2LCIA 2DPXA 1IN8A 1IAQA 3R7LA 4LNUB 3AT1A 5G2OA 1DFIA 1EXNA 3W7AA 1ZK0A 1LVHA 1CR4A 2R8XA 4GNKA 3EN0A 5DTIA 3WYBA 3D2LA 3FWNA 1DVRA 4JJFA 4G3XA 4E5SA 4CIYA 4IDCA 3ZDYB 2NVUA 3S2UA 1MMFB 2BEVA 3ZS8A 4DSUA 3U7HB 4WWHA 2BBOA 3T95A 5IYZF 5JQWA 5IKXA 1QIHA 1BOFA 3H17A 5K4GA 1AV6A 4MWEA 3BRCA 3JD3A 4A6PA 4HXGA 4HN2A 5DBOA 1S3FA 4RHFA 5EXSA 3ANNA 3TW8B 3ZGVA 1ODIA 2W0SA 4NNOA 2H1FA 2FN4A 2VJMB 3AW8A 3EISA 1EFPB 2JCVA 1IZYA 1RS0A 1RYNA 1S96A 4RK1A 1KZ7B 2F1HA 3NWJA 3WSTA 2K87A 3NLLA 3URMA 1YJBA 4GYWA 5A7HA 1MIOA 1NQWA 1E5VA 4A03A 4GX1A 1Z0AA 1ZSYA 3ZE9A 3EASA 2GN2A 4MINA 2Y0BA 6PFKA 4LC0A 1I94B 4WKPA 3VGJA 2C2GA 4X44A 1O5OA 1UBLS 3BILA 4O2RA 2JIDA 4R8MA 3ORYA 3W2FA 3VR6D 5TF4A 4P58A 3WIVA 5FTLA 1QBGA 1RJGA 4GXTA 1GTZA 1GCGA 1REQA 4MRMA 4UJ3A 3S3TA 5HUJA 1B8VA 3BYZA 1G8AA 1PNVA 2VF7A 1Z39A 4ZOLB 1N7JA 2G8NA 2VH2A 1F8UA 1FRFS 3FWKA 2JFWA 4HWPA 2OBXA 4URHA 3U31A 3RD5A 4F3NA 1ESDA 4ND4A 2DBRA 4RH1A 3HBNA 4GKKB 3UOWA 3RFVA 1XWFA 1A9RA 2GDZA 2E2WA 3P9RA 3QIVA 4BMCA 1SHKA 1Y48E 1Y37A 3RUFA 1K2VN 3RC2A 4P5DA 1JAHA 3WGUA 1H4QA 3IUBA 4BU0A 2N1MA 1JJBA 3KL2A 1U0EA 3O8NA 3DUFB 3KZ1E 2HJGA 1U63A 2YOHA 1RRFA 3RO7A 3HZOA 2JI7A 1P5ZB 4TWBA 1RFGE 4JEMA 4K9LA 1L5HB 4ZV7A 2OR3A 3KD3A 3PNVA 4OQXA 3TIVA 3WIDA 3FIUA 5LQAA 3EDCA 3UMYA 2H52A 1JI3A 4ILEA 1RTKA 3BCRA 4JUAA 5LWHA 1SKYE 1DUVG 1SCNE 1VTKA 1RQGA 3IPCA 1H2FA 4D9MA 4KR2A 4D7AA 2PT9A 4EB3A 2X1VA 1FYVA 1KDZA 2BC9A 4ESVA 3DBHA 5EKSA 2A9FA 5IEBA 4MPRA 3OQ6A 4XWGA 5CJPA 1N8NA 2DG2A 1I4OA 4Q7EA 1Z4IA 2C2YA 5GQSA 3WB9A 2O0HA 5JSQA 5CJ2A 2C1ZA 1LVUA 1XRRA 3A3PA 1KO5A 1PGNA 1V7CA 3S68A 4XSGA 3STTA 1LFDB 1EVIA 1I3NA 2PKXA 1HUQA 5GIPE 4BEBA 2GRAA 1E7YA 2W6CX 1AQYA 3OIVA 3VJRA 3HS3A 3Q41A 4EJMA 3BAFA 4O4IA 1DIAA 2FZKA 3DAPA 5BPHA 1Y34E 2B2XA 1NBIA 4CI0B 3WWEA 4FR5A 3IBFA 1PJTA 1WJGA 3HCRA 4UU0A 3VM6A 1W19A 1JDJA 2WI8A 3FYDA 1HFWA 5KNDA 4TKVB 4A5OA 1TM4E 1QG4A 4TV8B 2ZU0C 1UBGA 2J5KA 2VEDA 3UQYS 3LHHA 1SBQA 2J4DA 1E0AA 4KQ9A 3EGXB 2OHOA 5HF9A 2YUIA 3KKQA 3F49S 4QPNA 3O7WA 3PD0A 4J3JA 4XYMA 4KR6A 2GEKA 4JT9A 1B74A 1QFSA 1S2OA 3Q7EA 4I14A 1ML4A 3AUXA 4PNHA 4BVFA 2W2LA 4RA9B 5IC5A 4RTMA 5FNZA 1D2MA 2X1LA 4PAQA 3MPOA 4ZC1A 1E3WA 3DL4A 3EDYA 2QREE 3MK31 1ZM4A 7REQB 1E2JA 3F7MA 3KKZA 3QV2A 1Q3HA 1T3GA 1M83A 1IWOA 1GLVA 3A7EA 3BDIA 4I55A 1EFTA 3VO9A 1I4DD 2WPNA 3GRAA 1BWQA 2D0IA 4INOA 1A9XA 4LPSA 1JU3A 3FH0A 1JZSA 2R1ZA 4G63A 4IZIA 3KYBA 4YH1A 4BP9A 4EYGA 3WOHA 3C3KA 4CEHA 4FQ8A 1EFRA 1S3IA 3FJOA 5ALXA 1G42A 4YRZA 2UUBB 5IKPA 3JVDA 4CT0A 3GJZA 4XWYA 1UT8A 2YZ2A 1Z2NX 1PWYE 1E6EA 1TK3A 2G9VA 2X9NA 5IDYA 1LDGA 3Q88A 4Z3DA 2MR5A 3ADKA 3C24A 3EQ2A 1NMXA 2DM6A 2N75A 3SL7A 1PS8A 1G2IA 3HP7A 2HWWA 4B3HA 3KFVA 4O08A 1D2AA 4BFVA 3QQPA 4LGVA 2BH9A 2H5JA 4AY4A 1GTRA 1H9CA 1HZJA 1C3VA 1GNQA 1Z7EA 4AMZA 5B58T 3RKSA 2J48A 3E3AA 2B21A 1LC0A 4BO9A 1TLTA 4QUGA 4TXNA 1ZEMA 5FUWA 4HUJA 3SJBA 2ADMA 3NCHA 2JGDB 2YVKA 4TTVA 2FLWA 1E92A 4PW0A 4FFPA 2YS6A 3JASA 4M1EA 4OB8A 4GAEA 4ZZIA 2ZS9A 3BXFA 3JQGB 4AG3A 2IIPA 4GKVA 2B2CA 1PT8A 1R6AA 2R1UA 3MCWA 5ITZB 1YKFA 3JQFA 3QKRA 4HXFB 1BFDA 1FXWA 2G70A 4JVLA 4JXZA 1QK3A 2UYGA 4FNOA 4DDUA 3LTNC 3H18A 2BRUC 2LGJA 2VF4X 5F5LA 5TQ2A 2XT9A 5JQGB 4FINA 1GEEA 2P1RA 1YS9A 2J4CA 2QXTA 2YINC 1YJ8A 4C4OA 4KXFB 1HQDA 4GD3Q 2QK4A 3C48A 2Y67A 3QVOA 1BVYF 1ND5A 4JITA 5E7MA 4IILA 4G8BA 2NYRA 3PICA 4GICA 3GYGA 1EHIA 4OFZA 1RKXA 3C3PA 4KV7A 1AHPA 3GJ5A 3V34A 5BSGA 1OOEA 2EFCB 1QHXA 3CV3A 1HF3A 4XSHA 5KAMA 1YZFA 3IT1A 4D9NA 4FXOA 4P98A 5ALYA 1NKVA 1PZNA 2WT8A 1EPUA 3VSCA 4A8HA 1T0JB 2G63A 4E30A 2QUZA 3GFRA 1TIPA 3RLFA 1F17A 1C7QA 3FSGD 3R7WA 4BDTA 5B4UA 1V8FA 1O94D 2J33A 4JXXA 3WLAA 4KIGA 1KO8A 8ADHA 5A9SA 4J1QA 1N78A 2EXXA 1BX0A 3WLLA 3HVKA 4QDOA 1QGAA 2FRVA 1XLVA 2GARA 3VKVA 5ALOA 4D9EA 2J5XA 3FPSA 5CURA 4WPGA 2D5IA 4UTRA 3I2IA 2W70A 5E6RA 5DK6A 2VN8A 4KE8A 5DMHA 3E3NA 3BDAA 4J2TA 5EJFA 4ARIA 1NW8A 2QTMA 1IQPA 1SIWA 4RMJA 1V2HE 4CM4A 4XEHA 2I7VA 3IDQA 3TVTA 3WRYC 1L4FA 2Z56A 4JP3A 3O92A 4XVUA 1RMYA 3G1UA 3WLIA 4EPWA 1DRWA 1JG7A 1K1EA 2O05A 4XPIB 3I5XA 3FNQA 4TV8F 3DJYA 5U4QA 2VTBB 3JQ9A 4ZJPA 1FDRA 3PCRB 6YASA 1NW7A 4XVHA 2XA9A 3RTDA 4Z9BA 4BTLA 4Z6KA 1UK8A 2VAWA 2VUUA 4PS0A 4BX0A 5KNBA 2Q3FA 1N92A 5MMZA 1VL5A 2GUWA 2WU3A 3TCKA 1NUPA 2IXFA 2Q4OA 4G4IA 5JZOA 4MLZA 3PFBA 1N2BA 2YXPX 4HLUA 4D9KA 4D3FA 2IQ5A 3ND8A 5HKAA 1ADCA 2PLRA 3OTQA 1RWWA 1E5LA 3GWZA 2AFVA 5K3BA 2NIPA 2ROQA 5BVGA 1XR3A 1NU6A 3GZTB 2AOUA 4FWTA 4MR9B 1FUUA 3VAAA 3NIBA 3Q0TA 4QPZA 3U3KA 2WIAA 1W29A 2F9LA 3GFBA 1DC6A 3FXAA 3IJEB 3EVNA 4MUHA 1H22A 3FPKA 4LY0A 2DHQA 3MRXA 4EAQA 2EEZA 2PUWA 2RK6A 3I04A 3K1JA 4YJKA 3NDJA 4J90A 3LF1A 1H42A 3NTQA 4XCXA 1KBQA 4PZUA 4ODIA 1QV6A 2VT6A 3D3NA 1U2GC 2HSDA 3EC1A 5JH7A 1GCAA 4TKMA 1KPGA 3QPUA 3D0KA 1JG3A 1VLZA 3FHTA 1DRKA 1XE3A 2L69A 2Q6OA 2Z30A 3KXLA 3KZVA 3N0TA 5KIAA 3GRRA 2N0SA 4FYJA 1JF8A 1SVIA 4OGFA 1W36B 2X7XA 4D98A 2F8SA 2FN9A 2OV6A 3W7BA 3TZCA 1G98A 3IV7A 1Y9EA 3NM6B 4D02A 1WLYA 1GSAA 2O3QA 1ZNQO 3VNRA 2QS9A 3H13A 1J2UA 3MS2A 2EQ5A 2QF7A 2HFJA 3WKAA 4DCNA 3K16A 1ST2A 3QGMA 1Q1NA 2VAPA 2OGTA 1L8XA 2HNBA 2HRQA 2FQXA 2QE6A 4PC2A 2CBZA 4DN6A 2BUBA 1W0KA 2QL6A 4UBNA 2ZJZA 2ZWPA 4PZYA 4CMBA 4EMSA 4BZWA 2EFEB 1ECPA 2A0YA 3Q3CA 3N6XA 5EHQA 2VHJA 1ZR2A 2O9JA 2P11A 2CHQA 5GINE 1VC2A 3G7SA 4QO8A 2ZTVA 5JQGF 3VKGA 4YVFA 1FEZA 1C29B 4KRYA 4QLOA 3I72A 4NAHA 4ZT2A 2HW8A 3TECE 4E11A 1Q6ZA 5CPFA 3OOYA 4BO8A 5E1BA 1T2UA 2H11A 4N8DA 2IP1A 3Q8MA 1FVOA 4FHCA 4B33A 1KXZA 1OA0A 4X66B 3L0OA 1NJ5A 2A5GA 2QRQA 1YXMA 2HO4A 4TT3D 5I9IA 4MDEA 1SU4A 1IB6A 4OHMA 4X1IA 4NMMA 3QUQA 5LNK6 4NCKA 1Q14A 1M6VB 5DWQA 1SEVA 1WZ2A 1JHPA 2CN1A 2JFZA 2R25B 4Y9RA 4XQGA 4N41A 3WYEA 5SYMA 4NXNB 2PGIA 1RZ3A 3VFDA 2QG4A 2QTAA 2H1CA 1TU3A 4AKIA 1ESMA 4BFWA 5AKEA 1DUSA 3IJPA 2SCUA 3OJFA 3ZV5A 4MW6A 3J81k 2HMAA 1TD9A 1Y3DE 2Y1DA 4ZICA 2DT8A 1SUSA 4BTVA 1J6UA 5KJCA 2ISQA 4O0MA 3UCFA 1UM9A 2JJYA 2WJJA 4RQUA 1JRLA 2NXJA 1U8ZA 2G06A 2OXRA 4AYTA 2I2AA 5BSVA 3LBFA 1UOPA 3Q7QA 1ZHOA 4UNSA 3ZEIA 4Q1VA 1SHZA 1KAMA 1OKKA 3GR6A 2HHLA 3QP9A 4GE0A 4WOJA 5CP8A 3ZHQA 2JJ1A 3TKAA 2V8OA 1Y82A 2JLCA 3A6JA 2AFIB 3E61A 3NTRA 1TJPB 3IBCA 1ZNYA 4GR5A 4ZVRA 3SSAA 2EFJA 4V2IA 3UVEA 3O1LA 3HI4A 1RMTA 1EE9A 3HJGA 5HEKA 5L4NA 1G21B 1FMLA 1VJ0A 1QF7A 4H6WA 4CI9A 1QR6A 1P6QA 2CLMB 1P1BA 4TRJA 3ME5A 3QEOA 4B4DA 4DABA 1XXHA 4BUZA 3MWLA 3HCAA 3MMNA 2NO4A 2CJFA 4ZOQI 4EYSA 5AJTA 1YKSA 1XQXA 1DX9A 1VL6A 4OMUA 3EGEA 3ES9A 4A6EA 3WWOA 3AFIA 4EDFA 5TQ0B 4Y6RA 2W9XA 4FUQA 5FT9A 1YMVA 1WB9A 1ZAYA 3RAGA 3A1EA 5DNAA 2VHXA 2HT6A 3AY7A 4PYMA 2AG5A 1E2MA 4V24A 4G5RA 3ZTYA 4HB3A 5LXTA 2VOJA 2OBNA 4IFIA 4OLHA 4YJGB 2DQSA 4NV0A 4AN1A 5JS6A 5J5VA 3QKSA 2ZBFA 3FPEA 1AXEA 1NZDA 2BBWA 2X41A 2R6JA 1TI7A 5IULC 3IIIA 4DRYA 2NUAB 4GPAA 1GARA 4K46A 5A4AA 3U19A 4G07A 2HXSA 2Z3ZA 3P0RA 4BNVA 1K4MA 1N1GA 4WFIA 3TR5A 2PYDA 5TARA 3GXOA 3KLBA 3N7TA 2Y1FA 1SOVA 1KJWA 1Q2UA 2DQKA 2O8NA 3AC0A 3WV5A 5C35A 2BTEA 1QO0A 2NGRA 1J90A 3BHMA 3N8IA 1K8RA 1N2OA 4MR7B 1ECBA 4ZQGA 1EUDA 3SR4A 3RIMA 3WRYA 2BFMA 1O08A 4YUXA 3ZGYA 1JEQB 3ZJ5A 3FLMA 1GFZA 2V54A 4RA6B 1WSWA 5ITVA 2DLDA 3IPLA 4D9IA 3B3JA 4WCFA 2VHEA 3GPLA 3HSSA 2Y4NA 1K98A 5FUMA 3HN7A 721PA 3GLIA 4DS3A 2R5FA 5EY5B 5FA8A 3MT8A 1BHSA 3BWVA 4LWZA 5CDUA 5HFJA 3W5BA 4DBLE 2QN8A 2RHOA 1AC5A 2BI4A 4WGFA 3R3XA 4RF4A 3NBXX 1EUCA 5KQMA 3WA7A 3CNLA 5IUKC 1Q1EA 3F2VA 3ZN2A 4ZVKA 1QHIA 2ZTSA 4D9FA 2R6ZA 4EFLA 4EQZA 2ZOSA 2BP7B 5IT9A 5FHQA 4FONA 1OLUA 1M6YA 3EQZA 1WTAA 2QXUA 1CEQA 3S2IA 3VNQA 2GZMA 3EAGA 1Y63A 4Y6OA 3K9WA 3P4XA 1CY6A 2E49A 3E7FA 1M7BA 5DLDA 5BN3B 5CBPB 2BE9A 2AI1A 3NT5A 4QLBA 2YR0A 1ES9A 2RHRA 5IBQA 3O74A 5I7UA 4GXQA 3F6RA 1FNSA 1KMQA 1M1UA 3Q1LA 1IOLA 4MS1B 1DAGA 5E2BA 3T8YA 4JKOA 3CUKA 3HRIA 3I0ZA 2IYXA 4R81A 4W5WA 3FNBA 3IIKA 3N87A 3RU9A 1NMZA 3A70A 3SI7A 2UYYA 3BM5A 4KVAA 1Q15A 3PRKE 2AFIE 3GQBB 3ZGLA 4Z4CA 1ZSNA 1JQ5A 4QEZA 3JD2A 1MFPA 1QH1A 3BHNA 1NJ6A 2GKGA 4B5LA 1ZPDA 1GVHA 1IB0A 4B5KA 3LHDA 4PICA 3TQQA 1Q84A 2P41A 4J91A 2FSVC 2WYUA 2JLRA 3Q9UA 5JBNA 1ORDA 2BCEA 2EATA 5EKUA 2YFQA 4RULA 2P9HA 1E79D 1PFYA 4ZIRA 3AVWA 2PYIA 1O77A 2YNMC 1H8HA 1TJ5A 5JDCA 3LBYA 2ZRGA 1NRJB 3F6YA 3H19A 5J4VA 4FKZA 2ZTHA 4HYYA 2FK7A 1TVMA 1W85B 1M10A 3LO8A 3BGIA 4HL6A 4V0RA 3ND9A 2EF1A 1AUOA 1E4EB 2BW0A 4YRCA 3MT7A 1A1VA 3S1LA 3L9XA 2WIDA 1QH0A 1ODCA 2FSPA 4DQWA 1WMFA 2WYHA 2BKXA 3DVSX 2CL7X 4KAFA 5HM6A 5CVVA 2VO1A 3T7IA 1UC5B 5KHOC 3FYUC 3WQHA 4H16A 5J2UA 3ZQKA 3RHFA 4YACA 3TAUA 4DLVA 1L0BA 1PJ3A 3T4XA 4ABTA 3CKYA 5KJ6A 1RLMA 4PCVA 5LZ4A 2KM1A 2FPIB 1GYQA 1UDXA 4MK4A 1RRPA 3PUHA 4XDGA 4X95A 1GPDG 1II8B 1DAEA 1PGQA 2G3YA 2DP4E 3ZNNA 2XCSB 3PLRA 4V3CA 2GBCA 1KY5A 3FZQA 3CZQA 4R98A 3C16C 5A0TA 3E4DA 1ZM9A 1DZIA 2FEAA 3PQ3A 4II7A 3CEMA 3QWBA 4X7PA 4GDMA 1UBEA 2HSJA 4LGMA 1KI6B 4C0QC 4OY3A 3RF7A 1LK7A 3HK2A 1C14A 4EG3A 2OAGA 2PANA 2WWTA 1VJ1A 5JO9A 5MDHA 4HH0A 4C2UA 5DHPA 5D3KA 3SN6A 4BO6A 4KQGA 4JR1A 1TA9A 4YMWA 1FP7A 3ILXA 4YCDA 5ADWA 1EUQA 2R11A 3L7KA 4DQDA 1VP3A 4GKJB 1CUYA 1QB8A 1ZXLA 1VIDA 3ITKA 4NQRA 1SUPA 1Z68A 4CLOA 4Y2GA 1R7RA 3ZU4A 3H97A 3AUTA 1V45E 2A1TS 3D5TA 1RPTA 2UVPA 3A25A 1B42A 1PZFA 2YMLA 3JRWA 3KR1A 5DXJA 2GZAA 3ESQA 4FJ1A 4KYUA 3IVCA 3GEIA 3DO5A 3V8BA 4YCLA 3NHZA 1QYWA 2GPBA 2ZR0A 3CSUA 3W05A 2FPGB 3U7FB 3AZQA 1JYFA 3AG5A 1D7OA 2IXDA 5I8WA 1LFAA 3EIWA 2HF9A 1BDMA 1D4ZA 1O5TA 2CFCA 2ZJAA 2XCTB 2Z2JA 3SQLA 1US8B 4I36A 4DIMA 2GBLC 2JVIA 5SV2A 3PL5A 1CUAA 4TLEA 3OFSA 3QITA 4R9RA 4Z4IA 2A67A 3VPHA 2JFOA 9LDBA 4Q9DA 4RCYA 3OPYB 4WASA 4QOHA 1ABBA 6ADHA 4P7GA 2YVZA 1TQHA 2H6EA 1RXEA 4P4SB 5ED0A 3SS7X 3JZMA 1GWNA 4GXNA 4KQ1A 1ZN7A 1R5NA 2IPMA 1T1EA 3JAWB 5ESRA 6LDHA 5JNSA 2VXOA 3AF1A 1CJBA 4J7XA 1WCWA 4KWTA 2Q5EA 3CVXA 2ZQZA 4XCVA 3WWDA 1KK0A 2H1WA 2PPVA 2NQTA 1RR6A 3L1JA 2O3SA 3MRSA 1ZR4A 3OE7D 1ULBA 4IF6A 3TW6A 3NHMA 4BP8A 2ZIFA 4F86A 4N3NA 1PTKA 3GMIA 3U0VA 3RANA 2GBFA 1M8KA 1KJJA 1KYZA 3H0CA 1A76A 1FFXA 1VHLA 4X6LA 1AM4D 3RK1A 4DSTA 1HRKA 1JAXA 2ONZA 3ASVA 3FDZB 2IYFA 1OAOA 2QZZA 3Q6MA 3GMSA 3NGMA 5KREA 3WK4A 4C4XA 2X2EA 5EUBA 1HYEA 5CEJA 3WNQA 5KYKA 1G20B 2OHFA 2PBLA 1JQJC 3P1JA 5DB4A 5BWMA 5KOHA 3K71B 5F3WB 3GUHA 5SYNA 3P2KA 4R0MA 1MXHA 1G4HA 3MEQA 1H3NA 1LZKA 3QY0A 3RRJA 3RDPA 2BLLA 3WBFA 4AKHA 2RHTA 3EZ9A 4EUSA 5BR7A 4RY8A 1PDWA 4BRZA 1GZ3A 1SELA 4JLMA 3WC4A 3UKJA 1MGPA 1K8YB 1XZCA 1QPZA 2ON6A 3BTUA 4KDCA 1UXIA 1QP7A 4JX9A 1XL1A 4TSFA 4X7BA 3H5IA 1O4WA 3WB2A 3LPNA 1T15A 3AZPA 3NJ8A 3RYIB 3IT3A 5IJAA 4ZCTA 5JH7F 3G1WA 4KZKA 4BB9A 5I45A 1PR4A 1QRUA 3I09A 3RARA 1QSGA 4E31A 4CTMA 1FUIA 1AMOA 1QZZA 1VMAA 3GAFA 4GU5A 1A2KC 1LX7A 1CLEA 1E0JA 1UBRS 2I2BA 5DXFA 5EQFA 1NUHA 4C14A 4TM8A 1OWMA 3FRIA 1F06A 1EGHA 3EH2A 3E9QA 4EB6B 2QD2A 4G8DA 1AIPA 3Q1KA 4HNSA 4QWMA 3HVRA 5HPYB 2G71A 1PJAA 3KPCA 1PCXA 3AEUA 3I5MA 1WKCA 5CVEA 3N59A 3RC7A 1T0HB 5TMPA 1A97A 5K4AA 3DULA 1OI3A 1FFSA 5KS7A 3BIXA 3CTMA 3WVNA 3QEBZ 1SOAA 5DMXA 3ED1A 5EERA 5AKIA 1T5HX 4KGXA 1V1RA 2WYOA 2Q3DA 4HTAA 4KSCA 1MOZA 2W8BB 2P4HX 3KWFA 4BAUA 3DFFA 5BWLA 2V58A 5IW8A 4OFBA 2HX1A 2ZB7A 2VAVA 5CCBA 2LPMA 3OM8A 2OG1A 3TZBA 3N07A 4MYTA 4D6XA 3HCBA 3HA7A 1QS0A 1Q0TA 5F2EA 1PR6A 2WU4A 4GOKA 2H00A 5CVDA 2PZEA 5EMHA 1FDSA 4HQRA 3O4IA 2YYYA 1XNGA 1GPBA 4KKVA 1E3EA 1XTRA 4NKRA 2FUEA 3WXMA 3OZWA 1Q11A 1VECA 4NHEA 4E5DA 3QBEA 1BHO1 1YU6A 3LKBA 4Q15A 5KSPA 4EVRA 5JAPA 3VBCA 3L6CA 1B8NA 5HCUA 2HMYB 2V9ZA 5JXIA 1LWOA 4X5OA 4GMXA 1W8DA 4FFSA 3QBJA 1XNRB 2EQAA 4PU0A 3U9TA 2M6RA 1NMEA 2HA0A 5IZ4A 3AR7A 3HADA 2Z3VA 3MXTA 1VDZA 1P6UA 3I9LA 3HB7A 4ZRDA 1HH4A 3WNZA 1DJPA 1RAIA 2I4IA 3VZRA 2FMIA 4B6GA 3KBOA 2D8AA 4H3HB 4Y6SA 1DIOB 4PTLA 5AK6A 2PAFA 4Q7QA 2I99A 5G4LA 3C5CA 4OK6A 2ZM6B 3R5SA 1XMVA 2G72A 4R54A 3M4JA 3THOA 3X1MA 2CLSA 3TSZA 4ALKA 3S2YA 1WA5A 1QFZA 2QRLA 3EVTA 2OM6A 4FJ2A 3SVLA 2PTGA 4BX3A 2C0QA 4QJ5A 4ZFNA 5JWRA 1X7YA 2IS1A 5DIZA 5KJEA 3RSQA 1Q6YA 1H0HA 4EK9A 3QE3A 3AI7A 3WLPA 1PEYA 4B75A 4IY3A 1PKXA 1E32A 3BSFA 5EZYA 2AZXA 2BR5A 1BX1A 5F3DA 1NNLA 3VYSB 4U7PB 4AJKA 3E9DA 1G20E 1FXSA 5FORA 1NJSA 2HZBA 4RVHA 1A9OA 1D8AA 4UM8B 3LXXA 1RKUA 4KSBA 4X85A 2K7ZA 2YJ4A 3S55A 3NT2A 3T7EA 1PNRA 1A9SA 3NG1A 5E9WA 1P39A 2YWCA 4UE3S 4CKWB 1WVMA 4BMNA 1P44A 5FWYB 3D5EA 1ULTA 3I1FA 4ZJZA 4M2LA 3I5YA 1VFPA 3D2CA 2IT1A 1Z0JA 2VHCA 3INRA 4PPGA 4L8YA 3TLGA 4B8WA 1N3IA 3LHIA 5IK2D 1H65A 2VOEA 1XDZA 2QTFA 2BL4A 3LQ4A 5T64A 1XA4A 2WD8A 1QIKA 2OOYE 4MS4B 4NI5A 3OKFA 3WK5A 5I7SA 3I01A 4IG4A 5TV2A 2ZIXB 3B2NA 3E05A 4C3UA 1Z29A 2BGJA 3BFVA 3COJA 1VA4A 4Y30A 2PS0A 4UEWA 5KVSA 2DQYA 4WX2B 4HVLA 5I7OA 3J81A 2WHQA 3ONFA 3VMMA 5F52A 1QMGA 3IMCA 4P84A 4D6YA 1V11B 3GLQA 3CQ9A 1ZRNA 2OG2A 4PV7A 1C80A 4TWZA 1O96A 4V0SA 3OZVA 1RYEA 2ZSBA 3ND7A 3PHHA 1BRTA 1S7GA 5GP1A 4ZRNA 4JVNA 2QORA 1GUAA 3QKIA 3OTWA 1CUJA 1SVOA 4GX0A 4X3CA 3USES 5AW1A 2H54A 1QCZA 1U98A 2HFKA 1W4CA 1VCNA 3IAHA 1E9BA 3ELDA 4Z8XA 1X8LA 1V6SA 1GGJA 3A1VA 4M8NE 1DIHA 1VIAA 1LB1B 1GZ7A 2COUA 2CHEA 2D1RA 2PNFA 4EIWA 4AS1A 2HK6A 4PC6A 4A2WA 5CA0B 2X13A 5HFAA 4L0CA 1VG1A 4YO7A 2CXSA 3NIWA 3C6YA 2CKMA 2PZJA 2ZJOA 2XI4A 3D7KA 4BMDA 5TNXA 1SXHA 5C37A 3VI3B 5J1SB 4Z51A 2Q8PA 1N5MA 1F3LA 3DL7A 1P0MA 1E3LA 4F21A 5JMOA 2L2QA 5J5CA 3GBYA 4YJ2A 5B1YA 2WF7A 5J1TB 1A2QA 3PWTA 3O9MA 2NN3C 1D2HA 4TMKA 3VYTB 2EGUA 1UPUA 2FB9A 4M8LA 1P9NA 1V16B 3GJ8A 1RACA 1C3LA 4R2WA 5DF1A 5BW4A 3R7FA 1JG6A 4UHEA 3HB4X 3J7TA 5CLGA 5DASA 5TS3A 3G0GA 3BORA 2JLSA 3WRXC 5A7FA 2B8TA 1V35A 2G28A 3ZC3A 1W4BA 2JAWA 1BXGA 1C41A 2V7EA 3AR5A 1FRNA 3UJCA 2P9EA 1BW9B 4JA0A 3L31A 1E9EA 4IEIA 4LNHA 5FTMA 4CCWA 5CB4A 1NLZA 4B46A 5KTTA 1FF9A 1XLUA 2AUNA 3GLHE 5AOCA 5ADUS 2VKTA 3EGOA 4B6QA 1C7ZA 4EQ6A 3RQIA 1IVSA 4LY3A 4CBVA 2HDOA 4IHKA 1TOAA 1LBSA 3QPBA 4RLHA 3S28A 2OV3A 4AZ3A 5IUJC 4ZT5A 3IOYA 1E61A 3K72B 2J5RA 1GTG1 4M0CA 1R6TA 2I7CA 5IXSA 2VP3A 3IPAA 3MB5A 4QO7A 4GM1A 2R44A 3SICE 2PU7A 2NAPA 2JHCA 2Z95A 1HFJA 4TYPA 3DDUA 3D8SA 5BOSA 2PQ6A 4LJ7A 4L3OA 1B1CA 1DPGA 2RI0A 2MT9A 3EWAA 3HUUA 2HWYA 1E7SA 5BUZA 5KNCA 3I5AA 1U28C 2VRBA 3VC1A 3PX7A 1DG1G 3FZYA 2IHVA 2XUJA 3Q3JB 3QOXA 2A7XA 2OO7A 4K6MA 1RHQA 1R4MA 4NOMA 4D8YA 3KQKA 2F64A 4HS9A 1WOMA 1WULS 1JPNA 1J1ZA 2CLKB 4RU1A 2H7YA 4UCXA 1XZAA 1OXMA 1YZYA 3GRVA 1O94C 1UPXA 3N75A 4WJZA 3TZEA 4WKOA 4FMCF 5EXPA 5EC8A 3H0KA 4BV2A 2H1RA 1NVBA 2RC3A 1LLCA 1W0CA 3RU2A 1I7QB 2AC2A 3RGGA 2ADOA 5TVGA 3HCDA 4CM5A 4KFCA 2XAAA 3JAKB 3I6YA 3OY7A 2VP9A 1WTCA 2CF6A 3NWEA 3W5HA 3RSGA 2GK6A 1MG0A 4WLNA 4FE4A 2RAUA 3KKEA 2GXUA 2IU0A 3VTZA 3E22A 2BGLA 2CFIA 5AK5A 3DCJA 2IYRA 4JMLA 4OXNA 2APJA 3UUWA 3WL6A 2A4KA 3PXCX 5F9HA 3MBKA 4U5XA 2PBFA 1XJ5A 4N3CA 3BIOA 3CN9A 2QPOA 4F8YA 3GO4A 2G9NA 2GYWA 2PRKA 2EJUA 2NSJA 2ZDQA 4LRUA 4NV3A 4WRRA 2M6LA 3CVWA 2IBTA 2IWHA 5C8VA 1TEXA 4EUEA 2WQ7A 2JDIA 2Q1SA 2AEMA 4EJSC 1GL6A 4DHWA 5JT1A 1PTJA 2BF4A 3DFZA 3VSBA 5KQLA 1T29A 4YCJA 5FBVB 4QOFA 3T9BA 4UE2A 2HQRA 1NBWB 4UDXX 4YHBA 1IHOA 3L0PA 3IUYA 4U3JA 5EP3A 5B3KA 1XD9A 3R09A 3AOEC 2JGJA 4KVGA 4HRAA 4AWBA 1I01A 1RLJA 1SU7A 2C2WA 4X84A 4MW4A 3UT5A 3ZDQA 3EPPA 4I8IA 4U39A 1EM8A 1ZN9A 2IKSA 3EUEA 3NH9A 5INTA 1WEKA 2JZCA 3NGLA 3NS7A 3DB2A 2GF9A 3GDWA 2KSQA 1RLIA 2V6JA 3GLVA 2HA3A 3PJGA 3FOEC 4EI9A 5CA0F 2FSSA 4RW0A 4OSPA 4B3TB 2J3DA 5D86A 2OPBA 4TYWA 3M82A 3R6DA 1D2RA 1U9IC 3MMSA 2D1YA 4YCBA 1S2NA 1SBZA 4MHOA 4U2CA 4HV4A 1ESZA 4XYGA 4BX8A 1Z12A 3NHSA 1CKEA 3WLKX 5DO9A 2C07A 5I01A 5K01A 5DTQA 1Q3TA 3HP4A 1HR0B 1LS6A 4Y2XA 4BZPA 4KE7A 4TS3A 2R00A 4JYAB 3VU8A 2CE2X 2X22A 4FQ5A 1B6TA 2DZDA 1W5FA 3MCZA 4LX0A 2XKAA 1OIWA 3MGAA 3UMJA 3DEKA 1CIJA 5F2OA 2W42A 4UOEA 3BN3A 4UUAA 1Z9BA 5KSWB 5AKKA 3NETA 2V3VA 5H9VA 5ICFA 1MPTA 3IDZA 4F1WA 1KHHA 2OHIA 4WK0B 4ETMA 3HPQA 2IY8A 1PZEA 3G88A 4I3HA 2FP4A 1AUPA 1VG9B 1BD4A 4K7JA 1U3CA 4RV4A 3JQEA 2ZJ5A 1UJ5A 1VPEA 3I2HA 4M86A 3OPQA 5TVKA 5IP5A 2JLAA 3HA3A 3UGJA 4N7RA 4WKGA 5KYUA 1F8XA 1JDBB 1QQTA 1CWUA 1Z34A 2DWPA 2I1WA 2PRZA 2OE2A 3MJDA 1O9HA 2QU8A 3HCCA 1PBNA 3W9YA 2O8BB 2FPUA 2WSSA 4MW5A 4C5AA 1J8MF 1I7SB 4MGZR 2Y68A 2O23A 2JGEA 2WD7A 3O9VA 4YCAA 2RHJA 4UOZA 1JLLA 2PGXA 3WYAA 3RUPA 1YE5A 4BFTA 3R0XA 2VHUA 3OECA 3V8EA 4U7DA 2K6GA 1V7PC 5FL3A 2PBZA 4OHBA 3E3OA 1BH2A 3ZXUB 2OBBA 3UO8B 5FH9A 3HJRA 4C1NA 4G1BA 1R0YA 4LOAA 3TRKA 4BNKA 3WYFA 3ZJ4A 1TTQB 1VHTA 3TFQA 2NQ2C 4X8OA 1J8FA 1MA0A 1POXA 2D13A 4UUQA 4WNYA 3TIIA 4JP5A 4AX8A 4HZUA 1XTBA 2EWWA 2O3UA 3KZOA 3IPXA 4XFKA 1SG9A 3LL7A 4Z53A 1L3CA 5FTNA 3V3TA 2VJPA 1R0LA 1NMYA 5JWOA 1D6NA 3QYJA 3U9SA 3AIOA 4K05A 5K3AA 5B7NA 4LJYA 3HJCA 4EATA 3VH4A 4NOKA 1JSXA 3R3WA 3O8LA 5D7BA 3E2MA 2XIJA 1VJDA 1U0HC 2QIPA 3NM4A 4OMCA 5CD9A 3V1NA 2PKRA 4XWAA 3KO8A 3P2JA 2BHLA 3AU9A 2OV4A 3QFHA 5BR4A 5HIKA 5IAGA 4L73A 3ZCRA 2BH2A 1XD8A 1C4KA 2YJ5A 3MTBA 4N82A 4K2HA 2BDTA 3ETCA 4RK4A 4ZYUA 3GN2A 4R05A 4I4NA 3AEXA 3CZAA 2J9ZB 3EPRA 5LPNA 4E5KA 1N2SA 5B1IA 2MSDB 2NXCA 2CYBA 1UOEA 3WGOA 3GFTA 1E2UA 3D02A 1TPYA 1H66A 3NYRA 3RVNA 1KZYC 3SDSA 3TZKA 1G66A 3D8HA 3PXBA 2B5OA 1PEAA 4H6VA 1QGUB 2NPOA 1G9SA 3DXZA 4ZANA 3DEIA 3RSCA 3W5UA 3SHOA 3I64A 4LHEA 2W6JD 4M0MA 1UMBB 4N9QA 3KUDA 4BLUA 4C0LA 3E48A 3COSA 1A95A 4BV3A 5L9AA 3KU1A 4ZOLA 3B1ZA 4EKNB 5CNMA 3D6UA 4R8VA 5CYPA 3ZD7A 4O5OA 3LZCA 5DP2A 5LQNA 1J0AA 4Q4JB 4XR9A 4UAUA 5FIUA 3PFGA 5HA5A 1V8OA 3V9AA 1NFRA 1W7AA 5FOTA 2PTHA 5AQEA 3KPUA 4O2AB 3V2HA 3DZJA 5LIRA 1EUZA 4NXMB 2JJ2A 2ZR9A 5EZYF 2NMVA 4EWLA 3AI2A 4LXIA 2B4TO 4TPKA 1CR6A 3LNTA 3OBBA 3IHWA 2XGMA 3DHVA 3FWHA 5CT8A 3BWXA 4EHBA 2WINI 1PJQA 3GJ0A 3G5TA 2X6TA 4IRMA 5T4FA 3IDSA 3O91A 4COKA 3AI3A 3AKDA 4P0QB 4WLFA 5NLLA 4IL5A 3T54A 5A6SB 4YMTA 3MTEA 3L18A 4QTUB 1Y4UA 3KXPA 4YUAA 1SHTX 1YJ5A 1VPVA 4L4UA 3ZK9A 1F14A 1Q92A 1G5QA 3N2YA 1EP1B 3WKCA 5JANA 4HI0E 1BXRA 2DFTA 4WZBB 4GVLA 3TTWA 3ETDA 3JALA 5JZVA 1O6GA 1CR0A 5AXCA 3IVAA 4YV7A 4ZZ0A 1JE1A 2PH7A 2O57A 4DPKA 1E4YA 1EK5A 5AW2A 1V43A 2R8OA 4W9RA 3K53A 5KTYA 2VPXA 4J0GA 3LOQA 4LE1A 2DETA 3DF9A 4ZXPA 3DXFA 4C76A 4Y2JA 1EDBA 2SHKA 2I65A 2PXCA 4GEKA 4K2AA 4EG5A 1D5WA 5JLJA 5LBUA 1YVUA 3RHZA 1R6BX 3NDBB 4ALMA 3QFCA 3E8MA 3STWA 5I47A 4CQMA 4C7OB 2IHBA 2QTGA 3EAQA 1GGVA 2DUJA 3LGAA 4HYQA 4KQXA 2FQWA 1YFKA 2YMMA 3O8RA 2EHDA 2IP4A 5CYFA 3SE7A 4NCNA 2QLTA 1P18A 4NFLA 2V8BA 3K94A 4MWCA 3SBEA 4AWAA 3U6BA 2AGVA 1IUPA 3ZWYA 1OWPA 5AHWA 4DR7B 3IOCA 4XFDA 1K4YA 3NAMA 3NBYC 2L0XA 2QRGA 4RXUA 1VRWA 3BBLA 1XSEA 2P9CA 2PUAA 4EX6A 4EHIA 3CNEA 1YR9A 3E9NA 4NYIR 3X1KA 1CVLA 4JL8A 3ACBA 3SF8A 3UF0A 1XYGA 2WVAA 2PRJA 3QVXA 3FNRA 1JIIA 4RBNA 4XB6B 5D5QA 3IDFA 4HQLA 4V3BA 2V4UA 3UTCA 3EC2A 4TS9A 4M55A 1NOJA 3IV9A 4PC7A 5FBHA 4EHFA 2XMZA 3K0HA 3M7IA 1M2GA 2C5HA 3MCTA 3OZAA 2PWYA 4K03A 4GQIA 1N4AA 3PPIA 4MVJF 4ND1A 3ZDCA 121PA 1YS1X 2IIQA 5AVJA 4AVYA 3KQUA 2HJWA 4QTZA 5BQOA 1E3SA 1W9HA 3GGGA 4PZAA 2QD1A 4J49A 1QTRA 2I3BA 3LW8A 2XCUA 3MXOA 3ND5A 4OI4A 1P17A 1GDDA 3OC0A 4LVNA 1M75A 2WFLA 1QG6A 2PV0A 2VP6A 3HGTA 3OQHA 3W06A 1MHTA 4IIYA 1J42A 1Q74A 5GGYA 1CSEE 1Z0ZA 3T34A 3NGXA 3O3MB 3FZGA 1DCFA 3KYDB 1NF9A 3ZVRA 2WAOA 4Q9NA 3CYFA 3QFTA 3QMVA 4ZVTA 1GM5A 2P4SA 4U7JA 2ENUA 2NT4A 3HN2A 4QFDA 4EITA 1X3LA 2A57A 1DV2A 2O0MA 1FNCA 3DNPA 3FHOA 1D0SA 3WQSB 2AD5A 1EZ1A 1AG9A 1EVKA 4HF7A 1AUXA 3P0JA 3WMRA 4N3BA 4OUDA 4C01A 4H1TA 1PX2A 3WWZA 3D2BA 4O2AF 1ORVA 4PG7A 3KQMA 1WU8A 3O8QA 2ZRCA 5KWJA 3K32A 1S9DA 2ZCUA 1Z7BA 1TCUA 3D43A 4N5MA 4NBTA 5ER9A 2YQ4A 1FFGA 1T36B 4WBNB 4WZBE 3L1HA 1CHNA 1RKQA 3PDIB 5AHKA 5CLFA 1C7FA 4IQGA 5EL0A 3TXXA 1JXAA 2J9FB 3KPJA 5CLLA 5DEOA 4PPNA 4FGLA 3W6OA 3UUGA 5KB3A 1XVUA 2ODNA 4ARVA 3BWCA 4Q66C 5JAIA 5JMPA 2AOXA 4HB2A 5I9NA 1ULZA 1A8QA 2HJSA 4XLLA 3U44B 2GTPA 1QX3A 4G5XA 4Y1RB 3HO8A 3R0VA 4HDSA 1OH8A 4BNLA 1MOPA 1N0IA 5ERYA 1E6UA 1NNSA 2BMEA 5KNDD 3JQ7A 3QVSA 4QYSA 3KSZO 1NQVA 3KLPX 3A27A 4QU9A 2VATA 4B81A 4K9OA 3IO5A 2N42A 4PCLA 2YTZA 3RS9A 2UAGA 1VE7A 4JK3A 3T1VA 5A03A 1TF5A 4R84A 1EFHA 1TADA 3IMEA 2QMUA 3DP7A 4ZV4A 1D4OA 2K7FA 2IU3A 3UK2A 4BNJA 1Y5LA 2O2HA 2W2LD 3IE2A 3IHKA 3DONA 3KJEA 4AY3A 2FKAA 2DYKA 2VTBA 4A8JB 1SU6A 1GVNB 2CB0A 3E9EA 5ESXA 4AP9A 4NENB 1X8JA 2IA5A 1THTA 1UBTS 1LI4A 4E22A 3UHAA 3THYB 4LHSA 3GBVA 3RJ9A 1P19A 3KSRA 2ODPA 4ARZA 1VGQA 3VX4A 1L5OA 4GLJA 2P6NA 1KYQA 3H2KA 1EFRD 2PJDA 2QR5A 1FMCA 1BCRA 2HNAA 3IGFA 4FHGA 3BK7A 5AJXA 1G7RA 1QCDA 2CLEB 3SBXA 1V25A 3ZLTA 5B5SA 3Q2IA 4LUCA 3S2GA 3QUCA 4IMPA 3O3NB 4AWXA 2OOKA 1BCSA 2VT7A 3LHSA 4HSEA 5HW0A 3ABRB 1NU8A 4NPCA 4B3FX 1CHDA 1Q0QA 3U4MA 2BR4A 1M2OB 2DECA 3KX2A 1FQWA 4GM4A 1TLFA 1RW4A 4GYKA 4QEKA 4WVLA 1FLNA 1U3GA 4OB6A 5HIMA 2ISCA 1SVLA 1VE9A 2BI7A 4L5AA 4TQAA 1BAPA 1YDMA 2GRUA 1DV1A 3NKLA 3MBIA 3MILA 1AO0A 5E9QA 3W8NA 1OASA 3TLBA 4HKTA 3SKXA 3I01M 2D06A 3H2ZA 3AUKA 1AZTA 4DT1A 2QRKA 2I7DA 4E2ZA 3WLNA 5DKFA 1KFKB 1CQXA 3GUVA 4OIFA 3ZZ0A 2A9JA 5BVHA 1QFYA 1DLIA 2FWBA 3X2EA 1GQQA 4PHGA 2ZVDA 3HLKA 5J63A 4D0LB 5L3SA 1DHRA 1ULHA 3LIIA 4ZQEA 4QRDA 3EWNA 1M6HA 3I3SR 4BNWA 1JP7A 2BMWA 3W1VA 5EN4A 1JJVA 2X42A 1SQ5A 3K5PA 4YP1A 2IEBA 4BCDA 1E18A 4PZ0A 2R2AA 3L1KA 2XVZA 2PV7A 5EXEA 2IYVA 4M1QA 4BO4A 2GPWA 4DJFC 2GM4A 1L4GA 3ESXA 1WB5A 5TGTA 1Y5NA 1FFBA 2PS9A 4K6HA 4U7HA 5HRCA 4R1MA 4MV1A 4PZPA 3GW8A 3D4OA 6REQB 4PVCA 1IM5A 1BOOA 5AW0A 1KGSA 3EEQA 2WPDA 3PNOA 5K3CA 3GC6A 3CNNA 3KB2A 3L4BA 3HVHA 1Z2AA 1A2OA 4HR7A 1BN6A 1YI0A 2XDYA 3IDAA 1RAFA 1F0KA 4OBXA 3LAWA 4XZ3A 1IVNA 1L3IA 1Y80A 5DX8A 4AZTA 5BR8B 3LFTA 4IS2A 5H68A 4BNIA 1E3MA 5CLIA 1V71A 3Q3IA 1TCCA 1HRDA 2QRDE 1HYQA 4GWGA 2OCAA 4P22A 4C0AC 5IJ9B 3CCCA 2P35A 5LA6A 1ESCA 2HK7A 2G6BA 5AM2A 4OSEA 4QL3A 3EZXA 2X2FA 4E94A 1CY7A 2I8AA 1IQUA 3AERB 1HE3A 3NM5A 3KXRA 4XQEA 4H3VA 3BXGA 3BWMA 3ZVNA 2BTOA 3B9QA 3L8GA 4JQOA 5M3BA 3ANXA 3T12A 5HM8A 5IMBA 4UM7A 4L2IA 4ZN6A 1KE2A 3LVRE 1EINA 2H8GA 1J0DA 1LTKA 3QVMA 1MUUA 2VZ0A 2AYXA 4GS5A 3U7QA 2JAHA 2NU6B 3GNSA 2NSYA 3L77A 4AJJA 2QVLA 4CE6A 3KT6A 5KNBD 2XBMA 5A9RA 1HGXA 2MINA 2O4UX 1DMSA 1GRRA 3T7DA 5THXA 1R6XA 4PO1A 4GR4A 5KDDA 4CTOA 2Y0EA 2SKEA 1OXXK 2EGGA 2QT1A 3WLHA 8MHTA 1X7HA 1SK9A 4G1EB 1R0KA 3DE7X 1D5CA 1Z26A 2HYIC 1YIAA 4PBTA 2FW0A 4ARCA 2G0TA 2NADA 3I1YA 3AL2A 1V9LA 2VPIA 4F7DA 3EX7C 4CMAA 2DPLA 1WETA 3RVOA 3IKJA 4NS1A 1NBHA 4EGQA 1KEVA 1U2PA 3V4SA 3NR2A 5IN5A 3W3ZB 3VAYA 3T3HA 4BBZA 2BDUA 5ALVA 1DHTA 3TOSA 4DMRA 4DQKA 2Q5FA 5DGDA 3SBOA 2M98A 1E0SA 2BGMA 2JPDA 3C3MA 4X9XA 4MQEB 4YAOA 1FJGB 2R7KA 4P5PA 3VR3A 3GLGB 5K2OA 1TGVA 5LD2C 1SUAA 2WD9A 3A4TA 3P0IA 1M6EX 3RABA 4QUIA 4HO1X 5BMVB 3TI9A 5F3RA 1OT5A 1PIWA 1JMVA 2QN3A 4B4UA 2GF0A 4ITVA 4LFBB 4NOLA 5EGSA 2ZDHA 2X0DA 2HTFA 4RLFA 1T5TA 1GGFA 5EMMA 1F3OA 4QKQA 3ZDZB 1ZJJA 5HF8A 2VYFA 3BWDD 2DF8A 4M1TA 4XX0B 4BN5A 1COZA 2PT7A 3GVXA 4N0EA 5H4HA 4LYGA 4EHNA 4F1JA 1O5IA 2ZUUA 4X61A 3VOBA 3EVZA 3E9YA 3P4YA 1X1EA 2JF0A 2P5UA 1YD7A 1SC1A 2YXEA 3QI7A 2FLKA 1W0KD 3P9NA 1UPFA 3ONEA 2D2IA 3X2SA 2WU1A 2EBUA 3JPYA 3HNPA 3TFWA 1CUIA 1KH2A 4LA4A 4X7MA 5DHTA 3ZE6A 5DM70 2YV3A 3P2EA 3TL6A 2XUIA 4P81A 4R1QA 2HR1A 1S2GA 1C1DB 2PT5A 4ZMBA 3KSMA 4N48A 1T9KA 5B53A 1G38A 2WSYB 2E4ZA 4LRXA 4NCHA 4JI1B 2RONA 1RQRA 2C4MA 2P2GA 1G7SA 2ZSDA 4P33A 2VFAA 2FZEA 1EI9A 1ESEA 3MUEA 1KDVA 4FBGA 3EFHA 3YASA 2PUEA 4KUGA 3SQXA 3TNDA 4AD8A 3TM5A 3ZUPA 4OG2A 2GI4A 5AW7A 5LDHA 2Q3HA 1PD1A 2Y0PA 1EFVB 1H6BA 2C3OA 3GD7A 3HYNA 4JDUA 1FNBA 2NO6A 3UATA 1L6IA 3P5BA 4Y6LA 3AM4A 3JYNA 4BJ3A 3T3NA 5FO0A 4JYMA 3NBKA 5CDTA 4QPDA 4DQLA 5BN3A 1H0RA 2V7UA 1F7UA 4DCSA 3V2IA 5CDFA 1VLQA 2RKOA 5SYAA 2OECA 3FAKA 4LVCA 3VU3A 5I51A 5LQRA 1LKZA 2LV8A 4JP2A 1X9IA 2V6BA 4NG4A 9ABPA 4N1AA 1Y4ZA 4ZAZA 4F91B 2B25A 4BNNA 3R24A 3BICA 3MT0A 3N2NA 3STUA 4XUGB 3ZWMA 3A11A 2FOXA 4A7PA 1JQLB 3QU5A 2J3EA 1TDJA 3FWSA 2XMBA 5AKYA 3VR6H 5KZMB 5LP1A 4JJGA 4DV0B 1E9VA 1O95A 5COBA 2JIRA 2ZRQA 1T24A 1OKKD 1AS3A 2VLIA 4DIDA 4HG2A 4TL8A 3WL5A 3UPUA 4XD2A 1KVUA 4TUYA 5ERGB 4JB3A 2YHUA 3LT4A 2A5DA 4AZ0B 5JJBA 1PU2A 1LV8A 2CXUA 2ATEA 2NUPA 5ITWA 1XEXA 3B51X 1OBFO 1R9JA 1W34A 5B12A 3LWDA 3LY8A 4FGKA 2VZ9A 3KKPA 4LTMA 3R8CA 3A1CA 3NBMA 1TAGA 4NONA 4WY5A 2RCNA 5HYVA 3N2LA 5DNVA 5EZQA 2X5JO 2F7SA 2QLNA 3HZZA 3MN1A 2VG8A 3UZUA 1T4CA 3M1AA 3Q2KA 2Q1YA 2QI9F 2Z8XA 4UM9B 5A1TA 2WJIA 2LKCA 2I2XB 2J6BA 1WMDA 2AQHA 2Z58A 1NW3A 1L5VA 2MMGA 4KGDA 4LE0A 3M33A 3U7JA 5K03A 2E0IA 3VZSA 3FWRA 4F4UA 4RZUA 2QTZA 2Z5GA 1SHUX 3UJ6A 3OZBA 5LMCA 1YDWA 2HYDA 1TAHA 5DYWA 1TO1E 2HDNB 4TL6A 3U4CA 2FSGA 1YZKA 4LHYA 4IDBA 3V4LA 1JB1A 1T10A 4O25A 3ZIAA 2XITA 4HDRB 1JL3A 4NZYA 4COOA 4LOLA 1W47A 1I30A 2YN0A 4HAUA 2AUTA 4IW3B 2EBFX 2O2IA 2Y77A 3RUDA 1X77A 3TMAA 4Q47A 4AECA 1EXVA 2WTEA 4BPBA 1C7RA 2XUGA 1X92A 2XRZA 1MG5A 4CEIB 3AY0A 4R41A 2AI3A 1UKAA 1Y8ZA 2X8JB 3A4VA 3CIFA 3E03A 3ENZA 5C7IO 3L2BA 3FRHA 1LPOA 1OHHA 3D4BA 5BMVF 5CR9A 5K05A 1M0EA 4AN4A 1ZJ5A 4HEQA 4JLNA 4XD7A 3SZMA 4DEVA 1SWVA 3QNUA 4P5EA 1QO0D 1ZGAA 2REOA 4AMBA 2DCUA 5JR3A 3EXG1 2N9UA 4IVNA 3IURA 4YROA 1NUSA 2ZYVX 4F45A 2JKZA 1D6JA 2JBWA 3PE4A 4MCAA 5DBHX 3SX4A 2GPAA 1OXKB 2FXIA 4A91A 2D3TA 4QSHA 1GA6A 5AVXA 3BTSA 4YP5A 3PCXA 4BV8A 4M0LA 2HIGA 1A8SA 1GU0A 3DYBA 4J7UA 4R2MA 2IUUA 4RWZA 3ZZMA 5JXGA 3O83A 4G9GA 4JVMA 2HHAA 4Q05A 2Q28A 2R6AA 3P20A 2CSUA 3MG9A 4RVUA 4EBBA 1FFDA 5HK8A 3QPWA 5A62A 1KEKA 3GEPA 5F35A 1CQJB 4WJKB 1HBJA 1JHMA 2LUOA 1HA3A 2A5JA 4MO2A 3ENNA 5AJWA 2JJMA 2OXTA 3HB0A 1UQTA 3IYLW 1FTNA 5K0CA 1US8A 2ZTLA 4PY2A 3R7SA 4HHEA 3PA6A 2GK7A 3F5MA 3HM9A 4HX5A 3MWDB 3JV7A 3KEOA 4CLEA 3O90A 1L8QA 1NFFA 2QR2A 5HKBA 1W4RA 4N5IX 2R8ZA 1RM5A 3G2HA 4P4UA 5L7TA 4OM8A 3HRHA 2QZJA 3V8MA 5LLTA 4WLEA 4YHHB 4ZVSA 5JXHA 4KXNA 3GAAA 3SSOA 3RT7A 1PQWA 3LHFA 1NBMA 3AFOA 3D3QA 1S8AA 3U7GA 4CLHA 1G8KA 1DBVO 1NE7A 5IBPA 1BXKA 1AKVA 4TVBA 4D45A 4F4FA 3ODGA 1CZOA 4PZLA 1ZDMA 5ILQA 3T3IA 2F4NA 2WKRA 1NJ1A 1LDMA 4A0RA 2R751 2HIMA 3L0BA 4FZJA 3W8DA 3R3HA 4DR3B 2W6MA 4F5DA 1U1EA 4CCYB 2V7BA 1WL8A 4AUMA 1PWHA 4LHXA 2OAQ1 3AUYA 2XW6A 1XCBA 3QLUA 4EUNA 4DR2B 4KR9A 2IODA 4BRUA 5CB0A 3BSWA 3VH1A 4YREA 4AYXA 1RBQA 3PHGA 1AMUA 1A8UA 1GL3A 1BEZA 3FOAA 3H5NA 1KSFX 3R3SA 3ETNA 4FOPA 4R6XA 4FQ7A 2ZXUA 4JBXA 5HOEA 2EF7A 1QXSA 3QYPA 4MCHA 1I5EA 4LDRA 1Y1TA 4BB5A 3SFZA 3OQIB 3THWB 3AG6A 3OQVA 1PV4A 3SKYA 2RGCA 1DJMA 2OCLA 2YHIA 2GK4A 4OAPA 2ERCA 2VPYA 3M6WA 2FJUA 3L8YA 4MUNA 4XQ0A 1JIKA 2J4FA 3NZEA 3PUVA 3RW9A 3FOCA 3DZCA 4EEZA 3ZDBA 1P2BA 3DWGA 1RXIA 1JJFA 4GHWA 4FN4A 5L95A 1R8XA 2BONA 2VAXA 3ZHBA 2H4JA 1SQFA 4HAOA 2QRZA 4PX9A 2A9QA 3EHDA 2EDCA 4Q7MB 3IV6A 2NVWA 3ADBA 5KC8A 3ZNOA 4RVOA 4DDMA 1Z4NA 2Q9BA 2XODA 4BNDB 4R5MA 4EB6A 4C04A 2ZRHA 2XNCA 4LYJA 4P1GA 2W71A 4QGSA 5KX5A 4G1UC 3AKYA 1WHTB 4DV6B 3IBTA 3L41A 1V1JA 1MAWA 2W37A 5CNJA 2QX6A 1KRXA 1YRHA 2P9ZA 3A2NA 4R2LA 2IXEA 3TUIC 1ENOA 3OIGA 3G7NA 5G3ZA 4E09A 4YR9A 3VVCA 2Z5FA 2ZBRA 5EVCA 4BNTA 4F4CA 2A0FA 1B6SA 3AV3A 4QA9A 4YAEA 2O8VA 3VPBA 4JLUA 3UWMA 2D1SA 2NP7A 1TEVA 1J7JA 2WWVD 2Y76A 1VHQA 4CKCA 2PD4A 3PFHA 1ULSA 1CJKC 2BTQA 3FNEA 4MI6A 2OBYA 3EFBA 3FDXA 2OB1A 4OLAA 1FUEA 4R9NA 3DLBA 1I10A 2DFPA 2PL5A 5IJ0B 5CT4A 2VQFB 1YVPA 3DDWA 1HEUA 1ZVJA 1U3VA 1E4OA 2RD2A 3HU5A 4NJOA 5IT0A 4OI2A 2XMRA 1QHGA 3CTPA 3WK6A 1G8PA 2PIAA 3D0QA 4FEAA 2BUCA 2R96A 4LMRA 2O1EA 4YGXB 5CCDA 3C98A 5JJLA 1UKYA 2BYTA 3EXHA 3EVFA 3P9PA 4MYCA 2WW8A 3CF4A 1QO9A 3JYLA 3Q9SA 5EJ7A 3IEMA 1FTYA 3ECAA 5HKLA 1XC7A 4MYDA 1JEAA 5LA6F 4D3ZA 5EJEA 3E3LA 2I1QA 1WG8A 4OCZA 4N12A 2HMWA 1IMJA 4CTNA 5F73A 4CKEA 4Y67A 2QG9A 3BIWA 4N8EA 1Y8QB 4C6TA 1Q0UA 2PMDA 1R2QA 5D5PA 1FFEA 2J7PA 4DCVA 1YRBA 4ER3A 3V1MA 4FYWA 3GLHA 2VTVA 4J76A 1VM6A 4RDXA 5A4MS 1OH5A 1VLLA 4J9VA 1QMPA 3DH0A 4L8VA 2OCBA 3SEFA 2GHRA 5A9TA 3I76A 1IDOA 2CLLB 3KEGA 3LOUA 3C5WP 3NHFA 4U9IS 5DTJA 1QGED 1BC5A 3CB4A 2B82A 2FG5A 2YWGA 5CX1B 5LJIA 1M2HA 3HXOA 2FK8A 1RAEA 3A7DA 2QLMA 1MZPA 1NKSA 3QLTA 3R3YA 3ZBQA 1GUBA 2HF7A 2I6SA 5LB4A 3SZOA 4W9MC 4AUEA 4LZWA 2A3RA 4K9RA 3VKFA 4F8JA 1N4DA 3LKVA 1DGQA 4N7BA 4EKYA 4TSFD 1KRWA 4C0BA 3HTXA 3WIEA 3EQ6A 4IRXA 4NY1A 4BE7B 2ACVA 5K23C 1XDDA 2AC7A 2CF5A 2GUGA 2NSHA 3FCAA 4GP7A 4NL4H 1F6BA 3LWNA 1V8PA 4C21A 4B3GA 3NU1A 2J6HA 4UULA 3VC3A 1UT5A 1AZWA 2C9MA 3IAXA 3UG7A 1JW9B 1NQTA 3W4KA 1H6AA 1N5OX 1O3YA 2H63A 3WHIA 2QMHA 4C4PA 4GPZA 1B2RA 1A04A 5LCXA 4Q1FA 2DPGA 2GN0A 1V11A 3KG2A 4F3YA 1L5SA 3NEAA 2E89A 2ZZNA 1JG2A 5KTRA 5JEEA 2W6ZA 3NOVA 5F5NA 4NE2A 4C3OB 4N3GA 1E77A 3SIXA 1B14A 4MUIA 3OE1A 1M34B 1LK5A 2DX7A 3GP5A 3I53A 4AF6A 1IHYA 2Q5CA 4AJLA 3F5DA 1QE5A