4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
1RXUA 2H8GA 4MCHA 4LKRA 1ODKA 3E9RA 3MMSA 4WKNA 4E1VA 5F7OA 5B7PA 4NY1A 5EPUA 4DABA 3OCCA 5F7ZA 4OGKA 1PF7E 4YJKA 4I2VA 1V41E 3PNPA 4WKCA 4G89A 1TGVA 3ONVA 3D1VA 2Q7OE 2RJ3A 1ULBA 1VMKA 4GLFA 1RXSA 3BJEA 5CYGA 1ECPA 1YQQA 4D98A 1U1DA 1TD1A 4DA7A 1JP7A 3E9ZA 2AI1A 4L5YA 1N3IA 2HN9A 1RCTE 3O4VA 1Z36A 4F2PA 4TXNA 1VHWA 3TL6A 1Y6RA 4DA8A 3OF3A 1JPVA 4TTAA 5IU6A 4GKAA 5F77A 4BN0A 1LV8A 1JDTA 4LZWA 1PR6A 4JP5A 1Z5NA 1A69A 4EARA 5FAKA 1PBNA 3IEXA 3KVVA 1JDSA 4YO8A 5F73A 4RJ2A 4NSNA 3EUEA 1NW4A 5I3CA 1OVGA 2QTGA 3NM5A 3EMVA 1JE0A 2HRDA 3K8QA 3BGSA 4BMXA 3P0EA 1Y1QA 3BL6A 4TTJA 1M73E 1V48A 3ODGA 4BMZA 4TS3A 5KB3A 1WTAA 5CXQA 4MCIA 5C80A 4M1EA 1K3FA 2AC7A 4OF4A 1QE5A 3OZEA 3P0FA 1ODLA 1PR1A 1T8SA 4QAQA 3KVRA 3FUCA 1JDUA 4YNBA 1ODJA 5IFKA 1SD2A 3EEIA 4QASA 5EFOA 1Y6QA 1I80A 5CYFA 4R31A 2A0WA 2QDKA 2A8YA 4U2KA 2OXFA 5DK6A 4DA6A 4GMHA 4M3NA 5F76A 4F1WA 2B94A 3K8OE 1A9SA 4L5AA 1RSZA 1OV6A 1U1GA 5B7QA 1Z35A 3DDOA 5K1ZA 1ULAA 3UAZA 2ON6A 3UT6A 4ECEA 1PWYE 5CCDA 1Z5OA 3IOMA 3PHCA 5F7XA 1XE3A 4JOSA 4TYMA 3UAVA 4MARA 3KHSA 3PHBE 3FAZA 2HSWA 1RT9A 3OOHA 4TTIA 1K9SA 3LA8A 1C3XA 2AI2A 2I8AA 4G8JA 3E0QA 4FFSA 1JDVA 3FB1A 3OPVA 1OTXA 1T8YA 3MB8A 1V2HE 1ZL2A 1T8WA 4OEHA 3LGSA 1NC3A 3NBQA 3FOWA 4UC0A 1Z5PA 5B7GA 1CB0A 3OZBA 4QATA 4DARA 1PK9A 2OC9A 1Z37A 4H1TA 1Y1RA 4PR3A 4TS9A 3UAXA 4YMLA 4EB8A 4LNHA 3GGSA 3BSFA 4DAEA 4TXHA 1Z33A 3DPSA 1RFGE 4OGLA 3O6VA 1PR4A 2IQ5A 1VFNA 4LNAA 4DA0A 1TCUA 4L5CA 1A9TA 3F8WA 2HWUA 1Z34A 3ENZA 1PR5A 1V4NA 1SQ6A 1A9PA 1RR6A 1YQUA 2XRFA 4D8VA 2A0XA 1RXCA 4TXMA 5CXSA 1JYSA 4X24A 1JDZA 1LX7A 3LBAA 3UAWA 1TGYA 4OY3A 5F7JA 1ZOSA 2QPLA 5ETJA 2AI3A 1OU4A 1U1EA 5EUBA 1YBFA 4R2XA 3KVYA 1ODIA 3OZDA 2OECA 1T0UA 4IP0A 1A9QA 3DF9A 3UAYA 2A0YA 3EUFA 1V45E 4D9HA 1NC1A 2I4TA 3C74A 1B8NA 4BMYA 4QARA 4D8XA 3GB9A 4D8YA 1PKEA 2GUWA 3OOEA 1TCVA 4P54A 4R2WA 4DAOA 1PR2A 4QFBA 1FXUA 4M7WA 1Z38A 1YRYE 1OTYA 4F2WA 3FWPA 4K6OA 4DANA 4F3KA 1K27A 1JE1A 1U1FA 3KUKA 3NM6B 4TXJA 1B8OA 1RXYA 3NM4A 3T94A 5B7NA 1A9OA 2BSXA 3KU4A 1SD1A 1T8RA 4WKPA 1SJ9A 1Y1SA 4QEZA 5JPCA 3DJFA 3PNSA 1CG6A 4WKOA 5CCEA 1YR3A 1U1CA 3QPBA 4PNPA 1Y1TA 1A9RA 3OZCA 3DP9A 4GLJA 1LVUA 2PGAA 2ISCA 4G41A 4F3CA 1RYZA 4TXLA 3FNQA 1Z39A 1G2OA 1OUMA 1PK7A 4WKBA 2QTTA 4L6IA 1V3QE 4NS1A 1PR0A 4JWTA 4L0MA 4OJTA 2QSUA 5F78A 4LDNA 3SCZA 3INYA 3U40A 1Q1GA 2P4SA 2OC4A 4KN5A 1PW7A 1VHJA
chains in the Genus database with same CATH superfamily
2X5KO 3ZDDA 5JNRA 2BFFA 2YKGA 1QCCA 1IY2A 1YUMA 3P2IA 4CMBA 2GLUA 2E37A 4GZ3A 3RS5A 3H1BA 1IG0A 3W9SA 1P2DA 5TQJA 3TCNA 5JQGF 3KFXA 4FEEA 5ALJA 5B2ZA 5A3VA 1PJBA 2ANBA 4HFNA 3FTNA 3ROQA 2WG2A 4N0DA 3AFOA 3UATA 5IKEA 1CZNA 5B1IA 3P9RA 2O2EA 4PPQA 1N2OA 2ARKA 4GS5A 5KNCH 2GK4A 2PUCA 4LYHA 2P3LA 4X92A 3Q6NA 1JFSA 5KWSA 5B36A 2JARA 3NIFB 3KQKA 4GZ6A 5AVJA 3GUVA 3AP1A 3CLRC 3ZUPA 2W6ID 2ZSDA 4CMHA 2QROA 4Q7QA 2P68A 1VMAA 2YIDA 3KT0A 4H7HA 4QWWA 2Y2UA 3EF3A 4IG4A 1JI3A 1ESZA 4BB9A 1A88A 2IRWA 3ACCA 2QJWA 2RAUA 3EVTA 1GSHA 1PW5A 3KZ1E 4WKCA 3WRVA 5A5EA 2OM6A 2FFRA 2QPAA 3ICVA 3OPMA 3PNYA 2E4UA 4IIFA 3TLCA 1UEIA 1VB3A 4GLOA 2A3NA 6AT1A 2R87A 3NIDB 4JA0A 1K4YA 5CX4A 1H23A 1PZNA 4MWSA 2BM0A 3NETA 4V38A 4E1AA 3BJEA 4N0MA 3EZ7A 1TEVA 3RK4A 1U3UA 3B1KA 3PJDA 4CF4A 1HMPA 3DKIA 5G0WA 4G56A 3JRXA 3DF7A 2OBLA 4BC0A 2MDTA 5FWXB 3PQDA 1TUBA 1PJ2A 2VZ9A 3O93A 1J42A 3R9WA 4GBJA 1TD1A 2XZPA 2WQ7A 4FOLA 3ZWXA 3ZD9A 4TLEA 3K9QO 4EY4A 1SOMA 2MCFA 1WR8A 5JNVA 5J23A 3FBGA 4CXMA 1YS6A 5AKHA 1DDOA 1KVQA 1Y9DA 1Z8FA 1NXVA 5AT1A 1XGKA 1ZP6A 3O4VA 4RC9A 1TRKA 3AILA 2BR4A 2UUOA 4WOCA 2VAMA 1CQXA 5EE3A 4Y2VA 1P31A 3B6ZA 2P2LA 4XJTA 2XRMA 3KC2A 2TECE 2ENUA 1TYDE 2WJHA 4L1KA 4N49A 4LOLA 4OGGA 5CTAA 2BJHA 3RVDA 3ENKA 3SKXA 4AMYA 1P0PA 4PFQA 1Z0AA 1EEXB 2FPRA 1CS0A 4DA8A 2YNMA 2NT4A 3WDSA 3DZHA 5TNXA 5AXCA 1W7AA 1S2MA 5J59A 3KPWA 3UJ9A 1K08A 2RGNA 1QYIA 2V7VA 3X1YA 3OT1B 1H85A 3ED5A 3ETLA 4TL8A 5JW6A 3OIVA 4LZWA 4ND7A 1A2OA 4AK9A 2D00A 4L0CA 2P6OA 4TV9F 1D2CA 3BWXA 5C35A 2V7WA 1DJNA 5G02A 8ABPA 3MINB 3ID6C 2XDWA 3AB8A 1E6EA 1GUDA 2IZ6A 5AW8A 1Q83A 4LMAA 4YO8A 3AM1A 4PO9A 3TOZA 2D5LA 5C8VA 1E63A 1BX1A 4HKTA 1NW4A 2NZ2A 1M33A 2HK7A 2W0SA 4GBED 4P5PA 3NWBA 5EKTA 1UWLA 3COJA 4EEZA 3X0DA 1OFGA 2PMCA 3RAJA 3NM5A 1I0ZA 5EKUA 4E70A 1ZCAA 2XNDD 3QQ5A 1TUGA 2OD2A 3ELWA 3BN3A 4JDUA 3FVRA 1WF3A 3ZI7A 4AM8A 2QVGA 4K1XA 4R8LA 3JD4A 1QG2A 4QUDA 5BN4A 2YMLA 2FB9A 3A4VA 5ILQA 2O8FB 2IZOA 4F6RB 2XQVA 2VQ6A 3T9EA 3UJPA 1HNXB 1KJZA 5C3UA 1JA0A 3UKDA 3W5JA 2B7CA 3SYKA 1GSAA 4YRPA 3RKSA 4YRLA 4F5WA 3OE4A 5EP2A 4DQUA 4TPKA 4C1BA 2OBXA 1MOPA 3VHLB 5EIFA 1IN5A 1C1DA 4KPEC 3B60A 1R4AA 1ULSA 4OF4A 1VPTA 1AHIA 3M6AA 4XB6B 4OOEA 2HU5A 4X3CA 4CKEB 3I53A 3BG5A 4P08A 4QUKA 5IBQA 3UXMA 4UM5A 2D4AA 4GI7A 5CYPA 4I4NA 3D3NA 3MG9A 3AIIA 5HEKA 4J1NA 4QZVA 2BY4A 3EEQA 1HGXA 1YQ9A 4QASA 3RW9A 1FQWA 2H1SA 1FLVA 1HA3A 3PQ8A 3P96A 4UNPA 2VUHB 2ONYA 3K1ZA 1B0PA 1JHUA 4XYBA 4YQZA 1OH5A 1WZUA 5IXJA 4RTJA 4DA6A 4RFSA 3HHPA 2I6UA 4HH3C 4UHKA 4DWWA 5FBVB 1Z0KA 2V6FA 1KZ7B 3S99A 1CQJA 3UEOA 1GCOA 3QLUA 1HE3A 2ZYTX 3FPJA 3QG5A 4QDTA 3INTA 3R7FA 5H4GA 4V0LA 1XV5A 3BSSA 2QT1A 3VDNB 3L5KA 4HX5A 3R3YA 1CFJA 1BXRA 2IHBA 3ZTYA 1IY8A 4P0PB 1NJ6A 1F8UA 2YJ4A 1Z35A 4QUIA 1GT6A 2DT8A 4XD7A 3RG2A 4EKIA 3SU8A 1XNRB 2AV6A 4R6XA 3TGPA 2Z8ZA 1EFPA 1TMKA 1OJ7A 2CNOA 4I6JA 3BGOS 3ZE8A 1Q1BA 2IXEA 3IKTA 1V9CA 2C29D 4EHLA 3G0BA 4R01A 3U0BA 3SC2A 5GVSA 3CZQA 1KFBB 2NIPA 1UIRA 2NXJA 3LO5A 4K87A 1UBLS 3VXKA 1JH9A 1SUCA 3LHKA 2BKXA 1VJCA 3EN0A 4G97A 4JQZA 3WWPA 2CHFA 4WDQA 5F2OA 3U3ZA 3OFVA 5JD6A 2Q5EA 5HHTA 1U7UA 1MGOA 1XD8A 2G88A 1Z3IX 1YI1A 2W8BB 4X7PA 1BCRA 3MMPA 1GL3A 3W7AA 3TZCA 3P4YA 5C81A 2BEVA 1NATA 3IAFA 1KAOA 2R2GA 1QCYA 3OCJA 2ID8A 1WM1A 2O7RA 3MEQA 121PA 2B83A 3WL8A 3DOCA 1RKQA 1YS1X 3DDWA 2PS0A 3T06B 2VA8A 2NYVA 5F5NA 3HNRA 4YJFA 2QRJA 4YJ3A 3E3LA 1FTGA 3Q0IA 1GRQA 1PJQA 1V3TA 2BV3A 3A1TA 1ZL2A 3OZSA 4PX2A 3ECCA 1GG2A 4C4RA 2IH4A 1GGVA 3THRA 2ZYSA 2RHOA 3Q8XB 4GXQA 4XEUA 4NG4A 5DISB 4EG0A 1II9A 2H2FA 1PDWA 1QXSA 4NFYA 5SICE 3WICA 3EIUA 4C01A 4IJUA 5CITA 3IEMA 2POCA 3AVUA 4HQKA 1VG9B 4J91A 1R5BA 1XMIA 3N53A 1FP2A 2PJUA 4GRAA 3NLLA 4BN4A 4W5QA 1VPLA 1P39A 3PWSA 4AIIA 1XPOA 1GLGA 2DQYA 5CMLA 1NY6A 1CEYA 5CK5A 3ZVLA 3HY4A 2ZWVA 2F4NA 1ZRHA 1I9CA 3A6ZA 3K73O 3OZBA 4GUAA 4NCHA 3NYIA 2O20A 4OYRA 2AB0A 4YJ2A 4QICA 3GU3A 2A5YB 4QYMA 1BN7A 3T5BA 1WW2A 3W6OA 2IF0A 2PZLA 2PTHA 2Q2VA 3H99A 3PQ3A 4M89A 3VZRA 4KX3A 1TTHA 1USIA 3FWKA 3DNMA 3VSDA 5CM2Z 4AS1A 3E8XA 1E2FA 3M6XA 3JYNA 3E4DA 3D3QA 4YQEA 4UE6A 3NC4A 5BWBA 4Z4GA 4DR4B 5LOVF 4PEVA 3KNZA 4NFSA 1Y82A 3IEIA 4RVGA 2WRZA 5A1JA 3C5EA 1VPDA 4UQLA 4DEVA 2J9YB 1Q2UA 4LG1A 2J9FB 3B5EA 2GJKA 1LDEA 2TMDA 1QRTA 4HXEB 1T4MA 2O8EB 1PGOA 2OCGA 3OG9A 3S8YA 1MOSA 1TA9A 3O6VA 3P0RA 3PX2A 1YBHA 4PU0A 4IDOA 4WCVA 3SWWA 2O8BA 4H3HB 3O4FA 2IELA 1IWOA 4XIFA 2ZJ8A 1XTUA 3IIJA 4FDUA 2IQ5A 3GFRA 1A8UA 1AZWA 1ZGHA 2W2LD 3FSGA 2IS1A 3QKIA 3U44B 5F3WB 4Y67A 1I6MA 5EG5A 4B7CA 1V7ZA 4IICA 1QZ3A 2BFWA 4D3SA 5FOVA 3F1KA 4G5GA 4NENB 3K1AA 1N78A 1V2GA 3DCJA 3EOBI 3SAJA 1DJPA 1XZHA 4F9EA 1MIOB 1FMLA 1T8UA 3G0DA 5HRUA 1W19A 1YQUA 1D9XA 1ZW6A 3L7CA 3TQTA 2BHRA 2VT7A 5HFAA 1WBBA 4CTJA 3G1UA 3HJGA 2FE1A 5FHRA 3W77A 1SUDA 2IYVA 2VQ3A 4IMIB 1PJ3A 4BFXA 4ZYWA 1NQ5A 1P61B 3FTFA 2ZWMA 3KCNA 3LFHA 3PGJA 1MB9A 2JHPA 4IYJA 5CIWA 4RYDA 2A92A 5LPNA 5DF1A 2IX9A 1VSTA 4QVKA 3IUBA 3PWZA 5CEJA 4ZYUA 1GCIA 1HPLA 3E61A 1J2JA 5AM2A 1CIVA 3GK3A 3ZWPA 1QM5A 3IPAA 2D5IA 4LXUA 4AQYB 4TTPA 1RPZA 1M66A 1R00A 4DR1B 5E4JA 2BH2A 3AUYA 5ETJA 4AY4A 2JD2A 7YASA 5G0TA 1NBMD 2C61A 1OC2A 2GHQA 2H1HA 1T3ZA 2PYZA 1KYTA 4ZKEA 4E31A 4F8EA 1WMFA 5CJPA 4YECA 1LKZA 1FX0B 3LPNA 4TWRA 3Q15C 1P0QA 3CV3A 4TQAA 2R7MA 1UKAA 2C2ZA 3WGOA 4KEAA 4B3HA 2BFBA 4E51A 4E0BA 1E3DA 1J24A 3WGYA 2VSNA 4WBNB 4BNDA 1TLFA 2VJAA 2DR0A 4B35A 2YY7A 3Q7IA 3GQBB 4R2KA 2VWQA 1Z9BA 1Q3KA 2JDIA 1YB4A 1XCJA 2V3VA 1SG6A 2RGAA 2A5FA 2VC2B 3GV0A 3HEMA 4JGGA 1J8MF 3TSCA 2J41A 1T3GA 3NFRA 3VC3A 3WB2A 4N6OA 1KXZA 5T4HA 1QHFA 3BJZA 2DUWA 2WJVA 3G5MA 3OIUA 4QM7A 4EFMA 1NR5A 5ERGB 2FR1A 3EUFA 5ESXA 4A6XA 2RH4A 4JVNA 2ZIAA 4G5OA 4ZANA 3RANA 3WMXA 2FETA 4TL6A 4DTCA 4WERA 3F5QA 2FHPA 3EG5A 3T5CA 2BC9A 4D8TA 1USUA 3AVPA 4OO3A 4YJ2B 3VTFA 3AY3A 1E3JA 3KKKA 2QLLA 1CF9A 4WFQA 4UM9B 3CUSA 2GEDA 4RH3A 4Y9DA 3J81k 1XAIA 1R3UA 4QTXA 4Y0NA 2EZ8A 1DT3A 1K6EA 1NVKA 3QUQA 2VHQA 3PXAA 3BDVA 4YC7A 2BGNA 1FFYA 3CPSA 4XDYA 7GPBA 3TR6A 1E20A 1XB2A 1U31A 4XDGA 3RVNA 2C78A 1RYBA 2PX2A 3KTDA 1WZCA 2MWMA 5TEWA 3K0AA 4V1CB 3TIFA 3ND8A 4R8VA 3R75A 5M7EA 1W0KA 2LRHA 3GLQA 3SJCA 1WMEA 4EHBA 3G6KA 2GM4A 5EJ2A 4ZMSA 3I2JA 4O4LA 2QPTA 5K3OA 3DZFA 1I4LD 3NM6B 1U1FA 1FBTA 2VBCA 4CKWA 5E6UA 4ENQA 3DYBA 2PVPA 3KWFA 3ZDQA 4I14A 4LW8A 2FN4A 2VRWA 3IQEA 1GP2A 1TO2E 4OG2A 3KR1A 2EARA 2VCYA 2QRUA 1KZ4A 1E1NA 2QYOA 3LZ6A 1RYFA 3QBTA 3WB9A 2I7CA 4LPKA 2XIQA 1JKJA 4O4JA 1C9YA 2AKYA 3AUUA 1JR3E 3O8QA 3ZHVA 4CCYB 1CVRA 2PMFA 3A9VA 3B9QA 3IMFA 1OPXA 3NI2A 4V0MA 4HDSB 5K0FA 1M8GA 4DPLA 5GTDA 3J7TA 2AYZA 4QE3A 2XV1A 4BCCA 1K4KA 1UDCA 4OMFG 2ZWOA 5CM8B 1ZKDA 3LLCA 1HORA 1DL5A 1FDIA 3MERA 4QRHA 1NF8A 1CTQA 3IEPA 4UBJA 5KTTA 2CFSA 5CXUA 2H2IA 3UWDA 1LSSA 2EBWA 3VTAA 3ZEAA 3ZI4A 4HDKB 1DKRA 5CCEA 1YR3A 1Y1PA 1TJ5A 2C5LA 1U1CA 2OGWA 4CRWB 3WIVA 4OQXA 4I1PA 2A0UA 1N8TA 4BZWA 1AXGA 1BW9A 2J0QA 2JFOA 1GTG1 6ADHA 4PBRA 5E8JA 4G85A 4QFCA 1EUQA 4D4HA 4OSPA 4RE5A 4ZYVA 4EO4A 1ZI6A 2EKBA 1W1IA 2IYFA 2XTZA 1OGIA 4OI1A 4BUZA 3VZCA 4QOHA 4DLZA 2DH5A 2GHTA 2XUQA 3EF0A 3H2ZA 3DBHA 3IJRA 1G2OA 3CG0A 2VDWB 3H17A 5THKA 1YJQA 3M9XA 2CLLB 3ETGA 1PFUA 5K6AA 2E4AA 1C4WA 1CULC 1I3CA 2BSQA 2FDRA 4LXTA 5ADUS 1SPBS 2DETA 3IQGX 3UAOA 2HW8A 4WN9B 4AQDA 4ENPA 1ODSA 1T2CA 2P4UA 4TT3D 1EE9A 1V26A 4X84A 2C4KA 5KVVA 2VF5X 1WO8A 4JBXA 4UUAA 3GCDA 621PA 3C48A 5HYVA 3FETA 2BCJQ 4DC1A 3MAJA 5KVSA 3E5HA 3V8QA 4YGXB 5KYXB 3ENVA 5AVVA 5E4TA 3PIDA 4KX5A 2Z56A 4D80A 1F7VA 2A4MA 1KF0A 1T13A 4KE8A 2YYSA 4B09A 4U39A 3FCSB 3UHJA 2PY6A 1CV2A 1RWMA 2VZ8A 4HX2A 4HDNA 3ZVRA 5AFSA 2HSEA 2OC4A 5CT8A 5CCXA 2XBMA 3MAAC 3ZHYA 1WABA 1O96B 3EDRA 2IOFK 4ZC8A 4MUHA 5EQTA 3KSBC 1Z13A 3W1EA 2WWWA 5FOSA 4L4YA 3AHHA 1NX6A 4BO1A 3ZX4A 3N39C 1NLZA 4LK3A 3ZK9A 1OGJA 4LKRA 2NLOA 2PBRA 2XIJA 1V3UA 3OMXA 2C4WA 3HCEA 1W5BA 5DM1A 3VPDA 3SN6A 2EZUA 1Q7CA 2ZEJA 1OH7A 2GN0A 1M83A 1BG6A 2Q4RA 5CYOA 5E2IA 4ARSA 1YB1A 3NO4A 4UHCA 1QKJA 2BHNA 1SCDA 3FOAA 3E6AA 4FX5A 4ITVA 2FSHA 4PFJA 4KOEC 3S1LA 3NHZA 5EPUA 1QV9A 1PEYA 3PC4A 4AG3A 3WK7A 1UKYA 4OHCA 5E6RB 2HO4A 3HCWA 1V6CA 4MIYA 1EG7A 3EODA 5EHQA 3IIIA 3WZMA 4IPTA 1N6NA 1O97D 3C14C 1XYYA 1LPSA 1RQNA 2PXHA 1T2DA 3OUZA 1VG0B 3ZNQA 2XUKA 2PU7A 5B3JA 4B3CA 1BZYA 2Q5QA 2WIKA 4CKWB 4CMEC 2ZS9A 4MV7A 4YO7A 3QH4A 3V9PA 1X1BA 4RELA 2ZANA 2FPOA 4B4DA 1TCAA 2ZJ5A 3QVLA 4PM4A 3TM4A 4XYEA 1NE7A 3SKVA 2RDMA 4JJ6A 5U4XA 2OHFA 4PGAA 1K8XB 2B4KA 5IS2A 4DV3B 1KYIA 2F8TA 1BVUA 4F85A 4RHTA 5LZ7A 2CVHA 2WK1A 1Q3TA 4ZCQA 1QH8A 2PM8A 5B1YA 1KJQA 2F3RA 4M4SA 5F1PA 1YVPA 1WP9A 1L5QA 3F6EX 2JZCA 4M98A 3BPSA 1GPYA 3A36A 4RVNA 1Z63A 3N86A 4EJ2A 3VV2A 5IPFA 2QVZX 3E9QA 3NTRA 4QPCA 1JP7A 4KQXA 4G24A 1L4KA 3REFA 1DUVG 1A8SA 1L4GA 3SYRA 1MKYA 2I7DA 5F52A 3WBKA 1GUFA 2K7FA 2HMWA 2Q9UA 3WNDA 5K8LA 2YRXA 2AFIB 2HLPA 5IAJA 2UYYA 4BBPA 1ZS9A 3FDXA 1NWHA 4LHVA 4AD8A 4KFCA 2ZREA 1DEHA 4PPFA 3UHAA 5CHEA 1XQXA 2C1XA 5FF9A 1P9NA 1KY5A 1Z6QA 3LF2A 1MBZA 3HPQA 1UDBA 1AJEA 2PQ6A 1E3IA 4YBZA 4PHTA 5AJZA 4UU0A 1WMBA 2XH8A 4TOIA 5ABPA 4B83A 4N76A 5HBGA 3ZDZB 1Z0SA 3UNXA 1X77A 2W2LA 2H5IA 2ZSJA 4KO8A 4XIGS 1GQQA 1YHNA 5FUBA 3W06A 4NMMA 4PXAA 4BJ5A 5IG2A 3T7AA 1RPJA 3BGDA 3AI7A 3L9XA 4GH5A 4LJAA 3VJKA 4ZEVA 3U49A 5LZ2A 3WLPA 2PVCA 2WKQA 2XPCA 4OV6B 4ZT4A 3TN7A 2FW6A 2JIBA 3QKRA 4J7CA 4HDRA 3FCUB 3G9XA 1FA9A 2GNAA 2OLKA 2WJ6A 3W79A 1OBOA 3ZXXA 5HIMA 4DZTA 1X1QA 4EG7A 3BB4A 4B6OA 4UU7A 4UTNA 3SS7X 1JG1A 1QFZA 3CGGA 3HCDA 5LM3A 1DXHA 1T34A 3HUTA 4YDQA 4E1BA 3CJTA 2GHRA 1G55A 1LBEA 4XZ3A 1BWQA 4OQDA 1JIIA 1FFBA 4JBWA 4NBNA 1RXIA 5BVGA 4NCAA 2ZIUB 1TC2A 5ICCA 3K2IA 1CHDA 3T7DA 4MGZR 2QJOA 4JYCA 1XRJA 1L8OA 1EDBA 2J7KA 2MYNA 3P0EA 4Q3OA 4TMFA 1P7WA 2IHVA 4U2CA 1FIUA 3ROGA 1UFVA 4FFBA 4P0QB 5E6SA 2OHJA 4UFNA 5GM2A 1ZXBA 3PNOA 4I1UA 1OZHA 3HCPA 1JXMA 4CR7A 2XADA 1C7IA 1QF6A 1EVZA 2FA9A 1ISSA 2I29A 1OHHD 1G21A 4A1FA 3CPEA 3M4JA 2AC7A 2NUPB 1CZHA 2QM7A 5JRJA 1M2HA 2XVAA 2DSNA 4FBGA 1LZKA 3BRWA 3DL0A 1Z6PA 3QKSB 2GBIA 4FNOA 3PK0A 1DC8A 2GTHA 3OZEA 4P5EA 3O9VA 3TIGA 3ZGVA 2X9QA 2IVZA 4DADA 4DYVA 4J07A 4MA5A 1XRNA 3GZNB 1VRWA 4AS2A 1SHLA 4YRIA 2R6CA 4OP3A 1L5VA 1U2EA 3ZR4B 1E59A 3AR6A 1EP3B 4DQKA 2O8BB 4MYDA 3PRKE 2Y1FA 1J6UA 4YT8A 2GYYA 3K2QA 2DWOA 3NRJA 3P9YA 5ALGA 2XCLA 5A71A 2NNLD 1AQ6A 3HYRA 1QIMA 3OQBA 2BYTA 4OHVA 1NBOA 1KEPA 2CXUA 5INTA 3ZVMA 1UP4A 3EW7A 2QXTA 1Z18A 3PRYA 4HADA 4U2KA 4UVEA 5I47A 1M2WA 1JR2A 3RSOA 4ZI7A 1BEEA 2CXXA 2BFDA 4G5SA 4D4IA 5F64A 3V9AA 4YQFA 5JXWA 5D86A 4ZU6X 3W8RA 3BMNB 3K53A 2R3SA 3B6MA 1T9DA 1W5FA 5ALWA 2C9CA 5HILA 1V0JA 2C98A 3AEZA 1IQRA 1A9SA 1WXQA 2O8VA 5GINE 3SHOA 2WHEA 3P9KA 3P9QA 4YRCA 4UXIA 1SVMA 4EL5A 2ZPTX 1G21E 1QC5A 5HPYB 5DP2A 4MP3A 4MIEA 5YASA 1HQDA 3H2KA 1E3WA 3QQPA 4GQIA 3H65A 1C8LA 4TLCA 4DJDC 3N8GA 3FGZA 4COOA 2J3EA 3FTQA 3IOMA 3L7JA 1TZKA 3UWSA 1NW6A 3KYDA 1WZNA 2IOQA 4QOJA 4R1PA 1PNRA 1TTQB 4RFVA 4H7EA 3PP8A 3BWYA 4KNWA 2Q5CA 4P22A 1QFMA 1QVVA 3B9RA 5EIAA 3BIWA 3A7DA 4P4UA 1PT8A 2OBBA 1A3CA 2JATA 2WJWA 2ZKIA 3AXTA 4HDAA 4PFKA 5LA6A 3T7EA 5BP7A 3DZDA 5BW5A 5I7WA 2WYWA 5JFTA 2OA0A 2QG4A 5FI1B 4X1OA 4QO7A 2HSWA 2NO5A 1DBVO 4UATA 4B3SB 1XTTA 2X19A 2Y6UA 1DTEA 3I92A 1E4EA 3L8DA 3BCSA 2GK3A 3AETA 4EHFA 1XFAA 3C6BA 2WM2A 3ITNA 4L8VA 1ZBQA 1WX1A 1P91A 4L28A 3Q9SA 2QW8A 3ANYB 3RPEA 5KTMA 1M74A 3DVRX 3HZOA 1VPWA 4EIWA 1U65A 2XSZD 3DBLB 4FGZA 5C7YA 2AKEA 3G13A 5COAA 3ABOB 3D5QA 4M0MA 1IVYA 1T8WA 4B3FX 1XT6A 3JV7A 2GA9A 3LBIA 1V1MA 4M0DA 3RK0A 3ROPA 2XF8A 2Y4OA 1HETA 3KEOA 3II6X 5IJAA 4M9QA 3QBDA 2J7PA 2JRCA 4KRFA 5DYGA 2OENG 2F00A 2M6SA 4MUJA 4XOIA 4XQCA 3K20A 5DBFA 5LDGA 4B7XA 5DN6D 1ZM3A 4DNFA 1DKNA 4N39A 5AJXA 4IIBA 4RPCA 1X7WB 3RLFA 4GPBA 4XQ9A 4ZEWA 5B3JC 5TX7A 3DEFA 2FX2A 2PWZA 4QGBA 3QNMA 2XDQB 1HMYA 2ZTMA 4K46A 4YAJA 3UMSA 1XLTA 2RAPA 2H85A 1LLQA 2OFWA 3H1FA 3U9TA 3V4VB 3AKEA 3ZHTA 5AVXA 4EABA 3C24A 2XNKA 4KPFC 4PNZA 4HZUB 4H1TA 2QMQA 3PG5A 3N7TA 3QXHA 3PLRA 4CMGA 4QGAA 1AKWA 3IURA 1UDXA 4FSHA 4IDDA 3M9WA 1DKUA 4FKBA 4WN3A 2VAWA 3AHFA 2H17A 2W6IA 3A06A 3N3AC 4RFLA 3WLLA 5ITWA 3DPSA 3O4GA 4B3JA 4BO9A 2VG8A 4WZAB 4YJDA 4ENWA 1KI4A 2I62A 3FPLA 1U2DA 1L6RA 4TRJA 1U7HA 1M6VB 4BLUA 1H66A 1WUYA 4ZWNA 2XE6A 1G16A 1KYWA 1NOIA 1KR5A 3RRMA 2X4DA 3HC7A 3RJTA 4OMCA 3IUNA 1E2DA 2P4QA 1UK8A 4P7FA 3WOHA 1TCUA 4BNKA 3DDHA 4MYRA 3RS9A 5GZ1A 4F97A 3VU8A 4NBLA 3UMVA 4GE3A 4B73A 4N5DA 3LK6A 3JWHA 3N0RA 5TS2A 4KO4S 4YN3A 3MPUA 3KD2A 2VYQA 1SKBA 4RIHA 2WAMA 2SNIE 5DNAA 1T8TA 3ZHOA 1XI2A 2NPFA 2VVTA 4P83A 1R9NA 3LP8A 3HB7A 4CN8A 2P79A 3EQ6A 4JI1B 5JZ9A 2Q3MA 4DSTA 3IUYA 4C7BA 5HOQA 3WGZA 3GHYA 4XGQA 4YLYA 3O47A 1M1XB 1QMPA 3OX1A 3IHLA 2C2YA 4O8CA 2RAVA 3AH8A 3T7RA 2JH8A 3OIWA 4KXNA 1XTIA 5GOZA 2JCXA 2PGLA 2MR6A 3QLTA 2W6QA 3AUSA 1G3RA 1N6IA 1TVKB 5DHQA 2HV9A 5E9QA 3X2EA 3G5UA 3F4BA 4XUCA 4GFDA 3CNHA 2PX3A 4QYIA 2QB5A 3OBIA 2PL9A 4IEIA 4LE2A 3W8NA 2EWMA 5LZ9A 4RZUA 1RVV1 2HQ1A 1XDBA 3K70C 2IYNA 4JR2A 3CISA 2ATIA 3M5CA 2EIXA 1R18A 1GTVA 3BKWA 5DNEA 2EIHA 4K26A 2AI3A 3BJIC 1XQ6A 1GNSA 1SBCA 4YAIA 3AETB 2C4HA 1U1EA 5EUBA 3EXIA 2RB5A 4L0QA 3H2JA 4J0EA 4RMGA 3RG8A 3W9YA 1O58A 3D7RA 3ENNA 2XB4A 4N5NA 2VNHA 3D2BA 3IP7A 3AR5A 1VKOA 2QPOA 1W5SA 2JJQA 4P9NA 4Y2PA 4CKCA 1TMYA 3FBWA 1FFSA 2R97A 3CUKA 4WADA 4Q4HB 4JAVC 2H08A 2V5UA 4JI8B 2ZBDA 3P9XA 3G0IA 2OECA 5TGZA 5SZKB 3CVWA 3I52A 2JLVA 4CETA 3R9XA 4UUOA 1TO1E 2CMGA 3T1VA 2JJ2D 4JUDX 1D3AA 1E4OA 1FP6A 2IDMA 2DQZA 4J1SA 4JCCA 4X1YA 3ZK8A 3TQCA 4JKYA 5BUCA 1M34B 2C5SA 1EM8A 2R4UA 3EXHA 3JD0A 2DC1A 1C9KA 2GETA 2P9EA 4AXBA 3R5JA 3SF8B 5E9WA 3IODA 4RVHA 2Q45A 4MCJA 2MSDB 4GKVA 3RS8A 3OD5A 2B30A 4KLCA 4IRUB 4DNPA 2ZSUA 3M5WA 3GLGE 4RNDB 4D8YA 1QFYA 1Z25A 4JYBA 5AHXA 1S6YA 4IBOA 4X8OA 5DI3A 2PH5A 3L1VA 5FA8A 3KJNA 1VJ5A 4XD2A 4P81A 2PA0A 4MPTA 4XQGA 2E5LB 1E6MA 3CVJA 1I7SB 4MVJH 3EGOA 5LMUB 2C4NA 3UA3A 2QM3A 4UD2A 1YZVA 1YQGA 1DQZA 3RCBA 5AUNB 5JG7A 4F2WA 1FVXA 1FU7A 2DQKA 3GDFA 4XQEA 5JRZA 5TSDA 3LMKA 1ID8A 2L19A 3A05A 3L8YA 4RLSA 3AHEA 3WV5A 1W4CA 2J3JA 4NE7A 4PCAA 1H1DA 1UBNA 1KSJA 1O94C 2AN1A 1DE0A 3LX8A 4KAJA 4O1HA 4KHPB 4UULA 3PU6A 3G82C 3WIEA 4DIMA 3CO5A 3PGMA 2ONKA 2BE9A 3MELA 4IGKA 2QTVB 4OHUA 3K2EA 3FUXA 1E62A 3DA8A 2PGDA 4NL4H 4UE2A 5JCZA 2IS4A 3W9UA 3MWEA 3AKZA 4JI5B 1EB8A 4XH9B 5EE1A 4M9CA 3RS7A 2X76A 5BQFA 3LXRA 3RFTA 1P1HA 4LN1A 2XYVA 1A95A 5G53C 4QUEA 2BUCA 1JLHA 2OYCA 2ZAMA 1Y1SA 1B3RA 4Z86A 4LKOA 4EVSA 3QA3E 3EOZA 4HPJB 4QBHA 2NT3A 1R3DA 3GZTB 4N0EA 1IN7A 1QYVA 1G0NA 2W6MA 2BEKA 4O4HA 4U2DA 3RARA 1W29A 1T0BA 2OB1A 3JTEA 1W1WA 4HAZA 2QRHA 1V8OA 3I3SR 3JQBC 2YRFA 1DBRA 1R0XA 2GPYA 5J1TB 3QPBA 4C78A 1IU9A 5I5EA 2VXYA 2LWIA 3ROFA 1CX9B 3KSAC 2ASVA 1ZH8A 1BQ4A 1D2HA 1ZQ9A 3ESYA 1UJCA 3I34X 4LTNA 3MNFA 1J49A 1L4BA 2XKBA 3CLVA 1IOLA 4INPA 3G8CA 4MRVA 3T7KA 4A3SA 1GFIA 2XRZA 5E3IA 4JT2A 1FS6A 1GV0A 3I6BA 3NWOA 2QRZA 1QCZA 4F60A 3KJHA 4W5TA 4PVDA 1HLFA 4R41A 1VJRA 3U5ZB 3ZWBA 3I76A 1YR9A 1Z68A 1LX6A 1Z2AA 4XX0A 4ZT7A 1OIVA 3CR3C 1E0DA 3SDZA 1U4OA 4MROA 3DMHA 3F7TA 3IILA 3K31A 2LV8A 3MC1A 5T3YA 1AUXA 3DGEC 3F49S 3K2BA 4K9SA 5KQPA 3I0NA 1GJRA 4E4TA 3OQOA 3INGA 1WJGA 1W25A 1W4ZA 4NR0A 3EWAA 4AMVA 3A3KA 4QREA 1Z75A 2ZIXA 1CUVA 4N3BA 1NF9A 3LBYA 4WMLA 4DCVA 4WZZA 3OIFA 1JUDA 1DSSG 1XNGA 3QJGA 3QWHA 4EL0A 5DVZA 1JG4A 1R8SA 2HCFA 3EC7A 3P2MA 4QULA 1TKCA 4RA6A 5JUWA 2E7ZA 2PV0A 5JAPA 1TLLA 1XRMA 1DBWA 1AMUA 1NW5A 1GAQA 1IFXA 2P4SA 5K0NA 3UMCA 4KWHA 2J3LA 4XE5A 4F2DA 2Q4OA 4NEHB 2YV2A 4UFPA 8LDHA 3AHDA 4R8MA 3GNTA 2PFSA 4M49A 1GADO 1WMSA 2O19A 4IJ5A 3OH8A 1R10A 1D5WA 3QVXA 2VZEA 3DZGA 2QQEA 1ZC3A 3IA2A 3M8KA 1H65A 1PGPA 2G36A 2OBFA 3HPRA 1L7VC 3Q1KA 4MKIA 4P31A 1I1NA 5JO9A 3LIPA 5C31A 4G0WA 1VRCA 2VP4A 4DS3A 2LW7A 5EWJA 4BKOA 4C3VA 2XT0A 4M9RA 1CJVC 1Y8QA 2GN4A 3NP7A 5H02A 4AJNA 3PB3A 5AVYA 2WEKA 2QD2A 1FP4B 3JYOA 4JEMA 1CY1A 4YAUA 2I6QA 4J0CA 3LCUA 4XVCA 1H1LA 4ZGWA 1M8FA 1YU6A 3AINA 3R6GA 3R77A 4PSVA 4NJMA 3SZ3A 3H13A 2JLSA 3IBCA 4IGFA 5JC8A 1PF7E 2QN7A 1LV7A 2VUSA 1JA9A 2F62A 2GXSA 4I2VA 3B6JA 3TG8A 1NVUQ 2HHJA 3N7UA 1XD9A 1IJFA 1FY2A 2UZ1B 4DV1B 4TZ0A 3GLHE 4MVJP 1A8QA 1IB6A 4LBYA 2BGLA 5JNWA 3E9DA 1SM4A 2D0OB 3DKKA 1JFLA 2MINA 4DEXA 2FMUA 4L16A 3GJTA 1A2QA 5H81A 3L0CA 5ALYA 3HJHA 4TKVA 4GLFA 2ZYVX 3QE3A 4TV8A 2PIAA 1MC5A 5BSFA 2B25A 5HQJA 4X1KB 3K4QA 2FSVC 2FU5C 1ICIA 2YWHA 1KERA 3CR8A 1X13A 3BFPA 3I9FA 4EI8A 5AM0A 3TJRA 4CEHA 4HN4B 3MQFA 4H59A 3BDIA 5G0VA 3VR6H 2H3HA 4ZO8A 2I9PA 3O7WA 3TLEA 3C8DA 3FMOB 3URMA 2KLBA 2Z8YA 1IG3A 2QR5A 1MIHA 5A4JA 4JEUA 1RAAA 4RPIA 4XGNA 1RCTE 4RLFA 3ZQ6A 4HEJA 4DLAA 1Q91A 1A0OA 4CM5A 3LY7A 3O4RA 4LQDA 3UBMA 3ZZ0A 3E03A 4LZZA 4BBZA 1O95A 1XKTA 2Q5OA 1ELOA 3EWSA 1G8YA 3C41J 3RUAA 3UG7A 3BCRA 1AT1A 5HBRA 4G0NA 2J46A 3NU1A 3HUFA 5SY6A 1AHHA 4LJ7A 2IYWA 3B20A 2HMVA 1FPQA 4TMVA 1Q15A 3IEVA 5CVCA 5ECYA 4NF2A 4F9GA 4YXWA 4OQFA 4DCNA 1R6UA 4I36A 2DP4E 4ZRMA 4RL6A 1DBPA 3UUEA 1RHKA 4FFRA 3TBKA 4DR7B 3LVRE 1O3YA 1NN3A 4C4SA 2ID7A 1M2VB 5C9ZA 5FNVF 1CNMA 1R0WA 4OQZA 3CF0A 4DBZA 4OSEA 4XB2A 5JEDA 1PUJA 4AN1A 1JB9A 5HCNA 1YU9A 2G63A 3HU1A 1SQFA 4WT7A 2IPAB 3AXSA 1I2ZA 2B2CA 2C9YA 3K9BA 3K0FB 2WWIA 4BX0A 3P97A 3A6KA 1ORRA 3SQXA 3PUYA 3EMVA 1Q44A 4FUQA 1JE0A 2HRDA 2FUEA 5ALEA 1XZJA 5F3RA 4B2YA 1U04A 1P29A 2IJGX 1UJ2A 2W22A 1XKXA 2XWPA 3K72B 4DV4B 2XQIA 2ZT8A 1DCKA 5B3LA 4RPLA 1I51A 4MR8A 5J4KA 2BMEA 5ALPA 3BL6A 3F0TA 4MJLA 4OUKX 3LY9A 4GPEA 3IRUA 1IBMB 1QMGA 3OX4A 1H6CA 4HTAA 4IXDA 2PUEA 4BNGA 1E79D 3DAFA 1RLJA 4Q1CA 4BMZA 1BFDA 4LK2A 1W49A 5FBKA 3AR3A 2REOA 3BTSA 5EE5B 2V7XA 4MHSA 5HKKA 5KCMA 4B17A 4Q6WA 4E5UA 5K6RA 4DMUB 2DHDA 5EXPA 3P5BA 3NQ41 2IPOA 1KHTA 5F5XA 1D2AA 4DE5A 2D2EA 2AOVA 4NE2A 4J1QA 1IM2A 2XNCA 4DVJA 3EBOA 4K9DA 4QAQA 2P2YA 3Q0TA 3ZE0B 2FZ4A 1VLJA 1K3UB 2FPIA 3F4LA 1LB1B 4LJ6A 3TBHA 5B58T 5FI5A 3OWXA 5H7XA 3EYWA 3IBSA 4K8RB 2PQMA 1QGUB 1HDCA 2WHXA 3JQFC 1I80A 3VVBA 4ATNA 3T3IA 4URWR 5HKLA 2B4YA 2V1UA 4ETMA 1EM6A 1J8QA 3KQOA 4XFKA 4XJVA 1QVWA 1SUEA 1GARA 1KBQA 2OL4A 3W8DA 1MJNA 1YNSA 4TKVB 3BK7A 4URUR 4QNMA 1JR3A 4H0NA 1E5LA 2HXYA 3LRPA 4ICIA 2FPGB 1SOWA 3K0HA 5GONA 1R9GA 3MRVA 1OV6A 4JL5A 3ETHA 2QSJA 1RNLA 3ORSA 4LMRA 2JAWA 4RNCA 3CONA 1R4MB 2YJZA 1SOUA 1IYZA 2Z9CA 3I4CA 5DLQC 1AU9A 1J2UA 1B1CA 3FX2A 2ZCUA 3GT0A 4TROA 1A5BB 4ASUA 4Y2UA 3FNRA 5JECA 2C58A 1UBSB 3A28A 3DOHA 4OH1A 1KJWA 1E3SA 5C8YF 1L1RA 3GL9A 3IUPA 4EBBA 4B6EA 1CZRA 3JZFA 1I7QB 1DAOA 3FWZA 1BFUA 4JOSA 3WVNA 1WPRA 4QVGA 3U6KA 3ETEA 1QQBA 4HGPA 2DUMA 1D03A 2X0NA 3H3JA 4EMBA 4GOJA 2Q3EA 4DCPA 1CY2A 4UHHA 1OXXK 1H2HA 2ZB7A 5CK4A 2XE4A 1QQ6A 3PD1A 4O33A 3QENA 2EYQA 3CF6R 2G6TA 4RD0A 3F7MA 1K9SA 4IQ8A 3ZHCA 4UQOA 2AVDA 2E4VA 2B1RA 2QF7A 4X1IB 1S8NA 3RFCA 3VDRA 1D1TA 1JDVA 3FB1A 4BL5A 4QLOA 1A71A 1OKKA 3BWVA 3GA5A 4K86A 4ZT3A 4YK7A 1DO8A 1URPA 4REMA 3OKCA 2ZIZA 3JW8A 4WX2B 4XSHA 5BSGA 1AKEA 4BHTA 4HNTA 3B1ZA 4WDRA 1UBHS 3QXJA 1JEAA 4FMBB 4RKYA 3OQHA 1UIMA 1GUZA 1SA0B 4HBGA 4R1MA 5P21A 4BFYA 1VBKA 1YQWA 4WCFB 4QPDA 2F1RA 3NHYA 1C5KA 2PZBA 3KOWA 1A9YA 3CW9A 2QTHA 4B46A 2XGJA 3HGQA 2JAOA 2Y9PB 3KYIB 4E07A 1LNZA 1NVVR 2HADA 3PDWA 4GP7A 4PZYA 4F6RA 3UPDA 2AE1A 4KYIB 4R1NA 4XIIA 4FYWA 1SQSA 1ADCA 5D1HA 4AY2A 1DCFA 5EEHA 3PYLA 1VIMA 4LV6A 3KJGA 4R3NA 4EJFA 4FX2A 2X15A 4FE7A 1PL8A 4ZOLF 1X1TA 3MHPA 4U7TB 2UXDB 1Z82A 4BMVA 3GMIA 3SZUA 5KHOC 4X6UA 1M3SA 1II8A 2K2WA 2M98A 4ND5A 3TRHA 1GQRA 1R6XA 1EFCA 3AJ8A 2QUHA 4TXHA 3ZU2A 1LI5A 1NMXA 3I5AA 4RD1A 2XQKA 3KL4A 2I34A 1IXKA 4UCFA 2L82A 2JCVA 3C1AA 4F92B 4FN4A 4FGWA 1G5TA 1Y7TA 4IVRA 1S96A 5K9ZA 3H1EA 3KSUA 1QR6A 3RHZA 5AM3A 1P2BA 2GEJA 2B1GA 4NK4A 5EMLA 2XUIA 4MDHA 4P53A 3EGCA 1C3JA 2B9EA 3LCVB 1XQVA 2IUSA 5HZHA 1XD2B 3WLIA 4HBZA 2XQFA 2R5WA 1P5RA 4B0OA 4TRNA 1AGXA 3VR1A 4NNOA 4ZAFA 3AU9A 3IUMA 3LUDA 2RGCA 2XRFA 4OI4A 3WBBA 1OYYA 1WVIA 1NBWB 1UZAA 3NXKA 5KO2A 3PDIB 4R1QA 4UCWA 1N2BA 2IT1A 4JMLA 2A0XA 1PQWA 3Q87B 4IRXA 2CXSA 2GILA 4NG5A 4NX2A 1YL7A 3U37A 2V3CC 1M0SA 1OWLA 2JJ2A 3O1JC 1IM8A 3JVEA 3PHHA 3F6PA 2P0EA 1WNFA 3HRIA 4KZPA 2OMKA 2I1LA 2OLJA 4K3UA 4DC0A 4QX6A 1TTTA 3QOFA 1LF0A 3IOCA 5LVAA 1RQXA 2W6CX 3FAKA 3ZGYA 5BNFA 1W0CA 3PYXA 1FXWA 1DTSA 2R7NA 3VISA 2B0JA 5HQ3B 4OKSA 1F0PA 2IOHA 1E0SA 3CCBA 4WJKB 1YS9A 2ZI7A 1ESNA 4HVTA 3DFFA 3EEBA 3WS7A 4IIGA 1AKMA 4BP8A 3DWFA 3T41A 4OJKA 1NP7A 3ND5A 5ENZA 3ICEA 2C00A 4X71A 4YH1A 5E4YA 4AF8A 1JHMA 5JAUA 4RULA 4C7OA 4KLZA 1TJPB 3A6FA 3DT8A 3MMNA 3SEAA 1ZK1A 4B7ZA 1C9JA 1G3IA 4R05A 3E1SA 3GCXA 5A9RA 4C2TA 3LWDA 2XUGA 4NBVA 2VT2A 4N6GA 1K8RA 1RLUA 5AXBA 3I2YX 1DAEA 3I2KA 3ZIUA 1P9RA 3I5MA 1XRSB 2JLCA 1MW9X 3O3OB 3CN7A 2PRZA 2AH5A 4E94A 3DFUA 3PIRA 2ZJOA 1GXSB 3AF3A 1U2GC 5TB5A 5AK6A 5LP6F 4H3VA 4CTOA 3IJPA 2I2FA 3UXHA 2GESA 4F3YA 2ZSHA 5ALVA 4XR9A 4LF7B 2NZUG 3L7BA 5NLLA 3ZJUA 2HTEA 1PJLA 4GC5A 4TLBA 2EOAA 3RC1A 1IPFA 1KDPA 2C9DA 2YCBA 3OFNA 4JZKA 3OTQA 1M6YA 1YDEA 4TQ9A 3AOEC 1GDDA 3NAZA 4WLUA 2OCDA 1GRNA 1MV5A 2EAUA 1M0TA 1GSOA 2AFVA 2QZZA 1O54A 3H9GA 4GSYA 4P54A 4R2WA 4AY6A 3H75A 4PYQA 2R7AA 5E2BA 4E7PA 3KT8A 6GPBA 3X43A 4LZOA 5AOBA 3V3KA 3L6OO 3RGWS 3RTAA 4GP6A 1UWVA 2C04A 4A8HA 1VE3A 1WWKA 4MS4A 4FFLA 5ALNA 5DNCA 3FWPA 3ANLA 1O08A 3UJBA 4IKOA 3L05A 4R0MA 2FW8A 1Z8HA 4DDHA 2GJAA 2RJNA 1DELA 1V1RB 4YYZA 3BE5A 2G71A 1UMBB 2J3HA 3KUKA 1W93A 1HBJA 4YRRA 4NBTA 1G6KA 2PBFA 3OM0A 1ZD9A 2TSYB 4GF5A 2IUEA 4B5KA 2IUYA 2YY6A 2O48X 1FBNA 2IHUA 3U31A 1AZTA 3AIMA 4IR7A 3VI4B 4ZPXA 1A9OA 1MD9A 1U9IC 3WQRA 3CVYA 4LXQA 2XW6A 1F5SA 3F6BX 3AKDA 2YOGA 4PLYA 2XHZA 3A4YA 1DWUA 4B84A 1CDOA 1SJ9A 3N07A 2RK6A 4QTYA 3CX6A 1FDWA 3DC7A 1XVIA 3ZVNA 1E9RA 2QNIA 1KQPA 3T5AA 3I9NA 5KQLA 1BROA 1J99A 1GEEA 5CDGA 1QAOA 1MC8A 4DDTA 1QFJA 5MFZA 4Z4FA 3IEUA 3PDIA 2A30A 4UHJA 1P4RA 4Y7CA 3WJ7A 4HB4A 3WB1A 3CSDA 2G08A 4MAFA 3TEFA 2O2XA 3IT3A 4LJ4A 3UV3A 3VKVA 3EQ8A 4XYMA 4BMDA 4BO5A 1ZUNA 1D6JA 1REQB 2HGSA 3HVHA 4EHIA 4Y2JA 1SKQA 2ZJ2A 1CIPA 3OJCA 2AMFA 4B3IA 2IITA 1JX6A 2OVBA 3HWWA 2ISCA 4MZXA 5A5FA 1N8NA 3RV3A 4C7XA 4ZGBA 3IKVA 4ZVMA 4V03A 5DYTA 1IUNA 5EMMA 1WDMA 5FH9A 5JYEA 1NVBA 2RKWA 4A1OA 4PYNA 2ZU6A 4LC9A 3B3GA 4RIFA 2JJ8A 2HSGA 1JSXA 2EX0A 1IIBA 2BMJA 2CSUA 3NHSA 2VJNA 3FOCA 1QP8A 3O26A 2QVYX 4NAHA 3GIWA 1XNHA 4GM0A 1VHDA 4TSFA 4HDMA 3SVTA 3AL3A 1JMVA 3FFTA 1XAHA 3N8NA 1FYEA 5K6AC 1PFGA 3DTVB 1J39A 3HCNA 2R2AA 5KBYA 1Y5IA 4B7UA 4NS1A 3I1IA 1AKRA 1QLJA 1Z6YA 5D85A 2I6FA 1SRRA 3UOAB 1GGNA 2X8JB 1YCGA 3L49A 3F6SA 4R8SA 1E2PA 3WTBA 3K1JA 1P6UA 3PEVA 3WKAA 1YCHA 3U60B 1IZ9A 2NWQA 2Z1NA 3E27A 1HYBA 2FOXA 3QX8A 3HP4A 4FMDF 2IODA 2WQ6A 1GU1A 4M55A 3SIXA 1Q1GA 3LT5A 2FPXA 4YACA 2JCGA 2JH3A 3GYGA 3KKPA 3ZD8A 1IHUA 6REQB 2Q1YA 3UV7A 2G72A 4LYJA 1O5IA 2CXOA 2R25B 3T1HB 2APJA 3OZTA 2GR9A 2QI9F 3QYAA 3L6BA 1DOHA 2PBZA 1RE0A 2OQRA 3M1AA 4D2IA 1EFVB 4H0FA 1RBQA 2W7TA 3HKEA 3MMSA 3WK4A 2IIVA 3AY0A 3PWKA 4KFUA 1SG9A 2ENWA 4U7GA 3UGKA 4AO6A 5G3YA 2IA5A 4C20A 3MJVA 4TVSA 4PZLA 1J97A 1PEKE 1S3SA 4E4RA 2E49A 2EQ5A 4QL3A 5ARDA 2LP4Y 5KYGA 4B8ZA 1AVTA 1ZK3A 1HYQA 2JAUA 3H7AA 1SXQA 3ZH9B 3ESCA 1XF9A 1YFKA 4IFEA 4MVJA 4Q3BA 4ZOAA 1W46A 2PS3A 1S7GA 3T6KA 1YZFA 3OLQA 2VUUA 1FTNA 2BFEB 1UQRA 3HKBB 1Y9AA 4JYPA 1XZAA 2YZ2A 3GPBA 1MPXA 4PV7A 5JV5A 2V7BA 2YV1A 2CXRA 3CX3A 4JASB 3AEKA 3NG1A 3U7EB 3TECE 1CUGA 3L0ZA 3ANSA 1XROA 4L73A 1LI4A 3BGVA 3FNHA 4HTFB 1YOBA 1ULBA 1OF1A 2DBZA 2Z4RA 3FYUB 3R7LA 1M2OB 4WHMA 1J21A 1M8PA 1JKFA 1OXBB 4IZ6A 4TS4A 5SZIA 3RBAA 2B6NA 1U7DA 4K6KA 2XMBA 4Y0AA 1RM5A 3L4BA 3BMNA 4BFCA 1S7CA 4G09A 1BDBA 2MMCA 1QDEA 2PG3A 4KI7A 3TG2A 2ZRIA 3QPWA 3QUSA 2IKQA 5IKXA 3MCTA 4YUYA 3R5TA 3ZCQA 3PEYA 3MJTA 3VU9B 4WSOA 4W1QA 3N2GB 5KDDA 4NRDA 1BCSB 1WPXA 1MC4A 4R84A 3EW9A 2GH1A 4FDMA 5BQPA 4CBVA 4MX8A 4YV2A 3NOVA 1X2BA 4GI2A 2IP4A 1TT5B 4FYKA 3BXOA 4US2R 3DOEA 2G5TA 4QEDA 3A9UA 1RABA 2XGMA 4KDFA 1MVLA 4UTXA 1E3EA 1FUUA 4OVKA 1RPNA 4HNRA 1GGFA 4KUGA 4YT5A 1AO0A 3DP7A 4TTRA 5CLGA 2B20A 3JVDA 3Q9LA 3JRWA 4AJLA 1R9JA 4GMXA 3NR2A 3TNLA 1H5NA 1J0BA 3L0YA 5CGQB 2P9YA 6NULA 2GN8A 4URYR 5DOZA 1VP3A 4Y6PA 2ZIFA 1SXJE 2D1TA 1QHNA 3EY9A 4ND1A 5EGSA 3VOSA 4F2GA 4DUZB 3O91A 4HRAA 4RO0A 1T1JA 2AFHA 1BWRA 1NMQA 3QKUA 1OBHA 3MUEA 1HL7A 3J7AC 3WTCA 5F23A 3UJ6A 4D57A 4MR9A 1Z7WA 2ZBEA 2BKEA 1PBNA 5E9JA 3LS2A 2BZ1A 1TPYA 1V39A 3B3QA 3H5LA 4PLTA 4ZQFA 4CTKA 4MWOA 1JDSA 3MQ2A 4G01B 4MI1A 4QU8A 5ICSA 2H1LA 8AT1A 4OFZA 5LD2C 1ZRMA 2PMKA 3LUFA 1P81A 1SU6A 3OF5A 2GFHA 4MP8A 2ORIA 4MR7A 1UUFA 2I7XA 5K3BA 4RVSA 3ZXUB 2QTGA 2D1SA 2PK3A 4BV2A 1LNQA 1C80A 9LDTA 3PC8C 3K8QA 2VHWA 3WOVA 2ORED 5B1HA 2VWGA 2NXEA 3JQ8A 3W4IA 4ADSG 1Z7YA 1D9ZA 1X7WA 2PZGA 5EP3A 3EUWA 4N40A 4D4KA 4AUMA 1Y1QA 2VO1A 4RV5A 1OLXB 3HXQA 4ZVLA 4L6AA 3RYFB 4CR8A 1CUJA 1XMSA 1O77A 1RWXA 3QPAA 4M76B 4RZSA 4ZTZB 4FR0A 1LNSA 4R1TA 1YT5A 1U2QA 1E9FA 2QL6A 2EZTA 3CO0S 4O6VA 3E1GA 4EECA 4V0OA 4YXFA 1CR6A 2A3RA 2UVDA 4NBRA 1DG1G 5JMOA 1K3FA 4FZJA 3ISJA 4RKEA 2J0EA 4A73A 3TLMA 1COWD 1PDOA 4NOKA 1FYXA 5B6JA 1ZU5A 4UNIA 2ZSAA 4AY3A 4MUEA 4GNKA 1CJMA 3S70A 2XWJI 3P0FA 4IDEA 4X41A 4RPJA 3G2NA 4V1CI 1Z8NA 3H87A 3I6ZA 5FXMA 1EHYA 2BFEA 3C7KA 3GEGA 3WXBA 4MKFA 4ALNA 4KQHA 4K6CA 4N1AA 4XLZA 4H77A 4BLPA 5FBLB 1L8AA 4AWAA 5IM4F 1DXOA 4PANA 4IQGA 3ZH2A 2H4WA 3Q40A 3EF1A 3RC8A 4DIDA 4IS3A 4DQXA 2RGUA 3HUEA 5CYFA 2J67A 1J1UA 2WTBA 1ENPA 3KJQA 3KXIA 4HO1X 4EYQA 3KT6A 2G40A 3DMPA 1FSGA 3T5PA 2AWOA 4TUYB 4YIHA 2PTGA 1UC8A 1P1JA 1AF7A 2C0QA 3VH1A 1XIVA 2XBUA 3W3AD 4F1WA 3QZUA 3C3JA 1FTQA 3HSYA 3S2IA 4X1KA 4Z3OA 1GPNA 2DB3A 2QW1A 1PV1A 1N0VC 4OLFA 3IDFA 1TM3E 3NTLA 2DFKB 2FSPA 4F9FA 5K8VA 2PUFA 3HVKA 3STUA 4YAGA 5C51B 2BI8A 4K5QA 3FROA 3NX4A 4L08A 1JSZA 5CX1B 4AROA 4GMGA 3O3CA 4ZXFA 2D2IA 1PWZA 3K0SA 1OXTA 1AGNA 4UJ5A 4B2IA 3LQ2A 5KI6A 3Q88A 2F9FA 2XD9A 2NM0A 4WXYB 3ZX5A 2HQBA 5M34A 1U5AA 2OV6A 4ZJPA 2QU8A 3KIPA 4MZDA 3WJAA 3UAVA 4JLPA 3HCAA 1SVKA 1UOOA 4V0ME 1JDBC 1SY7A 5JAOA 4RF2A 2ODTX 3JVUA 4ZHSA 2XDYA 3O1IC 4C89A 4D9CA 1Z2CA 3GMSA 1E1RD 3HR8A 3LSYA 4LDJA 4OB7A 1P1IA 3TL3A 1RT9A 3WHPA 5BOSB 4ER3A 5CEFA 4O4IA 3NT2A 3N8KA 4DIUA 2HIAA 1X42A 4ZAGA 1PG5A 4GPIB 5JFOA 3TR0A 1IHXA 1TEXA 3CZRA 4K81B 5LQSA 3RTEA 1N8KA 5H5JA 2PSHA 1YFLA 2OHHA 5H3LA 3CX4A 1VJGA 3EXG1 4E03A 4RV4A 3JQCA 4PZ9A 2N1MA 2IGBA 1EXWA 4Q03A 4DIOA 3BQ9A 5KPJA 2P8SA 4OHKA 4XUEA 2F2TA 1ZJ6A 4RGQA 4DCMA 1X92A 2C96A 1TFUA 4Y2SA 2PZMA 2FVXA 1CDZA 2F4VB 1VKNA 4MVJI 1U3DA 3KQQA 4TMWA 4UVIA 4YMHA 1QOZA 3ZWMA 4EHJA 1SAYA 1FJ2A 4GGOA 1GGJA 5J5AA 2OZEA 3KOOA 2LZ0A 4Q7MB 4AB1A 1NJ5A 4WTOA 5BYJA 4OBWA 3A1DA 1I5RA 4Y9UA 4NBSA 2C07A 4KR0A 5DSZA 3ZWKA 2KWIA 5M5BA 4DMLA 3VO8A 3HFGA 4C06A 2PWPA 2ZJ7A 4HDQB 3AYXB 4PIPA 1TC1A 5AK0A 4ERNA 3PX7A 3ZNNA 4BAZA 2Y0DA 3AESA 2V54A 3M6UA 1OLXA 3FTCA 1JJFA 3DFKA 5T4EA 1JPJA 3WFIA 3WLEA 5I8WA 1QU3A 4HLCA 4CIBA 1WUHS 3PPVA 1RJWA 1DC4A 1EBUA 4ONEA 3MN1A 3PXDA 2XX3A 4C9BA 1XLTC 3C1UA 4L75A 1XXHB 3S55A 3EMBA 2EJUA 2VJMB 5HTKA 3TS1A 3VKGA 3F9CA 1MUUA 1XQWA 3KJXA 3QLUC 1ZD8A 1TI7A 1N1GA 4TVBA 3L8CA 4TWAA 3UICA 4IIJA 3AW8A 2JLAA 5L6MB 5BN1A 2G9ZA 1MJFA 2JFHA 3CSSA 3E82A 4MVJF 4P92A 4CDGA 5IYZA 3V3TA 4DRYA 3WADA 3ADOA 1ZIDA 4IGAA 3EGEA 4LIPD 2HK9A 1PT7A 4L5BA 3Q8KA 3IHKA 1YC2A 4AUKA 5JNSA 4N82A 1HYGA 1PV2A 2HRZA 1Y3AA 3F74A 4HD8A 4J90A 4RK0A 2X40A 1PIWA 4YEDA 1QGUA 3EFBA 2ZRHA 1Z0UA 1KAGA 2VPYA 2BGKA 5BSUA 2DBQA 4URHA 3KOXA 1I3LA 1RI1A 1RJ9A 3ITEA 1LPBB 2AEMA 5ICEA 4D26A 1GZDA 1Y63A 2BE7A 2DT5A 1PR5A 4B87A 2ZYUX 4KXQA 5LKAA 4KGVA 1GPLA 2Y8EA 3G9QA 4NNPA 3C3MA 4KTVE 4HLNA 4MV3A 4N8EA 5E7QA 3UB3A 3GEHA 4EUNA 2IX3A 2CLKB 1YIDA 3MLBA 4FYMA 4UPDA 5DGDA 2OFOA 4D8VA 2AUNA 1Q2XA 3FMIA 3ZEIA 1VYVA 3D7KA 4JJKA 3KYJB 1Y48E 2ERCA 2WOOA 5BQOA 5D6OA 5AW7A 1C9MA 4WZBA 4ZMRA 4X24A 1JXQA 1C0PA 3QFCA 5DM4A 2VLBA 3LAWA 1VIVA 4L4ZA 4DC9A 4HVCA 1XLWA 4U5QA 5JCJD 1E1CB 4HQRA 1P44A 4G81A 1PZXA 3GNSA 3OWOA 4ETIA 2RD2A 2YZKA 1GPH1 4JP8A 1ZO8A 4CQLA 2F67A 3N28A 5AOVA 3TUJC 1IQUA 4J16A 3JYQA 4PHHA 1NP3A 3AEYA 2PNFA 1M5TA 1U02A 2GCNA 4AULA 3S8MA 3U16A 3VI3B 2BFOA 4G4SO 3VR5D 4D3DA 4K8OA 5EWMB 1G1MA 1VL2A 5AYVA 3DV0B 2UUCB 2JHGA 4Y9SA 2BEVB 1T3TA 1G5FA 1DEKA 1EUCA 1Q0UA 1V7QA 3DBVO 3OPYB 4TLDA 5LA6F 3VU1A 4KR2A 2I2BA 2P9TA 2FQYA 2OT3B 1WW8A 2WFMA 4KUEA 3W05A 1MG5A 3R44A 4ZREA 2PCLA 3DLHA 1PTJC 2O2DA 4V24A 3UK2A 4W7SA 1XZMA 1KP2A 1R12A 2QP9X 1UBFA 2HK6A 1I9GA 3ZHXA 4C87A 4B71A 1PDVA 2Q3LA 2R6JA 9ATCA 3TFOA 3AL0C 4YCLA 2B1QA 3E3AA 1B2RA 2XGGA 4NZMA 1V6SA 4MUYA 2YQ5A 5B4UA 3Q85A 2B5WA 4ZV7A 2ZATA 1KSHA 5CUQA 3WGIA 4ZYXA 1AV7A 3T1OA 5F1KA 2H2HA 2V65A 1WLSA 3TSOA 1QE0A 2HXSA 1XRQA 2AL7A 4MSUA 5GOTA 2G7ZA 1CR2A 4HOYA 5BSRA 1DU4A 1YKFA 1PKEA 3NANA 2NX2A 2WYUA 4PYJA 3PFWO 3P2EA 3QF4B 3TCXB 2CMDA 1NBME 3BB1A 1F60A 1RI5A 1C7EA 1JG7A 4OATA 5C1PA 5J3JA 3EGXA 5KTKA 1PS8A 3HSSA 1XP5A 1QTNA 4NZOA 2HFJA 4GYJA 2D3WA 5JD4A 1DQNA 1H1LB 1V5IA 3OUTA 1PLKA 1OLOA 3DYVA 3FNBA 3IO5A 3VR3D 4EG1A 2JCSA 2OAGA 1Q57A 1Z2PX 3GLSA 3ZJ4A 1QYXA 1E98A 1QS0B 2J4FA 5H3HA 3GAFA 4EQ6B 5BXYA 5JHHB 2HH9A 2QV7A 3DONA 3VNAA 4D9JA 1GKYA 3HJBA 1KOFA 1T9CA 4JOQA 2B8TA 5KYTA 4EYSA 5IZCC 3SZOA 4NMXB 2OG1A 4Z1MA 1Z6XA 2GT1A 2VYFA 2Q3JA 2YDYA 3C3EA 4KI0A 3KRTA 1P0FA 2BGRA 3MUNA 3LYUA 1T3HA 5D5HA 1UZMA 3HZRA 4NENA 4PAOA 2PEZA 3GFGA 3S68A 3F7OA 3GCGA 3RTGA 4WD3A 4JA2A 4CVNA 1Y6ZA 3QU9A 1QH0A 3IUEA 2VR1A 2NW6A 2JI4A 2OUIA 1FYDA 1E6WA 3D2AA 1DWQA 3VZPA 4Z0TA 1W36C 2WJAA 4HNHA 3EXEA 3U3MA 5DGCA 4C2UA 4I9GA 4Y2XA 5ALOA 4IZOA 2QX9A 4QOEA 2V7QD 1FQOA 4UEQA 5LJIA 2C4MA 1NL3A 1UK7A 1ZNWA 1UK9A 5CLIA 5COBA 4ZT5A 5A4DA 2LCFA 4C6RA 3ZUGA 5DNYB 3PUKA 1V9LA 1W85B 2LKCA 3GUUA 2JI7A 1VC2A 2GFIA 3FXAA 3DDNA 4QLBA 1RYZA 4HY3A 1H8EA 2DUJA 2G09A 3E2IA 3H2IA 3FNQA 2XDAA 5EIWA 3GWGA 1PLLA 2PKCA 4IOMA 3LBFA 5AW4A 1ZR2A 1JQLB 4N7BA 4G1CA 2R6DA 4G9EA 5EI5A 4C6TB 3VO9A 5H68A 3DO8A 4C7OB 1K8QA 1SBHA 4YP5A 1FOEB 4CFYA 3KFLA 2G82A 2Z3WA 3ROZA 2WIAA 3TQRA 3R5XA 3VSEA 5BW8A 5C53B 3D8BA 4CNQA 1CFZA 3C3PA 3OEYA 4MDYA 1N2JA 3H2GA 3A6EA 3MAGA 3QKRB 4OP2A 5JCXA 3KXDA 3W1VA 3GLFA 3BAZA 4A0HA 3DTNA 5I7SA 2YIJA 5T8KC 4WIAA 4ZHQB 3G0HA 4DLXA 1SULA 1FNMA 3G23A 5FOWA 5A4KA 3VBCA 2R66A 2QUBA 4QC2A 1O1YA 1USWA 4DOMA 3FUWA 4YCJA 1P3DA 5AM5A 1U0TA 2IW1A 1QK3A 3JVVA 2FP4A 2BGMA 3LLUA 4QBGB 5EYPA 1ZMBA 1X15A 2PYDA 3LU1A 3V1MA 4XJSA 2AC4A 4BVLA 3RTDA 5I7RA 2QBYA 1PNVA 1TZBA 3BWEA 1KO8A 4YRMA 5EJ4A 1QP7A 4DR2B 1RQ7A 1PW7A 3ZLUA 3FDFA 2FUKA 1JDJA 2ACKA 2HJSA 4OX9Y 2FGJA 5IBRA 4GG1A 3PGLA 4ENRA 2ZRMA 3FZEA 1QX3A 3EVBA 4C0KA 3VYUB 3ZJ5A 3ZDAA 4NECA 1FFCA 2I33A 2VK1A 3D2CA 4UMEA 1WDLA 3K5PA 4X45A 1C1DB 1OAOC 4Z4EA 2DCMA 4NY1A 3AEUB 4HZGA 1OAKA 1Q7BA 4M87A 1NY5A 1DAIA 4N8SA 1O6GA 5HIJA 1ZVQA 2GAAA 3CNBA 4F5ZA 4U0KA 2CCKA 3RRBA 4IVNA 3WLFA 4HGZA 2XUZA 1G20A 2PZEA 1XDSA 1T1IA 2JPDA 3CQ9A 3V4LA 2HA2A 1MHPA 4RAQA 2W2PA 1ZK0A 1O0BA 4BOYA 4LOHA 2EW1A 4C30A 3V8NA 5BWOA 1IRXA 2Z2ZA 3M34A 1M1ZA 2X23A 1ZH4A 3AUTA 1US8B 5AOAA 4PO3X 2W2KB 3GNQA 3D1VA 5AXDA 1LA2A 1NHWA 1P33A 1WDTA 5K3DA 1KDRA 3GEBA 2EKQA 4F46A 2CC2A 4P32A 3TW4A 2P5TB 3WL3A 2C92A 5FA5A 1MO4A 2C4VA 1ZM7A 2HPVA 3GLKA 2G9NA 5A04A 3TEMA 3VQTA 2Z2YA 4G5FA 1SC1A 4F04A 1A7UA 2FG5A 5CD9A 5TS3A 4YUWA 2YN0A 1IWPB 1LW7A 4XGKA 1R4MA 2O3RA 4HC4A 1AQIA 1VSBA 3R0JA 1JS1X 1T5HX 5DN6A 3E9ZA 4ZOBA 5DNWA 2XNDA 3QXSA 1AKUA 1KEEA 4M8LA 3D3JA 1MPTA 1V8BA 3HNPA 3RRYA 3MGCA 3QSGA 4S1WA 1WMAA 2OSBA 1UEXC 4MW4A 1E3QA 2K2QB 5D5PA 3HDQA 2D4HA 2JB9A 2EC5A 1JAZA 3CC8A 4JSTA 5CDFA 5IDQA 2AFRA 2OCYC 1B8PA 4S2EA 1W85A 1TL7C 5KU1A 1EUZA 2FLWA 3WDMA 2FN9A 2V9PA 4O2AB 2EJCA 4G23A 4IAOA 4A0GA 3TL6A 3O2SB 4GLBA 4HAOA 4YWJA 3HQ4O 4UJ3A 2JRLA 2OCIA 3ANNA 3MJFA 4NLLA 4RAOA 4XPZA 2WG1A 3FTEA 3FPSA 3L0IB 4X66B 4ARUA 2TYSB 5HF9A 4ZDJA 5HA5A 1YJCA 4TTAA 1CVLA 1GGMA 1XYGA 4AJ9A 1E4EB 4B33A 4D8UA 1W581 1ABBA 1IY0A 1OA0A 4K0KB 3AU8A 4QJIA 2VJLA 3LT1A 1J06A 3BZWA 3QPVA 4XJXA 1PHRA 2ONJA 3WLMA 4DDUA 5DHUA 1D4OA 2FW1A 4BNJA 4GX0A 1O6BA 4MULA 1UT6A 1GNLA 1WKBA 2IY7A 2O57A 5AICA 1GA1A 1GFZA 2WHRA 1FYWA 3U09A 1P7YA 3AB7A 2RHWA 3IKMB 5AD1A 3M4ZA 1DLJA 1WUIS 2HU2A 2O3TA 5SZHB 4EG6A 5DRYA 4BGUA 1GNQA 4IWNA 5AXAA 1F8XA 4ID3A 4YPFA 3I9V6 1RYYA 2JFVA 1X1SA 2NTYC 2XWBF 3DE5X 3MRSA 3U3XA 4LJRA 3NATA 4D97A 3IQWA 2H4YA 1ZMTA 2X4GA 1V5WA 4ZTUB 1JQ3A 3I0MA 1T4CB 2CYCA 2RJOA 1PFVA 1J07A 3I45A 4YHHB 1F1JA 3G8BA 3ZOZA 3BH0A 3QTBA 2DZDA 1MORA 2FWNA 1LJUA 3PI7A 1W96A 4GKBA 5D6NA 1ARZA 5DH9A 3ZW7A 1M6NA 5KB3A 1Z7BA 2UYQA 3AR7A 3ZS8A 1B6TA 1YFJA 3Q98A 5KNCD 3DDCA 1M5RA 1FP4A 4PCVA 3JARA 1E2KA 3HU3A 1QVZA 1AKVA 5C5IA 2NU7B 2V5AA 1NM5C 5FKJA 5MN5A 3OX2A 1NQVA 4YP1A 5B53A 4LBVA 1IN6A 3H9UA 3I9JA 4LWZA 3SHFA 5LWHA 4QJ4A 2XTJA 3U3OA 5K8TA 4TV8F 3A25A 1IVNA 3V4FA 3SZMA 3DW1X 1VZ3A 5H82A 1SD2A 1RHMA 3RU2A 4YALA 3MJHA 3PJGA 3RVBA 1E1RA 3RREA 1BOOA 4EB6B 1MOZA 3S2YA 3IESA 1WXHA 3IE2A 5JQWA 1X6VA 2J87A 5AMXA 2GGSA 4OA5A 4O2RA 3DAOA 1E2NA 4F1KA 1JTEA 4N4AA 4KQ9A 2Z6AA 1NJGA 1T8PA 4QPZA 4X5OA 3MWJA 1PSDA 3CVUA 1TW2A 2W2NA 2LPMA 4XDZA 3K8OE 2YYAA 1PK8A 1XZDA 2QSZA 2RK3A 1Z6AA 3QOWA 3R4CA 4AN4A 4DNOA 5JAHA 1EEHA 5DRTA 5JEEA 3OSUA 4GX2A 3EFHA 4OXKA 5K6TA 3PXBA 3WC4A 4G8BA 2W37A 3UXYA 2K7ZA 4YRKA 2YHSA 1YI8A 3UHFA 3H8WA 1QQAA 3TIIA 1IHPA 1SC6A 5JASA 2HBZA 1L7DA 3BK2A 1XTJA 2GSDA 3JQ9C 3QV1A 5CD1A 4KLRA 5FPHA 4YRQA 1P4GA 2J4DA 2EJVA 1YR8A 3MGAA 3PEFA 3CHYA 4RTMA 7REQA 2JLWA 4A4DA 1NJ2A 3M9LA 4EVRA 1KQFA 1PJRA 5IAOA 4MARA 2ROQA 4WUTA 2ID4A 2H54A 3TQQA 4EYGA 5AM4A 4NOMA 1U9ZA 4PX3A 4KVZA 3TE6A 2O50A 1FCJA 1Q77A 2LIVA 3QU5A 5KNBA 1N3YA 3NHLA 4RIEA 5DHRA 2X22A 1ZICA 1GTJ1 2JAPA 1KQOA 2G1KA 3FBTA 2EF0A 4Q16A 5CNIA 1NKVA 2O2YA 3VAZA 4ARAA 3S0JA 4NAVA 1FL9A 1EDEA 1HSZA 2HU8A 2GPAA 4XFJA 2SHKA 2RFLA 3KSDO 1TJ3A 1IOWA 4WBNA 1CT9A 1HDXA 2C99A 3O8CA 3AUAA 3ESZA 3L8FA 3OLXA 4Q4JB 4UUQA 4NHEA 4OUDB 4QOIA 1XLUA 3ROTA 4TYWA 1JU9A 5C4GB 3FH0A 3ILXA 1GA4A 5IAEA 4Q1DA 1Z47A 1H69A 4CCAA 3LGSA 1JG3A 2PZ8A 2QM8A 4WZ6A 2H07A 2GRUA 1ZH0A 1PZEA 4BYMA 3FOWA 4BNHA 1AC5A 4JQCA 5LYJF 3M2PA 2BRUC 3DDUA 1ZSYA 4RDIA 1OFUX 1OE0A 4AZ0B 3GT7A 4K28A 1ABFA 3ET5A 1FF9A 2Q8PA 4REQA 2AOXA 5AI5A 1B7GO 4DW8A 3WJ1A 1K86A 2Y0EA 1F1BA 3TOXA 1TQ4A 5DFAA 1L4EA 1Q95A 3FRJA 2PKRA 4FDLA 2H00A 2O0LA 3H5IA 4G4IA 1GGKA 5EFZA 1E2QA 1G3MA 1PK9A 3SR0A 3R20A 2I99A 1FFGA 2OTCA 3KDAA 4U6NA 3S5UA 3IAXA 4X95A 5HUJA 2NV2B 2BPOA 1XSEA 4G5YA 1KYXA 4Y18A 1KC3A 3F9RA 1C81A 3RC7A 4CF3A 1DWOA 3OBBA 3R3ZA 4HB0A 4L9RA 5CTJA 3ZHZA 1WV0A 3AONB 3KLOA 3A6DA 3RO7A 4LYYA 5CFPA 4L85A 4JC8A 3DHVA 5KSPA 2HA5A 3CRMA 1JSRA 1UKEA 3ADBA 1A98A 4URZR 4U00A 2XNJA 1PR4A 1VE7A 3U7QB 1B73A 1YMQA 1WKCA 3USES 4IS2A 3ZCPA 1DAMA 3GELA 4UEOA 4P4TA 1YDMA 2B7LA 4W5NA 3HB4X 3CF4A 2OBYA 3ZYCA 5FPKA 3U4GA 1TYAE 4EUFA 1FYFA 3F46A 3PE6A 5A2GA 3HN2A 3HXTA 2CMFA 4TUYA 1QJ4A 2X0IA 3IPLA 4R9RA 4BCBA 2MSCB 1V4NA 2YXNA 4N3AA 4PPYA 1AGRA 5CGZA 1KDYA 4PYMA 2V97A 3CUUA 5B3AA 3TB6A 4HMOA 3TL2A 4HHEA 2QYSA 2QN8A 4XA8A 3A2LA 5EUQB 2I4LA 4ZYTA 3QLVC 4WE3A 4ZI2A 1G38A 2HMYB 3H5NA 1QE3A 2HBRA 1OYVA 5AKZA 5L53A 5GY7A 1DKOA 3QM1A 4WOKA 5C8XA 3SEQA 3H11A 3CF4G 2WP8J 1WRBA 4MRPA 3GLHA 1Z08A 1QIKA 4Q3CA 1FLDA 3EX7C 1R0LA 2ZYIA 2OK7A 4MWTA 5D1NA 4N7RA 4XAQA 5A05A 1GG9A 4Y2YA 4RTNA 5C8YB 3MSCA 1HG1A 1LPPA 2A5JA 2ODNA 3C8ZA 3INNA 3JR3A 3QW2A 4AYTA 4C0HA 3OY2A 2E4YA 1BRMA 1HDRA 4U02A 5FUVA 3I32A 3MTJA 1W6RA 1CETA 4D3FA 3AK4A 3CX8A 4BGVA 3EPLA 1NRXA 1P80A 2IYSA 3UQYS 3AZQA 5HS4A 3KVOA 5CPFA 3EVFA 4A2PA 3BH7A 3N0TA 4LUCA 3NT5A 4YMVA 5CB4F 5I7FA 4AMUA 1ZD5A 1AN0A 2CKMA 2TS1A 3BA6A 1EJBA 2C42A 3C3YA 3HB9A 5BSTA 3HXMA 3TLYA 3RIMA 1W5AA 3TXAA 2SCUB 3KZMA 1S8FA 4J94A 1SC9A 3GGCA 3H7IA 4Q4JA 1WOYA 2HQSA 2ZAOA 2ZLBA 5PNTA 5KVCA 2QTWB 2X9NA 3DBLA 1ZI8A 4Q18A 5KNCA 5IVKA 3IJ5A 3RSQA 2H11A 5L3ZA 2P78A 2P6UA 4RTLA 2WB4A 1MJGM 4YONB 3PITA 4BVEA 4C07A 2J33A 1ORVA 4HB2A 4KBFA 3UC5A 2RHRA 3L8ZA 3IPYA 4WCFA 3LVFO 4II3A 3JQEA 3ZCXA 1NMYA 3OOSA 3FI0A 1NC1A 4X64B 5HR5A 4K2AA 5JNUA 2R8OA 4ABTA 1ZGBA 2A9PA 3WLRA 4Y6LA 2PJDA 3STXA 1WZ2A 4BX8A 2NAFA 2Q29A 2Q5LA 1DRUA 1I4EB 1Q12A 2H59A 2WYIA 3DAHA 1QIEA 5J63A 3Q3HA 2BFFB 3MS4A 1O97C 2DHCA 3T4UA 2D6FA 3H9JA 5FL3A 3IAM1 1KIMA 1P8AA 3BGWA 3CUEF 4GD3Q 2KLHA 1YRLA 3H8VA 3HKEB 4W82A 2Y66A 1R15A 4FCWA 5E1MA 1GPKA 1QRDA 3GUHA 3K6RA 4JEHA 1AHPA 4HX9A 3N5CA 3PFHA 5LR6A 3P2YA 4JLMA 4ZCRA 2ZUEA 3A1VA 3KR9A 1G60A 4P33A 1AH2A 2HNBA 5HF8A 1LTKA 4CGYA 4EHKA 4UFOA 1KZ1A 1NRWA 1NLFA 1MB4A 4AW9A 2WQZA 4UBMA 2GOYA 1SIBE 3PPWA 1II8B 4RADA 2OAQ1 2F3PA 3HGMA 2GK6A 4LOAA 4DT1A 1GN8A 1DOAA 5EQFA 3L93A 3ZCTA 1TB4A 4FK8A 5L3SA 4EA9A 3PXXA 3LQ1A 3DVLA 4NZYA 4TSFD 4BWVA 5HKOA 4LSWA 4TXJA 1LK5A 3WZ2A 4BS9A 1SU8A 5KSZA 3RT1A 1U6IA 5K2MA 4QG3A 1ECBA 1T15A 5EINA 3D0RA 1KH2A 3IDOA 4GYYA 3IAS6 5B7NA 4YCCA 2CDBA 4M54A 4WL0A 2Z6VA 3V1LA 3PPIA 5K0EA 5J1SB 1PEAA 2EP7A 3SYLA 1B93A 1NFRA 2Z8XA 4IIEA 1UOEA 2HPHA 4MI3A 3EK2A 1AM4D 3CCCA 4RWZA 3RDPA 2FZEA 2WPDD 4E08A 5EJEA 2PSEA 3D8UA 3OSZA 2ODAA 3GLFE 4HUQB 1WXEA 4BN5A 1C0EA 1UBTS 3ECSA 4MRMA 3V48A 1E2EA 3AG6A 3ILYA 4CIDA 1T29A 1KJNA 3FR8A 4HJXA 4POAA 3L92A 1U8EA 1CBUA 1EINA 2I6XA 2ZB8A 4DY4A 1R2QA 2HXGA 5J5VA 1BCSA 5LP1A 1S2IA 2O6HA 2VKQA 4XQ0A 1EI9A 4U7JA 2JEYA 1E3LA 3ZU5A 3GGDA 1H0SA 4EAAA 2IXBA 3T3DA 3BFXA 3DZIA 3OZCA 2EBFX 3NGMA 4LY0A 3DBRA 3G2LA 2WPDA 2P7HA 4MMYB 1E9AA 1KE2A 4F91B 3IAHA 4DMGA 1KAEA 1W47A 3AEQB 2XUAA 4TXLA 1UJNA 4H15A 4I55F 2WM9B 4NCKA 4MYUA 3VYSB 1AMOA 4JP2A 1MFPA 4OQEA 2RHLA 3GYBA 4EW2A 1HT2E 1VIYA 5CB4B 1BN6A 4KLAA 1VYHA 3AHGA 4ZCLA 4O59O 2DWPA 3R3VA 5DX0A 1OX5A 1YACA 1J9EA 2FCRA 2OHVA 2VBGA 2MT9A 3CVOA 5A4FS 1OX4A 3WGNA 1FMFA 2GQ0A 2BELA 1WSDA 2AMYA 2GLXA 2V6BA 5ALFA 4EZBA 2JS7A 2NQ8A 3H83A 3IYLW 1ZNZA 4TWBA 1M2VA 4I1YA 3L7NA 3C3DA 1JAIA 3MINA 2O4CA 4Y7DA 4KR3A 4M37A 2G70A 2OK8A 4KO1S 4DG8A 2IVFA 4MDEA 5F3DA 2DU8A 4RABA 1JJAA 5DU2A 2BZ0A 3DC2A 3NPAA 3G89A 1IOZA 2J5KA 1YJ5A 3C7AA 3SVLA 1U8ZA 1ZX1A 3EXAA 3FD8A 1N57A 1RM3A 1YS2X 3HG7A 1ODCA 4U7HA 1KDVA 5LQDA 3FI9A 1E7WA 1UT8A 3P2KA 4EA7A 4R9VA 2YJTD 1S0UA 2FKNA 1MO3A 3GNLA 1CJTC 4JYMA 5TPZA 4RWEA 1U7PA 3HBLA 1G9XA 1VCNA 2AHRA 1E2UA 1N6OA 3FDIA 4PHGA 3P27A 4O4IF 5HJEA 4IDNA 4D4GA 4U1RA 4UUBA 1LD3A 5JD5A 3O2NA 4OHOA 5G40A 5TR9A 5FTJA 1ZD1A 4RTOA 1HRKA 1E4VA