4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
3DF9A 3O6VA 1Z36A 4P54A 3EUFA 3LBAA 1RXUA 4LZWA 4BMYA 4OY3A 1Z5OA 4UC0A 1OUMA 1RSZA 3KVYA 1A9PA 3MB8A 1PR4A 3IOMA 1PBNA 4R31A 4DA6A 3KHSA 1JE0A 1Z34A 2HSWA 4JP5A 4M3NA 1PR0A 4TTIA 1T0UA 1NC3A 3O4VA 3BSFA 3OOHA 4DAOA 4YNBA 3E9ZA 3NM6B 4WKPA 1YBFA 5DK6A 3DJFA 2BSXA 3OOEA 1A9RA 4D8XA 4D98A 3C74A 4PNPA 2Q7OE 3K8OE 4EARA 1LV8A 1K3FA 2GUWA 4BMXA 1VHWA 5F78A 5CXSA 4RJ2A 3P0FA 4K6OA 3ENZA 3D1VA 4M1EA 5K1ZA 1SD1A 4MCHA 1TD1A 3UAVA 4MCIA 1K9SA 1U1GA 3FUCA 1RR6A 2OC4A 1RCTE 1ODLA 4WKCA 1Z39A 2I4TA 4ECEA 3T94A 1Y6RA 2QTGA 3FB1A 3QPBA 5C80A 1ECPA 4WKNA 1PF7E 4JOSA 2P4SA 4IP0A 1Z5PA 2OECA 2B94A 2OXFA 1Z5NA 3UAZA 4F3CA 5CYGA 1OTXA 2ON6A 1Z35A 1T8WA 4H1TA 3NBQA 3NM4A 3EEIA 1OU4A 2A8YA 4LNAA 1JDZA 2XRFA 3ODGA 2AC7A 2RJ3A 3MMSA 3OZEA 1PWYE 4QAQA 3FOWA 4KN5A 1B8OA 5B7PA 1JPVA 4TXMA 4PR3A 1JE1A 5IU6A 1M73E 2I8AA 1A9QA 1A69A 3DP9A 3K8QA 1Q1GA 3PNPA 3GGSA 1VHJA 1ULAA 3PHCA 5F77A 5EFOA 5CCDA 1V48A 1OV6A 5B7GA 5I3CA 5CCEA 4QATA 4OF4A 1CG6A 5F73A 1I80A 4NY1A 1PK7A 4OJTA 3LA8A 3KVVA 1LX7A 4YMLA 1ULBA 3OPVA 3E9RA 1B8NA 1LVUA 4R2XA 3ONVA 4QASA 4WKOA 1V3QE 3EMVA 3OCCA 1T8YA 4TS3A 4DAEA 1G2OA 2HWUA 4D8VA 1YQQA 5F7XA 4LNHA 1Z38A 4E1VA 1Y1SA 3UT6A 1NW4A 2H8GA 3SCZA 4DARA 5KB3A 3UAYA 3E0QA 1Y1QA 3FAZA 5JPCA 1VFNA 4L6IA 1JDVA 1TGVA 2AI1A 1RXYA 4G8JA 5IFKA 4R2WA 1T8RA 5CXQA 4GMHA 1RFGE 1V45E 4F1WA 4BMZA 5EPUA 1RXCA 3DPSA 1CB0A 1JDUA 1YR3A 1RXSA 4D9HA 2QSUA 4QFBA 1JYSA 4EB8A 4GLFA 4NS1A 4TTAA 3UAXA 2OC9A 3DDOA 3OZDA 4OGKA 1ZL2A 4GKAA 4YJKA 2ISCA 4GLJA 1XE3A 3FNQA 4QEZA 4BN0A 4FFSA 1JP7A 5ETJA 5FAKA 4MARA 4TS9A 2PGAA 3OZCA 3KUKA 3OF3A 3EUEA 3UAWA 4QARA 4D8YA 4I2VA 1U1EA 3PHBE 1YQUA 1Z37A 3IEXA 1PR5A 1VMKA 1JDSA 5B7QA 3KVRA 1SQ6A 3OZBA 1QE5A 1T8SA 2QPLA 4F3KA 3GB9A 2A0WA 2A0XA 2HRDA 5F7OA 3BJEA 3BL6A 4TXLA 2IQ5A 4DANA 2HN9A 1V2HE 1Y1TA 4JWTA 5F76A 4F2WA 1A9OA 2AI2A 1PW7A 1PR6A 1ZOSA 5CYFA 1TCUA 5F7ZA 3PNSA 5F7JA 4L5CA 1RYZA 4TYMA 4X24A 1V41E 4DA8A 3U40A 2QTTA 4OEHA 4L0MA 1WTAA 1PK9A 4OGLA 1ODIA 1U1DA 1RT9A 4NSNA 1U1CA 5EUBA 1K27A 4LDNA 3BGSA 1U1FA 1A9TA 1PR1A 2QDKA 2A0YA 3KU4A 4M7WA 1PR2A 4DA0A 1OVGA 1ODKA 1PKEA 3LGSA 1TGYA 1C3XA 1V4NA 1A9SA 1Y1RA 3NM5A 1OTYA 4F2PA 4DA7A 3INYA 4G41A 3FWPA 4TXHA 4L5YA 1NC1A 1SJ9A 1Y6QA 2AI3A 1TCVA 3P0EA 3TL6A 4LKRA 5B7NA 4TXNA 1SD2A 1N3IA 4U2KA 1ODJA 3F8WA 4TTJA 4L5AA 4DABA 1FXUA 1JDTA 4G89A 4TXJA 1Z33A 4YO8A 4WKBA 1YRYE
chains in the Genus database with same CATH superfamily
2BFBA 4MV0A 5DLQC 4RGBA 3HXPA 3RKSA 3UA3A 2C9OA 3E3OA 1I4LD 4QT0A 1O89A 1Z56C 5K3OA 3RV3A 3B9BA 5B1IA 5AVZA 3DL4A 3ZGYA 3EUFA 3P9RA 2YYZA 1DKMA 1WUYA 4JR1A 4ARZA 4BO8A 4N6GA 4W9NC 1K7SN 4YAOA 2HKIA 1ORTA 1WQ3A 4PVCA 3C6XA 1Y4SA 1PEYA 2MDTA 2X2EA 1LLCA 4LDPA 1O03A 1QAOA 3BUSA 3AL3A 4JJ8A 1AUQA 4CKZA 1DXYA 4UDNA 5CFRA 4Q7JB 4ABYA 5FUBA 1WJGA 1T8TA 1KHHA 1A9PA 3IDAA 1DO8A 4F92B 3T7SA 1V8OA 1KNXA 1GTZA 1RM4A 3NTRA 4V1CB 3QX7A 3X1WA 1C3JA 4YRAA 3OQIB 3KSZO 1YB6A 2D3WA 4S0XA 4V0SA 5SZHB 3FZGA 3RF7A 3FA2A 4QG7A 2C2OA 2QRNA 2RAUA 3FUVA 5JJLA 2XMRA 3RFFA 2O4UX 4M3NA 4Q66C 4WXPA 4ETMA 1JR2A 1N0HA 2VUIB 2VDPB 2FMUA 2VBCA 1N2CE 2YICA 5IJ9A 3HP1A 4BX8A 5H5JA 1RC1A 4F5DA 5EPOA 3WBJA 1X2BA 3QY9A 1BCRA 1RM3A 1JLSA 4IM7A 1TW2A 1J00A 4D3ZA 1EPUA 1DTWA 1KFEB 1XJQA 3A0RB 2QM0A 2Z08A 3GRCA 3ZVRA 1YL7A 1RWVA 2OBLA 4KUHA 4YRZA 1LDYA 2PUHA 1YBFA 2FDXA 2Z30A 3DE3X 4N7RA 4PF1A 5C8YA 5IHXA 4R9UC 3ZDEA 4ETWA 2P91A 1I4WA 5DULA 3EZYA 3ZR4B 1X74A 4JGGA 4UUAA 2YASA 4EFLA 4U63A 3K32A 1I8TA 4HYQA 5DP1A 4N8EA 2YYAA 4C01A 5AI4A 5LN1A 5TS3A 4YT2A 5EXEA 4MB6A 4F3NA 2GBFA 3LPDA 2CV0A 3EFBA 3DL0A 1Z0SA 3ET5A 3B8HA 4G0MA 5A05A 1QGDA 2KI5A 1U0OC 3D0QA 2GN8A 2QTHA 1VP9A 1H69A 2ZR8A 2G5GX 4RENA 1W0KD 3SN6A 1RHQA 4EGJA 3CUKA 4X1KA 4D41A 2DQYA 3PPXA 3AJEA 5CU7A 1YDHA 2AHRA 3AZOA 3G89A 2BSQA 4BO7A 3A6EA 3ZCVA 5LP6B 1R50A 3MAGA 2W43A 3K2BA 1ZC4A 3KZOA 1FNNA 4YJHB 1XZIA 5CW1A 1EFPA 5DHPA 2QBYB 2OV4A 2R8BA 3SNHA 3T5CA 1A9YA 2GH1A 1Y82A 2O0HA 2OKGA 4E4YA 3CKKA 4IRUB 1CERA 4JI7B 3TIVA 2KBEA 1Z39A 2CHGA 4J0CA 5AM1A 2C7BA 2R3SA 2QLMA 1OFTA 3UCXA 3WK7A 3PFCA 2RAVA 4LWQA 1LA2A 3EA5A 3EMBA 3PYLA 4N1AA 1ETUA 3RFTA 2V1XA 3EBPA 1QP8A 1PJ8A 3P4UA 3K4QA 4JFRA 1NUTA 1PF7E 3GGOA 1LRJA 4XEHA 2AVDA 2PZBA 4QOGA 5DW0A 1E2EA 4D0NA 4INJA 1U98A 1WB5A 3BMNB 2SCUA 3EPRA 2VK2A 2WSSD 3IV9A 4NYJR 4YQYA 1KH3A 4B76A 4RZSA 5JNVA 3VC3A 1TFRA 3SDBA 5K8UA 3G0OA 2QVZX 3ZTTA 2Y93A 4CG0A 1L7RA 3HDHA 3QIAA 1P33A 5MHTA 4DMFA 4K9SA 1QIEA 1RAAA 4ZV7A 1TADA 3DFMA 2LDBA 4ZVTA 3DF7A 1M2EA 3DQZA 2AFIA 3WIOA 1H66A 1NVFA 1Z25A 3DHYA 4NJMB 3FZQA 3AOGA 4QJIA 4Y9SA 2ZI7A 121PA 2R62A 5IYZF 1C8LA 1UBCA 5CBPA 1RAEA 4ZCMA 2EBUA 1GPMA 1P5FA 4YXWA 2AC7A 5F23A 3AEUA 3NHMA 1A27A 3HCDA 4WOBA 3RUAA 1PQUA 1Q7CA 3SJ7A 3CUWA 2AUMA 1IBLB 1VJRA 1CUXA 4ZOAA 3RH0A 3ZK9A 3TLKA 2PDAA 1HDIA 1N36B 4MS1A 2YJ5A 5G0TA 4CODB 1JE1A 3P2KA 2XNDD 5IU6A 5H02A 4BKQA 5AW6A 2R47A 5L7TA 1EA7A 2ZYTX 4R3WA 2HRCA 5C0OE 3R9KA 4AK9A 1V16B 4KMOA 4JJEA 4M83A 2QQFA 3QE3A 5ALHA 1W9MA 2VUTA 1YVRA 3FVRA 3GLUA 1DKPA 4JLJA 3TXYA 4Q7QA 3PFWO 4MUYA 3GEPA 1AO0A 4HX5A 3O90A 1P1KA 3H13A 3OMXA 1TRKA 2Q5LA 4OGFA 1DG9A 1JLMA 4YDSA 5KOHA 1JLLA 4DR7B 2F9LA 4G25A 4MQUA 3QXGA 1IPFA 1M1YE 4RS4A 4LQDA 1H2WA 2GZAA 5JCJA 5A6SA 5F12A 1R5OA 1YACA 2H59A 1W93A 1XQ9A 3Q9LA 1XMXA 2O7QA 3BYZA 4X7RA 1KQOA 1TM7E 1OV6A 1SCNE 2GRAA 4YHBA 4CQMD 2WIAA 1QC5B 1W6RA 2C88A 2A5LA 3ZG6A 5I3CA 4IZOA 5CXXA 2G1UA 1WD7A 2BFFA 3FMGA 3OLVA 4OF4A 4P9NA 3TW4A 3C5WP 2GD6A 5JNUA 5JATA 4NULA 3AW8A 1ECGA 4V0MA 1T0PA 2XZDA 2JEZA 2GAJA 3R5FA 2Z8YM 3ROMA 1AF4A 2UUBB 4OJMX 1N7IA 5FOWA 3TQQA 4YIKA 4P35A 2PBFA 4GPIB 4QDUA 3TNFA 3QE9Y 5KWSA 5IM4F 5MF6A 2H1OA 1I51A 3R3UA 5KEIA 3TZHA 1LNZA 1V16A 2A9VA 2R6DA 1S8OA 3EVDA 3F5DA 5B2FA 4GMGA 4CMAA 4J16A 3AHJA 4UAUA 3U7EB 4ON9A 4ZTBA 1V11B 2BM8A 3MUFA 1HX7A 1OHHA 1GGFA 4H0NA 1MGPA 1QIDA 3EC2A 3EXAA 2D54A 3AK4A 3PL1A 5BUCA 3KBBA 3O8RA 2ERCA 4FGUA 4WCFB 2JFNA 4LMBA 1L4LA 3NC1C 2KYRA 1YIDA 2WVJA 4KQCA 4LNHA 3FYUC 3BDIA 2ZCUA 3B3GA 2HM7A 1JHDA 2EOAA 2W4QA 3K5HA 4LISA 4TWBA 3N7UA 5FNVF 1L5HB 5AQ1A 3MOGA 5KVSA 1EWRA 1U80A 3ILHA 2R68A 4O6VA 3T5AA 5IKMA 1RBMA 1GT6A 1NW9B 1CNFA 1A2OA 1XTQA 2X9LA 3PR1A 4GPEA 4D79A 4ENSA 2EIHA 1BDJA 3KLNA 1N1MA 5F4BA 1Z5GA 3GGJA 3T7TA 3V80A 4ED9A 5KNDA 4BAUA 1QGED 4P2BA 1YULA 3SC6A 3UFBA 4KDCA 3MGBA 1YL5A 5HOQA 2DJ5A 2QM3A 4NMLA 1C30B 5A7HA 4MEAA 5AQEA 5JPCA 2EW8A 2MHCA 4PZYA 3FCAA 1BGVA 4MYSA 3TI7A 2V7VA 2WSIA 4HFJA 4G0UA 4LZZA 5ECWA 2GBCA 1HE1C 3CX4A 3RVQA 3CWZA 2DUNA 2WTAA 2FRDC 4CF3A 1AGYA 2C83A 3MWFA 4X65B 3KQKA 1GITA 1KTIA 4JKIA 1SC1A 3IE1A 3KALA 4P98A 1VG1A 4GBED 4R2WA 3FTFA 3H2YA 1TVMA 2WMNB 1XX6A 1PV1A 3HV2A 2H52A 4JJGA 2UYYA 2MYNA 4MINA 4OATA 4ZU1X 1CRPA 2JHPA 1OWPA 1YHNA 3IAM6 3N2NA 3QZUA 5EWJA 3ZVLA 4BWYA 4TMKA 1M2OA 3ZU6A 2FVYA 5HGXA 2IZZA 4NCKA 1XK7A 3C5VA 2FSIA 4HQ0A 3L84A 4GMKA 1Q3TA 2AOUA 4D9HA 4Z7OB 1C9EA 4RANA 4NG4A 3WLPA 1QIGA 5K4AA 2Z8XA 1GTSA 2QAGA 4ZALA 4IHKA 1DAKA 1QAQA 3HRKA 5AXDA 1UQUA 4BLSA 5HRUA 1G6KA 3GA0A 4KIGA 1AV7A 5G0SA 1E59A 1QX4A 1ATIA 3AOEA 3O8OB 3EFHA 2YYYA 4FE3A 4H1UA 4JLPA 4BJ3A 5KTRA 2WUDA 1E69A 2IX3A 3UPUA 1EVQA 3HWRA 3WP0A 4RZUA 3VNQA 8AT1A 3JQDA 1VSBA 2DT5A 5F51A 2ZZNA 4AMYA 5LP1A 3JQBA 2P2NA 3ZOZA 4TSKA 3OH8A 4HQFA 3WLAA 1I01A 1VSQA 2C0PA 2OKCA 4JD5A 5ESRA 4ZT6A 5A2GA 2IEIA 4OXKA 2VJMB 3TLMA 2JJ2D 3ZHQA 2XB2A 1XE3A 2XUPA 4DMHA 2A9JA 5K99A 1J1UA 4PFQA 3AERB 3IA7A 2NYUA 4TKMA 5EIWA 1QIJA 2Q0HA 1A97A 3IYLW 3EQ2A 4MWOA 4YJ3F 2MSEB 5ALTA 4ND6A 5TQJA 3NU1A 3ZWNA 1EXWA 1WF6A 5TPWA 3NHLA 4AIIA 2REQA 3FPFA 2AJLI 3RNOA 1OLUA 3AO0B 1MW8X 5JALA 4KFSA 4YMUA 2ZRQA 621PA 3TNDA 2IPAB 3LDAA 4KR6A 2DERA 4FCTA 4MKIA 2BI4A 4BO2A 4IVNA 3STUA 2QXYA 4XD7A 1T1JA 1TM2A 4V0KA 1GUBA 2IOYA 3DKIA 2FN3A 3D6TB 4NOJA 4GNKA 1WCYA 4PYLA 1SEVA 3DKRA 4X94A 9ATCA 5JO0A 2JAPA 1UEIA 4PYNA 2GCEA 1O58A 2JGRA 1GP2A 2G6TA 1SNYA 2CXUA 4F12A 1GQSA 2X0NA 3KQYA 3BX1A 4UNRA 3JY6A 1ZXBA 4RORA 5EKUA 4YCJA 3EGXB 3N3AC 1II8A 3A6DA 4BGVA 1VG0B 2JANA 1X80A 3ZWDA 2NTYC 5C8XA 4S05A 1KMIY 1PWXA 2OBXA 1C9MA 1OH8A 3SZ3A 4F38A 4MB2A 2FPSA 2BN4A 3RUEA 3K5IA 1XT6A 1SCIA 4BO4A 3LW8A 5TGZA 3EQ7A 4P5EA 2I6GA 3A1FA 1DINA 4YK7A 3VZBA 5HIJA 1JLHA 5CEJA 1GGVA 5LMCA 1K2VN 2VT2A 4TMYA 1JG7A 3V6LA 3PDUA 2DBRA 1BGXT 1M1YA 4NATA 3THSA 1WCV1 1XCPA 1IHDA 4YBRA 2A0XA 4G0YA 3UN1A 3ODPA 1F9EA 1AGNA 2ZS9A 4ZT7A 1V2GA 5IKPA 4UOEA 1E4EA 1OC2A 3PPVA 4Q37A 1IN1A 4HWGA 3RRYA 3RSSA 3CVXA 2JLSA 5JFGA 1LI4A 1R5NA 2SKDA 1ADGA 1Y80A 3IIMA 3BH7A 1A9OA 5F76A 4COOA 4R8VA 2QQ5A 4M9XA 2QMEA 1Q1BA 1VRCA 2UYOA 4WLVA 3WMRA 2XGJA 2KMLA 5JSQA 4AY2A 2H1LA 3KDPA 4H4EA 3SBXA 3Q5EA 2X8JA 2HA3A 3H04A 2C5SA 2W48A 4UTRA 2VBIA 1OKKA 1LPNA 3PNSA 4XDHA 3G2KA 3AHCA 3P2YA 4PGAA 2WJGA 2GO7A 2PZAA 3AKZA 5DGXA 4L8VA 5C8DA 1Z12A 2P62A 1CR2A 4NK5A 3T1HB 4PYRA 3G1UA 5FB3A 3VU9A 1AV6A 3ZVNA 5BQ5A 3BQ9A 1W30A 1MDBA 5DBGA 4PPFA 4NSNA 5EUBA 2HK9A 4NABA 4N12A 2QGFA 4AJ1A 1KVRA 2BFOA 4N0PA 1GZ7A 1VE9A 2HU5A 2R25B 3OBBA 4RL6A 1J39A 3UJBA 3VU0A 1KIMA 4GI7A 3L8HA 1U1FA 1A9TA 1NVBA 1C3EA 1P7WA 3EGDA 3OIGA 4WDQA 1L8XA 1NT2A 3Q0EA 4N7BA 1F06A 1JHUA 4YONB 4LN1A 4V0NA 2FOLA 3ZK8A 4P5DA 1RQXA 1UDRA 3EE6A 3H1PA 1Q2XA 4GXQA 2PH1A 4B5KA 3DMTC 1N6OA 2Y1OA 3BFVA 3FI0A 4BKPA 2BISA 4X92A 3MOIA 2WWFA 4TMFA 4QRIA 3S28A 3QHPA 2WMYA 4BLOA 5KSYA 4YRRA 2K4MA 1W1IA 2PPVA 4F6CA 4DLLA 1CUEA 1QIHA 2WKWA 3RUIA 4CETA 1WHSB 5K0ZA 5K0TA 4PS0A 1B8UA 3E84A 2P2SA 3U7IA 3CQ9A 1NVAA 2WWGA 4LEIA 1IBKB 3TAXA 3MD9A 3G0HA 1VCOA 1QFXA 2HEGA 3M81A 1WU7A 2QTWB 4XM2A 4NDNE 2X5XA 4UHKA 5KYVA 5B1HA 4DLKA 9GPBA 4V1CA 5I9IA 1VJ0A 1A8SA 5TQ2A 4M9UA 3COPA 1O9HA 4HAUA 2M2IA 4PINA 3TYXA 5BOSA 3PNYA 1P0QA 1KOLA 5KWVA 1O6BA 2Q9BA 1CY7A 1Y6QA 1QGYA 4MAFA 2OCAA 4ENPA 5JI2E 1K5DA 4EB6B 1RKVA 3FVTA 4OHCA 2ORIA 5C1DA 2BSAA 1P17A 3KD2A 4KXXA 4BRSA 1OAAA 3BQMB 4KV9A 1DMRA 4G1EB 3T7IA 3JX9A 3MJTA 4S0ZA 2GTPA 5EUCA 2ZT7A 2ZAMA 4DJDC 2GZDA 2ZT8A 2G4CA 4Q18A 4U2KA 3RUPA 5AR1A 3KLBA 3I0ZA 1AK9A 5IUNC 4CF4A 1BGWA 4WLFA 1YFJA 2JFFA 3R6WA 3RYCA 5DOVA 4H0CA 2NSHA 1L1QA 4M53A 3BXPA 3X1KA 2CBXA 4YP9A 3UC9A 4FYIA 2V7UA 4L72A 1OV4A 4ZANA 1YB4A 3ZLUA 3UBTA 4MI1A 5JDIC 5IASA 2OGZA 4NZPA 3DBHA 1AB6A 1C1XA 3SXUA 1R6TA 4DWWA 3VUFA 4OPMA 4JT4A 2OYRA 4AX4A 1NVVQ 4P54A 1DBPA 2P9CA 3W6OA 4DCCA 3L1JA 1D0IA 1DJLA 4PCLA 5T64A 4AS1A 2C5AA 1V4VA 2INGX 2XCQA 2BVNA 1GA6A 3H8SA 4QXRA 4R1PA 1ZA2A 1LQUA 1VI2A 2VP4A 5EXTA 1XQYA 3B7WA 3LXUX 4UBIA 2I2AA 3V4OA 2PRSA 1FMCA 4OBBA 3R3ZA 2PQ2A 1SVNA 2QGNA 1XTKA 4AXBA 1QGUA 1GCIA 2NO7A 2BFEB 4AS2A 4JELA 1ZGBA 2ZQYA 3WQBA 1S7GA 4LRXA 4AKEA 2WC1A 3FDZB 2PV7A 1KVUA 3RFXA 4AY3A 1HDZA 2W7TA 1OA0A 1XO1A 5DNYB 2VTVA 4RA6A 4OP2A 1UF9A 2BBOA 3CH7A 3IOMA 3JQAB 3M6FA 1KE1A 4B40A 2J7PA 4F86A 3P4XA 1V5IA 4I1OA 4BLUA 1E1KA 1ST2A 3TR6A 1UQTA 4Z4GA 4IH9A 1PT5A 3D3EA 1PR0A 3BL8A 3M3DA 3S1AB 1Q0UA 4NNJA 1IK4A 1L7MA 2B3TA 2HL6A 1KZ6A 5CURA 2VDLB 4UEKA 1U94A 1V47A 2BHNA 3O83A 3QUQA 3M3PA 1DTEA 1ZMXA 1W581 2HMAA 4FC6A 1TL7C 4MCJA 4JBLA 1QLJA 4R83A 5ITVA 2Y1EA 4BLVA 1KVSA 3CNOA 1T9CA 4IWNA 2GB4A 2QM7A 4NCIA 1WCIB 3RUDA 4EJ0A 3LUPA 3A6FA 3DWEX 1G4HA 1UBTS 4RVSA 1D2MA 4CTNA 4EI2A 1C1DA 3GBPA 1WDKA 4IS3A 3ZD6A 3CISA 5LLTA 2QB5A 3KSRA 1J20A 3TOVA 4TQGA 4OXQA 1ADJA 4PNPA 1U8FO 1XD8A 2V7TA 3EG9B 2JCYA 2Q7OE 3PXGA 3OFND 3MT8A 4FOOA 1UPBA 4RKEA 3TBFA 4U7GA 1G38A 1F2UB 1GQYA 2ZZKA 1NFQA 1PDVA 2X76A 5KKAA 3RTAA 4CGYA 2ODWA 1UXOA 2WUEA 3MGCA 2WHYA 1V71A 5GONF 3WLJA 3E82A 1W4AA 5HNKA 4MR8B 2EYUA 2OV2A 1ZD1A 2EV9A 4ZK6A 1AGRA 1XPJA 5B3JA 1J2TA 3S1AA 1K8XB 1EFKA 5DMXA 4BNDB 4EQ6A 3F3YA 3KEGA 3KD3A 3FDJA 3M6IA 4K8OA 3G9QA 5D2CA 2H1SA 2GILA 1Y98A 3CEHA 3V7WA 2JRCA 4D45A 5IRCD 1L5ZA 1J2EA 4ZJUA 1D6SA 1YMUA 4AF6A 2XOKA 1W35A 1ZRMA 1LQ2A 4J0QA 2PQ0A 1NP6A 4W1RA 1QTIA 4NEGA 1FPMA 3UJHA 5KVVA 2XZOA 1ZK3A 1WB4A 2FDRA 2YH2A 3FSJX 2GM9A 5J9FA 3VR6A 5J43A 4JC8A 5ITSA 1MPXA 1T2DA 2C5HA 3PGJA 3QWHA 1B93A 3D81A 3D6AA 1WULS 4DYDA 3THYA 3T7JA 1Q1NA 1SC6A 4XE5A 4BLWA 2NU7A 1CTQA 1NE7A 1R9GA 4G5YA 3FB1A 3CPEA 3BK7A 1N5OX 1U5AA 3U44A 2IYZA 2OAEA 4MJ3A 3N70A 4RHTA 3SC2B 1YIAA 4KKVA 2X15A 1RRGA 2ZTUA 1QGZA 1R4AA 2R8RA 3B1KA 2DX7A 3RI3A 2DWCA 5FPKA 1HURA 4K6GA 5ALOA 5LP6F 2G1AA 4QULA 2X9GA 1W25A 4V38A 3JD4A 3AVOA 3KR2A 4JBHA 4EELA 1YZUA 5CT9A 3E05A 1IOLA 1X1AA 2DPYA 2Y1LA 1N2XA 2OP1A 2V6FA 2VWQA 4L74A 3VPFA 1Z35A 4NR0A 2OHVA 4L1KA 3G0DA 2HF2A 1O3YA 1POXA 1QHEA 4RHCA 3G49A 3WA7A 4JVLA 3EEIA 1Q83A 4LRWA 4LY0A 4PX2A 5DHAA 4FEYA 3IJPA 1HDRA 1N2ZA 4MV5A 2ZETA 1DCMA 1KSFX 2QUHA 3WK6A 3ZY6A 4ZYTA 4KVZA 3MD0A 4OUKX 5CDFA 4EHHA 1Y63A 4HNHA 2G9UA 2ZB8A 3TTUA 4ZAZA 3SX0A 5JD4A 4PZZA 4JA0A 3N5CA 2NO0A 2DUWA 2YWRA 3R77A 4BP1A 2GZ1A 4F06A 4MLDA 2I1VB 5TV2A 2WZCA 2AW5A 4ZGBA 3DOIA 3U4IA 4RIFA 3A6ZA 3F98A 5BWBA 4Y6QA 5GOTA 1RNLA 4TT3A 3SD7A 1BFUA 4CUKA 4UUQA 5LU8A 5LVAA 1UINA 4BQPA 2XUHA 2VOEA 1CZOA 1Q0HA 3ZQ6A 3EIUA 2BM1A 4RSRA 4A0SA 2GAOA 5HRCA 3BB4A 2QMZA 3IOCA 1QP7A 1Q3KA 2IXTA 5SYNA 1NIJA 3W5IA 3W2TA 3WNDA 4TLMB 2AOVA 3GQBB 2PX2A 1O6GA 2Q8PA 3WJAA 1LDNA 2MJLA 2X4GA 1DKLA 3WDKA 1JR3E 5HUQA 2VATA 3JPYA 4KPUB 3TJMA 6CHYA 1EGQA 4XUEA 4HDNA 1D03A 1K6XA 2FMKA 3D7KA 1E0SA 4Q3AA 1JKMA 1GNSA 2D00A 4LHVA 4WINA 4HNAB 1B14A 4DZZA 1Q0TA 5IAKA 1GWNA 2P5YA 5HE9A 4CTMA 3NYRA 4U9UA 5JAZA 3G2LA 3JQQA 4RPLA 2F3QA 3U6BA 1KBQA 2YY6A 2IV2X 2ETXA 3L1UA 4P83A 3ZW8A 2GTIA 3K1ZA 5KYUA 3CX6A 3IVCA 4D82A 3P0HA 5FLXA 2P9EA 4Z4QA 2AF3C 3VZQA 3AF3A 3G7SA 4XASA 3WYNA 1HY3A 3QVKA 4OMFG 1E0DA 4YDQA 3H99A 3HRIA 1L5LA 4DOMA 2QYTA 6Q21A 2DH6A 1JSRA 3ISTA 1N92A 4MI9A 3IEKA 3PCRB 4JP3A 3HO6A 4D4IA 3PC4A 2WVGA 2AFRA 3KFXA 3VXKA 5L95A 1FZTA 2YFYA 1E2PA 2WFLB 3MUNA 4NCJA 3WQQA 1G21A 4IAOA 5IDWA 5BN3A 2WK1A 1QUEA 2FSHA 2D1YA 3CCFA 2ZYAA 5A0FA 4AZ0B 1NBIA 4FR5A 2E0IA 4QEKA 2IGBA 2YWDA 3QQPA 2FWNA 4RNDB 4ZO4A 3TQHA 2YYSA 1VDZA 3N59A 1EKXA 3HYRA 4JH0A 3EUWA 2EW1A 5DKFA 3D4NA 4AC9A 3DMDA 4BNWA 2UYHA 3LPLA 4RTPA 3QPDA 3DYIA 3ZD8A 5KOIA 3JQFA 3WMWA 2R86A 1CY4A 1VHLA 2AFHB 2H2AA 3L4BC 4KQ6A 3E9MA 2VJMA 1RHJA 3L7AA 1UJ6A 1HUQA 2E6UX 4X71A 2P40A 2IUYA 2BCEA 1E1QD 1RKBA 2EZ4A 2ZTVA 3DLHA 2DY1A 2V5AA 3BGVA 3K5WA 4YP0A 5EMKA 3H0KA 4HC4A 5F2OA 3I2HA 4NC9A 4RJJA 1BE0A 1SU8A 1GIAA 1G8AA 4H9GA 1CLEA 1ZM9A 1MX5A 1SUEA 2HXYA 1U3WA 4XVQA 5DVZA 5I4BA 1JYEA 4MTCA 1SCQA 4YH1A 3ETJA 2FOXA 4DR3B 5AKXA 2P9FA 3KHUA 1UT5A 3REFA 2IHYA 2IUFA 1ZN9A 2IQIA 3L0PA 1UJNA 1FTNA 1V8FA 5IN4A 3GX1A 2VOJA 3IDQA 2XKBA 3TFQA 1SEPA 1GILA 4O2LA 4MV9A 3ZNOA 3JTEA 2XF8A 1J23A 1NTOA 4XW2A 4AWXA 1CETA 3CNHA 4QZVA 3KYCA 3VZSA 2P9ZA 4LQLA 3BPSA 3ORFA 4R8MA 4B3RB 5JYCA 1SC3A 5ICMA 1KDTA 4N18A 3OCWA 2RGBA 3HR8A 1N5KA 1IY1A 3U7FB 1UJMA 1JNXX 5JFTA 3ZY4A 1E3WB 4MUXA 4DJAA 2IL1A 4II3A 3TQCA 3X1YA 3AIOA 4AL4A 3TLBA 5JNWA 3U17A 2PSEA 3FWKA 3VNUA 1FDUA 1IG3A 1UMCA 3GD5A 4MI6A 3DBLA 3LC7O 4LOKA 3EDOA 4KO8A 1E9SA 1FP4B 2GEJA 2HCFA 2QMQA 2X13A 3I58A 4MW1A 1FFAA 2QVCA 4A73A 3AEUB 5KBYA 3NIGB 1XDBA 3C5HA 1H0RA 3QV2A 4YV7A 3BBLA 5IMBA 5CLFA 1ZP6A 1IUNA 5A9SB 1KGSA 4XYEA 3C6BA 1Y8QB 4CT0A 3MINA 3GMDA 2OC9A 1VSUA 4FDAA 4NJMA 3WLMA 5TRTA 4CKCA 1UDBA 1ULTA 4R2LA 5AKEA 4GKAA 1SKYE 4YJKA 3KT3A 4E5MA 5CBPB 1SBZA 4GLJA 5EE3A 3WL7A 1NU8A 1VB3A 1GGEA 3FNQA 4HB0A 2WD9A 3A32A 4DIEA 1E8MA 2FA9A 2BLNA 2BZGA 5D1HA 4DLZA 3LM8A 3GYBA 2W71A 5CG2A 3OPQA 4E5DA 5IS2A 5FAKA 4A0GA 1G20E 1CUGA 2J0UB 5FBVB 3BGWA 2PGAA 3IAM1 3OZCA 1RLUA 2H00A 1M6WA 3OWOA 4KSYA 3SYLA 5FWXB 2AD5A 2VUUA 1ZUD1 4XCVA 1OT5A 2JGJA 4UVHA 3N28A 5A9SA 5DB4A 4HK4A 1PHPA 3PEEA 1WY7A 3EF0A 2HSZA 1FW8A 3V7NA 3ZJTA 3RC7A 2M32A 2ADFA 4HYEA 5IVHA 1O5TA 3GJZA 1BH2A 1TMKA 3IIEA 3AR8A 3NT4A 4LBWA 4ZXFA 1F2TA 2ZJ2A 2XDQB 3IUBA 4KXVA 1KQNA 4AY6A 4RQAA 3MMXA 5BNWA 3CF4G 1M2WA 1P1CA 4TV8F 5G1PA 2OD7A 5K0CA 1EHCA 1VSTA 3HP7A 4YECA 5LL6P 4I4NA 3I2IA 3IV7A 5ED0A 1TW3A 3PHIA 4NTZA 1AS3A 1P3JA 4E5YA 1VE6A 3T15A 4AJOA 2AWOA 2AXPA 4YHHB 4AURA 1FE8A 2PBZA 4MYUA 4RTRA 4CR8A 3GU3A 4R3NA 1QQ5A 2IELA 5C53B 5B4UA 1TA0A 2BFFB 1JMKC 3NOOA 4PQYA 1Q92A 2G06A 2O3JA 5TPZD 3QJ5A 2VL7A 4GSLA 4IBOA 4BFTA 4DWVA 5KVAA 1MCZA 3RRZA 5EEGA 3PSAA 1G8YA 4P86A 3OOJA 5B4TA 2IEDA 4YCDA 3S40A 4B6SA 4OYHA 2CSUA 1M1XB 1NVVR 2O1SA 3DTNA 3GRUA 1KEVA 3OQPA 4XB1A 3ROFA 5KWIA 1CULC 1E3JA 3HSYA 3HMKA 4MS4A 3D3WA 2PTGA 4C4XA 1J0AA 2WZDA 2OUKA 3E3LA 5DEOA 3LL7A 4YRMA 3CUEF 2SBTA 4HAXA 3BJRA 2NOAA 3NALA 3ICQB 4X00A 1E9VA 1HC7A 4DJFC 4JVOA 3OAAD 2NXCA 3GLSA 3WLLA 1EFUA 1FMLA 4B9EA 1S2GA 4Q3NA 4CCYB 2XWBF 1DVRA 3IVRA 2EQ5A 2QVGA 5EGSA 1H5NA 5J40A 2VH2A 4BO1A 1A4UA 1O2DA 4Z9YA 1Z74A 4W8GA 2F8LA 3RASA 2B2CA 1GOTA 2RK4A 3OG9A 5F7JA 2C5BA 3DVAA 1VPVA 2EHDA 3BD9A 2HPAA 4QVGA 4RMGA 4N47A 5FOVA 5KQGA 3EVBA 4IYRA 4BLPA 4BKRA 3EGIA 3DXFA 4HAZA 3IJRA 4MEBA 3U1BA 1QVWA 2EJUA 1SIUA 5IXJA 1YJCA 1JEQA 2E4VA 1N5MA 1PK9A 3V9PA 5HW0A 1C9JA 3W8NA 1IUOA 3B89A 5FR2A 3UMFA 5I9NA 2P11A 2DTXA 1Q0SA 2WPDA 4TN1A 4MW5A 3H7AA 2KQUA 3P94A 1QRSA 4Q01A 1COWD 4CLOB 2VA9A 4DB2A 2G6BA 1J90A 1USWA 1KFJB 3N2IA 4HDOB 4Q3BA 3A6HA 4TYNA 2PMWB 5IK2A 3VR0A 3B7PA 2R6CA 1KAMA 3FWNA 3KOWA 4I4TF 5I7SA 3VR4D 2V65A 4RPJA 4X1IB 3ECSA 4C4AA 1J56A 3H11B 4XX1A 1JHXA 4CMBA 3TM5A 3U4MA 4MVXA 3ZGZA 1E1CA 1HEYA 5KWJA 2QS9A 4R1MA 3RYFA 2HA6A 3F2IA 1Y9ZA 3FJYA 4FHCA 5IARA 1VL2A 3VQTA 1I3LA 1GADO 2ATVA 4HADA 1MO4A 4WOPA 1JVSA 3R5TA 4HLDA 3WIDA 3PJRA 1T0JB 2VP3A 1HQCA 2Q5QA 4K9DA 5E6SA 2JA2A 3Q2IA 4K86A 1R64A 3QA9A 4LRSB 3BEDA 3GOQA 4Y2SA 3QUTA 3QF4A 3L6OO 5DWDA 1CUUA 4DA7A 3GA7A 3OSUA 4EGAA 2IY7A 2VQDA 1UKYA 2H07A 4JGBA 1OXTA 2J08A 4B4DA 3P1JA 3TD6A 4P5PA 2DKFA 3ZZUA 2NPOA 4MRPA 4PAOA 2QW0X 4EEZA 1K68A 3P0EA 4LOHA 4E12A 3KYJB 2XV1A 2E21A 3CH6A 3MLBA 1EFLA 5K6AC 3MMNA 2VRCD 1XL1A 3FNIA 2FY8A 1QVRA 4FYWA 4Y8VA 5DSZA 2H2FA 4YGYA 1P9NA 3B1VA 3GH1A 3HU1A 4EHBA 1TVKA 3PQ8A 1FXUA 2LPMA 1AKWA 5EESA 3U0BA 4FINA 1XEFA 1RPTA 4ICIA 1BN7A 3KXKA 1NFRA 2FKAA 3LQ1A 4FILA 1NNUA 1T1EA 2ROQA 3QU5A 1UC9A 3EXHC 5CPBA 4GM0A 3GL9A 2BWJA 3R0IA 4TXJA 5ARBA 1PK8A 4WXYB 4RZHA 3S8MA 1U5CA 5H1YA 3K4HA 2VK4A 1QSGA 3JASB 2BM0A 2E4WA 2Z43A 4FEGA 5JPIA 4EKYA 4YB8A 3AI2A 4LTNA 4JZYA 1SZDA 4FOSA 2OBFA 4G5GA 3UO8B 1Q0LA 3EEOA 3C41J 3ZDDA 1Z2AA 1O97C 1NJ1A 2AV6A 2V0CA 3GYGA 4HUJA 4LZWA 2R6AA 4I0WB 4JC4A 4DMUB 2JGLA 5KJFA 1T6YA 4IW3B 1XJ0A 1CUCA 2G5CA 1NSTA 1OJLA 2I80A 3LLVA 1XEXA 1HT0A 2ZYGA 3R5SA 1M6YA 1I4DD 5J2UF 1DMSA 1ZI9A 2WJ4A 3KLOA 4YP7A 2AE1A 1GNRA 1JR3A 3MB8A 2JCXA 4Q0MA 4DLNA 2OR3A 2FPGB 1GKLA 2Y1KA 1W8IA 4Q48A 1ZICA 4QXMA 2G80A 2O2JA 1HI9A 3H4IA 3EUAA 4EW1A 3IPAA 4P3NA 4DILA 4FSXA 4G5FA 3PG5A 5I47A 1OASA 3OQOA 1EFAA 4N4AA 4GMDA 2GN1A 5ADHA 2PMCA 3HJAA 3JU3A 1MV5A 3JZDA 1T9ZA 1UZNA 1SC4A 2HBRA 2I3BA 2HU8A 4HWKA 4OI2A 3MIZA 1LH0A 4TV9F 1AUPA 1BKSB 3KU1A 3USES 3YASA 2ORYA 3SE7A 2A1TR 5EKDA 1W5EA 3ZVMA 1XALA 3WL4A 1G20B 3FR7A 1DKNA 2W6JA 4K3UA 1MVNA 4LHZA 4A2WA 2QX8A 5AKYA 2D7DA 2UUCB 4XYLA 2IYQA 4U6QA 1JALA 2H2IA 2J6CA 2J87A 5B4VA 4LCJA 2I6TA 4GYJA 3K1YA 5IYZB 4R0VA 3L8CA 1AKEA 2HZBA 5MN5A 1K75A 2R60A 4Q24A 4WN9A 2I9PA 1JEJA 4ZOEA 1TM3E 2MSNA 5CRIA 1ZGHA 2AN5A 3H5RA 4GLBA 4OK6A 2OHJA 1OLOA 1NMZA 1C4KA 2VYVA 3N8GA 3UPTA 5DV9A 2GSDA 2IK8A 4UMDA 3I28A 2C4NA 3DO5A 3GFFA 4ARAA 2HIAA 3OFKA 1L4HA 4HN4B 4R54A 1KE2A 1KARA 1DX9A 1RJWA 1Y3BE 3WDLA 1ZY2A 1VPTA 1OH6A 4MR7B 2ZRMA 2EIXA 3OFVA 5AKHA 4BWFB 1BNCA 4ENTA 5BR8B 4YAWA 1E6LA 2A9PA 4WE3A 4PY2A 1W88B 4J3FA 4XLTA 4EITA 3A4TA 5KVQA 3ZDYB 4XWOA 1RI5A 1D5CA 4NX2A 6ABPA 2C7VA 1R3DA 2E4ZA 2UZ3A 3ZHZA 4C4YA 2K7ZA 4YUXA 1M2VB 4U7DA 2GETA 4XVRA 4E08A 1N2SA 4UXIA 1URPA 4CKEB 4U4AA 4DRYA 4W5QA 3KAPA 3OE7D 4MV6A 3V4VB 3JRNA 3AVUA 4H17A 3SC3A 1CVLA 4JR0A 3OMWA 1THTA 1P0PA 5AUOB 1W88A 4OU5A 4MSUA 2QLBA 4UTVA 5IXYA 3OVMA 3OM8A 3K05A 2JEYA 3K94A 1YR8A 1EEXB 3FDFA 2V6IA 3JYQA 3QLUC 3USCS 2XNJA 1KH1A 2I4TA 2OHFA 3VR6H 4E5VA 4CR6A 1U9IC 3DFUA 5F9MA 4LXXA 1HYBA 1P3DA 2A1TS 2WU1A 4MR7A 2N1MA 3LC1O 5JZ9A 2DPGA 1ECPA 1Y4UA 1C3LA 1R0YA 1BXKA 2BPOA 3HN7A 2WMOB 4GU5A 3SZMA 2PRKA 4IP0A 5A5FA 1ZD9A 1EVYA 5HS6A 1CKEA 3HKEA 2O8EA 2DCUA 1RMTA 4FU0A 1XLTA 2BT4A 4TLBA 1BA3A 2Y76A 2V9ZA 3GARA 4U7FA 4WFJA 4JLDA 4DCVA 2GEVA 4IL5A 4F3CA 1GA1A 5H3CA 3UT0A 1BA2A 2R7KA 1TVEA 1E92A 3T1OA 2X2FA 4G0OA 4KVAA 3ZTWA 5CDFE 1ND6A 3FE2A 4P31A 4IICA 4RZ2A 3WI7A 4Q1VA 3KZCA 1YQ9A 3KKEA 4PZPA 2AQ8A 1IHYA 4GYKA 3B12A 3BILA 3H2IA 1UKCA 3WLIA 4RZXA 3NHRA 4H7PA 5FNVB 2HB6A 2OLKA 1B1AA 1R6BX 2A5FA 5DYIA 4UMVA 3TNJA 4K87A 4V24A 3W2HA 1UP7A 3RFCA 1TCAA 4QG3A 5JC8A 1YOVA 2YCBA 4B0OA 1Q0QA 4FGLA 2ZWIA 2VP2A 5BSTA 3ZK7A 4NV0A 3FCEA 4LVCA 1STOA 3WMXA 1TI7A 4FLEA 4CCWA 1EBUA 3AILA 3LWZA 4LJKA 4F2GA 3A2KA 1BJKA 2JD0A 4JBWA 1FRZA 1U11A 5KCZA 2II6A 4BU0A 5HOEA 3K8QA 3QVVA 1RPAA 2HYIC 4HPJB 1BW9B 4O1HA 3TUIC 5AVQA 1Q1GA 2QE6A 2RGAA 3HEMA 2O3TA 4ND2A 5JCXA 4WK4B 4WSOA 3ZE8A 2QWXA 5JMWA 3ND7A 2YQ5A 3ETDA 1TYDE 1LBTA 5TMDA 2Z95A 5FLEX 3DFIA 2XQJA 4RKQA 3AF2A 3GPBA 1KVQA 2IC5A 2PMBA 2WHPB 4P3PA 2X42A 1F9AA 3RYIB 1BHSA 1QGUB 3N75A 4HHEA 5K0BA 1JSLA 2Z5GA 1GQQA 3BMNA 4GKBA 4IF6A 5IH3A 5B57C 4CI0B 4QATA 4WXRA 2YQZA 4MH0R 4WTOA 4B6JA 5F1YA 2CNNA 1LNQA 1SUWA 4P80A 2XVZA 3ZZTA 4FNGA 2ZRAA 3FOBA 1XRRA 4IUYA 1IN7A 4XZ3A 1HOXA 5DTIA 4X66B 3P2IA 2RGRA 3W0LB 1PVDA 2CXHA 1T9AA 4UZEA 4KE8A 2CGEA 2XQVA 3TRIA 3VKWA 5IJAA 3VTAA 1LVUA 1XVAA 3MWEB 1ZAYA 1QG0A 2HO5A 3IEUA 2M6SA 2DR3A 4CIVA 5TNXA 4NCBA 5GONB 3F3KA 1CQPA 4G09A 4MLPA 4QASA 4AN1A 2GNOA 2HBQA 4YIHA 4WKOA 2I2CA 3TSYA 2V0NA 3OIUA 4KGXA 5DYGA 3B6EA 3MK31 3I4LA 3T1TA 4LSGA 4BASA 3F9CA 2P75A 5F7XA 1Z73A 2WOJA 2CFCA 5E95A 1BZYA 2QAGB 1A7AA 2PG3A 3M4NA 2VTKA 2IH4A 4ZARA 3MJHA 2QTNA 2W9XA 2XBUA 1KMHB 3DO8A 1GQOA 4FMDB 5LNK6 2O8VA 4DSZA 1AZSC 4ITUA 2H8GA 1F5NA 3A1DA 5DW3A 1L8AA 4J7CA 4B6QA 1KEEB 3IDFA 3DBOB 4FQ5A 4HGZA 5AYVA 1JBEA 3ND6A 3E3NA 2HA7A 3PXDA 4ZVOA 1M0WA 4AICA 3WVNA 1IWOA 1YKSA 4M1ZA 2VO1A 2X5JO 3HEAA 4K26A 3ELYA 1HDOA 5HIAA 1FRVA 1VCIA 4LRYA 4QE3A 5G0VA 4BNZA 1PEAA 3NVMB 2VHJA 3MTQA 2O8DA 4XCQA 2JIZD 2XAUA 4L6IA 5M7EA 1N2JA 4DIUA 2NZ2A 2FQXA 2JI8A 3I04M 2VF4X 3OWXA 3BICA 4JVSB 4LDAA 1UBOS 3IMCA 2XCUA 2YS7A 4Q9IA 4UE3S 2XA9A 2ILVA 2FVXA 4H15A 4D7AA 1NVTA 2ZB3A 3Q7RA 3R3WA 5CXQA 2J8ZA 1O94A 2FX3A 1FXWF 3RABA 3CNNA 4PPNA 3GJ6A 1DQZA 1W2WB 3KR9A 4J76A 3JQ7A 1IHUA 1PT7A 3DPSA 4LYAA 2NVUB 3ZV5A 3E48A 2J5BA 1OI2A 1YKGA 2PD3A 4RZQA 4TYYA 1C3OB 1YZLA 3F7TA 1WVGA 3JYNA 1TT5B 1K8ZB 4GH5A 3H83A 4XGNA 3O94A 4CKWB 3ADKA 4JODA 2O8FB 3EVNA 5IK2D 1JYSA 2WR8A 3CLRC 3AF0A 4C7VA 3T3EA 4ND8A 3CR3C 5LWHA 4G0NA 3UY4A 4DG5A 4X3OA 4TVBA 2I2XB 1ZIOA 4QHTA 4WCFA 3T9BA 3CLSC 4TMXA 2CLKB 2WF5A 4GLFA 3SHVA 4ENVA 3TK1A 5C7LO 3ORYA 5CDUA 4BNJA 1DZ3A 3ERCA 2EFEB 4LYEA 5IMSA 1IRIA 4MICA 1XEWY 1CXZA 2FPLA 2WIKA 1J21A 1D4ZA 2P0AA 1ZL2A 2BFNA 3NT5A 3GUVA 2GK7A 4AVYA 2ID9A 4OTZA 2QHXA 5CH3A 4QEZA 1G4AE 4W9MC 1EWQA 3A2LA 1J9ZA 5CGQB 3ESDA 5ICFA 4HNTA 1JXQA 3VR3A 2F3TA 5BN4B 3JVVA 3T5GA 3FROA 5F9FA 5A02A 5J3JA 1A9XB 2XXBA 4QQFA 3KKQA 1N5RA 2WA2A 4MZDA 1N0IA 1U2GC 2XWSA 3WHKA 4AJIA 4E94A 1Z45A 4X3CA 4D8YA 2ZULA 2QTAA 4NBKA 4FEEA 2WPDD 1KOFA 5CA1F 3UPDA 3U4HA 1X1CA 2DWUA 3HKCB 3MSCA 2Q0XA 1SGWA 1M8KA 3N2EA 4UARA 5AKLA 3WL5A 1PFGA 2VKQA 4O4IB 3THOA 4G1BA 3ICWA 2J9FA 5FQOA 3TAUA 3AM4A 1KK1A 4BGDA 1PZHA 3LBYA 4ZHQF 4RESA 3CLKA 4IGFA 3QITA 4CV3A 3OM9A 4OI4A 1AQJA 4MQMA 4HR7A 5JSZA 3ESBA 5K3FA 1C41A 2WYOA 3QK7A 1LRLA 2AKEA 5FI3A 1Q7GA 1AG9A 3F6EX 4EGQA 5GONA 1VA5A 3DW1X 2H5EA 3OI7A 2JK1A 3B7GA 2WW8A 1CPYA 2VNKA 4UHJA 3PZRA 1BTOA 4TRJA 3I9LA 3MEQA 4RA9B 4OLBA 4CQJA 4E5UA 1MHTA 3H16A 3QFTA 4QGAA 1EVIA 1ZYUA 2D5CA 2IXFA 3E7XA 3HZZA 4EHIA 2XUKA 1JJBA 1Y4DE 4WLNA 1MRSA 3UMGA 3PC8A 3PQ3A 1L5MA 3ANYB 4BNFA 5GVRA 2CNDA 3L7IA 5IM4A 2JPDA 4M9CA 1JT9A 5BV1A 1V25A 1PDWA 1I9CA 3D5EA 3T5DA 2NTNA 3T1NA 5A71A 1U9ZA 5KO2A 1OU0A 5T5QA 4ZQBA 2NU8A 1N32B 4CEIA 3G9ZA 3DLCA 4HATA 4WCVA 4E2XA 3VYSB 2HU2A 3MC1A 3QOYA 1KYVA 4YBZA 1FNCA 1N0UA 3AERA 2CDNA 2X7XA 4F2WA 3USZA 3MYYA 4R41A 4Y6SA 2O8CA 1PR9A 5BUSA 1YRHA 4R81A 4MR9A 1V7CA 3SLRA 2AH5A 1FNDA 1XRQA 4JL8A 5FTWA 3PF9A 4IQFA 3T9DA 3U2QA 1T9KA 4AZ3B 4D3DA 1QH9A 1XD2B 2VQ6A 1HEUA 2WF7A 3M33A 2WT8A 1Z7EA 1R4NA 1U0NA 3QFSA 3PX3A 1YZQA 2FG6C 1O87A 5CR9A 1D6MA 3BMOB 3U13A 5LR6A 2VCEA 5DM4A 3IUJA 1RWOA 2R7NA 4OEHA 1QIIA 3LUCA 3SLGA 4EG5A 1CIVA 2PKQP 1OWNA 1GNLA 2FJUA 1B2LA 2VPZA 5DZSA 4INAA 1DARA 4UULA 3KQNA 1ISIA 1EWYA 2FSSA 4CTJA 4WWHA 1ONBA 2XA1A 4OQFA 2IHJA 2PMFA 2WHQA 4OQLA 5KX5B 1RDFA 4BE4A 4FB4A 1NG1A 4ZCPA 3F71A 4Q1DA 5PNTA 4JI4B 5EUQB 4OXRA 3DDUA 3R8CA 3HABA 2GPSA 1L5RA 4C0LA 1EFPB 5TMPA 1VPDA 4YA6A 5EI5A 1NR5A 4OQZA 1HR0B 2BJHA 1MAVA 1YE3A 3IUYA 4EYQA 5HZGA 4MUAA 2PMKA 1T3TA 4XWGA 1E1QA 3DEFA 4HH1A 3SQXA 4N9QA 3W79A 3PGLA 4IFTA 3DE5X 1XDWA 3FPLA 3QXJA 3UKOA 1C3XA 1I6LA 2W90A 3LFHA 3MJVA 1W19A 4M0KA 3AHFA 4PGHA 1IDOA 1FZQA 4GPZA 1HG1A 5DHRA 4ZRMA 3VH3A 1S3SA 4PICA 1NXOA 1OX5A 3INYA 4O4LB 4YMGA 1F3OA 2VN8A 2NTJA 2CUTA 2WKQA 2ZWOA 3FNBA 3TD9A 4EB0A 4L50A 2ETVA 1ECFA 1ZEMA 2NG1A 3ZE0B 3SEAA 2Y2VA 3NGXA 1L7AA 3T06B 3HJBA 4V2IA 5AESA 3S2YA 2LIPA 1J0EA 4NK4A 4P7BA 1EZ1A 4JJIA 2QP4A 4V0LA 4UEWA 1XQ1A 4BXOB 1Y8QA 4N01A 3T7AA 1JQ3A 4K2AA 4QUHA 4XYGA 5UKDA 3WA6A 2I4MA 2DECA 4ALJA 4FI3F 3FCUB 4CEHB 2P6OA 2VYQA 5CFQA 1XAJA 4N41A 1Z5WA 3MCWA 4TTRA 2G7MC 2C2ZA 5EIEA 3UHOA 2PD6A 3Q5GA 2PRYA 3FB4A 4HAIA 5FA5A 1A5SB 5GZ3A 1KI7A 2CLLB 4QDOA 2VJYA 1PTJC 3ABOB 1UBMS 3GRAA 3R9XA 3P9PA 2IXDA 2OGTA 3DDZX 5LM3A 3LCUA 1T5DX 3QKSA 2J6HA 1NN5A 1J4AA 4NLLA 1KC3A 1I33A 3LX6A 2XT9A 2Q28A 3I6BA 2B4KA 2WJVA 3PJFA 4OJNA 4DM3A 3JSXA 2WEKA 5D5QA 4XGKA 2JD2A 3WTBA 5CCXA 1GGHA 2Y0EA 2SNIE 3CE9A 2PXXA 1OE0A 5JAIA 2OVBA 4IG9A 2ZP1A 4DR6B 2G9ZA 4D4HA 2VP0A 5ALGA 4B3GA 1S8AA 2ZSUA 5EP2A 3IBYA 4RVDA 5HUHA 2D1QA 1DQSA 1N25A 3B1XA 3PPWA 3BFJA 2I76A 1PS0A 2GWHA 1SG9A 2H4WA 3MFYA 4M55A 2RD2A 1F3LA 3AY3A 4QL3A 3ZHCA 2JGDB 3QGMA 4P4SB 4EQ6B 1GQ2A 4WW0A 5FLKA 3V8PA 2RG1A 4KO1S 4YAGA 3HB7A 4NAUA 4C0WA 1VQ1A 2GZ2A 3ORRA 3A3OA 3KHSA 1SBIA 2C9BA 2WHXA 3QMVA 1SXJC 3V7FA 3HXQA 2XTJA 3B6IA 3JATB 4C07A 2GCGA 3GA5A 3ETHA 2GN9A 2XNKA 1Y5IA 2GCOB 2X0KA 1OWMA 5B1SA 1AB5A 2FW8A 1TUBB 4PXSA 2WT9A 3CVVA 1HFKA 5BMVF 3QX8A 1MXFA 1TT5A 1BS2A 5DCYA 5C3UA 5JRDS 2AF4C 3ICOA 3HA7A 3RC2A 4QPZA 1KJYA 1ZVQA 4DCUA 1UBUS 1QIFA 2N46A 1QP0A 3AUXA 2BMJA 4DSAA 2IGTA 4A2PA 2IYFA 4PTZA 2DPMA 5LXTA 1GVHA 1RXWA 2FWIA 5JLJA 2PUAA 5IJ9B 3WSWA 821PA 1P61B 4KH1A 3ASVA 3CMCO 1E63A 2NUBA 3R5XA 4HWRA 3FPAA 4AKIA 5KNCA 1MX3A 3OQIA 3TTYA 2ZIAA 3VV3A 3H86A 4LAFA 3SIXA 4XUCA 4ZMBA 4RABA 3ZY5A 3R9WA 3LWNA 2MTBA 1EB8A 4D9CA 3U7GA 4B45A 2HV9A 3L07A 3ENZA 3HQ4O 5H4GA 2XH8A 4EAAA 3CJQA 4HLUC 4M1EA 1JEQB 2Z9DA 3E61A 4Y1GA 5KC8A 1NYTA 5FPPA 2D0PB 5FKJA 5JDCC 2H4HA 5FTNA 5BT8A 4IIUA 5L3VA 4TROA 5E4JA 4DCSA 1DOZA 3FVQA 3GJ5A 2K7FA 3PQEA 2VZ9A 4NBWA 3B6MA 2C9ZA 1S0UA 3BMQA 4AQ7A 3V1KA 2OESA 3MSXA 3K20A 1FQOA 5E3IA 3T8YA 1AVTA 5H83A 3S7TA 3R7BA 3B2QA 3VSAA 2XOKD 1W5BA 1K9SA 3CN9A 1UAGA 4MCIA 1AKNA 3DB1A 1EAMA 4BAGA 2PLRA 1RR6A 3RBAA 2F1HA 1D1PA 2I62A 3LPCA 8LDHA 5BWLA 4YJFA 4K1XA 2P8JA 1P1RA 1P2TA 4P4UA 4DKJA 3V8VA 2ZRLA 3WKDA 2WAOA 3FFTA 2DR2A 1HA3A 1JZQA 1B74A 1U28A 2P2GA 4MYHA 1N8NA 5C80A 3TUJC 4D9BA 4FIDA 2O3SA 1ZFNA 1EE9A 4RTMA 4U0KA 2QN1A 3EXG2 3AIMA 3T9AA 2OLJA 1KGDA 4F7DA 1BMDA 3GUHA 1WU8A 3QVGB 2Z6UA 1LDEA 1KS9A 2BMEA 2X1LA 3PD1A 1MC8A 3KB1A 4M9ZA 4ZEXA 3FYDA 1JILA 1ZMOA 2AR0A 3OZRA 2FW0A 4Q00A 5IAGA 4A92A 2R1VB 1TO1E 1UH5A 5F3WB 8OHMA 5EZQA 3Q85A 4YR9A 2EJVA 1AX9A 4PSCA 2JL1A 1ZKDA 1NASA 2A5DA 3WBKA 3ZNPA 2HH9A 5CJ2A 3WMEA 2FP3A 1G2QA 3TSWA 3JRXA 4DCMA 4OKSA 4F9EA 3RS7A 2W98A 1G7SA 3LY8A 1SH7A 1SHUX 4DM4A 1G7TA 4KZKA 4LY3A 4OXYA 4WBNA 3IQDB 1I0IA 1RPNA 4MJXA 5EL0A 5A3SA 3VNRA 3HN6A 3UT5B 3AZPA 3ZTYA 2QRLA 5DJ5A 4LUCA 2ZRIA 4BP3A 4FZJA 5HP4A 2Z3ZA 3K0FB 1JI3A 2ODEA 4DDKA 2DWOA 1JFSA 3IAUA 5GY7A 4DMRA 5I7OA 3ZJ5A 4IHJF 3O73A 4S1PA 4EYOA 4BEBA 1FS4A 5ISMA 2Y68A 3HR7A 3BQNB 3HGTA 4B47A 4CM9A 4K28A 1P4GA 1R4MA 4I9GA 2HLDA 5A06A 3IAS6 2GCNA 1KY2A 4KPUA 4ZIRA 3UK6A 3PVCA 3C48A 3IESA 3JQ8B 1NOKA 3NHJA 1SR8A 2I8AA 2NU7B 4EY5A 3QY0A 1FRNA 1FSPA 3PGMA 4WJLA 3OLZA 2V6BA 5E4FA 1I32A 3LA6A 3QPUA 4I5IA 4U2GA 5DLEA 4RTOA 5BSWA 5AK4A 1RYMA 2OOSA 3RIGA 4PXYA 3VHRA 3O8LA 1XKQA 3VO8A 2J3EA 1M0TA 4RWZA 4QPCA 4ZC8A 3R7WB 3GJ7A 4CNBA 3BBPA 3N0XA 3ONFA 1QV7A 4UXJA 1YUBA 5ERGB 4EQZA 1ZGGA 2BGIA 1XJCA 2ZBPA 3L7BA 4RZ3A 4F04A 3HSKA 5AVJA 3A58B 4F6LA 4YCLA 1IM8A 1HDYA 1RAHA 3DWIA 1OZFA 5JQWA 3UT5A 1QV6A 2O7RA 3AHGA 3QM1A 1R8JA 4HRXA 3TG8A 1Z63A 3BXXA 4RW0A 5EP4A 3G6KA 2VR1A 5TGTA 3FPSA 1B73A 3O3NB 2UAGA 3QG5A 1H2XA 1X0XA 2WP8J 4PRLA 1P7YA 3LA8A 1DBVO 2C2XA 3SXJA 4TWRA 2X3YA 3ER9A 2A4KA 4KAJA 3UBMA 2P4HX 2PGDA 2ZQZA 3JZFA 3RRMA 1JHZA 3O95A 4BB5A 2CNOA 1B8NA 4I08A 2X0FA 2YHBA 4MP3A 4JLAA 3CNLA 2O3RA 3ZGOA 3DCJA 1E2KA 1TJNA 4W8OA 1KEUA 3L1IA 4NCHA 4R1TA 5T4BA 2VXCA 1GRRA 2BBWA 1RRCA 3DQQA 4D92A 3I1FA 4DS3A 5FYQA 5KSOA 3KYCB 4E07A 1QR2A 3EMVA 2BDUA 3RRJA 5J47A 4GICA 4HB2A 1ISGA 2Q46A 5FAXA 4BCDA 5DM70 1E9DA 1OREA 1QWSA 1P8AA 2HCTA 3BCRA 3SZRA 3ZZNA 4IILA 1H8HA 5JCZA 5KNLA 1O7JA 3DVRX 3KAJA 2RHGB 4ER0A 4EDHA 1SVOA 1B2RA 4WUVA 3TOZA 3BT7A 2B92A 1NX6A 2YOHA 3NETA 2DFDA 2DY0A 3IP3A 4NBLA 1T26A 1UDWA 4QGBA 5F2KA 4KOEC 2V7WA 3TBHA 2W2LD 3J81A 3PRKE 1SM4A 1AKVA 2W58A 3C14C 4D3SA 5L51A 1HZZC 2AUTA 4LDJA 5CG1A 2ID4A 1E3MA 1F6BA 2Q9AA 1NDUA 1PGNA 1QF9A 4RPHA 2EF0A 4C0XA 1RXVA 3A1WA 1NW8A 2IF2A 2QN8A 3ZHVA 3FGPA 5EKXA 4CIXA 4I50B 4X45A 4YRCA 2VH1A 1QYIA 5I9TA 5I45A 1M2VA 3VO2A 2HRQA 3DXZA 2NSLA 4LS3A 4YRLA 3WKAA 3NFYA 4G63A 3RIMA 3RRFA 3OBIA 2JJ1A 4HDRB 1C7RA 3A9VA 4ITRC 1YZKA 3D9QX 3FUWA 1L1EA 1N2HA 1ACLA 1J1IA 2Q6KA 3ZLVA 2OGSA 3WDMA 1FFYA 1ILEA 4CTOA 3A9UA 1JFVA 4GBMA 2AI1A 5ED4A 2FMXA 3DOUA 1H3NA 4MV8A 5J4VA 1GGNA 1IUKA 4RMIA 2QX9A 2XW6A 3GP3A 3R3SA 4G2NA 1HNNA 5CIWA 4ZEOA 3WP1B 2MSKA 4YV1A 4BNXA 1F2DA 2DBQA 3W5HA 1CVRA 4U3JA 3AI3A 5ICCA 4G5RA 4W5TA 4UATA 5CNMA 5ENVA 2FEWB 4WADA 3BXZA 2HWXA 2XNHA 4CM7A 3WIEA 3PQ7A 3IEPA 5TPWB 3G8YA 2C9YA 3ZI7A 2IODA 5IYZA 1OZHA 3H1EA 2QD3A 4AMGA 1DIHA 2HAEA 5FTJA 4B3TB 2ENUA 5EMMA 3AC0A 3PB3A 2XT0A 4ZI5A 1TIBA 5JRZA 2OUIA 1TDJA 2VHVA 2FW6A 3G1TA 4PO1A 3WB2A 1RYNA 3A06A 3LY7A 2CJFA 1UT6A 1I30A 1EFRD 2GK6A 5H59A 2B5WA 3LDUA 4K0KB 1Z9BA 1K63A 2H1WA 2I71A 4ZO9A 4MGHA 4GR4A 3H65A 3UMJA 5HQ3B 4JZKA 4U2EA 1DBIA 3KTAA 3AIIA 2CNWA 2BEWB 3FH0A 2YZNA 3HA5A 3MXTA 4TOIA 3ZYZA 3U3KA 4A15A 2IIPA 1JFLA 2LV8A 4GLOA 5I7AA 4C22A 2DYKA 2O2YA 2FEAA 1CEQA 3BZBA 3G6WA 3PE3A 4ZRDA 5E8RA 3I61A 1FRFS 5BOSB 5FA8A 4ZCLA 1NN3A 2WDZA 2IPLA 3LBHA 5TS2A 4XTCS 4CLEA 2YXBA 2NV0A 3UAWA 2Z6VA 1VKJA 2Q4EA 1NVGA 4W99A 3SYRA 4I2VA 4PYQA 3GLRA 4ZQHA 5IKEA 3I23A 2R5FA 4XQ9A 5E1MA 1P2BA 2O20A 2PZKA 1ZCFA 4NJOA 1HQDA 1NT4A 2JAUA 5EIAA 3V46A 3CEJA 4BVLA 1W0CA 2RK6A 3EXEB 4HVLA 4CCSA 4QPPA 3ZW7A 4BMCA 3IUNA 1S02A 2AW3A 1GPNA 1O5OA 1E0JA 2I33A 4WLEA 4JJAA 3ROTA 3IQIX 4H7IA 4JI1B 2FTKE 4AZ3A 4Z7QB 4I3HA 4HN9A 4F93B 3HWSA 1VMKA 2F1IA 2A6PA 2W6MA 3LDHA 3Q3HA 4JLOA 2VJDA 3B78A 5FO0A 4O33A 1CHDA 5ITWA 3K2QA 5B7QA 3X1XA 3DEJA 1Z3IX 1Q77A 3ICVA 4BZPA 3QMPA 3DAOA 2OFXA 1OI3A 3DPIA 4EKEA 5JNLA 5G1NA 1YI0A 3ROPA 1W7AA 1C1XB 2LCIA 3SXUB 2X9QA 2ADMA 2R9VA 3NC0C 4NHEA 5IT4A 3RU9A 4AMUA 3E5MA 3TZ6A 1AF7A 3PUJA 2QN9A 3OZ7A 3HYLA 4M0DA 5BYBA 4R1QA 5GGYA 3DSRA 4N6OA 5IABA 1NI4A 1IAVA 3GD7A 3PWZA 4NICA 2QPLA 1D8TA 3FPHA 1ESMA 3B82A 3M5PA 4N8SA 2Q8NA 2PS3A 1ECLA 2QSJA 3N74A 4ER7A 1FPQA 3PUZA 2HRDA 4AKTA 1MEEA 2NX2A 3ROXA 1A5AB 3EPPA 3FTCA 3OPYA 4OQXA 3TVYA 2CYBA 2GNAA 3H2JA 3ZJ4A 5I6DA 2BTQB 1CU1A 4JWTA 1XPOA 1T5TA 4J7AA 2A67A 4KN9S 4KXLA 2XEDA 4KDFA 3CPHA 3K96A 4CF6A 1IXYA 4EA8A 2H63A 4I4LA 5CYFA 1NRXA 1TLTA 1V6SA 1XZCA 3HB1A 2B4TO 4N6NA 4YAJA 2FN7A 2F3RA 1Q6YA 1XQVA 2I22A 3RYTC 3IHKA 1ORHA 3BWCA 5AMXA 3ZDRA 2BH9A 1M1YB 1N6RA 2ATIA 3IPRA 3LX8A 4V0RA 2BJWA 1WHSA 3L0YA 2QJFA 4YT5A 3AJDA 4FC7A 3EVFA 2EAUA 1OFVA 3LZDA 2VT3A 2O19A 1VLZA 4WK2B 3I2FA 4AB1A 1DE0A 2OTCA 1ZD3A 4WN3A 3NXKA 4QRHA 5T57A 5IJZA 5HZMA 5AK3A 4PVDA 1U7HA 1BWQA 3RFVA 1U6JA 3AJRA 5EMNA 1H4SA 2V97A 1FFEA 4MR9B 3VHQA 1Y8AA 3HR4A 5J2UB 3HJCA 4R6WA 3AUSA 1P4SA 1Z62A 3LF2A 3LKVA 5CP8A 1II8B 2F43A 2HZ7A 3NCHA 2A0YA 4O1MA 4TT3D 5SY4A 5KNBD 4BKMA 2EF1A 1IU9A 3CZAA 5E7QA 1MABA 5A9RA 1WB9A 1QQAA 1V1RA 4Q03A 4O59O 1ILWA 3WOVA 3K16A 2WP0A 1SKUA 3LCRA 2ZDHA 2YMLA 4UZFA 1WQ4A 3RJMA 1JYFA 4IX1A 4QTUB 1HLPA 1DJQA 1B4DA 4MVJD 2XDWA 2UYCA 1I2DA 1U8ZA 3BKWA 2ZRJA 2IF0A 1V4NA 2ZJBA 4DUGD 5JPDA 2ZR9A 3HVIA 5KQMA 3A25A 5ULLA 3KUCA 1I2MA 5I3ZA 1YCGA 4KGVA 3LJKA 3K72B 1YCFA 4L9AA 4BGIA 3THWB 3STYA 3F90A 4U5XA 1MJ5A 1GQFA 1ENPA 5C46F 2AZTA 3UJNA 3HPQA 4B79A 1ZW6A 5BSKA 1F0KA 4S1WA 3TKLA 1KKUA 3H5LA 2GS9A 3B20A 4LBYA 2VCHA 3GBVA 4PHGA 2CVQA 4CM4A 3RC8A 1UM9B 3HK2A 1D6NA 3W7AA 3W4IA 3K9LA 4K7JA 1WV1A 2Z58A 3ESZA 3DUFA 2W8BB 3VO1A 3WB1A 3DPUA 4GZLA 4GYWA 2WVAA 1Z88A 2JFYA 3PTAA 4GT1A 3F8WA 1NAHA 4IPTA 1UBJS 3R0XA 3E7WA 1ZHHA 3S4YA 4QUKA 4DLUA 1X1TA 1GR0A 1TB4A 2P7HA 2YV2A 4XFKA 1JDTA 5AVTA 5LD2B 5KUTA 2ZSEA 1UKZA 2ADOA 4R9SA 2GYUA 4MIOA 4DCPA 3NBXX 1E9CA 1MOPA 4LGVA 4E5NA 2A7XA 1A9XA 2C7OA 3A9WA 4FD2A 4WKBA 4DGSA 1YRYE 3PYMA 3O9ZA 3QUBA 4WMLA 4CCAA 4CPDA 3I2GA 3VSCA 2OXEA 1CZHA 1U0HC 1CIJA 2FRVA 4PFKA 5C8ZA 4ZAXA 2WJIA 4GI3A 4Y9TA 1M2NA 1FDRA 3KB8A 4RPKA 8ADHA 3DZIA 5BO5A 4G24A 4K9LA 4XR4A 5EE1A 2B5OA 4IOJA 4EY4A 4CGZA 1ESNA 4D96A 3RYCB 2ANBA 4X91A 1HWYA 1C1DB 1R88A 1T2AA 1L4KA 5DBIA 2QRKA 2ZSJA 5EP1A 1AQLA 4EG3A 1UFRA 1MNQA 5DYWA 3A6KA 3RR2A 3KRTA 4XJXA 4D9GA 1LPAB 4RO0A 2PSSA 5FTMA 5LA6A 1W5TA 3OPYB 4QYIA 3WYCA 4BV8A 4PWZA 4ZCTA 3DGFC 1EFDN 4S24A 1H3FA 4P32A 3LCCA 1VMDA 4IIGA 4S1VA 2YRWA 3EXIA 3GH3A 1XLWA 2XYVA 3EEYA 3CLTC 3ILYA 2BKEA 3DULA 3QBDA 4FDUA 1DNPA 2UV8A 3I32A 5T4HA 2NU8B 3RK4A 2J9GA 4R31A 2GFIA 2OO5C 3GJTA 1IN8A 3ZNQA 3DZJA 3C3PA 4NBTA 1K6EA 1F8GA 1RZ3A 4C3VA 1L4FA 1HYGA 1G9TA 4EYSA 2BGWA 2I99A 3O8QA 4LJ9A 3PUXA 5ERXA 1NPYA 2HYDA 2PAAA 3SF8A 3G2PA 5MGBA 3M5DA 2XRZA 2UUOA 4TV9A 4PLHA 1NBAA 3O4VA 5AW3A 2Z8ZA 1WUJS 2OYSA 2YVQA 4DAOA 3A4LA 4PNEA 1DBQA 3HXLA 4UBOA 2ZRPA 4I1IA 1SXIA 5D84A 1SIOA 3WXMA 5BVHA 5DK6A 4IO1A 3L7MA 4W82A 3MGAA 1CUAA 3C3KA 4CEJB 4ASUD 4EPWA 2Q3EA 4UBJA 2XB8A 3PUKA 5IAOA 2I3DA 2RB4A 3B3JA 3DZCA 3W2FA 1WMAA 2FPRA 4FFPA 4ZCQA 3OQ6A 4G84A 4BN5A 4D8XA 1LLUA 3LE8A 2WTBA 3PNMA 2FSVC 2AMYA 3WNQA 3DEAA 5INTA 1X1DA 3GJQA 2NM0A 3R76A 4H3SA 5BYJA 2AN9A 5J4KA 2G63A 4BATA 4P53A 1GFZA 5CXSA 1DAGA 2ZRFA 3BFKA 4WY5A 4JYBA 4FHZA 2GPJA 4RJ2A 3SDZA 4IGAA 4EVIA 4ZQEA 1CVIA 3WTCA 1U7TA 2PSHA 1F2TB 2DBYA 1OIVA 1X8KA 3CINA 1VGRA 1P5RA 1ZH6A 2PX0A 4TS1A 1C7QA 1VG9B 5D6OA 4DGQA 5CLJA 1EXDA 2JLWA 1F17A 4JR2A 2IYTA 4LECA 1RBQA 1SXJD 2LW7A 1JVNA 4DV2B 2KW5A 4A8JB 1H2FA 1RYEA 2I34A 2R85A 1PRYA 1S8NA 2IX9A 1RE0A 2JIMA 4PBRA 4TSFD 3S0JA 2QZZA 4G23A 4RACA 2HMYB 4E11A 4HI0E 3PDCA 3UK7A 1A72A 3LK6A 3HU2A 5EINA 3Q8LA 4L15A 4KNVA 1WQ1R 4U1RA 4Y1EA 1NZDA 1PTJA 4R01A 4WKCA 4AF8A 3LXRA 4UU7A 2HUNA 3OKPA 4PLWA 3VKVA 2J30A 4WUTA 3NPAA 4KO2S 4OHKA 1NP7A 2QTGA 4DDMA 2C1ZA 2PFGA 1YE8A 2BTOA 1JTFA 1SD5A 4EB3A 2XE7A 5T7BA 2JD1A 1WHTB 4LV6A 4ZQCB 4BDTA 2AEEA 4G8DA 1WW8A 3O0TA 3G0BA 1W87A 3VDXA 2FEKA 2WVHA 3KQOA 5TEWA 2WTEA 2WJYA 3SZUA 5KNBH 4J90A 1G5RA 1Q1AA 3UMBA 3K9FC 1NR7A 4F4HA 2XE8A 3RRXA 1TAQA 3QWIA 1ZD8A 3TPCA 5PGMA 1MB4A 3CZRA 3L4BA 2IYRA 2LXNA 2QVBA 3ZWKA 1ZUWA 4RY8A 4LWZA 5D1NA 4M1WA 1M1UA 4MP6A 1JG6A 1TF5A 3OFJA 4XDGA 3UKDA 3VU3A 5FEMA 4HF7A 1JU4A 1E2JA 1IAQA 4H77A 2HD4A 2QTMA 2A8YA 1KR5A 2ISQA 3UWKA 1ZJWA 4HDNB 2Q0QA 1BU5A 2V59A 3RTCA 3NHFA 4OVKA 2RJ3A 5ER9A 3TW8B 1XDDA 4DEXA 2GBLC 3K2EA 3P5BA 2Q07A 4HEA6 4MRMB 4EJSA 3DTVA 4YGXB 4P93A 3TLGB 3E7PA 3WGNA 1B0AA 5AUPB 2HK6A 3WB9A 2RHCA 1MORA 5LU9A 4ZXPA 2PFSA 3I4CA 3KZ1E 4TXMA 3AU8A 3T9FA 4RHEA 4YVFA 4GGOA 1U7XA 1QYWA 1GKKA 1NM5A 4HQOA 3A28A 4KBFA 3RU3A 3QVUA 4AJ2A 4C7JA 1PEKE 4BU1A 2JFHA 1AH2A 4PG5A 1G4UR 3GGSA 1NU6A 3GAMA 3N6XA 3A7EA 4MA0A 3UV7A 2SKCA 1ARZA 3B1YA 3R5HA 4K6CA 3D59A 2VAXA 2OXRA 1NBMD 5AKIA 3IERA 1JA9A 1E3DA 3BHJA 3S6JA 2EHJA 3H0CA 3OIVA 4YASA 1LB1B 3M9LA 1MKYA 1MXHA 4EHAA 4QRDA 3EULA 1VHQA 2DLNA 2C0CA 1TK3A 4HG2A 4EG8A 4BWVA 4EHJA 2JGDA 4O5AA 4TMTA 1G2PA 3K35A 4FD3A 1X9IA 5F73A 1F8UA 4EO4A 1HE4A 1F7UA 2F4NA 1PDOA 2BP7B 3HCFA 4OJTA 3ZDFA 4OSEA 4RSMA 3C3AA 5KTYA 2PWPA 4D4JA 3ZXIA 5G4LA 4EUKA 3GLHA 4YMLA 2HDWA 1UOOA 1ULBA 2PLFA 3CSSA 4G37A 5CDGA 3FOFC 1H2EA 1T6ZA 3JWEA 4FB5A 4I14A 1GXSB 1SFRA 1GCUA 3AIKA 1Z8DA 1N6KA 1EK0A 2D1FA 3C4JA 2BHSA 4MWCA 2XF2A 4Q3OA 5AXAA 4MIEA 2XCRB 3MQFA 4HL6A 1EUZA 1OBHA 1WXWA 5BR7A 3REOA 1JV2B 2ECFA 3BGOS 2AC2A 3D8HA 3IQFA 3W5CA 2YWFA 3TR0A 4BDSA 2XMPA 3COYA 3VPSA 1VIMA 1M5RA 2HRBA 3R7WA 1NBMA 4ZAYA 5H68A 3U80A 2DUJA 5EHZA 2ECKA 3WLEA 4WV3A 4NMXB 1W4BA 2OZVA 3C70A 3G88A 3SVTA 5JE8A 3PF8A 3W1VA 2DRIA 5EGNA 2B6NA 4GUAA 1E0KA 2GJ4A 2Q1XA 2XOEA 3C6KA 2FZWA 3L77A 4GOLD 5K0LA 1OQAA 2EEPA 1RJEA 2REOA 4B6PA 4COKA 1T6NA 1Z0AA 2OCDA 4YRJA 1Y1SA 3LXXA 2ZTSA 3QW2A 4B32A 2CW5A 4ATNA 3O3MB 3RCBA 2HJSA 4Z54A 1ZD5A 5B2ZA 2IDZA 5D85A 3Q1KA 3C85A 4BJ5A 2OCLA 1YB1A 4OKIA 4HDAA 4ZRNA 3LFUA 4PV7A 5HR5A 4M60A 3A9TA 3HC7A 1W47A 3LX5A 3E0QA 4O2BA 3W1WA 4NNOA 2RHLA 1XNRB 4KMSA 4OHOA 1WHTA 2RK3A 2X8LA 1LPMA 3IAFA 5CB4B 1X13A 2PN1A 3FAZA 5JI3E 2QPTA 5HBGA 2QRGA 3ORSA 4ZI2A 2N0SA 2DVMA 4RU1A 3UJPA 1RPJA 5CDYA 1AS0A 1GPH1 3G9XA 5BUQA 5K8CA 1JIQA 4YJHA 2AN3A 2VUHB 4AU1A 4M46A 4HSEA 3TPFA 4YLYA 4GPBA 5E0OA 1OGJA 2WIJA 5KAPA 2GF2A 2WYVA 1QCYA 4IFEA 5K2MA 5T6BA 5LQUA 3U5TA 1Y7LA 5DT2A 1EA5A 1L8OA 2ZBUA 4JJKA 5ALZA 4DC1A 3TUZC 3U3ZA 4JKYA 1SOAA 3MTAA 1PL8A 4OL0A 4C5CA 3ROGA 2C95A 5E7JA 1JZSA 4QNMA 5DPMA 4C2UA 3P97A 5BMVA 5JMPA 3RD5A 4EENA 3BK2A 1E7SA 1DC3A 4YRPA 3BAZA 3K1TA 3PWTA 3F97A 4E6EA 2YHIB 1BWSA 1K7YA 1NWHA 4EB8A 4PZCA 1Z22A 2YJ3A 1Z68A 5JNRA 1DEHA 5HTKA 2I1LA 2PX4A 3OECA 4OHVA 1O1YA 4WASA 5REQB 3Q87B 4CMHA 1W9HA 1NI3A 1WLYA 2I1WA 4NS1A 5DK4A 2FEMA 3IO5A 1G21E 4PC3A 4RE6A 3UXEA 2ZTHA 5LA6F 2XSZD 4OYLA 1XXLA 4YO7A 1T4MA 4OBXA 4BO0A 1GUZA 5ITZB 4Y9RA 1C4XA 1D4FA 1DADA 1LSSA 4KPFC 5LJLA 4POOA 4CEHA 2C4VA 4KQMA 1JZTA 4G9BA 1DXOA 4FN4A 3OJOA 1ACJA 1UFVA 2FLVA 4C7MA 4C7BA 3JD1A 3QKUA 2Q7XA 1J1ZA 1X7ZA 2GD2A 3QMWA 5CM9C 3SEQA 1T2NA 3AG6A 5FI1B 4G97A 1XKTA 4C21A 1H9AA 5C18A 2E37A 3V55A 3PNLA 3TEJA 5D5HA 4CMGA 2XWQA 3JWHA 2R00A 3EUEA 5EJFA 2IZOA 3J7AC 5C9ZA 3TXXA 3JYLA 4RD3A 5FOSA 2AMJA 1WG8A 2NQTA 3P8ZA 3X1DA 4QYTA 4YMTA 5DNAA 1W52X 1YA6A 2RGNC 4HQRA 4ILEA 4RJLA 2O8CB 3S7ZA 4LC1A 2EL7A 4JMLA 3SR3A 1PL0A 2XX3A 4EKGA 2ASEA 2VBGA 4KO3S 4H1WA 3NWOA 3ZZ0A 1IEWA 5L7YA 4V02A 1PVVA 2YJNA 1SXGA 3PITA 1EH5A 3GFBA 1KFCB 4CN9A 5DTQA 2ZJ6A 3QEJA 1YF3A 1E9BA 2ZVQX 1R0ZA 5C4IA 4GVPA 5K03A 1HYHA 5JS6A 3QENA 2I4IA 2CL7X 1DT3A 3GZTB 3OF2A 3SIRA 4F84A 3QEKA 4Y2VA 1T36B 1B43A 1ZNZA 2AHOA 1YVDA 2C2HA 2ORWA 1CUZA 3H8VA 3BGDA 3Q6NA 3VH2A 5BNZA 2SICE 3IAXA 2O2XA 1J24A 3RVPA 5BRAA 4ERNA 3HJUA 4D3XA 2QRHA 3T3PB 2HWKA 3HNOA 1EUYA 3ZKWA 3WL6A 4YT8A 2QQ0A 1MAUA 1XZJA 2VWGA 5K9ZA 4XJSA 1NHGA 5IH7A 2F43B 2GESA 3IEIA 4PW0A 4ZAFA 2IPXA 4ZN6A 3KZNA 3L7DA 1QZUA 5ANRB 4P4SA 1QOQB 3C16C 5AVSA 4LNUB 3ADDA 5DX1A 4A23A 1ZOLA 1M66A 3U9SA 3HB5X 1Y1TA 1AM4D 5DFAA 4I9NA 1MFPA 4DIMA 2G04A 1MA0A 1TT7A 1W5AA 5BV8A 2EJTA 4N5NA 3GJRA 5AXBA 4EX7A 4ZYZA 1BSVA 3D3KA 4BFCA 4JYPA 2A5GA 4IV0A 4NCNA 1HL3A 4OL9A 3F7MA 4KP7A 4WPGA 2OQ2A 3EOAI 2CLFB 1HRKA 2ZSKA 1YRWA 4FYPA 4HTFB 4MLCA 2G83A 5AI8A 4YN3A 1CBUA 2I4OA 4Q5IA 3UGJA 1NNEA 1IFXA 2VAMA 4PN3A 5TF4A 5L6MB 3ROKA 4KQGA 4ND4A 5COQA 3S27A 2XBMA 2AFVA 3D6VA 3ITNA 5CX1B 3WG9A 2ERYA 1Z5UA 2HJRA 1M0EA 1LW6E 1WTAA 4Y6RA 1GHTA 5AVKA 2PLWA 1NKVA 2QW1A 1V1JA 1ZLXA 3LFTA 1RAFA 2R65A 4O2AA 3WGLA 1JAXA 5ALKA 2I55A 1RZRA 1RI4A 2P6MA 3FRIA 3ZH9B 3NHPA 5E9WA 4GE3A 4LFCB 4JUFA 2H1RA 4Z1MD 4BQNA 4OHWA 1RLMA 3A7DA 4MZXA 2WRZA 4GI1A 1P29A 2JATA 3DBHB 5CPFA 1ODCA 2F7SA 3ZC3A 1IHOA 4C4TA 4R40A 1OXVA 1NYLA 5AW0A 3R6GA 1AHNA 1XFAA 2XR1A 4EY3A 2XUZA 3SSOA 3OEHA 4NP6A 1I1HA 2IOHA 3P9CA 2H17A 1H65A 2CXNA 2H65A 3FPGA 4IRMA 4XX0A 4EG4A 2CL5A 3DNMA 3LGSA 3HJGA 1EP3B 4MGZR 2OL4A 3PFIA 3RS3A 3SEZA 1F4LA 1ZKMA 3OP1A 1R74A 4J2TA 2A9KA 1TNDA 3KJHA 3F5FA 3CZQA 1UK9A 3NM5A 3BERA 5AM3A 5CB6A 3SSNA 3CZPA 3W5AA 1LJUA 2B30A 2J5QA 3JAMA 3DE1X 2WG2A 3ENWA 4Y2HA 1L4UA 1QJCA 5CLIA 3RJZA 1CUDA 4NJEB 1ZUNA 4ZOQI 1ZNQO 4L28A 3BD6A 1EWVA 2ALJA 1SULA 3CZ5A 1K6IA 3T5PA 4K03A 2HOQA 3K1JA 4TXHA 5JZSA 1XZGA 4DL9A 3MFQA 1O6CA 3C1AA 4EJFA 3H9QA 3UG6A 2NSDA 1T34A 3GT7A 4GHWA 4CDGA 2YL2A 3BFXA 4JLUA 5DYNA 1GZVA 1N6HA 4I8DA 1RKXA 2EQBA 3OJLA 5JY1A 3GLGA 1GTVA 4GOKA 4ZTZB 1HNXB 3CLVA 4Z6KA 3ORQA