4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
1ULAA 4WKBA 3U40A 2HSWA 3UAYA 1PWYE 5K1ZA 4D9HA 4M7WA 3LA8A 4TXHA 1T8SA 4EARA 1V48A 3EEIA 1YQQA 1PK7A 4LNAA 3FB1A 1T8WA 1PR2A 4LNHA 3MB8A 2QTGA 1SJ9A 1TGYA 4QATA 5EPUA 2QTTA 1Z38A 3DP9A 3BSFA 3OZEA 3OCCA 1YBFA 4M1EA 4DA8A 3E9RA 1JE0A 1LX7A 1U1GA 4MCHA 4WKPA 3EUFA 1JP7A 3FWPA 1Y6RA 3KVYA 1V4NA 2QDKA 3UT6A 3NM6B 4D8VA 1A9PA 5CXQA 1TCVA 4PR3A 1PR5A 4F1WA 1ECPA 3K8QA 1PW7A 2I8AA 3D1VA 2QSUA 1A9OA 3ODGA 1VMKA 5F78A 1LVUA 3MMSA 1JE1A 4D98A 5JPCA 5CYGA 1V3QE 1PKEA 3O6VA 1Z36A 3UAWA 4G41A 4YNBA 2BSXA 3K8OE 4QFBA 5B7QA 4DAOA 4E1VA 5B7PA 1U1EA 3UAZA 5F7ZA 1OV6A 1VHJA 4TYMA 4DANA 3NBQA 5EFOA 4OY3A 1Z33A 4GKAA 3IEXA 5F77A 3BL6A 3DDOA 1V45E 4R2XA 4TTAA 1U1DA 1I80A 1TD1A 3F8WA 2PGAA 4L6IA 1T8YA 1OUMA 3DJFA 3NM5A 3FNQA 1Z5NA 3ONVA 4EB8A 4U2KA 1JDTA 1K27A 1JDUA 5CCDA 1B8NA 4TS3A 4BN0A 4F3KA 5ETJA 3KVVA 5F7JA 1Z34A 3OOEA 5EUBA 1CB0A 4ECEA 1RCTE 1LV8A 3KUKA 1ODJA 4OEHA 4R31A 5FAKA 3OZBA 2I4TA 3GB9A 3PNSA 1K9SA 1PR4A 1OU4A 2ISCA 3EUEA 1RXUA 4NSNA 1A9QA 1ODKA 1ZL2A 3OOHA 4OGLA 3ENZA 3T94A 3FAZA 1V2HE 5B7NA 4OJTA 1OTYA 3BJEA 1RYZA 1N3IA 1ULBA 4JOSA 2XRFA 2GUWA 4BMYA 4YMLA 1G2OA 1JDVA 1NW4A 3UAVA 3PHBE 1OTXA 4F2WA 2Q7OE 1NC1A 1PR1A 3NM4A 3QPBA 3UAXA 2OC9A 1SD1A 3P0FA 5CYFA 1U1FA 4QAQA 5B7GA 4WKNA 1RXCA 4P54A 4BMZA 3C74A 1Y1TA 1Z35A 1A9RA 5I3CA 1PR6A 1TCUA 4GLFA 4TTJA 2AI3A 1RXYA 1A69A 4G89A 3E9ZA 4TTIA 4BMXA 4DARA 4DAEA 1Z5PA 2OC4A 3INYA 4UC0A 4L5CA 1C3XA 1YQUA 4DA6A 4QASA 1T0UA 1Y1QA 3DPSA 1JDZA 1Z5OA 3OPVA 3TL6A 3IOMA 5F7XA 3O4VA 1SQ6A 2B94A 4X24A 4L0MA 1U1CA 4OGKA 1RXSA 3PHCA 4DABA 5F7OA 1PBNA 4G8JA 4RJ2A 4DA0A 2P4SA 1YRYE 3EMVA 1OVGA 1JPVA 4GLJA 2HN9A 2AI1A 4L5AA 4R2WA 4JWTA 5IFKA 1NC3A 2A0XA 3KVRA 1ODLA 1ZOSA 2IQ5A 5IU6A 1VHWA 4NY1A 4LZWA 2HRDA 2AI2A 3PNPA 1XE3A 4MARA 1ODIA 4TXMA 5F76A 1PK9A 4FFSA 1CG6A 1M73E 1Y6QA 3GGSA 2ON6A 2H8GA 1TGVA 5F73A 2QPLA 1VFNA 1Y1RA 4LDNA 1RR6A 3OZCA 2RJ3A 1A9SA 4D8YA 4OF4A 1RSZA 1K3FA 2A0WA 4PNPA 3P0EA 5CCEA 1JDSA 2A8YA 4TXNA 1JYSA 1FXUA 3LBAA 3FUCA 3E0QA 2OXFA 1T8RA 4H1TA 2OECA 1Z37A 2AC7A 1PF7E 1YR3A 4LKRA 4M3NA 1WTAA 3KHSA 4NS1A 4TXJA 4QARA 4MCIA 4QEZA 4TXLA 5CXSA 2HWUA 2A0YA 1PR0A 5DK6A 3OF3A 1RT9A 4WKOA 3OZDA 4F2PA 4D8XA 4WKCA 4YO8A 1SD2A 4F3CA 4YJKA 3BGSA 1A9TA 1B8OA 1V41E 4K6OA 4IP0A 4JP5A 1Q1GA 1Z39A 4TS9A 4I2VA 4DA7A 5KB3A 3DF9A 1Y1SA 1RFGE 4L5YA 4KN5A 4GMHA 3KU4A 3SCZA 1QE5A 3LGSA 3FOWA 5C80A
chains in the Genus database with same CATH superfamily
3K16A 2YV4A 2RH4A 1UFVA 1VCMA 2C2HA 1Y5NA 2CL7X 2VAPA 2ZI4A 3IOBA 4JUAA 3H6GA 2RK4A 4G1UC 5LZ7A 4BMCA 4M7WA 1NA5A 2X2FA 1HSZA 4GLLA 1T5OA 2Y27A 4C4YA 4WKBA 5T3UA 4IR7A 5JZBA 5CCXA 4M37A 1KBQA 2C2OA 2VRBA 4H1VA 5B64A 1XL1A 1FBNA 2Y1XA 4OCZA 4YRFA 5JROA 4LNAA 1US8B 1CRLA 3A4NA 1SXJD 3PFNA 1G8HA 1RI5A 3K09C 2WV9A 5GONA 2IXAA 3LYAA 3ZE1B 1LX6A 1LC3A 2AG1A 2YYZA 4H7EA 1XP5A 2E49A 2H4JA 3LGXA 3OETA 3PR2B 1WG8A 2RJOA 5F4ZA 1EUQA 5DYYA 1QPBA 3F5FA 1HDXA 1T29A 3KFLA 1NUQA 4A26A 5LIRA 5I51A 4PYIA 1FUKA 1MJGA 3OPMA 4N4AA 3PQFA 4YCDA 1KJQA 4M36A 1RPTA 2OGZA 1WZCA 3C7TA 1K4MA 3L1KA 5IJAA 1K7YA 1JEYB 1UKZA 3OMWA 1CY0A 4PF1A 4C7KA 5AXBA 3RBZA 5JH7F 1AOXA 2JK0A 1V4NA 4NZ9A 3K70B 3NCTA 1SG6A 2XI4A 1V95A 1XMIA 4J7XA 1FMCA 1R50A 3OU7A 4WZAE 2ZR8A 5A7FA 1GV1A 5JS7A 1J8VA 3H87A 1EJ2A 2EHJA 3FUXA 1E7WA 1I1HA 3OX3A 2MYNA 4K5QA 2HPZA 3E03A 1CJKC 1P6QA 4MLPA 1P7WA 5LZ2A 3BFXA 5KU1A 5JZVA 2B4AA 2GAJA 4MKRA 1CKEA 2I7CA 3F5MA 2CHFA 3GUZA 4P84A 4ZI5A 3P2JA 4F3RA 1FQJA 2X4DA 3K0FB 3RS3A 4G86A 1NOIA 4KGDA 3VVMA 4AECA 1Z22A 2JCGA 1X77A 3NHJA 3WK6A 2WI8A 4D98A 3N0WA 5EIOA 1DXYA 1KH1A 1HOXA 1KJJA 3F7NA 4WNCA 4PR0A 4QG3A 5JPCA 3G2OA 3AF5A 4XWGA 3HDQA 2G0NA 5IT0A 1V3VA 1PKEA 3A6HA 2R751 2X5XA 2EV9A 3DTYA 3M1IA 1J0BA 1Q15A 2W43A 1TE2A 2CXSA 2Z43A 3DSRA 3TCXB 4EYEA 4C3ZA 3LT2A 4MQEA 3NKVA 4NV0A 2GFHA 2GK4A 2V7VA 1DJPA 4IOJA 2O0HA 3L7NA 4DN6A 3ITNA 1VKRA 3VSBA 3UWOA 4KMMA 2R7MA 3U4CA 2QTCA 3WP1B 1VJDA 4F85A 1D09A 4G23A 2QKYA 4DSNA 2PSDA 4X95A 3D31A 4QXPA 3L8MA 4HQFA 1JZTA 3LYUA 4G5SA 2EP7A 1ZVQA 1WMDA 2BGUA 5D01A 1GUYA 1U2DA 2C92A 2LRHA 3L40A 1ELOA 2ZBFA 3C3DA 3HL4A 2B1GA 3IHWA 5CB4B 5J2UF 3LA6A 4CTJA 1NV9A 4B7UA 4ZZ1A 4DXHA 3NTVA 5FOQA 1S2MA 3SLKA 4EUSA 2DBQA 4MVJI 5T57A 5I6DA 1PJBA 1UF9A 2QLFA 4CMBA 3KZNA 1SK8A 5HWSA 4D43A 2IOQA 4BO5A 5I4BA 3CVUA 4WZ6A 1Y1PA 5B4TA 2BZ0A 1IHOA 2YWDA 3ZKAA 1ZH4A 5DHQA 1Z0FA 5CDFA 1CEXA 1NTOA 3RARA 3T54A 3CKYA 5CM8B 3SYMA 2P2GA 2NXJA 5C5CA 5JISA 1C3OB 1N5JA 3FZQA 4MUBA 4F9FA 1CQZA 2FQWA 2FZKA 2QQEA 3I5UA 4NMLA 4IWNA 3BH6A 3NWEA 1XWIA 2QLMA 2X76A 4LHXA 2VDOB 1Y8AA 3EZLA 3FYUC 4O1IA 4QA9A 4UXIA 4N12A 1P1BA 2EX0A 2J9FA 1H0RA 3VRHA 5ELMA 4X65B 4RA9A 1RRGA 1RLOA 3H1AA 3LC2O 4FPXA 4RNCA 3HS3A 4EG5A 2FUEA 3R0ZA 3F6EX 2Y0EA 4ROSA 3GYBA 5CCDA 2YC2C 3OQMA 3B5EA 1JU3A 3UXHA 4MO2A 4D2IA 3G13A 2ZBEA 3VM6A 3WI7A 2YXPX 3BF8A 3ZDFA 1U3FA 2UUBB 1RADA 2CV0A 1E4YA 3IAM1 3ZVLA 5FBHA 5DPMA 3AL3A 3AF2A 2XDAA 4PG4A 3FPEA 5BQOA 2WD7B 4O1HA 3U0VA 1CF2O 3B7PA 1IY8A 4EEXA 3FZGA 1QG4A 1UMBB 2C3OA 3NG1A 4ITUA 4TRMA 3TQFA 4LXGA 1RRVA 3GFGA 2CL0X 3B1VA 4X7BA 3FLMA 4ND7A 1LLCA 3TZEA 1H4VB 1H0SA 2MSLA 3FFBA 3HM2A 4KFRA 3V4LA 1KR2A 4EYKA 1J8FA 1P0MA 1ZOIA 3DKKA 4HH3C 4BCDA 1D9ZA 2CUNA 2RMKA 1XTRA 3OQPA 3P9YA 4LRTB 5CIWA 2HRZA 4LMRA 3MWLA 4PZZA 3VHLB 5KTOA 3GB9A 4YJ3B 4K6GA 2IEZA 2AC4A 4UEWA 4BP3A 4DDVA 3QOXA 4RZQA 3FYUB 3GGCA 3IB6A 2FE1A 2GYVA 5P8WA 3UJ6A 1HDGO 3S1LA 2JJ1D 3IUYA 1A9QA 2O3SA 4OK6A 3X2EA 1DIGA 2I3AA 4OXQA 5CLGA 3MTGA 2W9XA 5IUKC 1RAHA 5DM4A 3ZE9A 5AJTA 1E5QA 1XMJA 1NV8A 2C8VA 3ZI4A 3RG8A 2YRFA 1XNHA 4CMIA 2BEUB 3CT6A 3ZCQA 1KO4A 1YZTA 2ORWA 5ABPA 4V3CA 1HMPA 3V1UA 3OSUA 2WM2A 5BV2P 4MVJD 3PHJA 1G5HA 4H16A 4O5OA 3HJUA 1C7FA 2W22A 2H29A 5KSZA 1N3IA 1XRNA 4FNOA 3T9BA 3IHKA 3QG1A 3C0KA 3WB1A 1KQOA 3UH0A 1KAHA 2JC3A 2P5YA 4LJ8A 2ZTLA 3FMGA 3IXLA 2A33A 3BCHA 3UGKA 5IYZB 5J4VA 1ZMTA 3K31A 1XALA 3D81A 5E1OA 5LMUB 1V71A 3VHRA 3FSGA 1DINA 1GGFA 1RM0A 3O38A 1C1DA 1PEKE 2FFRA 5HG0A 4Q7JB 1PFUA 2FP3A 4W5JA 4GYJA 5GZ1A 2DT5A 2BM9A 4NI5A 2G71A 5HA5A 1JRLA 3IVGA 1Z07A 1PEDA 3B53X 2ZJ5A 2XWPA 3E4DA 4FUTA 3CLUC 4FFBA 1ABEA 5KPJA 3Q40A 3KR2A 3G79A 1L5SA 1R6UA 4LDQA 3E58A 4OGWA 5F1OA 1J21A 4XJVA 2PBFA 1VKNA 4BY9E 4PIPA 3HDVA 2Q4DA 1O3YA 2VAMA 2IXDA 4C2AA 1NTRA 5AESA 4DQVA 2BTOA 4Y2SA 5K7SA 1GQQA 1B2RA 1QO7A 2GQ0A 4JLJA 4Q4CA 4YT2A 3JALB 1DCTA 1DWOA 1N2GA 2I03A 5C32A 1G6KA 2QMYA 1FJ2A 1RAIA 4N65A 1MC5A 1NMEA 2VHZA 3KKLA 3VAAA 3PGXA 1L7RA 3VKWA 4A7PA 4ESHA 2AEJA 2AJCA 3EVGA 3KT8A 4HAYA 4JFRA 4XIYA 5F3RA 1DELA 3WG9A 3ZGOA 2C2YA 4WL0A 3CN9A 1APBA 1IEVA 3DHWC 1PZXA 3PK0A 3ZWNA 4CHTA 4XQGA 3P9IA 3T7CA 3IX7A 2OCYC 1LI5A 3ZX4A 1XZHA 3IQWA 4MUAA 2CNLA 2VDKB 4Y6QA 5DGTA 2PGJA 5KNLA 5HJ5A 4C08A 4Q3EA 2N75A 3D4BA 5KO2A 3AL0C 4G89A 2FHPA 1US8A 2WMNB 3ZW9A 3AJRA 2HF2A 3PXAA 3HRIA 2OV2A 4KNVA 5AKHA 1WCWA 3LZ6A 4CNQA 3CCCA 1I7SB 2CGEA 1OFUA 3QPAA 1P7VA 1RI3A 3ZVNA 4K9SA 5IP5A 5HVNA 1RJEA 4YMVA 4KQIA 1W4RA 4R1UA 1SXHA 3TGWA 4S35A 3GVIA 3ZVRA 4DLZA 3FOFC 1WL8A 2J5RA 2ZSJA 1TIBA 1RWNA 1C5KA 4L9SA 4YJ2B 3ZE2B 1UM9B 5D7NA 4ACBA 2IV7A 2NO6A 2VP5A 3D6MA 1KBOA 5LNK1 1LDNA 4UDOA 1JEYA 3FLAA 1WP9A 4JP1A 1AGRA 2PS3A 3HVUA 4HLQB 4Y6LA 4L0MA 4TYNA 5AJYA 4QYMA 1SN7A 2O05A 2X3FA 4TM7A 4NCKA 4PSCA 4DM3A 2O50A 2E82A 2XQJA 3EW7A 3KOYA 3N3AC 1MX3A 1T1SA 4FR5A 3G59A 1ZIDA 3E2MA 1DE0A 4JJ8A 4OUKX 2YTZA 4U9UA 3VPDA 5KYVA 3IQZA 4G8JA 1M7BA 2ZKLA 1W6UA 2GZHA 2DY1A 4RJ2A 2ZJ4A 5DGCA 1E3MA 4ND1A 2HHAA 4TTVA 5E6RB 1ZIXA 4L0QA 3HM9A 1A27A 2NQ8A 1Y8ZA 3L4EA 4KC0A 4AWAA 2WJIA 4HCJA 1ZN2A 3K09A 3TJMA 3IESA 3ENWA 2PUEA 2BI4A 1A7JA 5A5VA 2CXXA 3FH0A 2XVAA 3W8FA 2CJPA 2XOXA 5E4JA 3C1OA 2Y2UA 2BMFA 5AJZA 1C8VB 5DXAA 2NZ8A 3JWIA 1KI6B 1OAKA 2M9MA 2ZU6A 4RMHA 4GEGA 5D85A 3DKVA 4C0BA 5AI4A 1HQYE 5DLQC 4PN7A 1JG7A 3KTFA 1K8RA 5FWXB 1XZMA 3KT3A 2QNBA 4EMTA 1HNXB 1N33B 5F2OA 4EJ6A 1ZGCA 1DZ3A 3FPAA 3ICOA 4KO2S 4XFDA 3SJAA 2WTXA 2DTXA 3ITKA 5T6MA 3DMHA 2JAPA 1LBSA 2ZTUA 4P5DA 2OSVA 1YT5A 3NP7A 3TZ6A 3QE0A 5EQTA 1CG6A 4IDCA 4L78A 1I2CA 1M73E 1E1QA 1QYDA 3AUJB 1E3JA 2GJ9A 4NE2A 2VCYA 3QPDA 4YWHA 2WPDD 1G64A 3SSOA 1P80A 5IARA 1PJLA 5K6AA 3FCAA 4Y1EA 4FX2A 4IJ6A 5DTRA 3WXBA 1IM5A 4LJKA 4QNNA 3IB3A 1G0OA 3LLCA 5J4KA 3AHGA 5E38A 2PS1A 2NSYA 4E1AA 5EMNA 5AD1A 4QM6A 4EZIA 3L43A 3PL5A 1X70A 4C0SA 5LJIA 5BV8A 1RBZA 4XZ3A 3I3SR 1IHPA 3EMDA 3F97A 1EQ2A 4M2LA 3U4GA 1JAXA 1C3OA 2CHQA 3ESCA 1FUUA 4WASA 3T38A 3AY6A 3UK0A 3WMXA 1YACA 1Y6JA 4KXUA 2J41A 3AONB 2PH3A 4NQZA 5A1JA 4FCWA 2O8BA 3O74A 1V16B 4I3FA 4KSYA 1C9KA 1MB3A 4D7AA 3DFUA 1KIMA 1QAOA 4MX8A 5FTMA 5JC8A 4YHBA 2POCA 3VOTA 1HMYA 3OIDA 4WKGA 1DIRA 3NU1A 1JIVA 3K4HA 1V6SA 2PZBA 3DAPA 3EASA 1JEEA 3ZZ0A 3RHSA 1QO0A 4EW2A 1AUPA 1VXOA 1JIQA 4LE1A 4YRCA 3C48A 1H2YA 4AZWA 4BNMA 5AW7A 2BGKA 3NWPA 4FXPA 2ZAIA 1VMDA 4IIHA 1NONA 5ALJA 1DUIA 4J0EA 1N92A 1QNLA 4PLCA 3BE8A 3W2EA 1ZBDA 3QLVC 2CSXA 4NS1A 4OFZA 4IH4A 3PSAA 4HNAB 2WD7A 3PWTA 5HEKA 1Q0TA 3QNUA 3GPLA 1UMBA 3W2HA 5K99A 4LXTA 2PX3A 3PQ7A 1TU0A 2ZRPA 3D3NA 4KITB 2J3LA 3DB1A 3JVDA 4V0SA 5DIZA 4RHCA 4JBGA 1NY6A 2QN9A 3OURA 1PT5A 3NDIA 2NV6A 5DDIP 3PEVA 4WKOA 3S2ZA 3ZLTA 3FM9A 3JQQA 3I4LA 1YBAA 4JLBA 2ILTA 4A0QA 3WMFA 2W42A 4YJKA 4YJ3A 4OHXA 1WHTB 1DRKA 1BVRA 1ICEA 2BV3A 2CCJA 2QTNA 3EYAA 3FYUA 3IE0A 3PDWA 4JC5A 3ZOZA 4AL4A 4BU1A 2V9CA 5IH7A 4CEHA 3E9DA 4FYHA 4QU8A 5LBTA 1NYQA 1X19A 2HHJA 4YDHB 3BAFA 2X0KA 4DM7A 3GMSA 3GCDA 2PVSA 1TVKA 3CVVA 2BKAA 1LVGA 2YCLA 5HIAA 4ZARA 2BEUA 1CNEA 1C4KA 2PMBA 4B6RA 2OD2A 1SGWA 3KKNA 3Q72A 4I55F 4OHRA 3AEUB 3ECSA 3HJGA 3IBGA 4NNOA 2FF7A 2QJWA 3VMFA 4NYJQ 5AKGA 4F2HA 3MGAA 2A1UB 3DL0A 4GXRA 4S05A 3WFZA 4W7SA 3A1SA 3JPYA 1RKBA 1HFEL 1MCZA 2QVYX 5DF1A 1VPDA 4A4DA 4EA9A 4CI0B 3QKSA 5I8WA 3RS7A 5A9SB 4JVSB 4JSRA 3TPZA 3C14C 4ZU6X 5GINE 1T8PA 2AF4C 2HLPA 2CB0A 1DKLA 3Q9SA 4DRZA 1HDIA 4H1UA 3TD2A 3I6QA 5JDIC 3QXHA 4Q03A 4X3CA 1GKIA 4P3PA 3ZWQA 1B0UA 3EUWA 5FRDA 5CLFA 2AEMA 1NJFA 1JHQA 1TC1A 3KEQA 1TCCA 4RELA 3VPGA 5K01A 4IW3B 1DOZA 4OTZA 5DBFA 4ZDKA 3AUUA 5ESDA 5ADVA 5HYVA 2H6EA 4CF5A 3J81A 2ZRGA 2AMYA 5FQOA 4N0EA 1JJ7A 2BPOA 3U48A 3DH0A 3AR2A 1XC7A 5CVEA 4YA6A 3G1TA 1GQYA 1T2DA 4UUBA 4BO9A 3TMYA 4MUKA 3COYA 5BRJA 2OILA 3WB2A 3BSFA 1KO8A 3CGWA 1JLLB 1IN1A 4MIKA 1XZGA 4QO7A 3FUUA 1VPVA 1ZJYA 1EFRD 3CIOA 4BRSA 1ZGZA 1LDMA 1MIOB 1K7FB 1U04A 1TMYA 1UFOA 1Z2OX 1ZMBA 3WQRA 4A0GA 2CVPA 1MZVA 2IYOA 1QG2A 2IYVA 3BH0A 2GASA 4MV4A 3SF8B 1BCRB 1Z5UA 1M3SA 1HK7A 1RAGA 2GN2A 2JH3A 2V1XA 2WWRA 2GXSA 3EUFA 4IMRA 2I4NA 3A4VA 2C78A 2HHHB 1DBPA 2JCYA 4W1SA 4A8TA 1OT5A 3IKVA 3JQRA 3WL7A 2WIDA 3NTRA 3IDAA 1OW3B 1ZMXA 4WERA 1QB8A 3DNFA 5BSRA 1WW8A 5JC1A 4ICIA 1OBCA 1ESCA 1Z6AA 1KORA 4BQOA 3CJTA 3IV9A 3GZNB 1JFLA 2FPRA 2IBSA 1I3LA 5HJEA 3AVTA 1YS2X 3GD7A 3N39C 4Q3KA 4S1TA 3JAKB 5TT0A 3TI7A 1VZ2A 5JAOA 1IOVA 1C3VA 1OYVA 4YJ2A 4DCUA 3ONFA 1UM9A 2YN2A 3NATA 1WMAA 4ND3A 3UUGA 3CKMA 2ODPA 2I22A 3T1OA 3QOYA 3MWDB 3CRRA 1CTQA 1Y33E 3ZJTA 2W83A 2JJ2D 4FW9A 3SOZA 4H60A 1O4VA 2J07A 2RG7A 1R27A 2YC4C 1FVXA 2XTAA 3B6ZA 3V2IA 4M83A 1DLJA 4RL6A 4L4YA 4NKRA 5E6SA 1NXTA 3D3EA 1IDN1 3NCHA 4MHTA 1E1DA 1N2CB 1Y9ZA 1X14A 3K8OE 3O82A 3IDOA 3Q3CA 4QNMA 3A1UA 3TTWA 3HJFA 2A1TS 3IEKA 4IIGA 4ZYLA 2CF6A 3WNVA 2JGFA 5KWSA 1UBHS 1BO6A 5E6RA 3I6IA 5BSFA 1MMFB 4GXTA 1NPTO 1OGJA 1RYYA 3HSSA 4K6HA 3IA7A 1I2AA 3II6X 1ZISA 5AM5A 2VK1A 2CXRA 4DANA 5K20A 4H7IA 3GGJA 5FOTA 4Y1GA 1IY2A 1HLPA 5J2TB 1SXIA 3NYIA 2B35A 2B7BA 4RPJA 4U3JB 1UBEA 4IPTA 2D3TA 4BATA 1KI6A 4RH0A 4XVHA 4QNRA 4IIEA 4K86A 4XLLA 1IQ0A 2B61A 2GRJA 1QIIA 2QQGA 4MB0A 4RF4A 5IXSA 1RHUA 1JQ3A 3JZFA 3NHBA 3FCXA 4DG8A 5IF9A 2PCJA 1E9CA 5FWXA 5ICSA 1KEEB 1F8UA 1SBNE 1Z6TA 1Y5IA 2XD4A 5EYPB 3T1QA 3WA6A 1S3FA 1C0EA 1GL3A 5KQGA 1HURA 1VCNA 4MCAA 1NG9A 3JWGA 3DDZX 3AIMA 4OA8A 5F98A 1E7YA 3OEHD 4JJ7A 1EHIA 1ZDMA 3LIIA 1IJBA 3WVNA 1TCBA 3CEMA 1VLQA 1FRQA 3W6NA 1F12A 3AYZB 4N3AA 4EECA 4NAVA 1OBVA 3JWPA 4B5LA 2OMEA 3IEPA 1MJNA 1T1RA 4G5OA 1P2UA 3AVPA 3IDFA 3MOGA 3EY9A 1SCAA 3A6EA 1DB3A 3NW9A 4RLHA 3ZXXA 1ST2A 5CJPA 5ECDA 2MR6A 3NUQA 3W8NA 4RDXA 3ROEA 1P1RA 1IHXA 5IKOA 4ZHQB 2YBDA 4RTPA 2M1XA 3RCBA 3EPJA 1QIDA 5B1SA 1PI3A 4E51A 5CA0F 2YJ3A 4BN0A 2PLWA 3AK4A 3FNEA 4PTLA 1NLYA 4KXLA 3HU5A 3U39A 5ER9A 4DVGA 1Z34A 3R7AA 3I39X 3JATB 1SC6A 2FUNB 5ALDA 3IQGX 1L7PA 2WU1A 1SULA 5AW9A 3IEIA 3HI4A 1LBTA 1UPTA 4NECA 3HZOA 2FZCA 3MMZA 3OP4A 5EWLB 4O3MA 1XZ8A 2R4QA 1QB7A 3PFIA 4CDNA 4F5YA 1NR1A 3CINA 4EHDA 1V16A 2Q50A 2VDRB 2XNDD 5DK4A 1ONSA 1WV1A 2OP0A 1LBQA 1XMVA 2JCVA 4L76A 5U4QA 2IELA 4DF3A 5CFQA 2FWMX 4MGEA 1G60A 2ZREA 4ZI7F 4C5AA 1DC5A 5LDDC 1NVBA 3MJRA 1SKUA 2PH1A 5IBPA 1RACA 1P4RA 1VLJA 1VI6A 2QX7A 1JG3A 3P9NA 3Q87B 4LXUA 4C30A 5KOJB 1SU6A 3JRWA 3FSRA 1OU0A 5EJGA 1NZDA 2NTNA 1KJWA 1LRLA 1YB1A 1ZWLA 1OVMA 3IOCA 4IMPA 4M0CA 5DHRA 3SJUA 3GRCA 5IC5A 3L46A 4HNAA 3RWBA 4LQDA 1J1UA 1GAJA 2BH2A 4H4EA 3A1DA 4BO6A 2CMFA 2I3ZA 3G2LA 3IOEA 3NKFA 3WAJA 4OYHA 4JQZA 2CT8A 2P6OA 4J4BA 1OTYA 4MPDA 2JAHA 1W2GA 5JYEA 3G49A 4J7CA 2YS7A 1XVIA 5H80A 1VYHA 1Q1NA 3IE1A 3EWNA 3OJCA 1ZS9A 1OFVA 1CJUC 2AVDA 2QP9X 1KZGB 3K0AB 4KXYA 5EE5B 1QHNA 1EWKA 4E2XA 5DNCA 1P17A 2H0AA 4KNWA 5CDHA 1ZUHA 4AT1A 2FPUA 3PXEA 3SIWA 4B3HA 3DMDA 3VPXA 4CR7A 5C8YF 1WHTA 4II2A 1LSSA 2YZMA 3PC8C 5HZHA 1QAMA 2EJTA 4JLWA 3X1XA 1PZNA 3A06A 2WSSA 4WK6A 5IN4A 5TLSA 3DAYA 1BTOA 2WKQA 1T0PA 3ZWVA 1NW4A 3AVUA 1FK8A 1KL7A 4S1OA 1ONOA 1CHDA 4FLEA 3V5NA 4DLTA 3UPUA 2RCNA 2V6IA 1RKQA 1PFWA 1NC1A 3GZJA 1JU9A 3OHSX 2C2KA 4HQOA 3AI2A 2Q1YA 1E2HA 1I2DA 2QB5A 3AEUA 4PG6A 3EHDA 3MGGA 4PAWA 4RKEA 2LR0A 4B40A 3FVQA 2A1UA 2YWHA 2H2HA 2O2EA 2LNDA 3P2YA 3ZXSA 1HE2A 1L5HB 3KHTA 1NN3A 5A9SA 4ZODA 2FSHA 4KQ9A 4KQEA 4A2CA 1CLEA 1Q17A 1O94C 1UQUA 2Q99A 3C3CA 3FNHA 4ZU1X 4NBKA 3VPSA 4BMZA 1B1AA 2IZZA 2D0IA 3QX7A 5EMJA 2O5RA 3LHKA 1ADBA 3WADA 2Y1CA 4RPGA 1XU4A 3BX1A 2ZTVA 3ESQA 3VAZA 3LLUA 3TYXA 3ET5A 4LCJA 2G1JA 3V48A 3BWEA 3G88A 5FIUA 1IHYA 3VDQA 3U1VA 3L0IB 3KWMA 4UNSA 2Q1WA 1K7CA 3LSYA 5MN5A 4F38A 5EWJB 4LQLA 2QLBA 1AX9A 4YRIA 3KQSA 3I61A 4B79A 3MJCA 4JBWA 2RHCA 4UHEA 3KKKA 4JT8A 1NP7A 4A8HA 5JSZB 1WCIB 3FFAA 1NT4A 2ZRAA 4MUJA 4N5LA 3HUTA 1SQSA 4UPEA 1RLJA 2QV0A 1UIMA 3L0CA 4LNUB 2OCDA 1Y98A 3DG9A 4R2HA 4TUYB 3RTAA 4OHCA 3V8QA 1JLLA 2OB1A 2H17A 5AJVB 2P11A 2P1RA 6REQA 1VCHA 1MIOA 1HDOA 3Q3GE 4HNVA 3D6VA 4RVSA 3ZNOA 5CU7A 4LXYA 1PLLA 4BRZA 3HNOA 3M81A 5IT5A 4AMUA 1LLUA 3K5IA 5KYGA 1DAGA 1BCRA 1WB5A 4BFYA 3CNBA 4D4JA 1AKNA 3VBCA 2FN8A 3C4QA 3HDJA 1C0LA 2AQIA 3B13B 5DHFA 2HH9A 4AVYA 4QDZA 4TMYA 3OQOA 4FMPA 4FUQA 3GUYA 2DPLA 4R1PA 4R0VA 5D00A 2OM2A 1RXSA 4BUJA 1O95D 3W5SA 5INTA 3V34A 1EEXB 3D02A 1COWD 3QIAA 2PD3A 4JNKA 4K9RA 4H35A 3U16A 4Z4QA 3REGA 1XU7A 2CK3A 4D02A 1RI1A 2FTKE 3CX3A 1TUBA 2B4QA 4KQCA 4L8LA 4F3TA 3TMKA 4BQSA 4IVQA 1NR7A 4GR9A 2G4LA 2H3HA 2W6PA 1A9ZA 3MCAA 4KN6A 4MYTA 4WV3A 1J1IA 3PP8A 3ZI0A 3OF5A 2UUAB 1SXGA 1DPGA 4O4IF 1J0AA 3JAKA 5FV7A 5CFMA 3SZGA 2PXCA 2E18A 3NKLA 4KQMA 4J9UE 4I50F 3ZU3A 4P34A 1FSFA 1JX6A 4OQLA 4QU0A 3CEPB 1F3LA 4K3UA 2UXCB 2F3QA 3WYEA 4YRKA 3MWDA 2O6LA 2FI1A 3WIDA 4HS4A 4YP5A 4ZZ0A 4OXNA 1K8XB 1QFYA 2AGVA 5AKIA 1AQLA 3T9CA 4HDKB 1IUNA 5EGNA 1ZU5A 2I4LA 3R3WA 4CL2A 1RPAA 2FEPA 3FNRA 5D5QA 2XGJA 1N0WA 3H0KA 4QGBA 1L4LA 4KAFA 2W8ZA 4FHEA 1KAEA 2XE4A 1VE3A 3KAPA 4RD2A 2DETA 4C2BA 3CC8A 1VIYA 4AN1A 3NEAA 4UOZA 2ZJBA 4EUHA 5D1HA 3BL5A 1GZDA 2QRNA 4LE0A 2QSZA 3FDJA 4XAQA 4YP1A 1I3KA 1KMQA 3I2FA 5A4JA 2VSNA 1TADA 1V3UA 2C59A 1TECE 2D74A 3HO6A 3IP8A 4WH0A 3STTA 5LJLA 5J2TA 1FSGA 1R5JA 3QSYA 2ON6A 4P9NA 3DHVA 2XQIA 3I6MA 4U3JA 5AVZA 1GFSA 5CW2A 1AQJA 3QA9A 4BFVA 2HI0A 4BB6A 3TECE 3H2YA 4RQUA 2C7PA 2AA3A 1ZZGA 2JH8A 1BU5A 4X8MA 3R7FA 2XSZD 3KBBA 1NQ5A 1T9GR 2CDNA 4TGLA 1T4GA 4XSHA 4Y2XA 4YFVA 3IXMA 1THGA 3ASYA 1VA4A 1KEEA 4BUZA 5EYPA 4NG4A 1XCLA 3A3KA 3HBLA 4B44A 4O4LA 3B1JA 5B36A 3IPAA 4UM9D 3GEPA 5DW3A 2ZSIA 5LMZA 1MOZA 4ZO4A 1A2BA 4DR2B 1KDOA 3R3UA 1FS5A 3BJZA 2PWYA 4PNPA 3E6AA 3M5WA 5DISB 2ZCJA 1A1SA 3SXUB 2FSUA 1X7WB 3ICPA 3OG9A 4Q9KA 4D82A 2XCUA 3LYHA 4XCQA 1NQAO 2X3UA 3EUAA 3ER9A 1FXUA 4PZDA 2P2YA 4NYMR 1SD5A 3K0BA 1UK8A 3BMXA 3Q9LA 4FNAA 3A1FA 3VNRA 2PUGA 4ZHQA 2FLKA 4AXBA 1OQAA 1BRMA 4BX2A 4K9DA 5DFAA 3H11B 1GEEA 1GO2A 2WTMA 3HXLA 4RE6A 4EQ6B 4ESEA 4LFBB 1FUIA 2I2AA 4RYLA 1NOJA 1UDCA 3P26A 3HXTA 2I2CA 5FUVA 3SM9A 3CSDA 3UAOA 3B85A 2WSLA 4NH4A 3UC5A 6CHYA 3WJ7A 4L22A 1O54A 5A4KA 1J70A 3C3EA 1XNQB 2E4ZA 1S8AA 5KDLA 3I42A 1NDHA 4U0JA 3LL7A 2ALJA 4DCMA 3JATA 4J0GA 4D5EA 1VJGA 3VO2A 1U2RA 2ZYGA 1XLUA 4GFDA 4J2TA 1GQSA 4C0XA 3EFEA 1HE3A 2I9PA 4MW7A 5EWLA 5CDTA 1F0KA 4X94A 1GZSA 5ALFA 4PAOA 2Q5HA 4N39A 3TSCA 4E03A 3HNPA 2OYRA 3QUBA 4ENTA 4DS3A 2QE7A 5LMCA 2ZI3A 4LX0A 4IWXA 3PB3A 4BZPA 1YHNA 3JTMA 4BAZA 4M9XA 1B23P 3GFVA 4BPRA 5CVVA 1K0UA 1ZFNA 1HETA 2HREA 3GT3A 3MJ4A 5LU9A 2PT9A 1A9TA 1B8OA 5TEVA 3SR0A 3IKJA 1DS6A 2FETA 4JB3A 5KOJA 3H5RA 3SQDA 1OT3A 1E4EB 1ICIA 1P2BA 1F9AA 3JWHA 4RTLA 3G2HA 1XVTA 4PE5B 3S2IA 4HDCA 1M10A 1S8FA 5LQCA 4GKKB 3T7JA 1DT5A 1DL5A 1PUJA 5GZ6A 2ARKA 4I3GA 3DF9A 1HA3A 1JZQA 3KD3A 2D62A 4RXTA 4DSAA 2Q2OA 3UMFA 4OLAA 3A1TA 1SUSA 4KKXB 1M5TA 5GP1A 3GJRA 3WSVA 3C5WP 3WGTA 3R41A 2BBTA 2OL4A 2I8LA 4OXYA 3EGDB 2FJ0A 3ETJA 3K0AA 2OFXA 2RHHA 3R3VA 5ALIA 3MA0A 1XAJA 3M33A 2RHDA 3CZAA 1R0SA 2G7MC 4BQNA 3C3AA 4I1SA 3L3BA 1TRKA 4BLWA 1JG1A 10MHA 1MC4A 3FOWA 3AB8A 4GRIA 4MRPA 1D04A 1L4KA 4EKNB 2X77A 1G9XA 1G7RA 1ULAA 4QQRA 5FWNA 1HV8A 1XHLA 4JA0A 1X3SA 2O7SA 3RH0A 1QDEA 1QH8B 3ZYCA 1DSSG 1O5OA 1YCFA 3ESXA 3DOJA 4KW7A 1NLZA 3DNPA 2O3QA 3KQTA 3S68A 1OYYA 4ZEWA 3OOJA 4RTQA 2JD2A 3ZD7A 3EEIA 3AMVA 3ME5A 3OZUA 2QBYA 2PANA 1W48A 3H2HA 1JG4A 1XZLA 4ZAWA 5F4BA 3K6KA 5DOZA 4B2YA 3KQUA 3DUFB 1LTKA 4YI3A 4IIUA 1ZINA 2GJSA 4HRAA 2UVDA 2V6MA 1K97A 2V7GA 3P9XA 1XGKA 3O4FA 1FTNA 4EYGA 1BYIA 1LS6A 3Q3IA 1EDDA 2DPGA 5B1EA 2OAGA 1L5HA 3DMGA 4GW3A 4WMLA 8ATCA 2A9FA 1L4HA 4GXQA 3OZEA 1JXMA 1DTSA 1QFZA 2JS7A 5ERXA 2IZ7A 2BP7B 1L7EA 4OP2A 3LP8A 2RGWA 4ACAA 3OFVA 1POWA 4OU4A 5IDVA 1U1GA 2H18A 5BORA 1TC2A 1OC2A 2JHAA 3PVZA 1GT6A 5A7GA 3KYDB 1ISPA 2J0SA 1JHUA 3FJ1A 3PC8A 4BAGA 5DXJA 3EOZA 1R1DA 3WOVA 1RHQA 3OUUA 3I2YX 4D8VA 1XPRA 3DLHA 2IX3A 1O1YA 1W9MA 3A3PA 4S1NA 3IP9A 5CXQA 2JGNA 1P3DA 4PYQA 1F5SA 2A0KA 3JYHA 3KTDA 4UVIA 4E5VA 1JT9A 4FR2A 5J47A 2V8BA 5ENVA 1E4VA 1WCIA 3LPCA 4WNYA 4WOBA 1P8JA 1L7BA 2RIRA 4LNUA 4EA8A 4EVQA 4EEKA 2O2XA 1KGDA 4TUYA 4DCCA 1OI4A 1HFJA 1WNTA 2JFBA 1OASA 2JLAA 4F3YA 5A2QA 3BTSA 1SKQA 2ZTSA 2QAJA 3ML1A 1FW6A 2J5BA 2X5JO 3SFTA 1Z28A 1L5WA 3SC6A 2MSCB 2HQBA 3HCNA 3COWA 1ARZA 2VA9A 1DXHA 2R62A 3FLEA 3ASVA 4C89A 1PSWA 3PPWA 5JADA 3UJAA 4DC9A 4HGZA 3TWOA 2DOKA 2ZZKA 4LXIA 1T8UA 2WKPA 3WNBA 4LF4B 4YAEA 1QHXA 2CVZA 1ZONA 1QWSA 1IOZA 1MRZA 1PJ4A 2W2LA 3BGDA 1K5HA 1ATZA 5T5QA 5BWOA 4W9MC 3E5HA 4QRDA 4YNBA 1N3YA 4A9AA 4LC9A 3FB4A 1KZ4A 4DV3B 4EABA 5BYAA 4UMVA 3W78A 2VJOA 4B3BA 3ZUPA 4FGSA 5F23A 3QI7A 3WYDA 3WGZA 3UAZA 2GWRA 2YRWA 3WKEA 3Q8KA 3TB4A 5F51A 1M1YE 4NMHA 5ER6A 1OXUA 4OHFA 3CZ4A 4ZVVA 3KJIA 1GU7A 5KJFA 2B83A 3QOFA 4FEEA 1RAAA 4P53A 3CISA 2D5IA 2X1HA 4EEZA 2BKXA 2R4TA 3DO6A 5FA5A 1Z33A 3H8SA 3FKSD 3G6KA 4GKAA 4K6CA 2V0GA 4RCVA 1GPJA 3OH8A 1BROA 1KEUA 4X8OA 4RFSA 3EE6A 3SX2A 1R88A 1VOTA 5EJ9A 4HWPA 2B4TO 3C6MA 3GJ4A 3T7IA 5CURA 4C6SA 2EG5A 3M9XA 1LK5A 4MQ5A 4EB0A 4KBGA 3IUJA 4AZ0B 1I80A 1Z2PX 3KPJA 3LXMA 3ZWCA 4JYMA 4CHGA 1H2XA 2LP4Y 1QCYA 1E2UA 1Z0JA 2FCRA 5DVZA 1EDEA 3W77A 4AYTA 4C01A 4YRMA 1KETA 2FEKA 2RAVA 2YQ5A 5C7LO 2XMCA 1GZ3A 1YK0A 1MJFA 1VM6A 3D59A 2Q4TA 1YAJA 3HSYA 2PJRA 1RRCA 3NASA 4IKOA 1THZA 2FZGA 4FIZA 3KQLA 1EXDA 4C78A 1KPIA 2YXNA 5JQWA 1LUAA 4ER5A 2DFKB 4WXRA 3TNJA 4F1JA 3K1TA 4UTVA 4TMWA 2GK6A 1AGPA 3OSZA 3SJCA 3AR3A 1PDWA 4Z0TA 3A31A 3GP8A 1YU6A 3ETDA 4MVJH 1YTLA 4OHUA 2JAWA 2VNIA 1OXTA 2DUWA 2ZYUX 2OWEA 4UUQA 4BFCA 5A5EA 5KTMA 4FFDA 3F3MA 2VTDA 3KHKA 1BHJA 3Q5GA 1TJ3A 3PA8A 4F5DA 1RM4A 5HOEA 1J5EB 4TYWA 3IJRA 1WOYA 2AVNA 4EGSA 3AM3A 3NHPA 4I5GA 3SXUA 1X7WA 1EGMB 1NWCA 2YS6A 4UVDA 1UDWA 1XK7A 3TPFA 3ZS9A 1S02A 5A0TA 2VBGA 4R31A 1JLHA 2H0QA 4Y18A 5BW5A 4FOTA 1HF3A 4PGGA 3D1LA 2IL1A 1G6Q1 1EINA 3VKVA 5BNFA 1VG8A 3QLUC 3RGGA 3H1FA 5IAOA 5KU7A 5FF9A 4NATA 1HTWA 5H1YA 1REQB 3WLQA 1Z45A 3WMWA 5BN5B 4FE3A 3H11A 2FRXA 4LRUA 3E48A 4UQLA 4ZCTA 1P1IA 1P5HA 1UK7A 5TPWB 2J6BA 2F1KA 4FOSA 3RIEA 3TKAA 1Q0UA 1JIJA 3PI6A 3E22B 3M2TA 1Q74A 2JJ8A 3X1DA 2ZK7A 2IT1A 1ODKA 2P7IA 3JZAA 1SBZA 1RJGA 2YKGA 3G9TA 5ALOA 3CG0A 2Q1XA 3FTCA 1BE6A 4DJTA 3AUKA 2FEXA 3I5AA 1IXRC 4ITVA 5I9MA 5B6PA 3WQBA 1OZHA 2GH1A 2J9XB 3U7GA 1I7PA 1A8HA 5KYTA 5BSHA 4AS2A 5KYNA 5TMBA 4MVXA 4D9EA 4QXMA 4Y1RB 5EPOA 3R5XA 4YYZA 4DY6A 3LOUA 5CW1A 2QMQA 5TQVA 1SXJE 1PGPA 2W8BA 2WILA 4FJ0A 2VAWA 4JOSA 3RLFA 1YS9A 3ZKWB 1FYXA 4BNDB 2VH5R 2CZGA 5MN6A 3SWWA 4LC0A 1S2IA 3EG5A 5FUBA 4L72A 3DXZA 3Q6MA 1DBQA 1TLTA 4OB8A 3IPXA 1E4EA 1EB8A 5KJ6A 2HTFA 3WK8A 2H4ZA 4JT2A 5FUQA 2BC9A 1EJ6A 2VHWA 3LM8A 1DCMA 1T34A 2IZ1A 2ZB4A 3TQRA 1NYRA 3TLBA 3A1WA 3UAVA 2V7BA 3MSXA 1ZSNA 1XTTA 1WXWA 4CIVA 3U1BA 1X3LA 4GI1A 1GTMA 1GTJ1 4OSEA 5AKXA 1Q0PA 4NFHA 2WTNA 3CUUA 3H3JA 2G04A 3HYRA 1M72A 3UAXA 5AK3A 3LY7A 3TL3A 3P0FA 4B87A 4AKEA 721PA 2NP6A 5DWQA 2ZQ5A 4LAFA 3OE5A 2C0PA 1OFUX 2JBHA 3EGDA 3LO8A 4XDZA 4ZAXA 3GLSA 4FTWA 1OAOC 2Q9UA 1E64A 1RXCA 4HGQA 4JHLA 4B47A 1ESEA 2C2XA 3CF2A 4C7MA 4EG8A 5HZGA 4Y9DA 5IM4F 4YRZA 2OK8A 3R77A 2PQ2A 4DHEA 2RB4A 2GM9A 3NT4A 4M53A 5TX7A 4AMGA 3GY0A 3QQPA 2NYUA 7GPBA 4ZKEA 1Y9EA 4W99A 3IUQA 1PFGA 2DWPA 2GJ4A 2PJZA 3DDSA 1WUHS 5BV0A 1G19A 3A05A 2AR9A 2J6HA 2WP8J 4LVUA 3GLGB 3CLTC 1QH8A 4PQYA 3UJ7A 1MX1A 1HZZC 2GFQA 3TIFA 1FFHA 5E1DA 3GD5A 5ELLA 1HBJA 4YMUA 1MPTA 2PD4A 4P22A 1EAMA 2ATXA 5BWBA 2NX2A 5ERGB 5LZ4A 4LX8A 2O19A 3T12A 2VT2A 3K3PA 3DUFA 1Q22A 5GV8A 3T3EA 2AJBA 4XR4A 1I3NA 3GP3A 1QH0A 1AC5A 4NP6A 3VPBA 2CVHA 1X1SA 4WXPA 2YVKA 3UKDA 2PS0A 3MELA 4P31A 2D1QA 3ROZA 2JLCA 3DBLB 3B1FA 3VR2A 4B43A 4RQTA 1HLFA 1AIPA 1H2HA 4IG9A 1DHTA 3INYA 1ADJA 1XDDA 3TEJA 4DCNA 4AM8A 1QMGA 3SDSA 2BP7A 2R8BA 1BMFA 1I0IA 1L7AA 3HLKA 5I8PA 4PCVA 3ONDA 3AKZA 1DO8A 2P27A 4QSMA 5ALPA 4AO8A 2WKRA 3NTQA 4RBNA 3ZD9A 2V1UA 3KYDA 3VU8A 4K46A 3HCDA 3ERCA 3R6DA 4G1VA 3PXDA 1XQWA 3RANA 1SOAA 3W6ZA 1JJFA 1OLSB 4DQ0A 2H1OA 2A5FA 1A50B 4XPZA 5IBCA 4U4AA 4F5WA 3P27A 2EFDB 3C98A 3NGXA 2F9LA 3ZCXA 4YASA 4M46A 4D9IA 3GRAA 2W0SA 4OQ4A 1EU1A 3E2IA 5DIFA 4Q9DA 4MYUA 2VRCA 3ELYA 2WUFA 1CLUA 1P0CA 1MAHA 1ZM4A 1RBQA 1SZCA 2V7QA 2VJQA 1ISJA 2XUOA 2AJLI 3EMVA 3BMOB 3K5HA 4ALNA 4M8IA 4CG0A 5CGQB 4COOA 2DB3A 4QGGA 2FJPA 2G8LA 3JQBA 3JR3A 2PRZA 2GR9A 3REFA 3KZMA 2Q3MA 3DEKA 1VPEA 4O4HB 3MT7A 3MGKA 3OU6A 4DQUA 1TEVA 3UHFA 1M2VB 3EA4A 3JQ6A 4DLVA 1SVIA 1XRRA 5DM0A 1OFTA 4MV5A 5A3SA 3MLEA 4NOMA 2O8VA 3KUUA 3UV7A 4U2BA 2GHTA 3ORYA 2Q27A 3EQ7A 1FFWA 1P2VA 3LHDA 3KAKA 4MYSA 1E9RA 3F6YA 1TT5B 1VHWA 1WMFA 2XWQA 5IYZF 2D06A 1OFGA 1J7JA 2MYUA 1CY7A 3RRZA 4DBLC 2HCRA 1GNPA 3RABA 1GCAA 1NXXA 3DT8A 1T0JB 4AJ1A 2FPLA 1MNQA 3D5QA 4F4DA 1DLIA 1KXJA 2MDTA 4HRVA 4KMSA 1GEGA 1T3GA 3E3LA 3FF1A 4MVJM 3AHCA 4QBKA 5HR5A 2IUYA 2IF0A 4LDAA 1NVVQ 2XNKA 1KDRA 1CCWA 1J07A 3BF7A 4HNGA 5AW4A 2OHIA 3GFSA 3RRJA 1XAHA 2GEDA 4WX2B 1HYBA 3AVQA 3AR7A 1DEOA 5IDYA 1NM5A 2JDIA 3QLTA 2V5AA 4MVJP 3KR1A 1E7QA 1Y37A 5JECA 1OCEA 1ZVMA 2PH5A 3SI7A 2EKLA 2QLNA 4IZIA 4WN9B 3UHOA 2R5WA 1SPXA 2QPLA 4KJZA 5CT4A 3H4VA 3RIMA 1P19A 1TYCA 4IHJA 5EJ7A 2CXUA 4D57A 2NU7A 1W25A 3EVZA 3IV7A 4BO0A 4YQFA 1K98A 3P2IA 1W29A 1YL7A 4K81B 1HDEA 3UOWA 4A1FA 3JD1A 5TARA 3UJHA 2V3WA 2NSJA 4WZBE 1UP6A 4GMGA 2XXAB 5JSKA 2Y05A 3SEQA 3PCTA 1F8YA 2SECE 4ZRNA 2WJ4A 1EFDN 4P7BA 4HFNA 4AZ0A 3WGOA 1Q1EA 3TQIA 2XB6A 1JYFA 2AL7A 1H65A 5LQAA 3LUDA 2J9RA 1GAEO 3VC1A 4V1CI 4F4FA 2H31A 2OUKA 1NMZA 1Z0ZA 1HE4A 2OM6A 3D3WA 2WF7A 2ID7A 4LWOA 4QTUB 4YB8A 5IF3A 4OHKA 3E0QA 2JGRA 3T61A 3WBFA 2FN7A 2CCGA 2QT1A 3MOIA 4D8UA 1YRAA 4DCTA 4EHNA 4NZYA 3TN7A 3B8HA 5HF6A 3R9WA 4Y6OA 2ID4A 4CR8A 2FB9A 1TA9A 4GQBA 4TTRA 4BMDA 3PV0A 4TRJA 2ODNA 5EESA 4AUEA 1U02A 4LJYA 4DMRA 1PL7A 2HQSA 4LKRA 4S1PA 2G5CA 3K35A 4MJ7A 3ZDQA 2YV3A 2PYIA 1XZBA 2RH5A 2WFLB 1EFCA 1Y42X 2Z4SA 4BJ1A 1R0ZA 2R6R1 4GZ6A 4EA7A 2OXRA 2E21A 3QYAA 2H4FA 1GZ6A 3H86A 3OFJA 5IDXA 2GCEA 3JU3A 4YV7A 2H1IA 2AE2A 1YA8A 1EHYA 3ANMA 3IPLA 4AJ9A 1GUDA 1WW3A 2WEKA 3D0KA 2ACVA 4TXJA 4CMCA 2QIOA 1JSLA 2GSWA 2WPNA 3SSAA 4OX9B 2Z9DA 2RGRA 5BN1A 1EYZA 1Y4ZA 3C24A 4AW9A 2DR3A 2EBWA 4UUNA 2PTGA 4KTTE 4ZOQI 3BJIC 4A0FA 1IBRA 5LXTA 1GM5A 3ZDAA 3LC7O 1AF7A 4FI3C 5BNTA 1GCUA 1VPTA 3V42A 1XXHE 1VLVA 1REQA 4OSPA 1Z0KA 2B5WA 4IDQA 1UAYA 3CFYA 2P9CA 4CXMA 3A9RA 5TPWA 1VI2A 3AW8A 1R10A 2GPSA 2VWPA 2Z8YA 2IXFA 3GU3A 4IYRA 3L93A 4LRSB 4PAGA 3E22A 3OX4A 4QFDA 1XCOA 4EKIA 1W30A 3UTDA 2QTHA 5KX5F 1XJCA 3C3MA 3DVSX 3FOZA 1RLMA 4DRYA 3SAJA 5K0TA 3LUGA 5GV7A 2PX2A 3A3NA 2H85A 5AIBA 2I7DA 4GD3Q 5JVDF 2PGLA 5L7WA 5MF6A 2JI8A 5DCUA 4P92A 4J6FA 4JIGA 4PGHA 4BNYA 2HSEA 1N5OX 4Y1RA 3I0MA 5CT5A 1VI5A 5FPKA 2P4QA 3WYGA 4DB2A 2Q0HA 3G23A 2YWFA 4QTYA 3VQTA 3UJCA 1J49A 2I4MA 3IAM6 4ZN6A 3QYJA 4AJHA 4GGPA 1O08A 2V4UA 4ZDWA 1I13A 2PPVA 3ZKWA 2R1TB 1Q7CA 4BNDA 3WAKA 1GA1A 3KQWA 4BTVA 4ETNA 2DQKA 3R5TA 3I2IA 5DGIA 4Y6RA 4ZPXA 2PAFA 3V4RA 1ZHFA 3MWEA 4EJMA 5K8VA 5A9RA 4CLXA 1U9IC 3K9CA 2FU5C 2PSHA 3DS8A 2H4XA 3QLUA 2QMHA 5FJJA 3V3KA 1SVSA 1SHUX 1IDOA 3FIUA 3RQSA 3VR3D 1XTPA 1QF6A 3OUZA 4JGIA 4RS3A 1NUAA 1NSTA 4I46A 5JG7A 1P18A 2Z8XA 5KNBH 2O59A 1L4BA 3MF4A 5DT2A 3L0SA 3VHQA 2OENG 4U7DA 2IGBA 1T8SA 3DGFC 3EIXA 4A36A 2CF5A 1CIPA 2QPAA 2ZG6A 3RQIA 4OHOA 3RRFA 2V65A 1PL8A 2XUFA 1FTGA 3DLAA 3I83A 4EA6A 4EB3A 2DLCX 3SE0A 4BO1A 1DO0A 1YOVB 2AJDA 2OV8A 2MIIA 3I12A 3ODPA 2W6ID 4U2GA 4DV0B 2GERA 1QHGA 1VFPA 4ZMBA 2H1HA 4CGYA 4C7OB 1W5TA 1LCIA 4TMXA 5K0FA 3ICVA 4EGJA 3WL5A 3WWDA 3N07A 4KWHA 4QL3A 5B1DA 2ROQA 4K7JA 3IIKA 5KEIA 2CLSA 3F4BA 2PZGA 4YEDA 4EHAA 1PFKA 4HDRB 2B78A 2YDXA 1HRDA 1JW9B 2TYSB 1YUMA 4DA8A 3Q15C 4ZYXA 2G5TA 1EFUA 3GLGA 4JQSA 3E9RA 5TJHA 3T7DA 4L57A 3IURA 4ENQA 5JHGB 1LWOA 4I1VA 4OB6A 1WU7A 2VRWA 3I72A 3DFFA 2OV3A 3FWPA 3N7UA 2GBGA 4JZKA 4MI1A 4YRDA 3IELA 4HEA1 5DBIA 4AMYA 5AUPB 1IVNA 1D4OA 2VDNB 2ZDGA 1FDVA 1ZXXA 1JAZA 3L2OB 4I8IA 4F8YA 3O8RA 2PRKA 1MFPA 3X1JA 3UPTA 3VO8A 4LFCB 1NYTA 2OO7A 3K8QA 1BU8A 4EFKA 1PW7A 5LLSA 3OCXA 1GTZA 3DBLA 3T95A 3MC1A 5EJ2A 4QT4A 3C7AA 4LZNA 4LHYA 3VSDA 3DLTA 1GRQA 2LE0A 4WGFA 1H5UA 1KK3A 2YHUA 4G0PA 4RA6B 1DDGA 4FFNA 1I3CA 1OAOA 3ZJUA 3OFNA 3I04M 4JVOA 1RE1A 2JCXA 4WZAA 1A8UA 2OHFA 2IYWA 2Z5VA 2ZITA 5CNMA 2DBVO 2RGDA 2HRRA 3QU5A 1DAFA 2OBXA 2JAUA 3G2KA 3P0JA 4P4SB 4QYTA 1KOFA 5EHNA 1V3QE 3CRZA 3MFQA 1VHLA 3S5JA 4BTEA 2X9VA 1OLSA 4U7JA 1NKTA 4I1PA 5KYUA 2ZVDA 4QDKA 5EKTA 4CM7A 2YZGA 1YVRA 1DV1A 2ZRFA 4JI6B 4ABTA 1EX9A 1P2TA 5K0SA 4M49A 1HZZA 1AZSC 2JK1A 2XD9A 4QC2A 3W3ZB 3ZTWA 2J3IA 3LBNA 3OM8A 2BYTA 2P0YA 3IKTA 3GLKA 4Q9NA 3ZJYA 4EJSA 4RD1A 1FZQA 3C2QA 1P75A 1NSYA 2YV2A 4PHCA 2GPWA 4G9EA 2BEKA 3BMOA 2IHKA 3GEMA 4GP7A 3UCXA 5DLDA 1DC6A 5BR4A 1J9GA 1U1EA 3N7AA 5HCNA 1ID8A 3ETHA 1BEEA 1DC3A 2J9ZB 3GPIA 4O4HA 2M6KA 3DLIA 3E4CA 5I48A 4HLCA 4X97A 4B3IA 1TF7A 3K9GA 3P0HA 3MPUA 4K9NA 2P3OA 3BHIA 4QOEA 1M2VA 4JEUA 4M22A 3R4VA 4RVNA 4W9RA 5ENDA 3U19A 2JHFA 1ETUA 1ZVKA 2ZYHA 4UDNA 5JPIA 3ZY2A 4RK7A 3UN1A 3VGJA 1BFUA 1N7GA 1OHHA 3F4KA 4KAAA 2O2HA 2EWMA 2DAPA 1G20E 4GU5A 1GYPA 1S2OA 3WB0A 3WP0A 3DQQA 3WK7A 5FOWA 3VZQA 3MJDA 1DFHA 3OTHA 2GNPA 1OX5A 4IMIB 2GM3A 4QQFA 5G2OA 3RK0A 1KKUA 3DO8A 4EKDA 5JV5A 4G5GA 3QEMB 2WDPA 2PGAA 4INAA 4MQMA 2HADA 2WZQA 4X6YA 3QWFA 2RD2A 1V6CA 1EA7A 3ZZ1A 3QFTA 1M2FA 4ILKA 4P98A 4XJXA 3ONVA 5LPNA 1RYNA 3A2KA 1GT91 4PQEA 4U2KA 3VV3A 1FW8A 3R3ZA 4IINA 1MAUA 4KQKA 1RPJA 2BD0A 4LYGA 1U7WA 2JZOA 3T1VA 4ALIA 2H9YA 4WN9A 3LQ1A 1GLGA 3TTVA 5BWNA 2G4VA 4BP8A 2JANA 2PKCA 2WKSA 1CX9B 5I5GA 4AY5A 2YUTA 5JCZA 1B8NA 3TX2A 3GVXA 4MKGA 1H8HD 4WEOA 3E0XA 1OWNA 5F52A 4AF8A 4C2TA 4F4HA 3QRWA 1WZ2A 3T4EA 1TK2A 3VR5A 5LP6C 3VYUB 2XXAA 4DW8A 3HEMA 4I4TF 1IOWA 2VXBA 3UYLA 3LG2A 4PZAA 1PD1A 3V7UA 4QT0A 3K32A 4XGQA 4JCOA 1EIZA 1GGNA 4HB4A 4H6PA 4RACA 2GLUA 1RJ9B 3MAAC 2DR2A 4HZUB 4ARAA 4HQ6A 2IYUA 2DQZA 4RIIA 3OT5A 5E1MA 4DZTA 1KVSA 3E3OA 2DFTA 3NHLA 1C3EA 2XZLA 4OU5A 5AVQA 1K92A 3QLEA 1NQWA 4Q1FA 3EZGA 3M4YA 2OQVA 4DR4B 1LY1A 2XUQA 3SS7X 3FPLA 5CIQA 1FSPA 3AF6A 4JI4B 3K05A 3PYXA 4MITA 1IBCA 1N2IA 3O4RA 5JNUA 1JAYA 1YS1X 3F98A 4L6AA 4MDEA 2F00A 4EG1A 3SBXA 2LKDA 3S2EA 3PC7A 1VKOA 4AJOA 3R23A 4MW0A 3Q8MA 4CQMD 3QPCA 5FUYA 2L17A 2Q8PA 4NBTA 2FPIA 2E89A 4B6EA 3AGQA 1GPNA 1GL7A 1X8JA 4PYOA 5BUZA 221PA 1TAUA 1ZD5A 1UPAA 3KJNA 4YQYA 4Y67A 4W5QA 1ZOLA 4HPJB 5DT9A 4PYMA 5LP6B 3WZMA 2P75A 1FNDA 2WT9A 4ZAFA 3JQAB 3K53A 2PU5A 3BFPA 2AXQA 5EJMA 5AVSA 4LJ6A 1M8PA 3UFXB 3VX3A 2Z3ZA 4UTPA 3C1UA 1TQHA 4TQ9A 3CX6A 1ULBA 4JJ4A 4GX0A 2W2KB 1JQDA 5K3OA 3P19A 4RHXA 3L05A 5I7SA 3WE7A 1U3GA 2CHUA 2O8BB 3A3YA 2BM1A 1V7CA 4BJ6A 5IJXA 1UT8A 1HORA 2SCUB 1C9EA 1U5AA 4GWKA 3SBOA 1G4HA 3BHNA 4KX3A 1E1MA 1NF8A 2YV5A 3KPWA 2ZIVB 4MIYA 4BZXA 5A5DA 2VP4A 2RHRA 2R7AA 1A9YA 2IP4A 3VI4B 2ECKA 5E0OA 3B9BA 5A3QA 4CEJB 2B1QA 2FQ1A 4RTRA 3PR1A 2OBFA 4FYJA 4IEFB 4QHYA 5I9SA 2HRBA 1V25A 1Z06A 4X6LA 3F6PA 4J1NA 1PZEA 4JJ6A 3AFOA 3KXDA 2FLWA 4AQYB 3KJHA 4MRVA 4CIBA 1ORIA 4BZQA 2AXEA 2ERXA 1EZZA 1YI8A 2VOEA 2WOOA 3OPNA 1PJCA 5EWMB 1OH7A 3O4JA 4WKNA 2B8NA 2OLEA 4J16C 3DMNA 3NWOA 4TLDA 3NBAA 1NFRA 3ELUA 2R1TA 3GQBB 1CUVA 4UNRA 2NXWA 4YDQA 3CA8A 2X4LA 1U31A 1J97A 4G85A 4RZSA 3URKA 3T3NA 3VPAA 1NP6A 4Q4LA 4XIGS 2GI4A 2Q2QA 3PZBA 1GNRA 2ZWAA 1Y1TA 3M6UA 2H1FA 4DYVA 3LCUA 4GP9A 2MT9A 4BV3A 2WJAA 4Q7QA 4HR7A 4TTJA 2ADOA 2E6UX 2OK7A 1V5FA 2RHWA 1P4GA 1NQVA 3O2QB 1MTZA 4QUHA 3O4GA 5K0NA 2E4YA 1KEWA 1RNLA 3E82A 5TQJA 2FUCA 5EMKA 1BYUA 5H81A 3SQWA 1EDZA 1PEYA 2EHDA 4GX1A 3RS4A 1JHDA 1BDJA 1Y89A 4HL6A 1QHYA 3ZTYA 1YOVA 3FVRA 3CE6A 2XWBF 4RANA 4FFPA 1NPDA 4G4IA 2HHLA 3U7HB 2ODQA 4YLYA 1O6ZA 2QG9A 3OEED 3PC6A 4OI0A 1RVV1 1T9BA 1QHEA 1TDJA 3EQZA 5EZYF 3TD9A 4GKJB 4QVGA 3I9FA 5FBQB 3U37A 1UBTS 1O9HA 2V5VA 3ADBA 4EJFA 3D3KA 3W5AA 2WWFA 2HOQA 4HDRA 3LT0A 4FWBA 2H1LA 1E79D 3KDPA 2YXDA 3IPYA 2DTDA 1JR2A 1T0UA 1GY8A 1AKEA 2DY0A 1QH1B 2WWXA 3KJZA 1E1YA 2R8XA 4ZO7A 5ENZA 1HEIA 5IJ0A 1WXEA 3DOHA 4JJIA 3O73A 1U9IA 3DQPA 3HSKA 5T8KC 1E9EA 4QPJC 2DBRA 2QWXA 5C46F 4R69A 1SCBA 1KGSA 1VIMA 5DTJA 4MKXA 5GJWC 5CDUA 3T0FA 1FFYA 3IO5A 5TC4A 4HQRA 3ZJ4A 4Z4IA 1XTUA 5JJ5A 4HMPA 2GWHA 1N6RA 4ZT6A 5IEBA 5ED4A 1ETHA 4PPYA 5IC4A 4S04A 1MVLA 1JGTA 3GT7A 1IUOA 2RAUA 1XVAA 4F1KA 1RZUA 2VDPB 4DA0A 3VO1A 2QRGA 3EEYA 3EHEA 2Y0DA 4W5TA 4RA6A 3PWKA 3ZIAA 4M98A 5ILOA 2RE8A 3IYLW 2WKWA 1K89A 3L0ZA 3ONEA 4D0LB 2P2LA 2AI1A 4PRLA 2R6ZA 3IIJA 4L5AA 4LBWA 3FPCA 1P31A 2GPNA 3G1UA 4P4SA 5IFKA 2FFAA 1NC3A 1UKYA 1KI9A 1O97D 3KVRA 3MJTA 3UICA 2VP0A 1HNZB 4IIDA 4OHZA 1EDBA 4MB6A 3UOGA 1W46A 4F56A 3OTIA 3F8SA 4K6FA 2ZYWX 3CUKA 2ATIA 1Y8QB 3H5IA 5DSXA 3EULA 4KV9A 1EFPB 1Z08A 3IEVA 5B3AA 2GSDA 3PPVA 2OLKA 4ZZ3A 3K71B 3PUYA 2AI2A 5JAUA 4AK9A 4BTLA 3I9V6 2GVNA 4EGCB 3MUOA 1FCJA 1LH0A 1GL6A 1MD9A 1JR3A 1W4CA 1YKSA 4TXMA 2WMDA 3ZWBA 2QUBA 2IOFA 4GC9A 1U28C 2XBUA 1NVKA 1QYWA 2GZ1A 2X8LA 2ST1A 4B6JA 3LRXA 2YJNA 5HZMA 1NVTA 3VJKA 1QFJA 3GEGA 3L7KA 821PA 1Y6QA 3GGSA 3RRYA 3D64A 2PL5A 2VYVD 3EZNA 4FW8A 2QSJA 2V58A 3FPSA 1TGVA 4FC7A 4EDFA 4X44A 1BE8A 3AI3A 1Z4IA 1U0LA 4N8SA 4M21A 2VYNA 4LDNA 2I99A 1VZ3A 3U80A 2AMVA 4EI8A 4NXNB 1JR4A 2C1XA 3E1SA 1G5TA 1JQ5A 3OHPA 3TUIC 4KSBA 1DKQA 1D7AA 1XA4A 1CYEA 1WHSB 3QEMA 5JO0A 5KOHA 1ZNYA 2DVMA 5JMPA 3Q7QA 3SHWA 4Z1MD 5DKFA 3AWIA 4PSAA 2ODTX 2YV1A 1QKJA 3L7IA 3ORRA 3TFQA 4EVRA 1Y6GA 3AVWA 5EP3A 4L8YA 3SZMA 2IEIA 1AS0A 2Y71A 3C97A 4O2LA 5AOAA 1BX1A 3LBAA 4D3YA 1ES9A 2NO1A 4JHXA 2EW8A 3KR9A 5G02A 1GSHA 2OBBA 4RD6A 5H59A 1ZC4A 4X71A 4YIKA 4CLOB 1QQBA 1KDTA 4N7BA 1K3TA 2V7WA 3CO5A 3PC2A 4D8TA 1JDBB 1DC7A 4ER0A 4NAUA 3H5WA 4UQPA 3AILA 3ETLA 4TN5A 4XM2A 1O96B 4XQEA 1BKYA 2D6FA 4ND5A 2X19A 3OMLA 3TLYA 4QULA 4B4OA 3MB5A 3WGNA 5COAA 1YR2A 1RJ9A 3DO5A 3F6RA 5HF9A 5I7UA 2YHAA 1CY6A 3G3EA 1GPBA 4HZUA 1QU3A 4JJFA 1UC8A 3VNBA 3ZGLA 4QJ5A 1VBMA 2I6XA 4QEZA 4TXLA 4XCXA 2XQGA 4D6XA 3D4IA 4XYMA 3WMGA 1KEVA 1LD3A 2VOJA 4L85A 2A0YA 3NFYA 3CTMA 2AZTA 4KRXA 5CXSA 5DK6A 3UEOA 2QA5A 4MR7B 3COPA 5F9MA 4LWQA 1RHRA 2B2XA 2UV8A 2PYZA 1B8VA 1U3DA 2VDWB 1CNMA 2PGDA 1V41E 1XZCA 1R74A 2GMWA 4HQ0A 4ARSA 1OXSC 1SBTA 1YBVA 1ZYUA 1P5ZB 4MWGA 4CTKA 1XDGA 3PITA 3EMBA 4G37A 2HZ7A 3PTAA 1SO8A 2QD3A 2CSUA 1I3MA 1Q21A 2AN9A 4D9GA 2I2WA 5E3IA 3CBGA 1H1LB 3WNCA 4KMOA 1NQTA 5KB3A 1UWVA 2FWAA 2GLXA 3WQSB 2G77B 3FWZA 3ILXA 4WFQA 3S0JA 1WW2A 4DTIA 5LP6A 3BT7A 2PRSA 1DKUA 3JQAA 4WESB 1MW9X 1HEYA 1M2OB 3USCS 2GPAA 4DV6B 4NBLA 3UFXA 2FOLA 2NZVG 1I10A 4GLBA 3FTPA 1PT7A 4NCIA 1Y3FE 2PCLA 1YFKA 3RSHA 1KXZA 4Q15A 3G6WA 5FCDA 1L3IA 4MKHA 4DYHA 1KI1A 1KI3A 4BN4A 5LSAA 3SCZA 4N41A 5JJKA 2IEYA 1DBWA 1T9HA 1M83A 1STOA 3NC4A 3WLKX 2SCUA 1Q6YA 3F49S 1IN4A 3OIVA 4IFEA 4PO1A 5AW3A 4NXMB 3JQCA 1N77A 2QRUA 4TTPA 5THKA 5C80A 2IUUA 2WG1A 4JI2B 1ABFA 1QCDA 2UVQA 2C2WA 4MWCA 5ILGA 4BNUA 4PV7A 4RH3A 3UAYA 1RMQA 5ARBA 1PWYE 2FKAA 4CEJA 3AFNA 3R0JA 4HUTA 4RL4A 1JBKA 1S7GA 1B16A 3NEPX 3QBTA 4N5HX 4IXNA 2V6BA 2SBTA 2H48A 2X23A 3AHFA 1CJCA 1Q91A 1YQQA 3R5FA 4NEGA 5KCMA 1E4OA 1QYIA 3UWMA 4POOA 1M6HA 5FP0A 1A5AB 1Y63A 3W34A 4JLKA 5EWMA 3EZ6A 2AB0A 3RVSA 5CDGA 1AO3A 4TLAA 2GJKA 4IQFA 1AK9A 1NVMB 1WKVA 3GQBA 5GOZA 3GLIB 4MS1A 1RXWA 2HIGA 1H2ZA 1R6XA 1T6YA 3PNBA 4NICA 4QHTA 4WADA 3ZCPA 4IHAA 3IODA 1CP3A 4RK5A 2J5XA 4LC1A 1JS1X 2CLOB 2C88A 1OF1A 3AINA 3RBVA 3MWJA 3TDNA 1SIOA 4NJMB 1QG6A 1BH2A 4AC9A 1S1CA 3LUFA 2QUAA 3PXXA 2CBXA 2OCIA 4IHKA 4XTCS 5KNCA 4NC9A 4URUR 4DJAA 2HNKA 4DV7B 1HXHA 4MAFA 3HVRA 5CEFA 4PLGA 1W94A 1WVIA 5FWDA 3ND7A 2OV4A 1JILA 1A8SA 4GQIA 1E2PA 3NM6B 1AHNA 3E1KA 4ZOAA 3WLHA 4FOPA 3GBVA 2X2OA 1L3CA 3AGPA 4GPBA 5I45A 3AUAA 5DMHA 3PS9A 1FS6A 1IFXA 1T43A 3TOVA 2D00A 3LQ4A 1R9GA 2LXNA 3RTBA 2ZAYA 4EZEA 5JAZA 4UCXA 1BQEA 5JEEA 4DREA 8LDHA 8GPBA 4HC4A 5NLLA 2DLNA 2JGAA 3OI7A 1LVUA 4G56A 1MDFA 4O25A 4BCCA 4DLRA 3CLKA 2JFUA 3PD7A 4IFBA 4DLBA 3PIRA 4J16A 1FX1A 2IIQA 3VSEA 1AKUA 4A10A 1EI9A 1RC0A 1XCMA 2I66A 2IYAA 5FPQA 3VKUA 4RTJA 4ZXFA 3FCEA 1Y4DE 3M83A 4LW8A 1EFTA 3T4PA 1NI3A 5DYTA 2ZFUA 4BKOA 3TB6A 4F8JA 4HBGA 3SZUA 5EMMA 3RS9A 4ZZ2A 4Q3OA 4DMGA 2IYTA 2GRUA 4DGQA 3O6VA 3AJDA 4LOJA 3WLJA 3PRKE 1NZJA 2XOKD 4TTQA 3EF3A 1QTQA 2J7KA 3QYPA 5DI9A 3GARA 1W85B 1I2ZA 1H66A 1JQKA 1DFGA 2WAOA 2X40A 4HJXA 2G9QA 4Q7MB 3FNBA 3GFBA 4M6WB 5CTJA 3UBMA 1YRHA 3BILA 5I7AA 2Z2YA 1Z4KA 5U4XA 9LDTA 3GNLA 1RPNA 1EE9A 3QMWA 2CL5A 2ZUSA 2NVOA 4MV0A 1XNJA 4LTDA 4MRMB 4E5PA 2K7ZA 4C0HA 5JPDA 1X13A 2YVLA 3WGMA 1V43A 2QT9A 2W2XA 5HOQA 2J3KA 2NG1A 4B3RB 1OBFO 2EAUA 4XUCA 2WA1A 2O2IA 4K05A 4PPFA 1FPQA 3MTJA 2B69A 2PSFA 2WIJA 1U8XX 2BCGY 2F6RA 3DEIA 1SHKA 2G76A 3N7TA 4IV0A 4R2KA 1NDQA 2ZRDA 3RYIB 2WIFA 3UW3A 4F46A 1CQJB 2X3YA 3B5IA 4HMOA 2BAGA 3VISA 4B80A 1G5FA 2XCQA 2YIDA 3I73A 3F0TA 1OXVA 1Y8QA 3IO3A 3PNLA 2RONA 4MV3A 4PN3A 2D2IA 1EFPA 4GGOA 4PWYA 3DDOA 2J46A 3MZ0A 4ODIA 1SBYA 4R2XA 5T8KA 2JEZA 4CT0A 2V98A 3E27A 1HLDA 2M98A 2RFLA 4GNKA 2XQFA 3BUSA 1TD1A 1VJTA 4PGMA 4IIVA 4MLCA 2CDRA 2FEMA 2WMYA 3EQ6A 3PIDA 1IH8A 4ZCSA 1DQSA 3F90A 2QX8A 3QEKA 3QP9A 1WXGA 1IY1A 1VCOA 4JN6B 3VR4D 3BD9A 4KE7A 4FHFA 4BKMA 3VH4A 2YNMD 4JIMA 5FTJA 3W9YA 4C6TB 1DJOA 1VSQA 4V24A 1FYWA 1DTEA 4RMIA 5J4YA 3SFVA 2C7RA 4DIKA 4Q01A 1DG9A 2HA7A 2XX3A 4KO8A 3LQFA 2VI5A 1E32A 5K4AA 3CZQA 3JXEA 3PI7A 2DWCA 2UZ0A 4IRMA 2I78A 5AW5A 1JTEA 2IYXA 2IZ5A 3KFXA 3AJ9A 3C5VA 2MYPA 2RCYA 5ES3A 1SKYE 4JVNA 1M2JA 4PLWA 5AK4A 3FRJA 3QH4A 5ETJA 2A9OA 1AK1A 5TVKA 1R0KA 2RDMA 2RBGA 1AUQA 1WHSA 4IDNA 4LYFA 3NVKI 3DTTA 2X4GA 3GLRA 4DBZA 4W5RA 4UUPA 4N5DA 5E9QA 3V2UA 3UMJA 1N6KA 5EHXA 2RKOA 2ETVA 2X9QA 2ZR9A 1OIWA 2UZ1B 3ZK9A 4OEHA 1L5LA 1GTL1 3BIXA 4OUDB 4AG5A 1GILA 1C0IA 1NVEA 4CM5A 1J0XO 1GARA 3MIZA 2LCIA 2XIQA 4DR7B 3B9RA 4CLOA 4OREX 1U28A 3V1LA 5AFSA 3T0IA 3HKCB 5UKDA 5AVOA 4KPYA 3HNRA 2I33A 3PNSA 5JWHA 3WL8A 4B45A 4YGYA 2QVXX 5KSYA 5HRCA 1AVTA 4DNPA 4GYWA 4ND4A 1IXKA 1XVVA 1O96A 3M4ZA 4MV9A 4B46A 2R6GA 5JAPA 3T3IA 3NUZA 2XZDA 3FY4A 5CEEA 1QV6A 3CH4B 2IYYA 3IHLA 5BW4A 4PCLA 1THTA 1D6MA 3NOOA 4RFLA 4Z9BA 1HQCA 5JIBA 5B7NA 2X1LA 3ZY4A 1O8CA 2ZPTX 5I4KA 4UMDA 5C8XA 3VUFA 2L19A 1WE2A 3NJ8A 4AUNA 4H3KB 4H27A 1BQ3A 1JKXA 2WJZB 4CUZA 4GKBA 4V0MA 2IPNA 2HTEA 1B8UA 2E1PA 2NQTA 5C34B 3B1ZA 4YAJA 3JYQA 1L5OA 4N54A 5TPZD 2VDWA 1L5QA 2OUIA 3JQEA 4XIJA 4BFTA 4FEYA 4O2AF 2J3DA 3GPBA 1YZGA 3WDMA 2EKBA 4XD2A 2XE7A 3F7OA 3THRA 3DCJA 4KACA 4GECA 3HN2A 1YFJA 1PYOA 3NYQA 4NARA 1ZH8A 5CPFA 5G0WA 3UA4A 4AJLA 4R8SA 3LHSA 1FP4B 5AW8A 2XT0A 4NYIR 4H4CA 4ZFNA 2KM1A 2OVBA 5IKPA 5ISMA 1YA6A 2D8MA 4UXJA 1CR6A 4X1KA 4IDBA 2KLBA 1H1LA 1SVOA 5CBKA 1E9SA 3EA0A 1TTPB 4XVQA 2GCNA 2A30A 1NBHA 2QD5A 2ZI7A 1C4XA 3O3OB 4H59A 4IBOA 3T3PB 4C6RA 2OCLA 5BQ3A 2OT3B 1M2OA 1MQAA 2ZWPA 4FBGA 4LMPA 1TI7A 3D4OA 3U0BA 3VV2A 5T4FA 1M66A 2VG8A 2XUZA 3WXMA 3EXEB 1XA3A 2NOAA 3G2PA 2IPAB 5HMLA 3SZRA 1YHYA 4K28A 2CNOA 4HVTA 5CLIA 3SSNA 1SCUB 3QE4A 1D4FA 4XGRA 2BHTA 3R5JA 1XAGA 2G1PA 3D7NA 3R7BA 4JVMA 4AF7A 4C7OA 2Y1OA 4QQKA 2IHJA 2FMIA 3RU2A 1XK6A 3TQCA 5JY6A 5L51A 2PZFA 2ID8A 3ED1A 3FHLA 2E4VA 3LQ2A 4EF6A 3GF4A 1YIDA 3NJ4A 1QX3A 5JI2E 2CMDA 2C8JA 4UHHA 1XZPA 3OCZA 4DE5A 1VKHA 1W47A 2ONYA 1KR5A 3VC2A 3T35A 1T2FA 2BTQB 4WBNB 3PNVA 4AP9A 5LC1A 2PVPA 1R0BA 3JZDA 1PJ8A 4G8DA 4RZUA 1ZEJA 2DQYA 2BFCA 4J1SA 1E2EA 4YCSA 3HR7A 4TL8A 1PWZA 2R96A 1W35A 1PG0A 4G5QA 4L4SA 4DAEA 5BRAA 4BOYA 4OBBA 1C7EA 2MSDB 3ZZNA 4XE5A 2Q3BA 1NVAA 2OC4A 2EZ9A 3USES 4JBLA 1U90A 4DIOA 2VTEA 4KR0A 4L0DA 2OD7A 3TOZA 4QOSA 3OTOB 5H5JA 2P5TB 1LFDB 1FFDA 2NO7A 3FWKA 1ZM9A 3JSAA 4DMHA 4NJMA 3RRBA 2AOTB 2AG8A 2LIPA 4OLFA 2JCSA 1ZSVA 4R40A 3RVKA 3MFYA 3RSGA 4JR1A 4KXNA 3BXZA 4Q00A 5F7XA 2NV0A 4MW5A 5G40A 2B98A 1MEEA 1LGYA 3O21A 4LVCA 3ABSB 4LG1A 3ZLBA 1U2TA 5FFMA 1P4AA 4TKUB 2OORC 2PWBA 4QJBA 4BLRA 4EHIA 3OLZA 2B6HA 4MHSA 4DSUA 4HF7A 3VR6D 3N8DA 4CF3A 2WB4A 1GUFA 2DFVA 2CLFB 4PICA 4E6EA 1TT7A 1BS2A 3MINB 2BFMA 3DGEC 4LYYA 5JLAA 2WWTA 1FSSA 1OVGA 3AW9A 5ALGA 5FA6A 3TXAA 3B1XA 1J9EA 2R2GA 1DAMA 4E5YA 4X1IB 1T4CB 5BOSB 2OHJA 2NAFA 4RVCA 4IWYA 2C4VA 4ECAA 1SQ0A 3HJNA 1UPBA 2B92A 4IV5A 2FFHA 3FZNA 2GBFA 4JOQA 4REQB 2GA8A 4EKEA 1G8KA 1XQ1A 4CV0A 4BNHA 3NVMB 1DDIA 3GMIA 1MQ9A 3L1JA 2EDCA 1X1RA 2PEZA 2H2AA 3O3CA 1KOLA 5KINB 1FRZA 2WSYB 2XH8A 5LLDA 1W85A 4LZWA 4H7PA 1H2FA 1EH5A 1W4BA 2O48X 2P35A 1M1YB 1P45A 5DLEA 3VYVA 2O8NA 4M6WA 4RX1A 2PXAA 3DD1A 4Q82A 4IIJA 1DX4A 4BQIA 2VSQA 1CDDA 2FW6A 2VWQA 2O0KA 4FLMA 1XE3A 2JGKA 3LLVA 2AD5A 4MRMA 1N3LA 5AICA 4JUFA 2PGOA 4X41A 3JQGA 4EF5A 2FXIA 1CUEA 4B0OA 3LDHA 3RVMA 2AX4A 4XYGA 3MXOA 4LYDA 1U0RA 4U6NA 4ZYUA 5JNLA 3IVAA 2ATEA 3N1UA 3WHKA 1KU6A 4NONA 2ZYTX 3RYIA 1ENYA 2GTPA 3WL6A 3F7MA 5A4FS 1VFNA 1XZFA 1A82A 1CQJA 2QR3A 4MV6A 5BOVA 4KI0A 3V8NA 2FN9A 4CIDA 4JR0A 4BQEA 3LK7A 4YK7A 2ZP1A 4XEUA 4AULA 3STVA 5KJ1A 1ONPA 3TSOA 3P9QA 4JQCA 4PS0A 3D7MA 1DEKA 4NCNA 4FYWA 4PC7A 2Q6KA 4IDOA 1M0WA 4XTRA 3L1HA 3KL4A 2A0WA 3OPXA 4II7A 4QU5A 4J0KA 1M1NB 2PQMA 2VCHA 2QD2A 3AUYA 5CPBA 2OOKA 4D4GA 3FYTA 1MHPA 2H52A 4LBZA 4C6TA 3L0PA 1RYHA 1W87A 1Z68A 2BR5A 2GD1O 4GO1A 4PZPA 1U4SA 1M34E 3AXSA 4C20A 4CV2A 4U9HS 2WVAA 2PT7A 4YGXB 2BJWA 1UEXC 3AG5A 5A4IS 1CP2A 3DE3X 1UZLA 2ZE8A 3G5AA 3HFGA 1W9HA 1YCDA 3I9KA 4FX5A 2C0CA 5KWIA 3CRMA 1R0XA 1NNSA 1IQPA 3FVTA 1Z0AA 4DIFA 4EITA 5DWDA 3HMQA 5L6MB 3X1KA 5SYNA 5DV9A 1MX5A 1B76A 2DKFA 2Z2JA 3WL4A 4HXEB 3S55A 3ZDYB 3J7AC 2GX6A 4G4GA 5KTPA 1KQPA 2H2DA 3NNNA 3OLXA 5EXSA 4B75A 1G21B 3I8XA 3TF5A 1AGXA 4G2TA 3GJ0A 4HEQA 4L5BA 3OQBA 2PH7A 4LQCA 4WQMA 3E3MA 5F1YA 2AUNA 1TUEA 2R3SA 4GX5A 3FYHA 1T6NA 6PFKA 5ALHA 3PHHA 3GRKA 2W4QA 1V26A 2UZ1A 1ZHHA 5D7BA 4OUDA 1SU7A 2AWNA 4ZQIA 2B37A 2QW1A 1FB5A 2B0JA 5GGXA 3ZWMA 1AE1A 4WTOA 1DIHA 3KV3O 2C9DA 2A7XA 2IYLD 2ZRKA 1DAEA 2Q29A 3BEOA 3OF3A 2XRZA 3O2NA 4D8XA 3EDOA 3FX2A 4LOLA 1ND6A 3HKCA 1VL2A 3CEJA 1UZMA 3V2GA 3AVVA 2PWAA 4ARBA 5FV4A 4LPKA 1R5OA 1D6NA 3L8ZA 3FETA 3B6EA 4OATA 2FPWA 1GGHA 4QTZA 3S3TA 5SYAA 5EOVA 3V1NA 1TAHA 3K9QO 4DADA 2VBIA 4A1OA 3JPWA 4ZT3A 1J8QA 4D4KA 3OUTA 3WDLA 2I76A 5JNVA 1B2LA 1R0RE 3LPMA 3R2JA 2NNWB 2CFCA 3UMRA 2O2ZA 4RMNA 1QRUA 4G5FA 4J7UA 4JYCA 3B6IA 5CJ2A 1AMOA 4Z0NA 1T9ZA 2V0NA 1L7NA 3LC0A 2JRCA 4HWKA 3QF4B 2EJUA 1RI2A 2VHEA 4KN5A 3E5MA 3D8BA 4KQHA 4LV5B 4ALLA 3KQYA 2ONJA 3UK1A 1VLLA 1OWMA 4MVJF 3PF9A 1TUGA 4OHWA 5C52B 3C6YA 1UT5A