4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
b'MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
3KVVA 1JE1A 1Y1TA 1PW7A 1TCVA 2AI1A 4F3KA 1A9QA 4E1VA 2I8AA 1PWYE 2Q7OE 5B7NA 3T94A 3FB1A 2HSWA 3UT6A 3BSFA 3C74A 1Z33A 1PR6A 5JPCA 1U1EA 1JDSA 4F3CA 5C80A 1RSZA 4U2KA 3KU4A 4H1TA 3KUKA 3PNPA 2HWUA 4NY1A 3O6VA 1YRYE 2B94A 4YMLA 3KVRA 3KVYA 5KB3A 3OZBA 1A9RA 3NBQA 3K8OE 1ODLA 4R2WA 4TTAA 3FWPA 5B7QA 1OV6A 1RXUA 5CCEA 1PR5A 5DK6A 1QE5A 4F2WA 3UAZA 1OTYA 2A0XA 3UAXA 4D8VA 3OOHA 2H8GA 1T0UA 2XRFA 2A8YA 1Z5PA 4QAQA 4L0MA 4TXNA 4WKBA 3OF3A 1LV8A 1ECPA 1YR3A 4GKAA 1M73E 2QPLA 2ON6A 4L6IA 1Z5NA 4LDNA 1RXCA 4M1EA 1JDUA 1Z5OA 1T8RA 5F7OA 4PNPA 1LX7A 4QEZA 1XE3A 4F2PA 1T8SA 4QASA 4R2XA 1ZOSA 1V48A 4QATA 3OZDA 5CXSA 4F1WA 4QARA 4D8YA 3DDOA 3PHCA 4L5YA 1Z34A 5CYGA 2RJ3A 1V45E 1K27A 4WKOA 3UAYA 4DABA 1RXYA 1B8NA 5F73A 3KHSA 4GLJA 3DP9A 5F76A 1JDTA 1A9OA 3E0QA 1I80A 1Z38A 2P4SA 1Z35A 4TYMA 1JPVA 4YJKA 1PK9A 1VHWA 1RXSA 3DPSA 2OC9A 3UAVA 4NSNA 1V41E 2PGAA 1TD1A 3EUEA 1RT9A 1Y1QA 3P0EA 1Y6RA 1SJ9A 1JP7A 2GUWA 3DF9A 3E9ZA 5EUBA 5F7XA 5I3CA 2A0WA 1SD1A 4OY3A 1V2HE 2I4TA 1VFNA 4X24A 5EPUA 3PNSA 1ODJA 3IEXA 4LNAA 4D9HA 4BMZA 1ODKA 3U40A 1K3FA 4GLFA 4FFSA 1OVGA 1PK7A 3BGSA 4OEHA 1RYZA 4TS3A 1A9TA 4DA7A 3LBAA 3ODGA 3FOWA 4NS1A 2HN9A 3GGSA 1N3IA 4TTJA 1VHJA 1YQUA 5CXQA 4DA8A 3BL6A 3UAWA 1C3XA 1Y1SA 1T8YA 5EFOA 2OC4A 1G2OA 4DA6A 1U1GA 5F78A 4DAOA 1U1FA 1SQ6A 4OGLA 1PKEA 4DA0A 1TGYA 1Z36A 1TGVA 1CB0A 5IU6A 4UC0A 3E9RA 3EEIA 4TXLA 4LKRA 4JP5A 4LNHA 4G8JA 1YBFA 1TCUA 4WKNA 3MB8A 2BSXA 3INYA 4DANA 1WTAA 1PR0A 4WKPA 1JYSA 4ECEA 3ENZA 4EB8A 1ZL2A 1OTXA 1JE0A 3OZCA 1PBNA 4M7WA 2OXFA 2QDKA 4JWTA 3OZEA 3PHBE 5F7JA 2ISCA 5F7ZA 1A9SA 3GB9A 4GMHA 4DAEA 1ULAA 3EUFA 1NC1A 4G41A 3OOEA 3IOMA 1VMKA 1JDZA 1A69A 5CYFA 1OU4A 5K1ZA 3NM5A 1V4NA 4PR3A 5IFKA 3K8QA 3LA8A 4TXMA 3FAZA 4BMXA 4P54A 1ODIA 1RFGE 1RR6A 1U1DA 1ULBA 1NW4A 4TS9A 4EARA 3EMVA 3OCCA 5FAKA 2AI3A 3ONVA 2QTTA 4MCIA 3LGSA 1PR1A 2QSUA 1RCTE 4G89A 4TTIA 4K6OA 1PR4A 3MMSA 1B8OA 4BMYA 1U1CA 1NC3A 1Z39A 4KN5A 4IP0A 4JOSA 4MCHA 4OF4A 5F77A 4D98A 1V3QE 4L5CA 2IQ5A 1JDVA 3F8WA 2QTGA 1SD2A 2HRDA 4DARA 4OGKA 3NM4A 4TXHA 1A9PA 1T8WA 3TL6A 2OECA 4YO8A 4QFBA 4L5AA 3FNQA 2AC7A 2AI2A 1CG6A 5B7GA 4WKCA 4BN0A 1OUMA 3OPVA 4TXJA 4LZWA 4M3NA 3D1VA 1Y6QA 5CCDA 1Z37A 3QPBA 4R31A 1YQQA 1PR2A 1FXUA 3SCZA 5ETJA 4MARA 4OJTA 3BJEA 3FUCA 3DJFA 4I2VA 4D8XA 5B7PA 4YNBA 1Y1RA 1Q1GA 4RJ2A 3NM6B 2A0YA 1LVUA 1K9SA 3P0FA 3O4VA 1PF7E
chains in the Genus database with same CATH superfamily
2QX8A 3AV3A 3OC6A 3QHPA 2HK7A 3EXFB 1NQOA 2J9RA 2J3HA 4LF5B 3WTCA 3NI2A 1Z2DA 2WJZB 4G9GA 1L5VA 4LC9A 3FDXA 4F3KA 2R5WA 4NWIA 5THQA 1M5UA 3HNOA 1EGQA 4KE8A 1NT2A 3IQGX 4AY3A 2I8AA 4KW7A 4A16A 4NEQA 4E4YA 3KT6A 3DFIA 4AL4A 1EBBA 2XB6A 5HZMA 2V7WA 4EEKA 2H00A 4IOMA 4JUAA 5TVGA 3I92A 4UU7A 5FO1A 1N77A 1WETA 2ZQYA 4FW9A 2JFQA 3HP4A 5K51A 1BYUA 2N75A 4LRYA 4MUYA 3EJWA 5DP2A 3REGA 4EDFA 3FCSB 3W5DA 1U2DA 1Z33A 3A9SA 2GAOA 2Q8NA 3F2VA 3NQ41 2GAAA 5K6AC 3VI4B 3DAPA 2O2DA 2JLBA 5FUWA 3AI7A 1L7OA 1R5BA 3ZUGA 3AQIA 1OCEA 1YKFA 5IAOA 1KZGB 3IE0A 5DM2A 1HQCA 2QZSA 4YASA 1I4TD 1G4HA 3TQOA 1W34A 1MC5A 4IDPA 4J7AA 3B1KA 5EESA 4P8RA 2CZQA 1E4EA 3CS3A 4DREA 2AVNA 4ZVVA 3W5VA 2QV7A 4JR0A 1LZLA 3BHMA 3L6BA 3MERA 4C5BA 3EOBI 1SK9A 2ODQA 4B6PA 4JH0A 3KX2A 1L8QA 3JARB 4MMXB 4OHFA 4HLQB 4R16A 2O3RA 4YRCA 4DYHA 3U6BA 2N3ZA 1IXSB 1NNLA 4R83A 4M7PA 1OXSC 5J5CA 1P2FA 3Q6NA 4X7RA 4IVNA 4PSCA 4MCAA 3U7EB 2GB4A 1JXQA 3BTUA 4FK8A 4PZEA 4G36A 3RKSA 1UQTA 4HFNA 3O8RA 2GYUA 4DIBA 3NO4A 1AZSC 3K70B 3BA1A 4J0KA 1AKUA 2HWXA 1BKDR 1YNSA 2TMGA 3FIJA 5FOUA 4QHSA 5CMLA 4YPOA 3THRA 4CV2A 2HW8A 3C3WA 1YS9A 2QXUA 1ZW1A 2O7SA 4JI5B 1RP1A 2ORWA 4ILEA 3G3EA 1EJ6A 1XZGA 3DMGA 1CUGA 1L3CA 1YBHA 2DPYA 4GL4A 3QWHA 3ZKWA 1XJWA 2BE7A 1CJKC 3VUFA 2JAWA 3GJ7A 2XV1A 4UTPA 1DMRA 2RK6A 3HHPA 3LS2A 4ZWNA 4D8VA 4MS4A 4R1SA 1EEHA 1OV4A 3OOHA 5KQGA 1X1BA 1J2TA 1YKGA 4Q3OA 3NDJA 5EZYB 2AN3A 4QBFA 4II3A 1VXOA 1IZ0A 4QECA 4UJ5A 2JHCA 5C4GB 2Q1XA 2CVOA 4D3FA 2BW0A 2EC5A 3RRNA 1DDIA 3QFSA 2GPJA 4IGIA 4QA9A 4H1WA 1JJFA 1K4YA 1SIBE 5G53C 4EZBA 4MQEB 4XVQA 2JCBA 4AF8A 4EX6A 2DWOA 2FSSA 2OZPA 4PBTA 2ORED 5JAIA 2X5KO 2HDHA 5B55A 5I7WA 1YVDA 1ND5A 5C51B 4KXYA 1SCDA 4GLBA 1Z5OA 1NX9A 2MYPA 4KXUA 4LSWA 1T6YA 3OQPA 4C5AA 5MHTA 2QR3A 2JHPA 5T4EA 3HCAA 2W6IA 2Q1YA 3M6FA 2XMDA 4MVJI 4ZYYA 1ZNYA 1DTWB 1RXEA 1X8XA 3EAFA 3IO3A 4M54A 4ARZA 1NXWA 3GJZA 2ZYVX 3H4VA 3RYHB 2RKBA 4V0NA 4RHEA 1RYEA 4MJXA 2ZSBA 4L5BA 4UMFA 1QH9A 3HN6A 5BV0A 4BGDA 5FYDA 4B0OA 1Y3CE 4REQB 1LNQA 3DZGA 4B4VA 1XMSA 3AI2A 1QLJA 1L4NA 3GHYA 4GE3A 5JNWA 1R6DA 1V48A 3NV9A 2PTHA 4AURA 4A8PA 3TRIA 3G2LA 4JLUA 4JC0A 2W83A 2QMEA 4KN9S 4IUDS 4FGKA 4P31A 5DNEA 3STVA 3A1DA 1LPPA 3PZRA 4AN4A 5FDFA 1RZRD 2Q3HA 1RPZA 3LCMA 2ZR7A 3C6MA 1W1WA 5DI3B 3GJTA 3PNOA 3RASA 2RONA 3T6KA 3M9WA 4GYKA 3RSCA 3WY9A 3ANNA 4U5QA 4CGZA 3ZE7A 1E1QD 3OMXA 3B70A 3WLAA 1H2ZA 1ZNWA 1NVGA 4NJEA 1JAHA 1Y82A 1VBKA 2EBFX 4FKZA 4N8EA 2A9OA 5HHTA 2VSXA 5LYYA 4EVIA 4GI7A 3LUFA 5BWMA 2C1ZA 5EHIA 1PE0A 5CU7A 4CIDA 5IYZB 3HJRA 3MCUA 3VR6A 1AB6A 1KYTA 5F9HA 4OAOA 4D56A 2NMVA 5I7OA 2JW5A 2WB2A 5HJ2A 2WJIA 2EEZA 2VFAA 1CZOA 4E7OA 2E6UX 3SFTA 5ELXA 1CYDA 3E3LA 2Z98A 1G20B 1NN0A 2H3HA 1YI1A 3RV4A 3NBFA 4PO9A 4PSUA 4U2GA 4KAAA 3ELDA 1PYOA 4L07A 4TT8A 4KGDA 4LYYA 1HEIA 1ETUA 2F62A 1DADA 1UBUS 5CAEA 3JTMA 3ENWA 1BFUA 4A0HA 3TD6A 4V03A 1Y6RA 1TMKA 2QU7A 3CPJB 4REOA 2I1VB 3HJUA 2P1DA 2FQWA 4C0BA 3JQAD 1E1CB 2EW8A 4YWJA 3C3EA 2QN3A 3PQDA 4LAFA 4M1KA 2FEWB 4O59O 2ZI6A 2W8BA 1S8FA 1SCQA 5DHQA 4Q48A 2HIGA 4E11A 2EL7A 2VS1A 3LFTA 5DM1A 5EPUA 4BLUA 3VZPA 3K32A 2CMKA 3TAXA 4FJ1A 3H8SA 2AWOA 4HXFB 1CUJA 2O2JA 4INPA 4QFCA 1AS3A 3ZZMA 1Y98A 4RJJA 1GTVA 4NBWA 4FLFA 5FL3A 4PF1A 3KFLA 4FGWA 3DZFA 1T3ZA 3T5TA 5DASA 2PBFA 2JI7A 2MTBA 3ZY4A 1PZGA 4FN5A 1NR1A 4AKEA 4X60A 3LX6A 3FJYA 5EWJA 2J3QA 3IQEA 3JD0A 2ZIXB 3PYXA 4W5WA 3V33A 3L02A 4HLUA 4X66B 1MXFA 3Q1KA 2H63A 3P32A 3OY2A 5D3ZA 2OPHA 4IV8A 5FF9A 1N3IA 1HDZA 1YIOA 5BSTA 3OFKA 5HBRA 5K3DA 2E6KA 2CXTA 3SQXA 3LCUA 2PXHA 4B3XA 1NSTA 2COUA 5AKJA 2EARA 1GXSB 1SKQA 3OU2A 5A0FA 4ZJUA 5CXQA 3TPZA 4IIHA 1R4NA 4ZEOA 1N2EA 4KMSA 5SZHB 1AXRA 5AVYA 3VJRA 3GG9A 4L8LA 3O74A 3TLGA 2QTCA 3VH1A 3ITDA 5JVDB 3FCEA 1P5RA 5K09A 3OT5A 4XSHA 1SHUX 4P4UA 3W04A 1C3OA 4NFYA 3E2MA 4YCBA 3WQBA 2HT1A 3TSOA 2VBIA 1H65A 2YFYA 3OEHD 4XE5A 1ZHFA 2WTUA 1R9JA 1RC1A 1KYZA 5AJWA 5KUTA 1A2OA 4D4IA 2QTAA 3KL4A 1SQGA 3AVOA 4B4WA 1SBHA 4LRWA 1HE2A 1WEHA 3OH8A 5IXSA 4IO1A 5JZBA 2WWIA 3ICOA 5HIMA 4CMIA 4CT4B 5SY6A 1DQYA 3CO5A 2VNIA 3IP5A 2UDPA 3RKUA 3L1JA 4B7AA 4RTNA 4TQUS 2RCNA 1LPBB 1Z36A 4QSHA 3ZE2B 1JFVA 3CWQA 1GL6A 1P4HA 2XITA 1LC0A 3LUJA 2PX5A 5ALVA 1HETA 5TGZA 1J5XA 2REQB 2OZVA 1ZH6A 1FJXA 2Q8QA 4EMSA 1P5ZB 3Q15C 1CP2A 2C5BA 3PRHA 3AF2A 4OXKA 4Y2HA 3TRHA 1K5GA 1QJCA 2FFHA 4M0UA 1KOLA 4S1OA 3DOUA 3BILA 3DOFA 3ME5A 1XI2A 5FOTA 1MZVA 3ZU5A 1XLUA 4OI0A 4U2DA 3DL2A 3VZCA 2ZS9A 1DC4A 3WX0A 4EKYA 2YHBA 1NBIA 1Z7YA 4OA5A 3DFMA 1UBLS 1SVLA 3LTNC 1HNXB 2K2QB 4RDHA 4O2RA 1QHEA 4P58A 2Q7DA 4AY4A 1AKQA 3OOSA 4N5IX 4BJHB 1W88A 2A59A 4HNUA 2ZYAA 4BNUA 1Z3CA 3JQ7B 2A3RA 1XT6A 1K6MA 4OU4A 2R4UA 2JFWA 2PGLA 1OYOA 3LKBA 4HO1X 4PWYA 5DLPA 4XVHA 2B25A 3O3NB 3W34A 2Q6VA 1KYQA 3T5PA 1Z4MA 3GGDA 4BVHA 3CGWA 4HDNA 1DRVA 4P4NA 2NUPB 1H1LA 4BX0A 3L1UA 2I65A 3UPTA 3DOHA 3HCWA 3OHSX 1Q3KA 1N2XA 3QELB 1QVRA 2H1WA 3CRW1 4Z9AA 5E2AA 1YDFA 2X76A 3ND6A 5I4BA 1ORRA 1THTA 2VYFA 4GXRA 4MHOA 4R8KA 4BB9A 1ZH8A 4ZKDA 4M38A 4M0MA 2JJ2A 1KO1A 1JDNA 3BK2A 2D1RA 2QD3A 3R0XA 4PCAA 2A5YB 1DNPA 2REOA 3ETDA 2D00A 2VTKA 4AS2A 3GRUA 2XQIA 2IVFA 4I46A 2C88A 4FBLA 4B3GA 4BLVA 3VFDA 2VF7A 1QYDA 4FCWA 5EGNA 2H1RA 5JO9A 1K1EA 1ST2A 4BLOA 2J5BA 4RAOA 1EXDA 3JALB 1ZH2A 2OHXA 3WB2A 5KU1A 1ACJA 4QOSA 2OEPA 4LY0A 5H3CA 1I14A 3X0DA 3U81A 1SKYB 3F0TA 3O7MA 2BR4A 5AK0A 4QGAA 2IH2A 3GUHA 4YJ2B 3WYDA 1D6JA 1U4SA 3CA8A 1BWRA 1HYBA 1NW9B 4TS9A 1CIPA 5HA5A 1IFXA 3UJHA 1AMOA 2RHWA 1ADCA 1Q11A 1HTTA 1C1XA 1EFKA 1TO2E 4DHWA 1N3YA 1T9DA 1O6GA 1Q0HA 2H54A 2VDKB 3VC7A 1JVNA 3GFGA 1M7HA 4CFYA 3LT2A 1ZN7A 3IKMB 2XZLA 1VIYA 2PSHA 2HK9A 3LPCA 3N2IA 3SI7A 1UEJA 3WLKX 5JSZB 3LF1A 4ZVQA 2FEOA 1PR4A 5LZ7A 1EP2B 2BL4A 2H4HA 2WTMA 3GNSA 2V74B 4CM6A 4FT2A 5T64A 3TBKA 4FYIA 2ECFA 4CQLB 1JTVA 4URYR 1O0SA 2BM1A 3A4LA 2ZIVB 3DMTC 3GYGA 3N2KB 2EW1A 3UGKA 5JDCA 5FR1A 1CSEE 2PMFA 4QRDA 2AFIE 1UPTA 3D4PA 2NO9A 2VAXA 1GCOA 4UDYX 4ZEWA 3V7NA 2ZRPA 3DCIA 2XYVA 1WWKA 1JDVA 2XECA 4FWBA 1PDOA 3EGVA 1LDNA 5KYTA 3W5AA 2MIIA 5EQTA 5EQFA 1Y8CA 3ASYA 5KYGA 4IGKA 4TYNA 4W5NA 1ZGCA 1M83A 1Z6ZA 1DZ3A 4Z54A 1I4OA 2XCLA 1BS1A 4MR9B 3TL6A 3L07A 4W1RA 5HF8A 3ZDFA 4XWOA 2X9GA 1N5DA 3GT7A 1KO7A 1T8PA 3BB4A 1E8NA 4HEQA 2FSIA 4WMLA 3LIIA 5SY4A 2C4NA 3E9MA 2ZGVA 2D5AA 3BD7A 4JSRA 1RQ2A 1PJ4A 3VYSB 4EMTA 5C32A 1R6TA 1ZFNA 4Q24A 3SX2A 3U13A 2O2ZA 5C1IA 4BQOA 5B7GA 1W0CA 2OCGA 3E5HA 1W9MA 1NKVA 1GZ3A 3X1XA 1DBQA 4BMOB 3RR2A 1PJ3A 1EJ2A 3FPCA 3AY6A 2PVPA 5IW8A 5DNUA 2P75A 4Z9BA 1CEEA 2HJSA 5ALNA 1EUDA 1K4KA 1YL5A 2IPAB 1X1SA 4K9MA 4AP5A 1JV2B 2J5RA 1ZOPA 1J1ZA 4YFYA 1LK7A 2O8FA 4QQ8A 1NIJA 1TCAA 2FETA 4Q05A 5CLHA 4LVNA 3GEEA 3GUZA 1GLGA 2AL7A 3CLRC 1MJ5A 4RKWA 3BVPA 1M7BA 2GN1A 2H65A 3C3CA 3OF2A 4GUDA 5CXXA 1PR2A 1CJCA 4HPXB 4KQMA 1L7XA 2E5FA 1FXUA 2V1XA 5E4JA 4PAQA 3CXRA 2IEAA 4MARA 3OSUA 5C1BA 4I6JA 1G8GA 1PTJC 2OR3A 2QN8A 2J9XB 2XTAA 3CF4A 3EFBA 3L0SA 4YFVA 4E5KA 4ZCIA 3JWIA 5ALFA 1G21E 3ZUPA 5JZVA 1GTRA 3AEKB 1FSGA 2C04A 3L4KA 2ZANA 4LN1A 1GGVA 1YOBA 3GQVA 2P5SA 4IDAA 2R11A 1GU7A 3E7PA 3IODA 2HO4A 5HPYB 1YRLA 4AUEA 4E0BA 5BXYA 4O4LA 4I50A 4BMDA 2PJRA 4BFZA 4GPEA 1W4CA 4I66A 1R00A 3X2EA 2YWBA 3QTBA 3EUWA 1BDIA 1WO8A 1TFUA 4LBYA 5K0SA 1CLUA 4WA8A 4F8EA 4F86A 3NAZA 2OLJA 3GRRA 3IA7A 3R6WA 1FSZA 5CFNA 1Q1ZA 3BORA 1DUSA 3C7AA 5ARCA 3V42A 1RHKA 4A3SA 3EXIA 3AFHA 1Y4DE 3QVMA 3HB1A 4FNMA 2TSYB 4CM3A 2Q5HA 3E4DA 3E8XA 4WOJA 1Q6YA 1CF9A 3NBXX 2IUFA 4BO1A 1ZAYA 4RPJA 1QV9A 1FVOA 1AIPA 5BURA 2I1QA 5BN3A 1TO6A 1BGVA 4YCSA 3B6JA 3TQQA 3QQ5A 4JYZA 3UB3A 3S55A 5FTWA 1J70A 2Q7OE 3S2SA 5LIRA 2VH2A 2A58A 2ZZNA 4O5OA 3LBHA 2V5VA 5IC5A 1ICIA 4GGPA 1QIKA 2KSQA 5ESXA 1BE6A 3VSDA 4YR9A 2W2NA 4NMHA 3FGNA 2FCAA 2DGDA 2QT9A 4MQFB 3EA0A 3EF3A 1TAQA 4EA8A 4PLPA 1QRRA 2RDMA 3IAS6 3CHYA 3MD9A 4PYRA 1C9YA 2WQZA 2B0CA 4RIIA 1TK2A 1YA4A 4W6ZA 4UATA 3PWZA 4L3OA 1GWNA 4PONA 4ZREA 4B73A 5K8JB 3HCDA 5FFFA 2HL6A 5CUQA 4G97A 4NZ9A 4I8XA 3CMCO 3NC1C 3WP1B 1FP4B 1SKYE 2X6TA 3DUFA 5CBKA 1WHTA 2YNMC 4PLZA 2FVXA 1VMEA 2HPZA 3CPHA 2ZXFA 2XE7A 1HYGA 2C99A 3O75A 2YZ7A 2JAQA 4P82A 4ID9A 4ZCSA 1DU4A 3A3PA 3AVQA 1LBIA 1SCJA 3AI3A 1A82A 3FPHA 5HQJA 3TQRA 3QVGB 5HF9A 4DDWA 1BWSA 1Y5MA 2A9VA 1KO5A 3TXAA 3O6VA 5IF3A 3B48A 3BFVA 1ZM3A 2V55B 1IG3A 3UUWA 1JF8A 2FW0A 5EE5B 2X1MA 1WBDA 4QTUB 5KB3A 3SF8B 4JYBA 6PFKA 4O4IF 3TAHA 1JBEA 4TV8F 3UC5A 4Y0NA 5DCUA 4BMVA 2H3EA 1L0BA 1BMTA 1OYYA 4PC2A 1DXOA 1U1IA 1QAMA 4CMIB 3QEMB 3E48A 2PGXA 3K8OE 2GT1A 2F1IA 3R7WB 1LFAA 1VJ1A 2B83A 3AJRA 2HPVA 1VE7A 3W5SA 2F9FA 2VJDA 5TQ0B 3R0IA 4MYHA 1BVRA 2XDAA 3S1AB 3X2SA 1EGVB 4OH1A 1NJ8A 3UC9A 4EY3A 5T41A 3ZJTA 1EDDA 3FCUB 2FQQA 3DB1A 1WXFA 5A5EA 2EKDA 1OZFA 3FSGD 1YR2A 5DTQA 4ZVMA 3WLMA 8ADHA 2RC6A 3AFGA 1XVAA 3RS0A 5AVWA 2XUKA 3T9DA 2W6NA 5JWHA 5JXWA 5LP6B 4AZWA 2G6BA 5AW3A 3TMAA 3B20A 1PS8A 4MI1A 2OUKA 3IUEA 3WGNA 4TTRA 4EZIA 4XWWA 2J9ZB 3H97A 4XYMA 5C9ZA 1OPXA 2WWTA 5HKBA 1TL7C 2HADA 2QM7A 4CIBA 2CY0A 1SXJC 2Q41A 3SSOA 4DUPA 4DWWA 2OAP1 1OX6A 3HCPA 2CDCA 2XB8A 1DIAA 1TF2A 2V6IA 2IWHA 1UUFA 4ZGBA 1N6NA 3LC0A 4QPDA 2PZJA 2BHLA 5U1PA 3ANTA 1M73E 3W79A 3EWAA 1DRJA 3AUTA 4WJLA 2FMIA 4TYYA 3QWFA 2QPLA 3GMIA 1SUEA 4B9EA 4DV3B 3KOWA 3ZLBA 3KJIA 1DQRA 1AKYA 4ND6A 4F85A 4YCNA 1RWKA 1FDVA 3K4HA 1ZIXA 1AG9A 3BN3A 3CIFA 4QM6A 2E4VA 4IYRA 4GH5A 4V1CA 2W11A 2BLLA 5SZKB 5J2UF 3TE7A 4UOZA 2AOUB 2H5JA 3U4GA 2O8BA 4WNIA 2PO5A 2GCEA 1N9GA 2C2BA 4BHTA 4ETNA 2AW3A 2V3VA 3PUXA 4DQKA 5IAKA 2PUEA 1RWXA 1NBMA 2HF2A 3UA4A 2C8KA 4TT3A 2O1XA 1AC5A 3LU1A 4PNZA 1JR2A 2X3UA 4WN3A 1DWQA 2VZLA 1KHHA 3ABZA 4G5GA 4V3BA 4QTYA 4YPVA 1TF5A 3DTNA 5KYWB 5M2QA 1EE9A 3C1TA 3PFFA 2LD4A 3GEHA 5DYYA 3KZOA 4JYMA 5FKJA 3THXA 3D6UA 5KNCH 3H8JA 2CNOA 2GARA 2KYRA 3TVYA 4RLQA 3A2MA 3U9TA 1NVVQ 2P2DA 2VJAA 4M36A 3RHFA 3U7QA 1CFJA 1YVPA 4OO3A 4TL6A 4RVSA 1GOTA 5FPTA 2PUAA 2BH2A 1MB2A 2JZOA 1NVAA 2QQGA 1KK0A 3RNOA 1VE9A 3ER6A 5FA8A 2QQ5A 3AUKA 3WO1A 3GWGA 3OC0A 4QDKA 4GKJB 1ZBDA 3KB6A 4TLCA 4FUQA 2A5DA 1YRWA 1SCAA 4BWYA 1MXHA 5HCNA 4C88A 3WAGA 3OZAA 4MPDA 2JB9A 5C2JB 4F3NA 5AOAA 3UAYA 2VYQA 4HLDA 1IIRA 4J03A 4NH4A 4QVGA 3KCNA 4MAMA 2OYSA 1FZQA 5AKKA 4J7XA 4J1NA 4FDUA 2J0SA 3WHIA 4JLSA 4K88A 1NYTA 2VWGA 3RYHA 4QGGA 1QX4A 2WD8A 4FT4A 5SY9A 4FLEA 3WXBA 5B64A 3VNVA 4UULA 4Q3BA 3WIDA 2I8CA 5K0BA 3ONDA 4I1IA 2X22A 1GILA 4PIVA 1UZMA 4NQRA 1DXHA 4C29A 4KACA 3PITA 5HZGA 1YDWA 2TYSB 1UJCA 1B41A 1GRCA 1ACLA 1EFPA 2QV0A 4GOXA 4KYVA 3ICQB 2VHUA 5DOVA 3LOPA 4BKPA 3TQHA 4N5MA 1EG2A 4QM7A 2GHQA 1Q17A 2I2XB 4J1SA 2AZXA 1VPVA 4U5XA 3C8DA 1U7ZA 2ZSFA 1SCNE 3U0BA 4UTZA 1PWEA 4MUAA 1ESCA 3ICVA 5AK3A 2Q27A 3OCYA 5B1SA 1PS9A 3P0EA 4CMBA 2GCPA 2AB0A 3EQ2A 4WOBA 1JP7A 3RH0A 4BLQA 3OOYA 1U31A 1I33A 4JL8A 1KVSA 3WL4A 2JJ8A 1ZCFA 1GSHA 3FE2A 3GU3A 3HJCA 4I5EA 4IEIA 2A92A 4CF4A 1A0OA 2VH1A 3K9QO 3G1TA 2J3LA 3LPNA 3MXOA 4RLSA 2GWRA 2PGDA 2AN9A 2INGX 1AT1A 1ZKMA 1AE1A 3EN0A 3WLPA 4BFVA 3S1LA 4GGOA 4HEJA 3SJ7A 2W42A 4DLWA 4A6PA 1ODKA 3DSRA 3EQ7A 3AY7A 5CT8A 1EEXB 4GLFA 2DAPA 2QRNA 2OVFA 4MRSA 1N7HA 1JDJA 2AEMA 2XVZA 4Q4HA 3CIOA 4A92A 3ZJUA 2BFDA 2I4MA 4DC1A 1JJBA 5BPFA 3KYIB 4UKDA 4MROA 3KJHA 4JVOA 4LRUA 4HQNA 5EJIA 3ZDYB 2NUTA 4CU5A 3ESQA 4Z4IA 1XWWA 1IATA 4M1MA 5FV7A 4XB6B 4XLZA 2MJLA 1RBQA 3L8HA 4IJUA 4NYMR 3ECAA 2X4GA 3EXEA 2JKVA 4HH3C 4B2IA 3T1QA 1JZSA 2AOVA 2P9HA 5EOVA 4CMEC 1J2JA 3G0BA 2ZTLA 2HWYA 4NL4H 3KAQA 3I8OA 4TPKA 1GFSA 1NATA 3AEXA 4ABYA 2JEYA 1QHGA 1X7ZB 2VRBA 3DQZA 3OJCA 5TR9A 4BRUA 1TAUA 5ICCA 1L7VC 1NAHA 2IYWA 2PS9A 3ET5A 1NZJA 3KALA 4J9UE 3I9FA 4I5GA 3WZMA 4HDQB 4C0JA 5TQJA 2CN1A 4D0GA 1GKYA 3CTPA 4BP3A 1ZGHA 2G7ZA 5LQRA 1B2RA 3H99A 4UUNA 2J4CA 2R8RA 1KKLA 2IZZA 3DV0B 2H2IA 2O5CA 2I0FA 2J3KA 4UMEA 3ZN2A 2GYYA 3CCBA 4N03A 1KK3A 1PKEA 4EHFA 1YZQA 1XDWA 4EPVA 2GN8A 4LJAA 4ALLA 5IT4A 4BYGA 4OQFA 1OXUA 3ZVLA 1ZK2A 4BO8A 121PA 1D2NA 1HDCA 2OV8A 3L4BC 1AD2A 4TS4A 3SSAA 5DM60 1JHXA 1NU8A 4F72A 3HY6A 3N74A 2VK4A 4GZ3A 1DIHA 4ESOA 4B4OA 2JPDA 4FU0A 4ENPA 3U80A 5LC1A 2C8LA 5F35A 1MHPA 3T4UA 2LGJA 4OHCA 1OWMA 3DZHA 3FBTA 3SF0A 4EM6A 5I7FA 2VJOA 1F8YA 1QR6A 3O3MB 4CVNA 4ZYVA 3EXHA 4TMYA 2OK8A 1GAQA 4O5AA 3NH6A 4H15A 4HB3A 2HLNA 4DRZA 5JVDA 5EE1A 3RS4A 3M3PA 1Y6GA 4FZRA 1ADYA 3AVXA 2ANBA 2C29D 1CQZA 3M4JA 4X0EA 3EZ2A 1VHQA 1FDUA 1MNAA 3UMCA 4K9RA 2ENWA 3ZDCA 1Z5UA 2NZ2A 2WMNB 3UWSA 2GF9A 1QBKC 1OTXA 4YTEA 1MRZA 4L95C 1P61B 5BQ5A 3O0DA 2P5UA 3RRXA 3QWIA 4D8UA 3L4SO 3OUUA 5DE3A 1YZVA 1D8AA 1PBNA 1RRFA 5DTJA 3PRYA 1PFWA 1UPXA 3WSVA 1I7NA 1QTIA 4HXGA 2DQKA 3IMKA 1XXLA 2G1UA 1JFFB 2A9JA 5TJHA 4AJOA 1H9BA 2IYLD 4DNXA 1XFAA 2XOKA 2FG7C 2XWBF 3OFND 1EHCA 1C9MA 4QX6A 1N92A 2SICE 1E1DA 2REXB 1WZNA 4ND8B 5LL6P 3B2QA 3O8QB 3HA7A 1T2DA 1ZCJA 2IEYA 3CC8A 1VYHA 3K8YA 4FN4A 1KYXA 3RYFA 3GOQA 1KEPA 4U00A 1VPWA 2C9CA 1BN7A 5FL7D 1AGYA 2V7EA 2QYOA 3U9SA 1QYXA 1JDZA 2Q07A 4D3SA 1KFEB 2C2HA 5AR1A 5EYPA 4FD2A 4U02A 5JHGB 1JYEA 2HFJA 4XVCA 2HJHA 5D5PA 5F2OA 5FPPA 1T9KA 3NVKI 4C0AC 1L5SA 5FCDA 4DMMA 2DR2A 3SIPA 1I5RA 2HMYB 1AN9A 2D0DA 2XOEA 4TQAA 4U7JA 2JVKA 3FVRA 3CEHA 3SX0A 3PGJA 3VVCA 4NZMA 1K0UA 1SELA 3RWMB 3N8HA 2ZEJA 4W6QA 4ZHSA 2XBMA 2YN4A 1WEKA 2JIPA 2X9VA 5KJ1A 1TLLA 3CH6A 3O3OB 4OHOA 4M0CA 3DLIA 4TLLB 5CPBA 1W5BA 3PC4A 1R0LA 4WDQA 2YC2C 3WB9A 5K0ZA 4EARA 1YD7A 1DDOA 4PR0A 4GQBA 4UTRA 3LDGA 4AJ9A 3UH1A 1WSBA 2W6CX 2AI3A 3ONVA 1AQIA 3RVNA 4TKUA 3CR8A 2FP3A 3NFRA 4L6AA 3L1HA 3W4KA 3PHJA 4ALIA 4QG3A 3RIXA 3EDRA 3OP4A 4H0NA 2OP0A 3HJBA 4PZUA 3RSHA 1VCNA 4QUJA 4F6RB 4ZK6A 1ECFA 2UAGA 2Q6TA 2APJA 2P90A 2V59A 4OHZA 3FF4A 1WCIB 3OJXA 4X65B 5EMHA 3KQQA 1U1CA 6AT1A 1ZU5A 3NGMA 2HQSA 3RYIB 1QE3A 3S27A 1Z39A 3D3NA 1G8AA 1NLZA 3NANA 4C1NA 4NBSA 2B5WA 2I4IA 3HMQA 4PBSA 4D9IA 3HVIA 3HI6A 1VMDA 3MT9A 1ISPA 3PIRA 4Q6WA 4PANA 2REBA 4QGFA 1OA0A 4YJ2A 1ABEA 2A9RA 4QDXA 1G8KA 1DB3A 4KO1S 3BH0A 4XDYA 4ZOEA 3U4AA 1KH1A 4UOEA 1XPUA 4CGYA 1ZUNB 1U7UA 2EZTA 1XZHA 1W5TA 2IYTA 2ONCA 5DBFA 2BMEA 3K9HA 3ZNQA 3FPEA 2P2GA 1PGPA 3W5UA 3ETCA 2FEMA 5KIAA 4MGIR 3C6BA 4MV4A 4OATA 3WBFA 4MIYA 1NI4A 2BMAA 5IJ0A 521PA 1WB9A 2ZYWX 4XLTA 3EIOA 1KHTA 2B9VA 4PCLA 5F3DA 4XPZA 4ZHQB 2CLLB 3WISA 6LDHA 1A4RA 4Z4EA 1WNTA 1U5BB 3Q7TA 2AI2A 1BXRB 1QGED 1UM8A 2WIGA 2ZFUA 4JBHA 4Q3EA 4EB6A 3Q6IA 4LQDA 4RLFA 5KQRA 3GLGA 3SMQA 2AZMA 3HADA 1YQWA 1UZLA 3GZNA 3OPVA 4QU9A 2FFBA 4D43A 2GO1A 3KQNA 2CV0A 2CLOB 3HKCB 1BYIA 3H8VA 2GJKA 1LLDA 2GRAA 4I7EA 2JFFA 5TPZD 3VA7A 2PKXA 3IUQA 3ZOKA 1E60A 1LSSA 1HEUA 1F1JA 2XIJA 3CNEA 3PT5A 2O7VA 4O4JA 3HDTA 3LGAA 4ALJA 1YK1A 2IZ7A 2J45A 2QUJA 5FUBA 3U0VA 4MP8A 8ATCA 4KIUA 3PFCA 4QDZA 1KU0A 2GILA 2X0NA 1P39A 3A9CA 4KIJA 4EZEA 1OFHA 1W9HA 3JX9A 3KNZA 5JZSA 1W0KD 2E1RA 2XMGA 4PSDA 1NRWA 2GHRA 3TGLA 5CVUA 4LGCA 1FTQA 2IZ5A 4FDVA 1DEAA 4QICA 3H1AA 1QGUB 3FTFA 1YS6A 1Z2AA 1FQKA 1K6IA 2JBAA 1Y4UA 2Q0SA 2F1OA 1HG1A 4KGXA 4NE9A 4OAPA 5GOTA 3WHKA 3WC4A 4C7BA 1HC7A 5BW8A 2H7VA 1QANA 3DZKA 4GM4A 3WKBA 1R6AA 5BSWA 4B81A 1ZITA 2OAGA 3JD2A 1V3VA 3LP5A 4KWTA 4TV9F 3NGXA 4ZOCA 1TW2A 3AX6A 2BBTA 1DAIA 3B1FA 1UBJS 3B7WA 1XZJA 4GNKA 4Y9UA 3S2UA 1OZAA 1CUIA 2ZREA 1ZK4A 4BE4A 5KTRA 3RYIA 4GPD1 4H16A 4LF8B 4IQFA 4R8VA 2PGIA 5J9FA 3UT0A 2JGJA 3IH5A 4R3NA 5G3YA 4X62B 1SKMA 3A0RB 4UM7A 3EZNA 3DDWA 1ORIA 5IM4F 2OM6A 3M33A 1MG5A 2Z4SA 4HBZA 4NS4A 2ZPAA 3G7NA 5IC6A 2GSDA 3EB9A 3EZFA 4ER6A 2FE4A 4MX8A 1JG3A 1E62A 3AEKA 3NXKA 4HZGA 3T94A 2FN9A 2QUIA 2WABA 4UMVA 2OCIA 5A7GA 1DC8A 3UT6A 1VPLA 3AFIA 4MQ5A 5IWCA 3PKZA 4WGGA 3NX4A 3J81A 1YU6A 4WBNB 3T3PB 2BFBA 3B12A 3WYBA 4F38A 4NXMB 1F8FA 5EHXA 1A8UA 3WKAA 1E18A 2XWSA 1R6BX 4BE9A 1TVKB 3DDNA 5JPCA 3GH3A 4KQ6A 1J9GA 4OREX 5DTEA 4F97A 1DPGA 5CA1A 1WV0A 5E7QA 5A9SA 4F3CA 4A23A 5EN4A 3AT1A 2DCMA 1RLJA 4JXKA 3EVBA 4U2KA 3D4LA 3TW4A 1Z16A 1L7PA 1T43A 3BFPA 3JZDA 1ELOA 5I9IA 3KUKA 4D7AA 1GNTA 1KQPA 1I32A 3IDAA 5BUSA 1JT9A 3DLCA 2PZKA 1BW9B 1HURA 5M3BA 3VR1A 5C7IO 1I36A 1WSAA 3MINA 1QHIA 2IIVA 3SZRA 3F6EX 4DDMA 5K3EA 1YSCA 2AFHB 4YCDA 4DM4A 3G88A 5EWMA 1GQFA 1E9EA 1TA4A 4QG7A 4YGYA 5FJJA 4Y8VA 2Z95A 3RTCA 4LX0A 3JATA 1J97A 2C1XA 4PZYA 2ID7A 1ARZA 1RIFA 5I5GA 4MQFA 4IG4A 3GBSA 4G56A 3TM4A 3VJMA 4FHCA 2X8LA 4DRYA 1RDFA 4WNAA 2MU1A 1NVWQ 2Z2ZA 1DQNA 2OV1A 1AZTA 1O7JA 3ABOB 1LI5A 3IJEB 2CHVA 3QPAA 3NYQA 1QE5A 3ED5A 4V24A 3ST7A 1QWSA 1GPBA 3UXYA 5BQXA 5AVQA 5KWVA 2P1RA 3D5EA 1RQGA 3ZD8A 4E2ZA 2SCUB 1R0BA 4QXPA 4Y2PA 4DQXA 3UCEA 3R3YA 2B69A 2YUIA 3L5KA 4ZV7A 1Y6ZA 2A1UA 1HYEA 1VBNA 3KKNA 3SYMA 4RX1A 3KEOA 4J91A 1ISFA 4A1FA 1VIMA 3I0ZA 3VR6H 2FE1A 3C2QA 3DLTA 5CD1A 4QAQA 3G68A 3QE2A 2XQVA 5GZ6A 5BW4A 3COYA 5FPQA 3V8RA 1YC2A 4PZLA 1USWA 3NTOA 4Q4JA 2YVQA 4C76A 4CUKA 2R00C 3BE5A 1UMCA 4U2EA 3WGJA 5DNYB 3FMOB 2YXBA 3PQEA 5CGQB 5AH0A 1MEEA 4N8SA 2R6DA 2CDAA 1WMDA 1T5LA 3I09A 5AP9A 5K3CA 5KHLB 2ACEA 2AOXA 4HWPA 1UP6A 1PL7A 1YK0A 2Q3FA 3HB4X 2W70A 4IM7A 5K4GA 1OFTA 4Z4FA 3OTHA 2VJMB 4XAQA 1M8PA 1HQKA 5BN5B 3G5UA 1NNSA 3FGZA 1RAAA 1T25A 1AHPA 3EISA 1VTKA 3PQ3A 3R3ZA 2X0FA 3DEFA 1OW3B 1THMA 3BH7A 5DHRA 3DBRB 4WLEA 4B82A 1N8NA 1XNRB 4L2IB 4R2XA 2SBTA 1KXJA 3CQ9A 1US8A 5HGXA 4K2HA 2B92A 1BRMA 3JVVA 3PWTA 4OJYA 1KOFA 3L4EA 3HBMA 4CLOB 1E1RD 2Q1TA 2JGMA 2GK3A 3PUZA 3QIAA 2IP1A 5CXSA 4MO2A 5CR9A 4KHZA 4QULA 1IM2A 3RU7A 4ZYUA 1UPCA 1OIWA 3V8BA 3OX3A 3K6SB 3HXQA 4IIJA 1WBBA 1V1JA 2ZWVA 1FW8A 5ECYA 3CNNA 3OQ1A 2CHEA 1RU3A 3KKZA 3Q7PA 3LHSA 3NORA 3QOWA 4OK6A 1FLDA 3R75A 4KH1A 5FFNA 4D0NA 3QPDA 2FFRA 3JAKA 1JLMA 2WUVA 3NCHA 2OYRA 3C85A 4DUZB 5TMPA 1MO4A 1PAUA 2UZ3A 3C3MA 4R01A 4KMOA 1YHYA 5FWDA 4FMBB 4HNVA 1N0HA 4IMIB 4B84A 3K0FA 4UZSA 1V5FA 2WJWA 1D9ZA 2ZKIA 1JRLA 3K15A 5K9ZA 1GG8A 2Z6QA 4W5TA 3O1HB 4GSKA 3WS7A 1GCAA 2AVDA 3L06A 1N8TA 3EA5A 4E5DA 4BYMA 2A5FA 4A2QA 3UGQA 4QYMA 2NP7A 2X2FA 3A6FA 3ZV5A 2II6A 1K5HA 4UUBA 4Z1MA 2ZWPA 4PXAA 3R7SA 3OEWA 4FCCA 4LHZA 3WR5A 1I6KA 1IHUA 1RXSA 2HCBA 2PL5A 2QROA 1Z75A 2YTZA 3H6GA 3MC1A 4Y0VA 3DE1X 3R76A 2D7JA 1EDOA 1ZDMA 2EOAA 2HKIA 4M76B 1QCZA 3BMNA 4OXIA 3LKZA 3C1OA 5T8KC 4BFLA 2GETA 3U3RA 3LF2A 3FH0A 4PO3X 4RSGA 1H05A 3DAFA 4UUOA 3QVUA 1FRFS 3AKYA 2FPGA 2Y3IA 1A7UA 2XHEA 4X00A 5EUCA 4Q4LA 1EXVA 2WSIA 5TPWB 3S2EA 1V5IA 1FXSA 4DC9A 3HB7A 1LU9A 1V6CA 4LJ9A 8GPBA 2OFXA 2FUCA 3L7KA 1WLSA 2WTNA 2V45A 3ESYA 3HV0A 3IHTA 3RTAA 1QB8A 1PWXA 1SXHA 2HH9A 2A0WA 3DMDA 1O97D 1PIWA 3MLBA 3SVZA 1DFHA 1M1YA 1DJOA 2W37A 3F6YA 4NABA 2NVUB 3SJBA 4LVCA 1U98A 2WV9A 2WPDA 2RHLA 3I23A 3N05A 4LNAA 4LGYA 3B1JA 3M7IA 3PXGA 4J0DA 1OC2A 3RIYA 3B6MA 1LDGA 4HAVA 1QMGA 2ZJ3A 3MJTA 4ZO8A 1NJGA 4FYVA 5HCUA 3UJ7A 1KNXA 4LPSA 4Y2GA 4J6EA 5CRIA 4RVCA 1QQBA 5ALEA 3A58B 4KR2A 1QQ5A 2W2OA 2ZYGA 5FAXA 3K0BA 5BVHA 4N49A 2FSVA 4CR6A 4JMPA 2FJ0A 2AFHE 2GJAA 1PR3A 1Z5VA 1MB3A 3N39C 3VR4A 5GMOA 3M4NA 4HZUA 5C1DA 3EXG1 3JAWA 3CPSA 1EUCB 3AUJB 4J07A 3RDPA 4Q3DA 2DBZA 2YMPA 3WK8A 5CDTA 1GZUA 2VL7A 3UYKA 1LJ8A 3LLVA 4WY5A 4LISA 1N6RA 1ADFA 3HUTA 5NULA 2M32A 4BUZA 2B21A 5JTTA 2XRYA 4Q7QA 4OPMA 3WK4A 1E3LA 1XDZA 1E61A 3D3WB 4P08A 3YASA 5FUQA 2P9QA 3EPLA 3IAUA 1KZ4A 3PXBA 3VBEA 2D0PB 2CWWA 2W4IA 5LA6F 2KI5A 3H2GA 4DA8A 2JIQA 5SICE 3P2KA 4HYQA 2YV1A 4FFDA 5BN4B 3VR5H 2FLKA 2ZJAA 3VPDA 2WMYA 3M6AA 3B1ZA 3C3JA 3FOAA 3JQFC 1G42A 3R0ZA 4L5JA 4BMSA 1NBWB 1W5AA 2Y1CA 3BD6A 3MWFA 5IN5A 3DZIA 1PLKA 2UYQA 4A4DA 4BQPA 1NNUA 3SWWA 3C48A 4P7GA 2WAOA 5I6DA 2XT9A 3ZD6A 4X1KB 4XQ9A 3U17A 3LQ4A 1ILEA 2IXBA 3ZY2A 1TUEA 1EFRA 1WJGA 4D44A 3RNLA 3PEUA 4K26A 1B0PA 1SUSA 2WDZA 4KXNA 4XGQA 2PZMA 1CUDA 1ZN9A 2OCAA 4MUXA 1G5IA 2RHCA 3LNCA 1W46A 3RVKA 3V80A 4A5OA 1XPRA 1KI6B 1EVEA 1J0DA 1NYRA 1P8JA 3DEYX 4FHGA 3HJNA 1Z4QA 3GY0A 5TGDA 4AJNA 3EVNA 2XVAA 2WIAA 4KVGA 3QMWA 2FVYA 1MW9X 4F2GA 4CM8A 4P3XA 3CUYA 1DJLA 3AHEA 2KHZA 5C8YF 3SZGA 5KJFA 3FYUB 4EA7A 1PJRA 1RLTA 1ZU4A 1U7PA 2VHZA 3FNHA 4DPMA 3I28A 3E7WA 1V6SA 3JQ9A 4G6ZA 2M98A 4NH0A 4D6YA 1LBTA 3GAMA 1QZXA 1TCCA 2ZBPA 5KTNA 1VIDA 1WY5A 2CEAA 1TEHA 1MO2A 4LMBA 3F47A 1JDBC 4JJ6A 4FIDA 3DV0A 3I39X 1FY2A 1ZL2A 4JCCA 3VYRB 4FI3C 2X1VA 2TRSB 3ESAA 4IIGA 3FYCA 4RXTA 2GXQA 2FUG6 5AKLA 5LMZA 3O2NA 1X9IA 3V2GA 5CB4B 1UJ2A 1YE3A 3R74A 4Q1CA 1FX1A 3DO8A 3AB8A 4P3NA 4N0QA 5C1PA 2WICA 1SQ5A 3CG0A 4CUZA 2PT5A 3WYGA 1ZJ6A 2WVJA 4DG9A 4GGMX 3CZ5A 2BFEA 4F4CA 4IRXA 2YKGA 3K1TA 4QXOA 5IUJC 5LDDC 3H2ZA 4QVIA 4FI3F 3TMKA 2DLCX 3KSMA 3SKXA 2AQIA 3HG7A 4Z3OA 4JLBA 1JQAA 2PFGA 1IHYA 4K6MA 1NXVA 1IN1A 4CJXA 4D9JA 2JIRA 3KPVA 3CLUC 1EUYA 2P6NA 1FMFA 3HJFA 1QU3A 3LUGA 2I87A 1GNPA 2JFZA 1PT6A 3AERB 3BWXA 3HDYA 2H2HA 3G79A 1D03A 4G0XA 2Q4EA 3ACBA 3LVFO 5CX1B 1HYQA 3BMQA 2LIPA 2PR2A 2PFKA 3IEKA 4JD5A 4NNOA 4RK0A 2ID4A 5T3YA 2AG1A 1R7RA 4HY3A 5ESRA 4CIVA 3U3OA 5K3OA 1KEEA 4JOBA 2RAPA 1XRRA 3QENA 1S3FA 2MYUA 2QTLA 3DOJA 1D9XA 4L5IA 1U2GC 4L7QA 2O48X 4WZAA 3NAGA 4YJGB 4BQNA 4JYAB 1N3LA 2HHLA 2XKJE 3GZTB 4B3JA 1ESEA 4YV7A 3SFVA 4B6GA 5EHZA 1WB6A 2WLTA 3AUXA 4B6JA 1E3EA 2GPSA 1BOOA 2OOKA 3VPFA 2DFNA 2EX1A 4Z7NB 2PLRA 4CQMB 4F06A 2DH6A 3QKSB 2EFCB 3EMVA 4KMRA 3AIKA 2FEKA 3F5MA 3DNPA 2VSFA 4ZOLF 2X8JB 1UXKA 4NIMA 4BUCA 1P1FA 1ISSA 4BMPB 5JH7B 1COWA 3DVLA 2BLNA 1BMDA 4UJ3A 4CMGA 2I2DA 1OT5A 4G89A 1AQJA 2P6MA 2Y1EA 2VDRB 2XVMA 3PXXA 3ZIAD 1NONA 2PQMA 3L6RA 4KB5A 4RVNA 2XZOA 2BY4A 4KQ1A 2XB2A 4L4RA 5JDIA 3BGWA 1U28A 1DTSA 4Y6QA 3RRYA 2WQ7A 3H3FA 3NJRA 1C4OA 3B1XA 3ASZA 1DS6A 2NXWA 3ULKA 5CEFA 4FDAA 1E3MA 1JA9A 2WAMA 3GV0A 5AW0A 1YQEA 3TCNA 4DXDA 1LUAA 1T0BA 5LLDA 3NDRA 5JD4A 2ZR0A 4FPXA 4LWQA 4ZRMA 3D6AA 1BEEA 1H2XA 2XRMA 4OF4A 1VYTA 3V8EA 5JNLA 4L5CA 3U7IA 2H31A 3PE6A 4M7RA 4TZTA 1TM7E 2CJFA 3QHAA 4KR9A 4MOWA 3FJOA 1IQ0A 4Z53A 4W5OA 1GAJA 4MQUA 3EZGA 4ZQGA 4HWGA 1Q16A 2ZOSA 3AJ8A 1PBTA 3FHTA 4AJIA 2O07A 3OZSA 4JWKA 3PX3A 1CJMA 2CJYA 1GPUA 1JQ5A 4FQ8A 4RENA 5REQB 4EQZA 1RKUA 1YF3A 4AIRA 3DT8A 4GKKB 2MR5A 4ZQIA 1FYDA 1CJTC 4AJEA 1L2TA 2H2FA 2RAFA 4FDLA 3IVGA 1JLLB 1QR2A 2R1ZA 3LXUX 1CZNA 4NTZA 1UP7A 5KU7A 2WTEA 3ANXA 3QLUC 3PWKA 5A4MS 1ZD3A 2BMWA 1QNFA 3M3DA 3WLFA 3JV7A 4BN0A 1UWKA 1RXIA 4WUVA 3I1JA 4HGZA 5LB2A 2YUTA 3GFOA 3D0OA 4MVJF 3H11A 5CDFE 4MDYA 5KNDD 3EEBA 2UVDA 3MSCA 3FNBA 4D02A 3I4LA 4DMUB 1C8VB 4MUMA 5FWXA 1DX4A 3HBLA 5CM9C 4EJ2A 1EKXA 1NUUA 4M3NA 3EOZA 3DT9A 3TD9A 4YCMA 4DJJA 2BTOA 3GLUA 1E4OA 1EGMB 1GPKA 1B1CA 1HDOA 1MABA 1Y6QA 4G1EB 5DEOA 5ALLA 4Y9RA 3ZHZA 3H9QA 2QD5A 1NOKA 4BFYA 2QRLA 3VTKA 1UQUA 3VU1A 3W3AD 2Q3BA 4ZZIA 5LB4A 4HDSA 3OTGA 2WBLC 1UJBA 3KHKA 3QLVA 4Q0MA 5IVIA 2BBWA 3OZWA 4HDKA 4GXQA 1Y9ZA 7GPBA 1Y1RA 3ESXA 1CBUA 1HT3A 1Q1GA 4ZV4A 3ZE0B 4A0QA 4R3WA 3WWZA 4OX9Y 3WJ2A 2GCOB 1RYFA 1X3SA 1ZD2P 5IJZA 4CE6A 1M6WA 1RVDA 4RMHA 4F92B 5SZIA 1F60A 5JYEA 3ON5A 2RH5A 1E20A 1JL3A 3TLMA 5KYYB 1GRVA 2EV9A 2RGNC 2CFIA 1JMVA 4OFXA 3UK0A 2B3TA 5IBCA 3WQHA 2ODPA 2WM9B 2O6HA 4C2AA 1G38A 3NHPA 3S8YA 2PNJA 2P9ZA 5AKHA 1HFWA 1GFIA 2VATA 3C5WP 1G4UR 3U6KA 3HO1A 3QW4B 4DQVA 5HRUA 3WWYA 4UPEA 3GA5A 5J1TB 5LYJB 1ILWA 1ENPA 3I4FA 1Y5NA 4PPGA 5AVKA 2BMDA 1WIWA 1XMXA 3R0JA 2X3FA 1G7CA 2E87A 5F1OA 5CW1A 1D5CA 1O03A 2VBCA 1OJLA 2XW6A 3BIXA 1JHDA 3EWNA 5DLQC 4YT2A 2IH5A 2FKAA 3TTTA 3FOEC 1UMDA 4CI0B 1FZTA 3A1WA 4M9RA 1JECA 1DO2A 3CRQA 3FDZA 2GS9A 1JQKA 4AULA 2QRHA 3SXUA 2LDXA 3UK2A 5GTDA 4L75A 4HGOA 5A4KA 1NXQA 2IOYA 4F4FA 1P0IA 3A2LA 3P97A 4I99A 2PIDA 4G1CA 2AS0A 1BXKA 4DHEA 1M6VB 4OGWA 1KVUA 4OSEA 4OSPA 1GRQA 1XMIA 4O4HF 2EKQA 5FWAA 4BAUA 4DMHA 2PEZA 3DOIA 2AT1A 1OB5A 1JIIA 4MHTA 2Y4NA 3OKPA 4IGEA 4E5VA 3VZDA 2ADMA 2I99A 3T4EA 3TUJC 5HZHA 2DFPA 2IP2A 1V47A 1DAMA 5KTYA 1Z2NX 2EX0A 5FD8A 4F9GA 4X7MA 1XLTA 5L7TA 1WCYA 1EWRA 4NONA 3DMHA 3IIIA 2BGGA 3ABQB 4H2DA 5H68A 3O1IC 2XAAA 1LNZA 4CUJA 1KAGA 2QN1A 5GY7A 2KLBA 3C7CB 2O57A 1FF9A 3L7BA 3OPMA 3K4PA 4D4MA 2RBKA 1N57A 3KVYA 4HGQA 1ZI9A 3KSRA 5E9JA 4MRAA 3RFCA 1IUOA 4E3WA 4XLLA 3MFQA 2Z8XA 5DYIA 4Z5XA 1PNOA 3MELA 4GBGA 5JS6A 3BXPA 5JADA 3HS3A 1K92A 2QSYA 2P9GA 1QDEA 3Q6MA 4JT2A 3S99A 1GM5A 5CFRA 2AUNA 3ANSA 4Q1EA 1W6UA 4UEOA 3A9VA 1QKJA 3O2SB 4HRAA 4J9VA 1P19A 4XWTA 5DF1A 1Z6YA 1H8EA 2XUQA 4H3SA 4N3GA 1Q7RA 2MYTA 5BVGA 5E2IA 5K2MA 2P41A 1CT9A 3B9RA 3QJ5A 5B30A 4WEQA 4LNUA 3CO0S 5K0CA 2V7QD 3UAZA 5KX5B 4DCCA 3UMMA 4RDXA 1DBVO 3D8TA 1IPFA 4HB0A 2Q6LA 3L01A 1Z7WA 3PKJA 5ES4B 3A2KA 1D0VA 1GU0A 1KKUA 1T3TA 4KLNA 5G4LA 1J23A 1DSSG 3RREA 2C9BA 4N0MA 2ZJ1A 2QP3A 3P20A 5AK4A 3CX3A 4RC9A 1UPFA 3EC1A 3NUQA 2HXSA 5HWSA 1SK8A 2C83A 1MIOA 1E1MA 1KS9A 2OBMA 3OIVA 2AJ8A 4DDVA 3D0QA 5TJ9A 1D6NA 5HKKD 4OI1A 3WWEA 1IJFA 4XM0A 3V7WA 4BWFB 3O3CA 2OBLA 2WDPA 3TCXB 1SXJB 2QX7A 3ZNOA 2CLMB 5G4KB 1YR3A 2QAIA 3D8SA 4B34A 3N2ZB 3ZE8A 4LYGA 2CNLA 4BZXA 4L76A 3G2OA 3L77A 4KKXB 1SVUA 4LDPA 4TWAA 4NZOA 3W9SA 2VA8A 4B1FA 4EFNA 1HM5A 5IDVA 4L0CA 2ZBDA 2XMSA 3C16C 3GT3A 5CVTA 5K0GA 4XQGA 4EI2A 3ZPXA 3ZDBA 5AFSA 1TECE 4HI0E 4EEXA 2JCSA 3IAM1 2HRCA 1U02A 3L1VA 1XAJA 5COBA 2XSZD 3MTEA 3VH3A 3H9UA 3RK1A 5JYBA 4UMDA 3KUDA 3RAFC 1YKSA 1DI0A 1Z17A 4RE6A 4B2PA 4D1YA 5DN6D 5C18A 1M76A 3BCSA 4OQ4A 4QYXA 2CMHA 1F2TA 5AKIA 1NN1A 5FNVB 2D8AA 2EG5A 3WRYA 1MAWA 2G28A 3HKDB 4H3HB 1DCFA 4LE0A 5H82A 3ZV4A 5CBPB 3AHCA 3GO4A 4MV7A 5JYCA 4ZD6A 5G0WA 2B1JA 1B00A 1EJ0A 4H27A 3GGPA 1RZRA 3U4IA 4QARA 3WRWA 2ACKA 2Z30A 3HN2A 1W59A 3B13B 2Q45A 1T4CB 2H5EA 4HWTA 3KTAB 1V8DA 1NVXQ 2E2WA 2RJ3A 3FRHA 4R9VA 5IBPA 1M1UA 1W44A 4M0FA 4EYGA 2OWDA 3HCOA 4G1MB 3RT9A 4DABA 1C8LA 4CIWA 4XVUA 4GUAA 5J4HA 1RI4A 1KK1A 4GLJA 5L45A 1HL7A 5BN5A 4DJAA 2VHEA 5KOHB 2AHOA 2CNKA 5DCWA 3E0QA 5H81A 1SUPA 4JK3A 4NDZA 1S7CA 2XLBA 1ZM7A 4RESA 3DBRA 1N5JA 1XRQA 4YJFA 4OOEA 5H16A 4AI6A 3KWJA 3G5AA 4J0EA 1U3GA 4CR7A 1C7FA 2KJQA 3HY3A 3FLBA 2IEDA 5K7SA 1R3DA 1H6CA 4FBMA 3UAVA 4CLOA 4UBKA 1Q7EA 3JQRA 4WFJA 1UDAA 4PBRA 1E64A 4IY1A 5G0UA 4XCXA 3STWA 5JISA 1SY7A 5BMVB 1NMZA 3K6SA 1F0PA 4EUFA 2FEXA 1VM6A 2XR1A 1NTRA 5A04A 4MWGA 1QGDA 4RSRA 4D57A 2WMOB 1QG6A 3ND7A 3PC6A 4UEQA 5HP4A 3JPWA 4JIMA 3V8MA 3TD2A 3J7TA 1AB5A 4CTOA 3JQAA 5F7XA 2NO7A 2HJ9A 3B2EA 5EIXA 1JKFA 4Q1FA 5J59A 3VNQA 4JFAA 4R1QA 1X1QA 5J3JA 1VFNA 1GN8A 3O9VA 5AJXA 3S2ZA 1OIXA 4MVJM 4CCYB 2GOYA 5LZ2A 1YTUA 3FBGA 3K0AB 2PHZA 3EVFA 2I4RA 2DWQA 3R7NA 3V1MA 3KU1A 3U40A 3COJA 1I5EA 1K3FA 1I3NA 1SUAA 2NTYC 4MPJA 4MWSA 2NTEA 3VHRA 3T61A 5BNFA 1G8HA 1WXHA 3LM8A 3WYEA 3NHBA 3VKGA 3LE8A 3BT7A 4ZI7B 4MINA 3PV0A 3WDKA 4M0EA 1K8RA 2HJGA 3PJFA 3RUHA 4O0MA 4CQMD 2YIVX 4LRXA 2AR9A 1N5LA 1OFGA 1U7OA 4UVEA 5TPWA 1XDBA 1YS7A 3GBPA 3P9IA 4RUKA 5AMXA 1ORDA 1I3KA 3RSOA 1NLUA 2RG1A 2HN9A 3A10A 4B5LA 4UD2A 1ADJA 4BB0A 2I3GA 4BN4A 4A6EA 3WP0A 1GFWA 3V4OA 1NMYA 1DKOA 4G5OA 3CX8A 3TPCA 3KQVA 4R3UC 5IKXA 3BXEA 2GTPA 1KJ8A 2HC9A 2NVUA 5TY0A 1RPTA 2V98A 1G3UA 4G4JA 2JFOA 4JR1A 3BL6A 4UCFA 3U1BA 5DXAA 2NZYA 3NT5A 1Y1SA 1GD1O 1RRMA 2ZSHA 4GRDA 1F3LA 3SYLA 2YJNA 1KFCB 5H9VA 4AZ3B 2OC4A 1Z62A 2VNKA 2Q1UA 3GXBA 4BLPA 4CPDA 2BDTA 3JQBC 1PL8A 3U4HA 3K1YA 3CISA 3OEHA 2R66A 2VDPB 4U9IS 4AKIA 2BZ0A 2GX6A 1CEQA 1SXJE 4JXJA 4PZ9A 5H5JA 1V8FA 4JS0A 4U6QA 2PXCA 3E27A 2A5JA 3NNDA 3VHXB 2XDQB 2XF8A 5I01A 3TTUA 3HCBA 4Z7QB 1EVJA 2C42A 3SEAA 1DXYA 1YB2A 1EX9A 3OA0A 4S1NA 1LJUA 1PL0A 1C30B 1TGYA 1O08A 3T9FA 4KU4A 4GVPA 2NSYA 1UBTS 3ZDDA 1FXWF 3EF1A 2ZJBA 5GONA 4LDZA 2GPBA 3UATA 4LDJA 3VAZA 1DC5A 2WHRA 1B6TA 3NJ8A 4HQKA 3MT0A 2WEKA 1B0ZA 4KSYA 4KRYA 5J2TB 4R8MA 3QTTA 1VE1A 2VXYA 5K01A 1ZGGA 1K68A 1KMCA 2QVZX 3GRZA 1TT5B 3KHUA 4OK3A 4PX9A 2QLFA 3H2YA 4B3BA 1F7UA 4F4IA 4RL6A 5JCOA 5DMXA 3FHCB 4MR8B 5JAOA 3MG9A 4MJLA 5CG1A 1DAKA 3OP1A 3Q3EA 4ZAGA 4AYWA 5D7NA 1DWOA 1SU6A 2IXFA 2CFCA 1IXYA 1BXZA 1F1BA 3F7TA 3KV1A 4CEJB 4JA0A 1UKBA 4BV2A 4FGZA 4DBVO 2BM9A 1HX7A 4UM9D 3IQZA 3PEFA 1XTRA 2O3SA 3GPBA 1NUSA 1U2DC 1SAYA 2C5FA 4FE3A 5FLYA 4PE5B 3A4NA 2MINA 2EF1A 1VKZA 4A8JC 1CQXA 4B3CA 3A14A 3CLRD 4LWOA 1QS0A 4RLHA 4E5YA 3RUCA 1Z0FA 3OZEA 3TXXA 1R6XA 1K8ZB 2VKTA 4NEGA 5EP2A 2FPOA 1UK9A 3IUYA 4X5OA 4EPRA 3M89A 2XTZA 2P62A 2QD2A 4LJ6A 4RIHA 2R6JA 2W98A 4GOMD 3IC5A 4XB2A 4KQ2A 4JBLA 3P2YA 4L1KA 1MLDA 4MVJG 2M6LA 2JATA 3WNVA 1I6MA 1JSRA 3LLCA 1GQ2A 3HFRA 5B4VA 4D3ZA 5ITVA 1JAXA 1E2MA 3N8IA 1YS2X 4PRLA 3OOEA 2PIAA 4IJQA 9ATCA 3D8UA 3USES 2CNWD 3BFXA 3GR6A 3LK7A 2VDWB 3ZHVA 1QU2A 5CFPA 2Q2QA 5JWOA 2QGNA 3LZCA 1D2CA 5B1IA 2IS2A 3U62A 5IS2A 3KBOA 4HK4A 3O5AA 3M1LA 4FOLA 4IIFA 3OLYA 1CETA 3IEMA 3LI2A 1F8UA 1TK9A 3BM5A 3HKBB 4FONA 1KGDA 1ATZA 2BI7A 2CMFA 2IX9A 3AILA 1KEKA 2C3MA 3TF5A 3LA8A 2XUFA 1C8BA 3QJGA 4E13A 1DRUA 4EY8A 3LQRA 4XWAA 5CB4A 1IJEA 5EIBC 4YAJA 5G40A 3T5GA 4ZALA 4HGRA 2JFBA 2X5JO 4KLZA 4IPTA 5A3VA 1VA5A 2AOTA 1RTKA 3C4QA 2Z6UA 2EKBA 1PL6A 2CJPA 1WE2A 1B16A 1Z73A 3HWSA 3Q9LA 4LVUA 4XR9A 4H3KB 5E7IA 4C4SA 4ZQFA 1F14A 4K6FA 5TQ2B 2HV9A 4AUNA 1U65A 2AEJA 5EP1A 1PJQA 1QHFA 1F4PA 1QQ7A 1T5SA 4FHFA 3STXA 4A27A 5LUAA 4KR0A 1CJSA 3DNMA 4LHXA 3P0JA 4URUR 2GKOA 3WWCA 4IKPA 2LXNA 3AERA 3N2LA 1NQXA 2PV7A 3MJSA 4PIMA 5LD2C 3ZQJA 3HCRA 3QSGA 4X7PA 1KDYA 2ERXA 4KV9A 4DQ0A 4EGAA 3OKCA 5CX1A 5BR4A 3NBAA 4K5QA 3AM4A 3Q8LA 1LQ2A 3KLBA 5BWLA 4KGZA 4KO4S 4JVSB 4XOIA 4JX8A 2Q5OA 2IDMA 3VO8A 2YNMD 2F48A 4Z7JA 4D45A 5JTUA 2V7UA 4FS8A 1BD3A 3QBEA 4L72A 3EHEA 4JJAA 4OHXA 2Z3ZA 1EFLA 2G8LA 2WSBA 1E6CA 3NTXA 4PRZA 3ROKA 5CB6A 5KHOC 3NHUA 2OCDA 1V4VA 2C0QA 4X7BA 4EB3A 4UHFA 4L16A 1Q1AA 4FFOA 1D4FA 3BCRA 3D8BA 4NOJA 5GM2A 2SKDA 3F6SA 2BDUA 5HJ5A 4GZ5A 4ZRNA 3NBKA 4O2AB 1TUBA 4OGKA 2GBGA 3BWYA 2AZDA 1T9BA 3SQDA 4ALNA 3KJXA 1FRZA 5K4AA 3HXTA 3QY9A 5FTKA 3L8YA 4QNMA 5DNWA 4F4DA 1JB1A 5BQ3A 5BUQA 2V4ZA 4TRNA 4UTOA 1XTIA 5BQPA 3V00A 2OKCA 4M99A 1CVLA 2OD2A 2YZ2A 1Q83A 2P65A 3HPQA 4BP8A 5DLEA 3UNXA 2P91A 4DIEA 5K8LA 1T5OA 3WOVA 5BSGA 4JENA 3AGQA 3H18A 3CF6R 1IK4A 2A9PA 1TKAA 1X39A 2YZMA 2R1VB 4YEDA 4Y6RA 3T15A 3GC6A 4OLJA 5DGCA 3Q8WA 4OKNA 2YN0A 1VSUA 2A4MA 1H1DA 1YCHA 1XD2A 2DFDA 3AEQA 3KR2A 1KP3A 3OF5A 5JY1A 1M0WA 2XMRA 2UXDB 3RRZA 4YDSA 4YP5A 4ZGWA 1AZWA 1WW3A 4LKOA 1A98A 4EFLA 4P4SB 1TJ5A 1JJAA 3PEEA 3R77A 2R85A 3P2JA 3I2HA 1NV9A 1RQRA 4NZZA 4EHJA 2TMKA 1PEDA 1F12A 5J40A 2X7XA 5AHRA 3PCXA 3GLRA 1U8UA 3CKLA 3TQSA 2UUCB 5A6SA 1T9GR 3QF7A 3R09A 2WU1A 1C7JA 3AOGA 3MVEA 5CLGA 4E1AA 5JPDA 2ZI4A 1UAYA 2QA5A 2QLJA 4QBHA 3T3IA 3JVEA 1ESDA 4A91A 2PUTA 1ZJWA 3LDUA 4WBXC 1QIJA 4BXOB 1L7NA 2RG7A 3F67A 1QH8A 3B8HA 5AW9A 4C4TA 1EESA 1YAJA 2IV3A 3I2GA 1RABA 1LBHA 4KE6A 4CF5A 1TO1E 4MW7A 2CDNA 3MFYA 3DOEA 3O4VA 2C2ZA 2NADA 2HLDD 1EGAA 4B35A 5TT0A 3RW9A 4YI3A 2BBOA 4MDHA 1T91A 3ORYA 3LY7A 4YJ3F 1WQ4A 3FWZA 1ST3A 1N2OA 1P17A 3L0BA 3H8WA 1T1RA 2QTBA 2WAXA 2XTNA 4X8HA 1OJ7A 5CA0F 1NI5A 3TW8A 2XVYA 4PN7A 3KETA 2BEWA 2I4OA 4II2A 3L0YA 4ZICA 2G1KA 5ARBA 1P9LA 4C03A 4CLHA 1S1MA 3X1WA 4WW0A 2FN7A 2WWVD 3Q8XB 5JANA 3V97A 3DVSX 2B8TA 4LZJA 1HG0A 2V7XA 3MCAA 3BE6A 1EUQA 2LZ0A 2GCOA 1ZEJA 2BH9A 4J1TA 3I01M 2J6IA 2BJVA 4FILA 4UNPA 3H17A 4BNJA 2QLBA 2QP4A 4LBZA 4B79A 5KYKA 3RC8A 2B99A 2IFTA 2D0OB 2VK2A 2ZIGA 1MV5A 4HLUC 4FQ7A 2RHJA 4H35A 3ICEA 3W2HA 4PHHA 4NCAA 1QTNA 4RIEA 1F5SA 1B15A 3BQMB 3CE9A 4MO9A 2ADFA 3LLSA 1C9KA 4DRXB 4F93B 3F1LA 1E69A 3CURA 2PVSA 1EVQA 2YR0A 3I45A 4R4JA 3QOYA 5GVSA 4FDMA 5LYJA 5ALKA 1OX4A 2J59A 1V95A 3NR2A 3QEJA 4MPRA 1GTG1 4H1TA 4MWDA 3MWEA 1BN6A 2RGUA 4RJIA 2P2ZA 1ONBA 2O0JA 2W5UA 4FS3A 3UMFA 5TX7A 4O1MA 2PZAA 2EKZA 2FR8A 4QEKA 5EJ6A 2A33A 3W90A 5HS4A 1E2DA 2F9MA 1E5DA 2H1IA 2BFMA 2HHJA 2DF8A 2VUUA 4UHKA 1MOQA 3C45A 4D42A 1E5VA 4W9MC 1FP1D 5DWDA 1BCRB 2JAPA 1TJPB 4TUYB 3F7OA 1YO6A 3V3KA 2QMHA 2ZB4A 3W1EA 2JAHA 3W0LB 4HH1A 4O2BB 4AG5A 3BF7A 2PH7A 2VZ0A 3K92A 3A05A 3KT8A 4ZMSA 5KQSA 4N5HX 5SZJA 3CKKA 4YVFA 5JSFA 2O8CB 4J16A 1NT4A 2F3TA 1V1RA 2XUZA 5L6LB 1F51E 1H4QA 1KDVA 9LDTA 2IBMA 3NVDA 4S12A 3I5XA 3A3OA 1QIMA 1MO3A 5TMBA 3FSGA 3QF4A 4IR7A 5D3MB 2OB1A 3H9BA 5T3UA 1GZ7A 1K86A 4E2XA 2RK4A 2E3JA 4X84A 2IU0A 1C1DB 4AZ0A 3CUUA 2RH8A 1VSTA 4OUDA 2RAUA 5BNZA 3PUKA 3FOCA 4MUNA 4C6TA 1GO2A 1FTWA 1RKXA 1UIRA 4IIVA 4ZA2A 4ZKEA 2PZBA 2VTBA 4HUJA 3UFXB 1J22A 1LW6E 2OFWA 2AFIA 5F2KA 3RC3A 2OPBA 3VXKA 3RS5A 1M8JA 5LLTA 3C5HA 1R2QA 1XL1A 3ES9A 1U3WA 3K7EA 2D1TA 1XG5A 3A6HA 3BZUA 3QY0A 3P9PA 2W43A 1E0SA 4ND2A 3CRVA 1AQUA 3LA6A 4AMZA 1ZYUA 3BEOA 1IN7A 1T2UA 3DGEC 1M7GA 5H1YA 4EMBA 5LNK1 3H2KA 5LU8A 5AM1A 3P4YA 3C3KA 3SX4A 1EA5A 1IXKA 1BD4A 5CVJA 3LG2A 3V4SA 4BCCA 3IOEA 1J6UA 3DS8A 1XRJA 4CV0A 4FHEA 4C3OB 1FFDA 1EG7A 3CZPA 4BKQA 4BNMA 4RULA 3IIMA 1TYAE 3ZWKA 2G04A 2V3WA 3GA0A 1SC4A 3GLHB 1OA1A 2QJFA 1RMTA 2R6R1 4UE6A 1JILA 2B82A 1FFXB 4AJLA 2P9TA 3KELA 4IXDA 2SHKA 1W4LA 3JSAA 3OZFA 4DSZA 1N6IA 4ZP1A 1AXEA 1NHGA 1Z0IA 1BFKA 2Q28A 3SC2A 3C4JA 3PJGA 2OZLB 4M60A 1E7YA 3JQPA 3RLIA 3LHFA 3VZBA 3LBFA 4ILKA 5T57A 5HW0A 3LBNA 2PT7A 1DPFA 4TRMA 5DW3A 4ZZ1A 5I3ZA 2WWRA 2Q3CA 5K20A 2UUBB 3UWKA 3DBOB 3TUZC 2CWDA 2HBQA 2VWHA 2J3JA 1JQLB 1OREA 2PRIA 3JQEA 4S0ZA 5TIIA 2WQ6A 2CL7X 4HR7A 1K27A 1W1UA 4WXEA 1LEHA 1G21A 1GKLA 3GRKA 4ZMBA 1GUBA 3QE3A 5DBEX 3VR4H 1TTQB 4N7JA 1W25A 2D4HA 2P77A 3F6RA 4GI3A 4EHHA 5JNRA 3E61A 2CVZA 1QCCA 2GD2A 3DP9A 1E0DA 3OM8A 1UJ6A 3D5TA 1UT5A 4BVBA 3DTVD 4M4SA 4RIGA 4LXUA 3HBFA 3I6MA 3PFIA 5EKDA 5IASA 3QFTA 1Z6TA 4R6XA 1OBCA 4D99A 3KYCB 1GDDA 3D7MA 4GX0A 2JDID 4IYJA 1TM1E 4X1OA 2ZJ0A 3KFXA 1AO3A 1XCPA 3B6EA 3HKDA 3E58A 2QBYB 3EFHA 5U4QA 4ML3A 2OC9A 1JEJA 4ETWA 2I6XA 1PGNA 2V8OA 3FMFA 1JXOA 1IDOA 1LRJA 4LJ8A 4PGMA 5BNWA 1B7GO 4PC6A 3K73O 3WO0A 2AJTA 1CDDA 2XNDD 1Y1QA 1PHRA 1XP5A 1W85A 3GGJA 3TSYA 1ZEMA 4W82A 1TRHA 3WNCA 2NT3A 5JDCC 1P44A 1NBAA 1MT0A 2EZUA 1CW2B 4G63A 3LOQA 2Y67A 5LOVB 3O03A 3NETA 2H48A 5E95A 3AHFA 3LWDA 3LY8A 3WIEA 1JR4A 2L42A 4C01A 3E9ZA 3TOXA 1L7BA 1Z18A 5BOSA 4LC0A 3WLTA 3DF7A 1QP8A 4IWYA 2GD6A 3QIVA 3ETNA 2VPQA 2DB3A 1J0AA 2FSFA 3X1DA 5GVRA 4HNTA 4EA9A 1RJWA 2XMCA 3I5YA 4DANA 1E9FA 4P35A 1M2VB 2WSMA 1X86B 1ESZA 5IVDA 2Q3EA 4KPYA 3GLTA 1YZFA 2DZDA 2R5NA 5BWOA 5I7RA 2ZS7A 4I1YA 1SCUB 3TL3A 2Y0PA 4FFPA 4MV9A 2B4AA 3Q5EA 1CKEA 5JNSA 5IT0A 1S2GA 4XJVA 5MGBA 1BH6A 1M2WA 4B3SB 4OBWA 1RYZA 4C06A 1Q3TA 4HDMA 1A71A 1Z26A 2AUMA 1GAEO 1A9TA 3IVAA 3KVNA 3N0XA 1HBJA 4MP3A 5E7JA 1A8PA 3BAFA 3OVMA 4IILA 1NG9A 4JXZA 3MJRA 1X74A 2FDXA 1Q57A 3QXGA 1P1RA 4N7MA 4AO6A 4KYUA 3L43A 3HNRA 3MTIA 4OJMX 4EHAA 1W36C 2Q9AA 2NYUA 2QRJA 2UZ1A 1MB9A 2ODAA 5TS3A 4BN5A 3C6KA 2X9LA 4DZTA 4AS3A 1ZJZA 2GDJA 3GP3A 2ZATA 3A25A 4JQCA 4M8IA 1TTTA 5F3WB 4HTAA 1Y5IA 3A6GA 3OQIB 4G01B 821PA 1VZ2A 2KE5A 4Y2RA 3SZUA 3IQDB 2D2EA 4WH0A 1T9GS 5LXTF 1QCYA 1T5IA 1M8GA 3V2UA 1N6OA 6NULA 4JCOA 3Q3IA 2QW8A 3DYBA 3FXAA 3REOA 2PCLA 1ZG3A 1PFYA 3Q7RA 3W8EA 2C9MA 2C61A 4Q16A 4RVGA 2D5IA 4GOND 3HACA 3AM1A 1EIZA 5CB8A 2P4HX 1SQ6A 5GJVC 3V6LA 1UT8A 4PPYA 3O9MA 1J90A 3GPIA 2Q2WA 5T6MA 4BNKA 3D0RA 3NZEA 3ADKA 3ZWMA 4EW2A 1W93A 1A77A 5DHFA 4BNVA 1YFJA 2YIJA 1JIJA 1IEWA 4KODA 2NPFA 3K2IA 5LZ5A 3NOVA 1TPYA 2WWHA 1HF3A 2P1ZA 2XE8A 3GN2A 4X64B 1E6MA 5EJ4A 1K5DA 3FSJX 3E22B 4LSZA 4S1VA 3B78A 1GGJA 1L4GA 1W87A 2HIAA 4KWIA 4LBWA 3IP3A 5DOZA 5AXCA 1A1SA 1YBMA 3HGTA 1T0PA 1TA0A 4JP5A 5DX8A 1AA6A 3H42B 4WESA 5TARA 4ESEA 5J4KA 2RARA 2QVYX 1JG2A 1UDRA 2I80A 4GX2A 5KCMA 3UH0A 2FZ4A 4V0MA 1T2VA 3RAGA 4DOMA 5FPHA 2YIMA 4MCJA 4AZ3A 2H6EA 2P78A 4TLDA 4UU8A 5CURA 5HM8A 3NUGA 2R1TB 3K96A 1QONA 1QVVA 1OE0A 5A2GA 3ELUA 4X85A 2XUIA 4D9MA 5AD1A 2DUNA 3Q2KA 1Y89A 4W7IA 3GLIB 3R7AA 1MOPA 3GH1A 1LY1A 4FYMA 1L4FA 3DBLB 4HQRA 5DIFA 4CL2A 4G0OA 3BFJA 1N5MA 3DCNA 4RH3A 2XDQA 2G9ZA 4Q9JA 5HE9A 3VHXA 3ZV6A 5D01A 3THOA 1TU4A 3H9JA 1OVMA 4TVOA 4UHJA 2OV3A 4W63A 4ZOAA 2NO0A 1XNHA 2GSWA 4CM1A 1Z08A 2VSOA 3C3PA 3DR5A 4QUHA 5CLLA 3G02A 1DINA 1TIBA 3FI9A 3OFNA 4Q18A 1I5OA 1UWVA 2H7YA 1ZMRA 2UZAA 2Z3VA 1IHOA 1AKVA 1BXGA 2Z2IA 3MS2A 4FFBA 5DISB 4YRRA 4DAEA 3SM3A 3VOBA 2EJBA 1E7RA 5HK9A 3I52A 5C8VA 1T9CA 3RS8A 4ND7A 1L7AA 1P7PA 3OUZA 3CZ4A 3FNRA 1HR0B 1RZ3A 3D8RA 3LPAA 3WQQA 1BHJA 4XGRA 1B42A 4G23A 4YUVA 5AHKA 3AF6A 4GQAA 3GLKA 3W06A 1W30A 4LRQA 1QH1B 1YHZA 4PC3A 4Q12A 1IRIA 2R6HA 4CEJA 5IEBA 4E5SA 3BGOS 3L0CA 2EDAA 3NM5A 4QYSA 1IL0A 3V8VA 3AESA 4Y1FA 4DXHA 2FUEA 1MN6A 5AK6A 4GEKA 2J3IA 1GNRA 2XGSA 3E7FA 3MT8A 3OJ0A 3FZGA 4YN3A 2P6OA 3RCBA 2FP4A 2ZRMA 4BMXA 2O3QA 3CLHA 5KMGB 5JATA 4EY6A 3EZLA 4X1YA 2GLXA 5JC1A 1JPUA 1RAFA 1AKEA 2HCRA 4TTPA 2BFAA 2NV0A 1RYMA 2FG5A 4HRXA 1BU5A 4Y6SA 3T7AA 4B9AA 2XQFA 4IHJA 4Q47A 1V8PA 3CH5A 1G1MA 1CUWA 3IV7A 1RW4A 3ZTYA 4RAQA 4EJMA 2JG3A 3THSA 2LPMA 4QUIA 1NRJB 4H1HA 5CLQA 5CT4A 2RC5A 2VP0A 3D3JA 3OE5A 3NRJA 3SG0A 4E51A 2P2YA 2IPMA 1OWNA 4YB8A 1DBWA 3QYJA 2H11A 4IUBS 5DGIA 3PGA1 2DECA 3VMMA 4YUZA 2GBIA 4IIBA 3EH2A 3AJEA 4ETMA 4UVDA 4RTLA 5CG2A 3IBCA 1PG5A 1U5AA 1U8ZA 3R0VA 4J7UA 4BO2A 5IJAA 2XUPA 1RQXA 1YI8A 4QHTA 4LJYA 4POOA 4R71A 4KPEC 1NC3A 3X43A 1WXWA 1SO8A 4XI9A 4H7KA 1DKMA 4X97A 4MS1A 1X13A 3E1GA 4WASA 4AWAA 3K70C 3N6XA 1Z22A 1RI5A 1V8BA 4KQWA 5ALGA 2GEUA 1JWBB 2B34A 2OL4A 3KKOA 4JOSA 2I8LA 1EK6A 4IAOA 4L9WA 2J4DA 1HE4A 4QELA 4XIGS 4ND1A 2ZUTA 4D98A 4Z99A 1I1HA 1NXXA 3E3MA 4LZOA 3OZ7A 4RSMA 1JU3A 2QL7A 2VYNA 3CNOA 2VIIA 3HSSA 3I3SR 4UU1A 4G0UA 4BC1A 5JFOA 3OQMA 2UV8A 3ILYA 4M1TA 3H5IA 3ZEAA 1ZPDA 2JJ1D 4QOGA 3RRJA 3QFHA 4TXHA 3GA7A 1A9PA 3NP9A 1QKIA 2OM2A 3SAJA 1RBZA 3TAUA 1TZJA 4H0CA 4NCIA 2HPHA 2M2IA 5DGXA 3ZLTA 2A78A 2RHBA 1R8XA 1NJ5A 1LPNA 1VSBA 2WA2A 3ZHSA 3UKJA 5IH7A 3U39A 2BVNA 1A76A 4QXQA 3TRDA 1BEUB 1GP2A 3QITA 5JROA 2DM6A 4LHEA 4KQGA 3BMCB 4O63O 1XAGA 4EX7A 4QZVA 1N1MA 3FFXA 1P1IA 5HUQA 5M7EA 3M5WA 5A0VA 4ATNA 3RC7A 4URXR 2PUCA 3I04M 4S2EA 4P80A 5A2QA 5EZYF 3KOMA 1J9ZA 5BPHA 2F1RA 5H59A 5CW2A 1YASA 2W2KA 2BSQA 1NMQA 5C0OE 4XX0B 4MV5A 1H3FA 2XADA 5G0VA 1HY3A 1U8EA 1CEXA 2GQ0A 4PN3A 3RVBA 3AL0C 2XUAA 5KAMA 4KAXA 1UZUA 1H94A 5EZ6B 5TPZA 4LXGA 3A1TA 1G41A 1P6XA 2I22A 2VP4A 5THXA 3ZCRA 4GYYA 1CE8A 5K99A 2N1BA 2DQYA 4MRMB 2PWBA 3G2JA 5KTOA 2X7HA 3SYNA 3SCZA 1NUTA 2B61A 3GUYA 5HQTA 1Q0LA 1FYXA 1YNOA 2NU6A 3BWCA 1V7PC 3GELA 3NKVA 4M1YA 3R8CA 2WLSA 2JD0A 1OFIA 3DZBA 9LDBA 3LQYA 3TNLA 4B48A 1UM9A 3MGKA 1W0KA 3LCRA 1S3SA 1NN5A 4G9EA 5EUMA 3WDMA 5JXGA 4W5RA 1RNLA 2A9QA 2RGBA 1BRTA 3NPAA 4WPGA 4WXYB 1BJTA 1FNBA 2XBUA 5ALYA 1J0BA 4H4EA 3WLSA 1MDBA 4D81A 5KREA 3V1LA 1Y9EA 4E15A 5DHAA 4MW6A 1QGAA 3SS9X 3A1CA 4ZCPA 4CMJA 1KETA 3TR6A 2JD1A 4BBAA 1UBOS 4ISBA 2YWHA 2C5SA 5LLSA 3VU0A 3VOSA 4MR7A 1TJNA 1N33B