4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
1Z33A 4MCHA 1A69A 1A9TA 4MARA 1U1EA 1JDTA 2HWUA 3UAVA 3GGSA 4BMYA 2AI2A 5CYFA 1RT9A 4ECEA 1VMKA 3C74A 1TCUA 4JP5A 3FUCA 4TXJA 4OGLA 3OCCA 1PBNA 4BMZA 4WKBA 3UT6A 1NC3A 3INYA 1Y6QA 1RXSA 2P4SA 4LZWA 1OV6A 3SCZA 1PK9A 4D8XA 1YQQA 2A0WA 1Z5NA 4M3NA 1YRYE 2I8AA 1PR2A 4JWTA 1B8OA 2QTTA 1RYZA 2HN9A 2AC7A 4M1EA 1WTAA 1LV8A 4K6OA 1U1CA 3DF9A 1SQ6A 3E9RA 3NM4A 5B7GA 3LBAA 3KVYA 5F7JA 4YO8A 3D1VA 4WKCA 4DAEA 4H1TA 3KVVA 1OTXA 1JDUA 1SJ9A 1VHWA 1JE1A 1ODKA 1V48A 3MB8A 5I3CA 1N3IA 4TS9A 1Z39A 4DABA 1JP7A 1M73E 5F7ZA 2OC9A 4P54A 1OUMA 1RXCA 1RXUA 4KN5A 4DANA 3K8QA 1PR4A 1U1FA 1I80A 1PWYE 1A9SA 1B8NA 4PR3A 4TTIA 1LVUA 3LGSA 1RSZA 5B7PA 3KHSA 4G8JA 1K27A 2XRFA 1T0UA 5F7XA 2A0XA 3O4VA 3FWPA 4X24A 1RCTE 3NM6B 4NSNA 1PR6A 2OECA 2QTGA 1V4NA 3BGSA 2HSWA 5ETJA 4TTAA 1Z5PA 5CXQA 3EUEA 1OVGA 4OF4A 4L5AA 1XE3A 3LA8A 3TL6A 2ISCA 1A9RA 3BSFA 1CB0A 1PW7A 3UAWA 1PR1A 2A0YA 1PK7A 1JPVA 3GB9A 3ONVA 1PF7E 4R2XA 5B7QA 4QEZA 3P0EA 4RJ2A 1NW4A 3O6VA 5F77A 3UAZA 5F78A 1JDZA 5F76A 1YR3A 3IEXA 4YNBA 3FOWA 2AI1A 1OTYA 1PKEA 4UC0A 1V2HE 2A8YA 4DAOA 3NBQA 4LDNA 1PR5A 4QASA 2B94A 1NC1A 2HRDA 1ODJA 4F2WA 4DA0A 1JDSA 2GUWA 1A9OA 1OU4A 1U1DA 1RR6A 4L5YA 4OGKA 1K3FA 3OZBA 1SD1A 4QARA 1CG6A 5K1ZA 2QSUA 4LKRA 2OC4A 1T8YA 1Y1SA 3E0QA 4GLFA 4BN0A 4GKAA 4R31A 4EARA 4OEHA 5CXSA 5DK6A 4OY3A 1ODIA 4L6IA 1Q1GA 4WKNA 1A9PA 3ODGA 4M7WA 1Y1RA 4QFBA 4TXLA 5F7OA 5FAKA 3OOHA 4L5CA 5IFKA 3P0FA 4WKPA 5EPUA 3UAXA 3OF3A 1FXUA 5EFOA 2QDKA 4D9HA 1V3QE 1T8SA 3T94A 1YBFA 1ZOSA 4EB8A 4FFSA 2RJ3A 4F3KA 2AI3A 4G89A 4YMLA 1K9SA 2OXFA 4D8YA 3IOMA 3PHCA 4JOSA 1ODLA 4LNHA 5CCDA 2H8GA 1VFNA 4R2WA 4TXNA 4IP0A 1JDVA 3BL6A 3EEIA 4TS3A 4PNPA 1ULAA 3OZCA 3PNPA 4GLJA 3UAYA 5CCEA 1ZL2A 1LX7A 3DPSA 4F1WA 4LNAA 1C3XA 4QATA 1RFGE 1TCVA 4G41A 1T8WA 4DARA 1JE0A 1G2OA 1QE5A 2IQ5A 4E1VA 5B7NA 2PGAA 5C80A 1Z38A 3EMVA 4I2VA 5EUBA 3EUFA 3K8OE 3KVRA 2ON6A 3F8WA 4F3CA 1Z37A 4WKOA 4D98A 1Z36A 4NS1A 2I4TA 3OZEA 3DDOA 1YQUA 4L0MA 4BMXA 3KUKA 1A9QA 1PR0A 1JYSA 3DP9A 4TXHA 4TXMA 5IU6A 1RXYA 3ENZA 1TGVA 1SD2A 4GMHA 5CYGA 3E9ZA 1TD1A 3MMSA 4NY1A 4MCIA 4F2PA 1Y1QA 4D8VA 4DA7A 1VHJA 3BJEA 2QPLA 4TTJA 1Z35A 2BSXA 3FB1A 1Z5OA 5JPCA 1Z34A 4U2KA 4DA8A 1V41E 3QPBA 3FAZA 4TYMA 1T8RA 3OOEA 3DJFA 5F73A 4OJTA 3NM5A 1V45E 3FNQA 4QAQA 1Y1TA 3U40A 1ECPA 1TGYA 3PNSA 3PHBE 3OZDA 3KU4A 1ULBA 4YJKA 4DA6A 3OPVA 2Q7OE 5KB3A 1Y6RA 1U1GA
chains in the Genus database with same CATH superfamily
3QOXA 1XDGA 1B2LA 3TX6A 4XZ3A 1DTSA 5DGIA 2QU8A 3CRRA 4OKSA 1YBMA 3GBPA 4NG5A 4TS1A 3SDZA 1TJ3A 5DSZA 4FK8A 1J09A 1U1EA 4JASB 4ZK2A 3R0QA 1Z4QA 4I36A 1Z2AA 3DWIA 2JLVA 3GGSA 3V1LA 3X2FA 3S1LA 1FPQA 5U9CA 1E7WA 1WA5A 2J3LA 2XB9A 4IHJB 4ZJZA 3HV0A 4H6XA 4BZQA 1Y9ZA 1WHSA 2LTAA 1UC5B 4N3GA 1XQ6A 1G3MA 3FBGA 4KUGA 3WGYA 2A3RA 2V7BA 1N8TA 1SIOA 3AXTA 3D43A 5D85A 3TJZA 4A0QA 4EG0A 1XJQA 3DULA 3CBQA 3E9MA 4MZXA 4RW0A 5BYBA 3RAFC 3RWMB 1SN7A 2PJUA 3DB1A 3SKVA 1TZJA 4MVXA 4J3NA 3WIVA 1JH8A 1HE1C 5IT5A 3I58A 3WBFA 4YCJA 4KGVA 3X44A 1OI4A 4LFAB 3N2GB 1MAHA 1OBVA 4LGCA 1AQLA 5FB3A 4FMDF 3TO5A 2EFHB 3QMVA 1ESEA 1GUDA 3T5BA 5BN4A 3OZFA 4FBGA 4N3NA 2O19A 5AVXA 1F5SA 2X2OA 3C8DA 3GJ0A 1LKZA 2J33A 5H02A 1GAJA 3CRZA 3LYAA 1ODCA 4HLNA 4FR5A 1JZTA 3GGGA 3NPMA 4M1TA 3WR5A 5C7LO 5KNBD 1ZAKA 1ULTA 2CFSA 2GZ2A 3C3EA 1CR4A 1JFVA 1L8QA 2GEJA 3AY7A 1TVKB 3QUCA 3SFZA 3TL2A 4IXMA 2D00A 3VH2A 4BX3A 3U62A 2WT8A 3SOPA 1BQ3A 3ZTWA 5L3QA 2PE5A 2XRMA 3ADBA 2Q0HA 2JLQA 3WOVA 5LA6F 3PV0A 3PRJA 4ZOAA 5C8XA 2EC5A 2GXSA 1AGXA 1HE5A 3EY9A 3WIDA 4JB0A 4HOYA 4B1FA 3CU5A 1B8VA 1A5ZA 4HN9A 1OLSA 2OGWA 2R4QA 2WF8A 2QVLA 2QX6A 3PE6A 1BYUA 3AUYA 3Q40A 3G9QA 3NW9A 1I9CA 4EG6A 3LPNA 1EDEA 3JAWA 3OAAD 4EPXA 3U9LA 1EK2A 2MIIA 5J5AA 4BFTA 4WLNA 2C2YA 2ODPA 3B3FA 2JVKA 1EBFA 3HWSA 3FRIA 3SJAA 1M2EA 4UZEA 5J63A 1GPKA 1QOPB 2VXYA 1O95D 3ELBA 3KVYA 3HXKA 4PG6A 4DXHA 4PYJA 1UM8A 2FN7A 2P75A 2WEKA 1JLHA 4HZUA 1X1EA 1ZRHA 2Y1CA 1WXIA 3E18A 1GYRA 3GEIA 3X1WA 4V2IA 2BUBA 4H1TA 3VNUA 3EGDA 3VSDA 4X94A 4GKKB 4QO8A 2XADA 5TX7A 4TTTS 1C50A 3INRA 1ORHA 2DOKA 2DEUA 2MU1A 1XDSA 2OFWA 2Q3CA 4KPEC 4QDKA 1QO9A 1N0IA 4I1UA 5H5JA 4EPWA 1T35A 2YINC 5E9AA 3SZOA 4MGEA 1SXIA 3MT9A 3WYEA 4R2MA 3E4CA 5A6SA 1VKZA 1MOPA 4MUFA 1JBQA 2GN8A 3AHJA 5GM1A 1B15A 1GLVA 2DH6A 3W5VA 3KPVA 4QUEA 3P9QA 4TS9A 4FKBA 2Z3ZA 4QL3A 3OP1A 2AVDA 5B57C 2DBRA 2FP4A 3X1ZA 2JW5A 3H5TA 3WYAA 4CKEB 1U8FO 3AYZB 1CS0A 1H4SA 1RHUA 3A9WA 1B74A 2CD9A 3TTWA 1L9KA 1J24A 3HCAA 2QG9A 5FBHA 2QUAA 5F2EA 1JQEA 4HX2A 5JVDF 3AXSA 3VVCA 4KQGA 3OEEA 1ULSA 2LXNA 1A5TA 2YIMA 3EXFB 1N5KA 3I9LA 2WIAA 4JJKA 1ULZA 1OI3A 3N58A 1SB8A 1UQTA 4I1OA 3PJRA 3A31A 1XRLA 2WIBA 2C4NA 2GCPA 4K7JA 4LUCA 3M6FA 4DDTA 3EISA 4LVUA 4JI1B 3BCHA 2DCUA 4JIGA 1PLJA 1Q0RA 2J0UB 1UDRA 2G8LA 5LUBA 3WADA 1E5VA 2ORIA 3DD1A 2BRUA 3EG5A 5CG1A 2DCMA 2FDRA 1T2NA 1ZFNA 2QZ4A 4UZSA 3GJ6A 3RTAA 3WTCA 5KOHB 2BV3A 2P2CA 3LIIA 4K3UA 4B09A 5JCJA 3DT8A 4H4CA 1TF7A 2YYSA 5AJHA 2WTUA 1LW7A 4LFBB 4W9RA 1RKXA 4GFDA 1VBKA 3V2GA 1CUAA 5F7XA 1SKMA 1GN8A 1QHSA 5T5QA 1EKXA 4Q5IA 4WBNB 4BQQA 1YS9A 3FLBA 1LDGA 1T3SA 4FOTA 4CIDA 2NSYA 3WFJA 2FHPA 1V8ZA 1ZIOA 2L82A 2R7LA 1GL6A 1ZISA 3P97A 4DLPA 2O06A 4NSNA 2PGIA 1DBSA 4QPDA 3S2ZA 4YUAA 4E94A 4IEFB 2HPHA 3BVPA 5A0FA 4BEVA 1ESMA 1CR6A 3Q0IA 3WSTA 1FEZA 1EXNA 2ZBVA 2V7GA 3CZ4A 1JIJA 3SYRA 4YUWA 3DAFA 3N8IA 2I1WA 1MO6A 1OWMA 2P2DA 2QROA 3BDIA 3NR2A 2P77A 4TMYA 3TH5A 1TJNA 2BHTA 2C2OA 1T4DA 4WXMA 4E03A 4ENQA 1F6WA 4RL6A 3TUIC 4LXTA 1A8SA 1AXEA 1JAHA 1QH8A 4HHEA 4Y2JA 1DGQA 3AP3A 3I0MA 2DSTA 3F3KA 2HV8A 2X8WA 2C78A 1W0KA 1FMLA 2KE5A 4JSTA 3STXA 1V3TA 2OG2A 5AW2A 3TQSA 1R6TA 4E4YA 2XDQB 1LVGA 1OXKB 1P9WA 1U3WA 2BR4A 4KJXA 1AN0A 1UKVY 5C34B 2QVYX 2WLSA 2HW8A 1IHOA 4LCBA 4RPIA 4V1CI 2ZZMA 1DIAA 1VG8A 3KLNA 3SAJA 3U7EB 3PL1A 3E5NA 3VO8A 4KDRA 3ER6A 4YUXA 3PPVA 4RCZA 5GGXA 3A3PA 4JLAA 2HA4A 3CZ5A 3D3JA 2V65A 3NWPA 1KDOA 3GA0A 1ODFA 1GNLA 4DMRA 4YCBA 4BBAA 3GXBA 3L8EA 6CHYA 1IAVA 1U6KA 3RTEA 1SHZA 5JATA 1V95A 3KR2A 4C7MA 4YNBA 2XF8A 3GZTB 3L7OA 3FF1A 3NHLA 3ZWBA 2AMFA 2EOAA 1KQ3A 1TZMA 1O9GA 3LQ4A 3T15A 4Q3NA 1I33A 3RJTA 5EWLB 4WOKA 2IOFK 1XBTA 5E6SA 4O4HB 1HT3A 4OBEA 4HTFA 1XTBA 3K0SA 3HR4A 3IUPA 4YBRA 2QT1A 3VPBA 3OEED 2HRDA 4BQFA 3COPA 1E69A 2DYKA 3B7GA 3P2IA 1ZLXA 2ZOSA 5CLHA 1KZHA 4DUGA 5I9NA 3R7WB 1YMQA 2JPDA 1NBHA 3TIVA 3HC7A 1TK2A 2HCFA 4BEWA 3AKDA 2SKCA 1IXYA 2P2SA 4H16A 1QB8A 1QB7A 5DHTA 1IMOA 4R1MA 2B1IA 3S0JA 3WRVA 2ADFA 4I1VA 2H00A 3T1QA 4HS4A 4F91B 2Q41A 1ZSNA 5JCJD 4IRXA 3RF7A 3Q2IA 3D4BA 4HADA 4NV1A 2JL1A 4BQEA 3S5JA 2J09A 4EZIA 1WU8A 4UUBA 1FDRA 1RW4A 4LZOA 3GNLA 3ZDBA 3MPUA 1AXRA 1MT0A 2R8PA 2OC4A 1E8MA 2V7TA 1ZIYA 2ZYTX 3RSLA 5EAIA 1ZGJA 1XKLA 4IFBA 4HVTA 4UE2A 2IHBA 1GOTA 3ZE7A 3LP6A 4AZ3A 5HJ2A 4EYSA 4YRMA 1YJ8A 2GXUA 2ZS9A 3IV7A 3W8FA 3E0QA 5MFZA 1U2QA 4ZMSA 2JKZA 1P8JA 1Y3BE 1MG5A 4X92A 2EBHX 3UJPA 2D54A 1WM1A 3UYKA 2OFXA 3OEYA 4XX0A 4V0NA 1RBYA 3LG2A 5LZ5A 3WGQA 3ZEAA 3PQDA 3QP9A 2HREA 2BMVA 1P1KA 1Z47A 3H9UA 1OW3B 3HR7A 1A9PA 3HJAA 3L0SA 3N2ZB 4P3NA 4YUYA 3IV6A 2IYVA 1TK9A 1ECCA 4OJNA 1VPVA 2HLPA 3QUAA 4LRQA 5LN1A 2R2AA 1XNQB 1CUSA 2SKDA 4I8XA 3PT5A 1GG2A 2KMLA 2OB2A 2GAJA 2X0JA 1F2VA 1ZMRA 1I2ZA 3HU1A 1B41A 2CKDA 3D4OA 1MA0A 3HUUA 3QJGA 2LKDA 4JIMA 4KAAA 1UOOA 4CYMA 1YL6A 4UATA 1U0RA 5LQCA 3F46A 3R40A 2I87A 2R96A 1G42A 3ZU6A 3RS3A 1DPGA 1KRWA 1JHMA 3ZHRA 2IEBA 3VSEA 3B36A 1R5NA 1ZUD1 1IN5A 1AE1A 1YNOA 4S12A 4HDNA 4JBYA 1T3GA 3TOSA 3V1MA 4F8EA 1DP4A 1JZQA 4UHKA 4YPVA 4EB8A 3HFSA 2BC9A 3KQHA 1RABA 2G28A 4URZR 3LWNA 1ZL0A 2XNHA 4B3MB 2Z1NA 4QEDA 3ILVA 3NANA 3D6JA 4K8RB 5BMOA 1TM3E 4EYQA 3M0EA 5BUZA 5GIOE 3H97A 1JYFA 4K6FA 1PJ4A 1P2UA 4ZU3A 2YWJA 3IR5A 3TDKA 1MIOB 4BRUA 3LO8A 2JLYA 2F48A 2PVPA 4X8MA 5CJPA 4YJ3A 4WHMA 1BW9A 1LBSA 3TIGA 1Z4NA 4UVEA 3THXB 4O1IA 3U13A 1X7HA 1UPFA 5JSZA 4DUGD 3FZNA 3B9QA 4TWBA 3S6JA 1XU9A 1Z6PA 4OQLA 3UJCA 3UV3A 4UMFA 2HFJA 1Z28A 1N7HA 4XYBA 1HKHA 4IIBA 3MQFA 4XJVA 1L4UA 4FHEA 5AVVA 1I2CA 1I0LA 2AE2A 4WZ6A 3NXKA 1XALA 5JQGA 4AURA 4BNTA 4HPXB 1HRDA 4EGSA 5CA1A 5CX4A 1WE2A 4L8LA 1IOZA 2AJDA 4WERA 3N7AA 2ZRDA 4J0HA 2ZSKA 1FFDA 1NXQA 1UMDB 1VE9A 1GPNA 3D7LA 3Q0TA 3TQTA 3WLJA 1AGNA 2FJPA 2PS0A 4WZZA 2QLMA 5ALNA 5JMTA 1EX6A 4WESA 4D99A 1AZTA 5FP0A 3HLKA 4F1WA 3KWJA 3MWLA 4I5EA 4V02A 3TLAA 2H4YA 3H75A 3QTLA 2Y71A 2BUCA 2WHXA 1UFVA 4YA6A 1E62A 5FQNA 5E1MA 4HUJA 4XW2A 4U63A 4UUMA 2WNIA 1EINA 4UBJA 1A8HA 4CKCA 3B6ZA 1PEDA 3BTUA 3I6IA 2FGJA 3V9PA 5E1OA 1W1WA 3BBLA 4V38A 5BNFA 3DCIA 1WZ2A 4E1AA 1H93A 1RC1A 4NZ9A 1TAQA 1VZ3A 3FTPA 4MTCA 1PTJA 3UKDA 5BV7A 4I50F 4ARSA 3GP5A 4TKMA 3TUZC 3KALA 3RE1A 1NLZA 5G1PA 4WGGA 4NU8X 4CU5A 3S81A 3T61A 1ADYA 3ES9A 3BHMA 1R0BA 4DBVO 3SHQA 1HPLA 1JL3A 4FI3F 2G08A 4QAJA 4IDFA 3PXAA 2QR2A 5HIAA 3ZHQA 1IN4A 2NNWB 4TTPA 1NQAO 1K6IA 2ZRNA 2FPUA 3AFGA 2PRKA 1Q0SA 1ONOA 4Q4JB 1VYTA 3H4TA 1A2KC 5TQ2A 2HV9A 1VIAA 3CRQA 2UAGA 4RMJA 1O95C 2C4TA 4RF4A 4KGDA 2HH9A 3GLQA 3ML1A 4S1OA 2XXAA 4F2DA 2FEXA 3F9IA 1OTHA 5GJCA 4ZV4A 3V8RA 2NU6B 5AK6A 4X7MA 4DARA 3B5EA 4XLLA 1I30A 5LA6B 1H4QA 2JIZA 2VG8A 4QXPA 1FSPA 1JR4A 3TEMA 4Y1GA 4C06A 3M6MD 4WN9A 1EE1A 5E2AA 3UN1A 2D7DA 2HOQA 3PNMA 4L4SA 3ZW9A 2V7QD 4C43A 3MWKA 5JHHB 1HEYA 1G20E 1YCHA 3QFFA 5FI1B 3W6OA 3FDZA 3MRXA 4MVJA 4OFBA 1LA2A 4U7HA 4IIXA 4OB6A 2HWXA 3RROA 3RSSA 3ZNOA 1NQXA 1QTNA 4MGZR 1G7RA 3ET5A 1NN0A 3WDLA 2QPLA 2RHDA 2EJBA 1E89A 1N2ZA 1PK8A 2BI8A 3ETNA 2H6EA 2YZ7A 3TFOA 3U44A 1ONBA 1NM5A 4N12A 2X76A 2Q5LA 1XKTA 3ZU3A 1VKRA 3EAQA 3L7MA 2Q29A 3QLVA 2QAJA 3DVRX 3FOBA 1EFDN 4R1NA 1I10A 1VCMA 4QOSA 5CT5A 2ZB8A 5JUWA 4FGLA 1FS5A 3RI3A 1Z5OA 1YS7A 5BNZA 4H3HB 1Q83A 4AY6A 1RI3A 1T2CA 1R3UA 3RS0A 4L95C 3X2EA 1A95A 2RHBA 3BN3A 2CUNA 4ND4A 1NBMA 4DV3B 5E9QA 2IX9A 2YXBA 1DIBA 5LKRA 3OOEA 2PGNA 4KAFA 3SSMA 3TN7A 2X4GA 1TJ5A 3H3JA 4JVOA 3PFIA 1XZQA 5GJVC 5GOZA 2VTBA 1BDMA 2JAPA 2HADA 4GWLA 4J9VA 2Z4SA 2CBZA 3FNQA 3CLRD 3ZBUA 1HDGO 3O8BA 1FFHA 1RCFA 1YAJA 1Y5LA 3MD0A 3QI2A 1GCIA 1R0YA 1XF9A 1AVTA 3BIWA 2V6BA 4DQXA 3OIUA 1EH5A 2X1HA 4FT2A 3TW6A 4A8JC 3DWFA 5JARA 2FPIB 2OLEA 3DAHA 2UUCB 3ZYCA 5IHPA 4KE7A 2IOHA 5JNRA 4MWZA 1GGJA 5KB3A 3OURA 1WF6A 3UMSA 3SSAA 2CZCA 4CRWB 1MX5A 3MD9A 3N6XA 4F96A 1C7JA 3FN4A 1YB6A 1OZFA 3OT4A 1RXWA 5HGXA 2J45A 1JB9A 4AY5A 2R1ZA 4YJ2F 4KPUB 4N7MA 4HT3B 1R6DA 1XQVA 1J1IA 1ZVJA 3EIEA 3H2HA 1I3OA 3E27A 3GJSA 4HFJA 3SF0A 2P9CA 4TTRA 4O2LA 1X9IA 4AVYA 1N3YA 2BKLA 3CR8A 2E1RA 2ZJ1A 4XWOA 4H15A 3EOBI 5CB4B 1FE8A 1NTRA 3NV9A 1MHPA 4HX5A 1XNRB 4V0RA 1NU6A 2IHYA 4NENB 2REBA 1AGYA 3C74A 1LPNA 1REQB 5DLDA 3DLCA 3U16A 1RWOA 3ZHUA 3U56A 1EWKA 1O57A 3Q2OA 2UYYA 3SN6A 4EMBA 2HJGA 3B6IA 1KEZA 2J31A 1W2GA 5I8WA 4UM8B 3H8SA 1D04A 4FGZA 1F6DA 3K4HA 5EHXA 1QTIA 3ICOA 4KNYA 3ZHXA 1UKYA 2OSVA 2DJIA 1M2JA 1KNXA 2BCGY 4D9CA 1DI0A 1Q0PA 2BEWA 4IF4A 4CCSA 1QG6A 2FW7A 3NNSA 4B73A 4LJRA 2I03A 2I76A 2RIPA 2W6IA 3X1MA 3EDMA 1RXSA 2QVZX 4M0KA 3IQFA 1GRCA 2G9VA 3EVGA 3I6YA 3UK2A 4AS3A 3A3OA 3KEFA 3TINA 3CKYA 3DE7X 5H9VA 1X86B 1UXKA 4Q3BA 3UC5A 4GBGA 4NV0A 4D8TA 1N33B 5K01A 3GOHA 3RVOA 3RYHB 1NBAA 1TYCA 3Q7IA 1NJ8A 4O3FA 4RD4A 4RSRA 1D2NA 1OVMA 2JHCA 1IG0A 3KV3O 3OUZA 4PLYA 1L7AA 1XFDA 5LYYA 3CVWA 4HAWA 4GSKA 3E2MA 2JI7A 4TMWA 1SBQA 3D6UA 3WB9A 2B4RO 5EZYB 3VOTA 1DRWA 4PHCA 1XMXA 4WY2A 1NVMB 2QZJA 4ID3A 1TYEB 1Z29A 4NCIA 4W9MC 1L4MA 1I01A 4KB5A 2FLKA 5CP8A 5TQ0A 2DB3A 4AG5A 3F0TA 4KZPA 3LXMA 4RACA 3TPFA 2H5JA 4CUKA 4DXAA 3DE5X 3HCBA 3HXLA 4J0IA 2A3NA 4MV3A 3CKMA 4HEJA 3SSOA 4AMBA 2NNLD 1H0SA 2Q3FA 1A9YA 2R11A 4HDQB 4HQNA 1SIWA 3DLHA 1K66A 4PCAA 3ZD9A 2CHGA 3DNMA 1VLHA 2DX7A 2QOEA 3DMTA 2ECPA 2Z6UA 2QN8A 2Q2NA 4D9MA 2EWMA 4DG5A 5TB5A 1P91A 1RNLA 3QVUA 3C3MA 2OHIA 1OJLA 2D8MA 4YP9A 121PA 4P5EA 2C4KA 3OZXA 1JE1A 4MICA 2RJOA 5HS6A 4DCSA 1UXIA 1E20A 4EY4A 1N3IA 4F12A 1KHTA 3LC2O 2JVJA 2WU0A 2GLUA 4UQOA 5CNJA 4DMLA 4HNTA 2DHRA 1DWOA 2WWWA 3OC0A 4EJSB 1DLJA 1YNSA 4IOMA 3SXUB 2VDKB 3PUZA 1XZAA 2QVBA 3H04A 2H59A 5EHIA 4B6OA 4JJ6A 3DE0X 1EBUA 3FHJA 621PA 2J9RA 4E5NA 5KX5A 1F0NA 3AESB 3BERA 3C7TA 2AXPA 2Z6VA 1CDOA 2ZT5A 2CNKA 3NP9A 1GGNA 3WNZA 1I3KA 2E9SA 2IBMA 4H1WA 4RSHA 1MJHA 1SK8A 1SZJG 3DMRA 3WZMA 4M1WA 3GUZA 2CJWB 2WM3A 4WT7A 3DE4X 2VJYA 1RYBA 2VT6A 1A0OA 3PGLA 1GPH1 5DBIA 4Z0TA 3V4FA 4BU1A 4ETIA 2VRBA 5EJ4A 4HK4A 1N78A 4B7XA 1V43A 2JD1A 4B4VA 2H1IA 1LVUA 1U65A 1V7QA 4YRSA 1IQUA 4L2IA 1HEIA 3FLMA 1F12A 2QD3A 3JV7A 2TSYB 4CL8A 4IF6A 3OA0A 1EFVA 3KKPA 2YV5A 1XWWA 4O4JF 2G0NA 4DRYA 1ONNA 3GJQA 5DASA 5HYVA 3BWEA 1AG9A 4ZDKA 2A0XA 4ZYUA 3C6MA 3FWPA 1ZU5A 4EUEA 3M9XA 5CBKA 1Y4AE 2GKGA 3N2YA 2YJ5A 1G5RA 3U4GA 1GNRA 4W5HA 3BIXA 3FSEA 1H6AA 2JFQA 4KO4S 5M34A 1RLJA 1DV2A 4GS5A 2VZ9A 4I9FA 3U7IA 3PEWA 1L1EA 5HKAA 3LCUA 1NDHA 1VE7A 5KNCA 4CXMA 2QRVB 3I2HA 4G4IA 3X1KA 3U6KA 3X2SA 3WLPA 4Q9NA 4C0BA 3NEAA 2UVPA 4RLSA 2X8AA 1P1HA 1X6VA 4YALA 5KQRA 3LAWA 4OF4A 5J2TA 2E82A 4GOND 5F12A 2OXCA 4FGWA 5KYNA 4KSCA 5L3SA 4M7PA 3H18A 3KOYA 1BX3A 2Z4RA 3GLTA 3M4NA 3SE7A 4GOXA 3A1VA 4YV7A 2Q50A 3EWNA 1EB9A 1CVIA 1JQJC 1DBWA 2RB4A 4EATA 1P6XA 1JF8A 1R15A 1L4FA 1KYQA 4FS3A 5DCUA 3OMXA 4A0SA 1E2GA 2FK7A 3A9TA 3QU7A 2IXGA 4J1TA 3EDQA 1GGVA 1FB5A 1PK7A 4ZT5A 3TQFA 3RFCA 1J8DA 2IS2A 1DAHA 1NBWB 1M6NA 3GB9A 2X58A 5HJ7A 2XQIA 3FUTA 5BQPA 1YB5A 3BRQA 3FDFA 4HQKA 3RSFA 5B1EA 1G20B 1QANA 1U04A 2RBGA 2FK8A 3SP1A 4J7CA 5C81A 3LDHA 1KP2A 4R51A 4QNRA 1Z6YA 3ZHOA 2I6UA 1X74A 1RYHA 4L28A 2B0JA 2YN0A 5F76A 1L5ZA 1OHHA 5AP9A 3T5GA 3GLGE 4TYWA 2H1RA 2JCBA 1IZ0A 3ENNA 4ZYZA 1X70A 3I39X 1NF8A 3NYRA 3T9AA 4NCHA 1ZONA 3GFTA 4CLRA 1ESCA 3I4CA 1GGFA 1KZ6A 5LQMA 1L5GB 1AS2A 3VTKA 3HI6A 4K6CA 4M9XA 1CEXA 2FZ5A 3VHXA 4DQ0A 4Q66C 1KIMA 3ITEA 4QASA 4LZAA 4NFSA 1O3YA 1JLSA 3R2JA 3WYBA 1F17A 1CERA 3U48A 4MQLA 4F7WA 5HQJA 1CC1S 3I9MA 1D5CA 3TD9A 1P19A 3K05A 3VKVA 4AULA 5KSYA 3P26A 4GM0A 3IV9A 3R8XA 5LSAA 4G5FA 4PN7A 3F73A 3LE8A 1BRTA 2N1BA 4DDHA 4DZRA 1NNI1 1Z5VA 3H9QA 3JR7A 2Q8PA 1TQ2A 4C0HA 1ZN9A 4FOPA 4FGKA 1N6PA 1U90A 3ISVA 3MWFA 1I2DA 5M3BA 4BS9A 4MUIA 3OZBA 4XD7D 1KO4A 1FRVA 3JQ9C 2OGTA 2XWJI 5KYUB 3AEQB 1U63A 2I1VB 3O1HB 3GY0A 4PTYA 1QG4A 1MMFB 3PR2B 1IWPB 2P62A 3PWTA 4Q1FA 1WY5A 5EP2A 1JU4A 4D9KA 4OK3A 2Q1XA 1J5PA 3L7YA 4IDDA 1FOEB 4L9RA 4U9UA 2NYRA 2JIMA 1NASA 2VQDA 3JPWA 4DJDC 4Z1MD 1Y0BA 3WQHA 4E32A 2HRRA 1KRHA 2PIAA 3CE9A 2YXPX 4MWOA 3AWDA 4E15A 3DTVA 3FZYA 1TECE 2I99A 5KNCD 1GM5A 3RR2A 1SH7A 2CKMA 3ZK7A 3K2BA 3P9XA 1CJKC 4BU0A 1XZBA 1FMCA 2WA2A 1CUZA 1XVIA 3LU1A 1NUUA 2NLOA 3F6EX 1ODIA 1QO7A 1SC9A 2P5TB 5K3DA 2XR1A 2AE1A 3S55A 3D9QX 4WRRA 1OA1A 2FPPB 4RCVA 2M1XA 2FQQA 3CZAA 1U3GA 3A6HA 4BNUA 4XD2A 4C7OB 2C3OA 2EGHA 1SVIA 1WCWA 1YVRA 1ZK3A 1ZRNA 3BT7A 4TVKA 3PEFA 3NDJA 2WM9B 5D3QA 1GT6A 4IDOA 4F97A 4UKDA 2H1CA 5FAKA 1MB2A 5HBRA 2RBKA 3P0FA 4GSLA 2C0QA 4NOKA 3VOSA 4MHSA 4FLFA 2RBEA 5ADWA 1KAMA 5JFGA 3Q10A 4L16A 4BJ1A 5ENVA 1NJ2A 4CCYA 1EGHA 2XCRB 2D5LA 3KP1A 1RI2A 2B25A 1N2GA 3SE0A 3UQZA 4OHUA 3CLRC 4X63A 1CZLA 3BQ9A 5EP3A 1T4GA 1X3LA 2JJMA 1TFUA 3UM9A 1E1CB 5JFOA 1TM1E 3PKZA 2PLRA 3C4VA 3PGMA 4YCSA 3T38A 3NASA 1C7RA 5B53A 5FUYA 4DUPA 2HHAA 4JI2B 3E81A 4DEYA 4B35A 3GPIA 3U1TA 3Q4GA 3BA6A 4MUYA 4UE3S 1OQAA 4OL9A 1GV0A 4IOKA 3WIBA 1U0EA 5FTWA 3MJTA 3AIOA 3VPCA 4YMLA 5AXAA 2J7KA 3GEBA 4NZNA 3STTA 3WL7A 4M88A 4DWWA 2VK1A 3QOWA 2EEPA 4FDUA 1HV8A 2EZTA 3H2YA 4B71A 3EZ6A 1J42A 3IPCA 2VCYA 3KJGA 4NZYA 4L76A 1ZK1A 5K8IA 2RD2A 2Q7XA 2XOXA 2E4ZA 5ALVA 1O97D 3HMKA 5CCDA 4B85A 5HUHA 1RPZA 2BFWA 5DN9A 1AQYA 2IY9A 2X7XA 3A0UA 3R3VA 3FSJX 1E7RA 4M9QA 4NPAA 4AF7A 1SUBA 4OTZA 4FFRA 1JAZA 3I5AA 4IH9A 2OZEA 3LOUA 3D0RA 3N5KA 2QA5A 5YASA 1JHVA 4YAIA 4HLDA 5A06A 1XVVA 4HLUC 4J16A 2RFLA 2ZIVB 3HXQA 2QJOA 4MRNA 2XGMA 4L5IA 3H5WA 3MINB 3DBRB 3MHPA 1XTIA 3K15A 4Y2VA 2W2PA 3WVNA 2JFBA 3LX4A 3S27A 3E9EA 5DYWA 1OAOC 3KEQA 2Q5EA 1U2GC 3ZWWA 2ZW9A 1QE5A 2WLTA 3PZRA 1Q7RA 1VL0A 3A1CA 3GFQA 3BIJA 5ER6A 2CSXA 1YVEI 3JQEA 3RYIB 5C80A 5CTJA 1GSOA 4Y9RA 2PM8A 3WL5A 5CH8A 4B3FX 4UPEA 4K87A 5DLEA 1C9DB 2ZFUA 3DBHA 3GAAA 3DYBA 3JZIA 4HYEA 1YDEA 2IVFA 5L4NA 3PHJA 1HQDA 4IHJA 1DC3A 4TSRA 5A9SA 3GT0A 3DPIA 2OCGA 2OK7A 2OFFA 5A9RA 5PGMA 5BN3B 2O8FB 3U4MA 3F8WA 3IOCA 2JIBA 4OHPA 4JYMA 2WFZA 2WSLA 3JARB 1H8HA 3SLGA 3BXEA 3W4JA 4E1BA 1KQFA 2V7EA 1VJCA 4BXOA 1Q14A 3UCFA 3TLBA 3U5TA 3U4IA 1ZD1A 2QMYA 2UDPA 3NC0C 3ONEA 1YDMA 2Y3IA 1M7BA 1SRRA 3GFRA 4ZO7A 3RYIA 3SEAA 5M29A 5CW1A 2AXQA 4EMUA 3EIWA 2WKQA 3VXKA 2JFUA 3A9UA 4FDMA 4BC0A 4ZI3A 4B44A 1N8SA 3CX6A 2VSXA 4HGRA 3C5WP 4S1NA 2IX3A 1RZRA 1PN3A 4C7JA 1X94A 4FFMA 2YUTA 3V1NA 3LK7A 4L3VA 2FU5C 4C4OA 1G7TA 2DLNA 1GNTA 1GLGA 2Y1EA 3Q8WA 4E31A 2XYHA 5IU6A 2VXOA 4R41A 2CLEB 3KOZA 3ZCUA 1D1QA 1TGVA 2B21A 2CWDA 3T3GA 4EVQA 3UBTA 4KQXA 5HMLA 2WJWA 3ACBA 3FVRA 4KMRA 3HO1A 1IN1A 5EGSA 3GJ5A 3BJMA 2QNIA 4DJAA 3CH6A 2A14A 5T6BA 1Z08A 3MELA 1NAHA 1DKLA 1GR1A 3UICA 5CFMA 3MMSA 1DTEA 1JU3A 3ADOA 3ICVA 3MFQA 5LR6A 3JQ8B 2OEPA 4PLFA 5AJVB 4BLWA 4BP8A 2WJ4A 1UMCA 1XRPA 3EGVA 1M8KA 2ZJ4A 4B8YA 1WBJB 3RHSA 4EHBA 2EF1A 4UTXA 3Q3IA 3ZJ5A 2YBDA 3C24A 3OE4A 2QRUA 4Y6PA 1ABBA 3HEBA 2PMKA 1G7SA 2JAQA 1FNNA 1QDEA 2D1SA 4D4JA 2B8TA 1Z8NA 5JJCA 1TUIA 5DHSA 5CFZA 4GL2A 2BTOA 4ISCA 1VPDA 4NFLA 1P1BA 1XI2A 3VSCA 3S44A 3L8YA 1KJQA 3BSSA 3CNOA 5JEEA 3EWSA 2Q6LA 3MW8A 1V8PA 5HPYB 3AUUA 3C5HA 4CKYA 2WTBA 3DXZA 1QHXA 4FX5A 1ZO8A 4GXNA 1T13A 3FXAA 4IXTA 4ZOEA 5FUXA 4HVAA 4B6RA 4GR4A 4KWTA 3S2EA 2OCLA 3B6JA 3ID6C 1SVNA 4TQ9A 4TT8A 3TFWA 2NTJA 4FC7A 3VGPA 2C94A 4K28A 4FFWA 4ARAA 2VC2B 3PX3A 3L4BC 4RJIA 1SUAA 5JNUA 1EUYA 1ADJA 5KIAA 3JWEA 4M6WB 4YJGB 1XTRA 1IOLA 1V45E 2HU5A 3F7OA 5KWSA 3U40A 4F5WA 4NYMQ 3F47A 1K8YB 2AX4A 2ZBRA 3GIDA 5EYPB 4R71A 3P5SA 4CKEA 4QTTB 1ZX1A 1D4AA 1VGVA 3ND5A 4J1NA 3TTVA 2HD4A 1ECBA 1NT2A 2YWXA 4Z0NA 2DPLA 4JUFA 2X8BA 3NJ4A 5B3AA 1KJNA 2WK1A 3L6RA 4HQOA 4JFRA 4Q24A 1XXHB 5TXGA 4EPYA 3QGMA 3JZAA 4HNRA 3UT5B 5IXSA 4LDZA 3RGWS 1HYEA 1M34A 3DWEX 2ZYSA 4BMPB 4R1LA 1YRHA 3K2EA 4PZUA 1M2WA 1M83A 3WLKX 1PGNA 1H8HD 4F93B 2J5XA 3VISA 2NZYA 4FIZA 3O4RA 1XEXB 5FPQA 3UAVA 2BYTA 2VHYA 4P5DA 1FDSA 4RH1A 3X1DA 4ZCLA 2J0UA 4C0AC 4DIDA 1ZXBA 3A58B 5TR9A 4O4JB 5C32A 3H2GA 3TJRA 2Q3DA 1SK9A 1XN1A 4K9PA 4UFOA 3ZV6A 1A76A 1JWLA 3GF4A 2ZLBA 5CYFA 3D6TB 4JVMA 3QMWA 4JLMA 1GKLA 1ZC3A 2N1MA 1TPZA 2JGDB 3DMYA 5DCLA 1YB4A 1MO5A 3SBEA 1XLTA 2ABWA 2MT9A 3EZYA 2E4YA 3FUCA 3Q6NA 3QVGB 3TYXA 2V59A 1UBNA 2PSSA 4BMZA 2GEFA 2PTHA 3HFGA 4II2A 1N2EA 2BE9A 4R8RA 3VNRA 3E23A 4NATA 4EUSA 2WFLB 2E21A 1JNYA 2WIFA 2B35A 3IKVA 4QODA 5B55A 2J4FA 3T3NA 1YI8A 3TE7A 1QV6A 5EEGA 1E79A 4YCLA 1ZN2A 2PZJA 3INYA 2Q0SA 3FRJA 2XXJA 2OQVA 2PIDA 1KZ9A 4E2YA 3FCEA 2I65A 3WRYC 2PCJA 4BO8A 3AQIA 4Z1OA 2JS7A 1QRRA 1QZZA 4G8BA 1NRJB 3ZNQA 4NOJA 5HDBB 1ZJWA 4QOIA 5L95A 1SG9A 3B9BA 4JL6A 4M3NA 4WD3A 3K0KA 4BFYA 2PSJA 4X41A 1PFKA 1BWPA 5EXDA 1BCSB 5FLYA 3UXYA 3NT5A 3H65A 4RH0A 4HAVA 4EKYA 4Z6KA 1P9RA 2XDQA 4JI3B 1DJLA 4X71A 1KAOA 4UHCA 2CN1A 2QTTA 1S1CA 2ZU6A 5D00A 3PG5A 2F9MA 5JZBA 2NTYC 4GQIA 4E88A 2B7LA 3Q9SA 4LQCA 3L0YA 3NT4A 2HHJA 4MS3B 3CS3A 2WT4A 1WTAA 3WZLA 2DQKA 1UAYA 1YV9A 1M3SA 2PUJA 3TTUA 3ZHYA 4CIAA 3C6YA 3PFGA 2QLJA 3BWVA 2ZBEA 4PNHA 5KKNB 2CLFB 2XVZA 1E9SA 1UT5A 3H1AA 2BGIA 1WP4A 4NU0A 1QNFA 1HYHA 2PL9A 1E4EA 2PXHA 3IHKA 1EE2A 3K30A 4S2EA 5BSGA 3EXG1 2V0NA 1JHOA 3PQ6A 3M1AA 3NRJA 4FIDA 3WBKA 5LMCA 2J4CA 1TEHA 3EBPA 4DAEA 4QHTA 1ICIA 3IKJA 4XE5A 3TSZA 5JPIA 2DFTA 4C29A 1QZXA 3IBSA 3MNFA 2VQ3A 2CVQA 3Q9LA 2AW5A 3ESYA 1VFPA 1BS2A 4KXUA 1C5KA 3JZMA 1YL5A 4J4TA 3AF4A 1W5BA 4BX2A 5EWLA 4W7HA 5K51A 4MDHA 4B3HA 4O4HA 3LCRA 4J0CA 4N49A 2R25B 5A2QA 3QMMA 2X40A 5DYTA 2FN8A 1GRNA 2BHNA 3LBNA 3NBZC 3VZBA 3QX7A 4Z4IA 4M0PA 3GBVA 3EIQA 2IS4A 4BTEA 4BNDB 1JP7A 3R7WA 2WM2A 3AQ4A 1QHHB 3EXEB 1SKAA 2B0CA 4RETA 1RRGA 2PX8A 3SQLA 2CB0A 3GA7A 4PEVA 3TZHA 3SSNA 2ZBDA 4WNAA 3VH1A 3DNFA 2UV8A 1GNVA 3DG9A 4E22A 4K2AA 3ZY4A 4X91A 3I73A 3FOZA 5FI3A 2EWVA 5HILA 4OBXA 4B7UA 1PSZA 2VK4A 4OXKA 5DCWA 3A6JA 2C5HA 3OTWA 1WCIB 2XJ9A 3CEPB 2OFPA 1PWXA 1W4ZA 1N7IA 2WD7B 5UKDA 1YU6A 3M9LA 3HLYA 4OO3A 5ES4B 3KIPA 1CX9B 1W6UA 2AUMA 5EIXA 1ZS9A 3VDQA 2YZNA 4ZEOA 1JN0A 5K3BA 5I48A 4QYXA 2VEOA 2HJSA 4WADA 1IEVA 3KSAC 1FP7A 3MK31 4UFNA 2CNNA 3TB4A 3SQWA 1ACLA 2O3JA 1JHPA 3H0CA 4GMGA 4NJMB 2RGDA 1H2ZA 4L6CA 2F1IA 2HJVA 2QZSA 2RI1A 2VF8A 1UQRA 1GGMA 3EMDA 4UPDA 3VR6A 4DC9A 5EIBD 1CRLA 4MVJH 4ZO8A 1FNDA 3ENVA 3GDHA 3KYDB 1BJTA 1HYGA 2PZEA 4MX8A 3ZWVA 2O5EA 4RD3A 1KOJA 1LQTA 5HTKA 3LF2A 4DZTA 1JJ7A 2JFNA 2G63A 1ZICA 3T7SA 1Q21A 2AN5A 3PD0A 3PPYA 4INZA 1YGPA 2GYWA 4BO6A 2XUAA 1OH8A 4XVQA 3V6LA 2QW1A 4JLNA 2OSBA 4YDHB 4ENPA 4M9ZA 3PR3A 2AKAB 3AJDA 5GJWC 1E5TA 4QQNA 1O6GA 3C1AA 3Q5GA 4PAWA 2ORYA 3HB5X 4DV7B 2J3MA 1O97C 2HMYB 3FMIA 1IXSB 4LF6B 1PFYA 1SM4A 3V34A 2XZTA 4ACAA 3K5PA 4GT1A 1V3UA 5IMBA 4BZZA 4CF7A 2DXIA 2I0FA 4NYJQ 4ZEWA 4YECA 3ROXA 3TD2A 1WHTA 2XYGA 2R60A 3A28A 2FMKA 2R47A 5AIBA 2BM0A 2AGVA 1K68A 1OU0A 5DGTA 1ZOPA 2OV8A 4YWHA 4DMHA 2V3WA 4ZVQA 1PT6A 3LW7A 1R5OA 2VP4A 4HYYA 4RIEA 4X8HA 4DCTA 2OV3A 4JLVA 3ZTTA 1X80B 3EZNA 2B36A 4Q1AA 2FWBA 3JWIA 3NWJA 4GGMX 4KHZA 1TMOA 3E9DA 1RWXA 2MMCA 3F5QA 5JJ5A 2WHEA 4CM3A 1MIOA 3ADKA 3PX2A 1XMSA 3MZ0A 1WNFA 4IS2A 1JLRA 1HLFA 1PL0A 4IG4A 1WSWA 2DHQA 4KRGA 4LXGA 4XSGA 3THXA 1SXJD 1XMJA 2V74B 4DSOA 1RQRA 4LKOA 5DZSA 3QKRB 4QG3A 1CIJA 1HG0A 2YYAA 5IAJA 4HQRA 1LI5A 5JU6A 5E7MA 3DT6A 1HFJA 2YS6A 4I3GA 5FDFA 5AW1A 4WLFA 1XAGA 5I7UA 1CULC 2Z09A 1YR8A 4D8WA 2D7JA 4OH7A 4DR4B 4YHHB 1KI6B 2IPAB 5EE3A 1UMDA 2DWOA 4I3HA 1RQXA 5AESA 4NBKA 3N0VA 4EITA 1PUJA 3TNDA 1HDXA 2QX7A 1MX3A 1JWBB 2OHJA 5JWRA 2O1EA 3FROA 3G2IA 4KG7A 1V3VA 2DP4E 1FUUA 3LMKA 5EIHA 2VZ0A 3KJZA 5KYKA 2C2KA 5MDHA 2GZSA 4HQ6A 1C14A 4B5LA 4DQUA 4OI1A 3VAZA 5M5BA 4MIYA 3AIMA 1EFRD 2F00A 2VWQA 3RODA 2O1XA 1OYYA 4P4SB 1JA1A 1ORVA 1BHQ1 4UXHA 3FYDA 3UW1A 2FF5A 1CJMA 2RGXA 4RVNA 3AKCA 3JWGA 1QAOA 1QHNA 1H2FA 1SVWA 1J0EA 4GZLA 4DNXA 3KUCA 1HZJA 4HRYA 2PZFA 3TI7A 1VL2A 4KWIA 1Q1QA 5JPDA 2C57A 1CNMA 4MQFA 1TO1E 3RYCA 1FLNA 3VV2A 3LNTA 3WDMA 4BL5A 2G9UA 2G71A 4RY8A 3C87A 1Y1SA 3G7UA 4GLFA 4ZVVA 6GPBA 1BKYA 1NUHA 3LPAA 1BQEA 1IONA 2P2NA 3MSXA 2B2XA 4DPKA 1ECGA 4MV7A 2QJFA 3I6ZA 3UWMA 4EARA 2QV7A 4OA5A 4EYKA 2H4HA 2SKEA 3DWGA 4OI4A 1T5SA 4L6IA 4Z0HO 4U6SA 5TY0A 2NZUG 3QEMB 2P0YA 2N46A 1RYMA 5IH7A 1N6KA 4M7WA 2AZTA 3KCQA 2W2KA 4PHGA 3SICE 3ZUGA 2P11A 4RDXA 3VPSA 2WUWE 4HR7A 5C18A 1WXXA 5EXSA 1HMYA 1XZ8A 4L5CA 4MULA 2TMGA 3AUFA 5EWJB 2GK7A 2HQBA 1MJGM 2NU6A 3MOGA 3QHPA 4KIGA 4YBZA 4ER6A 3JSAA 5LA6A 2X19A 4EG8A 3JYLA 4MK4A 2UZIR 1EUCB 2V98A 2FV8A 1USVA 4ETWA 1HNZB 2AF3C 2YX1A 2JBAB 2EYUA 5KYTA 1FRFS 1PT7A 3H5VA 4IR7A 5MGBA 1JJVA 4L0DA 4IS3A 4ENTA 1M5RA 3WI7A 3FTDA 3N70A 2A88A 3BIOA 4GPTA 1BE0A 2C4MA 3P5BA 4WBXC 4KFUA 2ZRMA 2NYVA 1X0XA 5C3UA 2DBZA 4BECA 1J0XO 4DLLA 4UU8A 1RDFA 3KK0A 2RMKA 3GLRA 3N76A 4NCJA 2NXWA 2Y1KA 4GNRA 4XXHA 2IDJA 3OPYB 4FR0A 4PY2A 1HWYA 1K9SA 2PWBA 2XBUA 4GVPA 2JBHA 4BNGA 1T1RA 4C76A 5CB0A 2LGJA 2GHTA 4OL0A 1E77A 2IXBA 4EA9A 1JEDA 3NU1A 4X1YB 5AD1A 3O93A 1E9BA 1HK7A 4JSYA 4NU5A 1JHYA 1Z0ZA 2RKOA 4L8VA 1QWSA 1XMVA 2VPTA 1W4CA 3IBTA 2OBXA 2VP5A 4W1QA 3WIOA 1RLUA 3JASA 1H94A 2PNFA 3FMVA 1XZNA 4N76A 3NAGA 4PSKA 1C0EA 2V9CA 4TM8A 5DNUA 2H4WA 4IMIB 4P1ZA 2X2EA 3U4HA 2AC2A 4PIMA 5FR1A 4O4IB 3SM9A 1CU1A 4FEEA 1N2SA 2P1DA 4UEQA 4CUZA 3H6GA 3A1UA 5ECYA 5EJEA 2FA9A 1OI2A 1CK4A 4B2YA 3K6SB 1KYVA 2ZI6A 3UAYA 1BGVA 2A9KA 4I2NA 5JVDA 5TS3A 2QTWB 3K73O 2UXDB 2XGOA 2IW3A 4QUBA 1M1NB 2ZJZA 3BBPA 1OWPA 4WPGA 5HFAA 3UC9A 1EP3B 1HF3A 1RFGE 1USUA 2O0JA 2CZGA 4LJ9A 3ZY2A 2PR2A 3GUHA 4CMKA 3MSCA 3AETB 2XRZA 2YJZA 1RHKA 3OFNA 3PIIA 2WZCA 3WLSA 4A0FA 5KS2A 2DM6A 5B7NA 1YOVA 1U9JA 1QCCA 3IR7A 5AJTA 5KNCH 3GMIA 5ALUA 2YOGA 5J4LA 5CFRA 2VYQA 5K5EA 5FH9A 4PZAA 4A0HA 3TAUA 1UK6A 2ODEA 2I6XA 1RM3A 3KSBC 1RWNA 3EC1A 3HBJA 1CQIB 2EKDA 1E3TA 3QVSA 4BC1A 1X1SA 3GCDA 2I6QA 1IXRC 1R5JA 1Y63A 2BZ1A 1SKYB 1PG5A 2GARA 2EATA 3AERA 4FLEA 4R8SA 1ZN7A 5FBVB 4KV9A 1QFSA 4NENA 3NBYC 2Y99A 3SYKA 1N32B 3QV1A 1REQA 1YJ5A 2LZ0A 3T1VA 1PGJA 4CV2A 2PL3A 4P0TA 2DG2A 3UJAA 5DFAA 4G1MB 5DBEX 5AM1A 2NU8A 1J6UA 2GN2A 4NS1A 3W1WA 1G21B 2YNMD 1UADA 5F2NA 4AG6A 3AVPA 2VRNA 3UHOA 3V8PA 2BEJA 1RXIA 4PFQA 3BH0A 4BVJA 1B14A 2F6RA 3Q9UA 5DMHA 2R84A 1BDHA 1G0NA 3PDIB 1VE6A 3OC6A 4QXMA 1A9XB 4JXJA 3IL2A 1L5WA 4R2JA 3C8UA 3SBOA 2AG8A 3EGXA 1VJTA 2HCTA 4HSGA 2WQ7A 3GQBB 4Y9TA 2QYHA 3TNLA 1EHCA 1Q0UA 1V1MB 3ZLVA 1KC1A 2WSBA 2PS1A 3OI7A 2CY0A 2FOIA 3K5IA 3EGIA 4I55F 3ZGVA 1Z62A 5F2KA 2CV0A 1I7PA 2Z5FA 4DMCA 2IYXA 3RYHA 1PSWA 4GI3A 2EW8A 4K03A 4DLXA 1R74A 2REQB 2SHKA 3DYVA 2GHQA 1ESZA 4LK2A 3SDSA 2A4KA 3HHPA 2W2VA 4LVCA 5KAMA 5EI5A 1YACA 1B0ZA 2BJWA 2Y67A 2AG5A 3QHAA 5I8ZA 1Q6YA 4OM7A 1XZEA 1NVDA 4JZKA 4MMXB 2J7PA 2PA3A 1XA0A 3NC4A 3AO0B 1WABA 3QBJA 4KXXA 3T5DA 2FG7C 5JSFA 1Y3FE 1H42A 2OESA 1OMOA 3JQGB 4Q18A 3UFXB 1UMBB 4II7A 3EZGA 4OX9Y 4H3KB 2VDWB 2P8SA 2JI8A 4E5SA 2FQYA 1XPJA 2VBGA 2C9DA 1O5IA 3BZBA 3PICA 3CVOA 3CN7A 4Y2QA 5IG2A 1GUFA 1W73A 4MV5A 1DJPA 4GKBA 4PC2A 4YMWA 5D87A 2QRLA 1Y8QB 3VU0A 3PL5A 2XTAA 3DJFA 4O2BF 2HK9A 1QUEA 2I4LA 4XQ0A 4ZVNA 2ONJA 3CBGA 2YIVX 1DXQA 2QM3A 3KT3A 2K2QB 4LA4A 2GBFA 2HLNA 4UMDA 3ND8A 2Y0DA 4P6VF 3PZBA 4KE8A 2ZXUA 3ANLA 3QPDA 4B45A 4EJSA 5JH7F 5KINB 3SXUA 2E18A 3OZDA 4IILA 3KQLA 4CV3A 1HXHA 1ZJ5A 3EW7A 2WPDD 3LCJA 1SY7A 2HRCA 3M83A 1OE0A 1WDKA 1XHFA 2Q7OE 2J5RA 3NHBA 3I0ZA 3V1TC 4WCFC 2H65A 1EUDB 2PKYX 3G02A 3RT9A 4BVHA 1QCDA 4EJ6A 5BW8A 3B85A 1T0HB 1AK1A 4B47A 5B36A 1KO8A 2CJWA 3QY9A 3UBMA 4INJA 1OZ0A 4B6SA 2H2HA 3VUEA 1XN4A 5DNAA 3G7SA 1AC5A 1KJ8A 5JO0A 1WQ1R 1G3QA 3ABZA 4JBHA 4BBZA 5DBOA 1DOAA 1QYWA 3H9BA 3DB2A 3JATA 4B6QA 4RD1A 5J47A 3DC2A 2YTZA 1CZOA 2Q49A 4L1KA 3TS1A 2CCJA 2V5UA 4ITRC 3LF1A 3TBFA 1RPTA 2C04A 4R9NA 1EFKA 4Z4EA 3C5CA 5KYXA 5TPZA 2X6RA 2IOQA 2VSQA 3I62A 4JV5B 1IUOA 3TZ6A 4F8YA 4MYDA 5HNKA 2GZAA 5FWYB 1UWKA 2GT1A 2OV2A 2X23A 2IEIA 3U3RA 3N2IA 2V4UA 2BVNA 1JAIA 2GX6A 1G5TA 1GVNB 3C39A 4Q7MB 1P7ZA 3BD9A 3N8KA 3Q6IA 3JYNA 3FYUC 4L8YA 2Q3BA 1SXJC 2QRVA 2ECKA 1XU4A 2YCBA 5BXYA 3ER9A 3FYUB 1B73A 3F1LA 4CKBB 1DS6A 2O9JA 1B0AA 3T41A 5CURA 2YW9A 4CF6A 3V4VB 4DLWA 4EPRA 1NQUA 1IL0A 3DL0A 5K6AA 3B3QA 3CUYA 2Y4OA 1LSUA 5KKAA 4Y2UA 2ZUSA 4MKZA 2JZCA 1OAKA 1KJIA 4G0VA 1KU6A 2OKCA 2W70A 3KB8A 3KYJB 4QBTA 1UC8A 1KI3A 4N8EA 4RIGA 4XCXA 1EQAA 4BVEA 2UUOA 3SX4A 1EX1A 3RSOA 3ETLA 4R2HA 4WY5A 2WVHA 1W5FA 3H13A 1TD9A 1J8FA 4D46A 3MTBA 4K6MA 1GU0A 1ZUNA 5IKEA 3IHWA 1H2BA 3LWDA 4Q3LA 1G20A 4BKMA 5ILQA 4Z5XA 3GEMA 5U4QA 3U7QB 3LBAA 4WINA 1YRWA 1QHGA 4UHDA 2RGNC 5CGQB 2Q1SA 3HDJA 3V7NA 1S02A 2G9ZA 3WRWA 1RWPA 1WB5A 4N3CA 1ECJA 3THWA 4EI2A 1PJZA 2J0SA 1FPMA 2X6TA 3EGEA 2WM8A 3QUTA 1F48A 2HLDD 4CMHA 2QQGA 3LXUX 5ECDA 3QEAZ 3A2KA 1HDRA 3ITDA 3LD9A 3HUEA 1C9EA 4R98A 2FZKA 3FPFA 4EPVA 2QSYA 2VVTA 2RKWA 5HHTA 5FI0B 3BJZA 3I05A 3Q8KA 1SOUA 1ORIA 4O33A 3RHFA 3LWZA 4WZAE 3KBBA 2JGIA 3O4FA 5CNMA 1Z88A 2Z5VA 3U1BA 1D4FA 4P2BA 1DRUA 1LRJA 1P6QA 3D7RA 4FZVA 1I5EA 5LBIA 4F45A 4MUKA 2VRWA 1VJGA 4WOJA 2Z8XA 5ALYA 3M1IA 3A6EA 2E5WA 3TBKA 4FNGA 3WDKA 4B0OA 7REQB 4JP1A 3G0IA 4B6PA 1XTSA 1YE8A 1HFEL 1U02A 4HAXA 2GK4A 4LYFA 5A1JA 4F4FA 1JB1A 2XKJE 4X85A 2CLKB 3MS7A 4NFHA 1PS0A 4JYBA 3FWKA 1T9GR 3AEQA 5KYUA 1DC8A 1GCUA 1PVDA 5G0TA 3EVFA 4F38A 1JKMA 5TPZD 3ROMA 4AWBA 4BEBA 1HC7A 1XK6A 1YSCA 2F1JA 3KAJA 5BSVA 4RKEA 4XR9A 4PFKA 1W5EA 3ZS8A 5IMSA 3QMPA 4Q00A 2L19A 1DZ3A 3KT8A 3PXGA 2PQ0A 1CY7A 1U5BB 1FMJA 2TRSB 1JDBC 3DFUA 4NF2A 1ISHA 4G26A 4XQ9A 1YKSA 3EHDA 1VGQA 3HCPA 2AX3A 4QLOA 3G8AA 2A2ZA 3B82A 2V5AA 3V32A 4AJEA 2JRCA 2VSNA 5SV2A 4UAGA 1R0SA 4ZKDA 1XPUA 3IEPA 3K92A 2IL1A 4PX2A 3PQ7A 1WBBA 4KMMA 5B3KA 4IV5A 2XZDA 4K9DA 3R3ZA 1B7GO 2D7CA 2P1RA 3MAGA 3U39A 2JFHA 5AUOB 2FPPA 5EUQB 4NLLA 1UKAA 3JYOA 1FX0B 1VB5A 5KYYB 2G7ZA 3RRYA 1SXHA 3K1TA 3DHVA 4MUBA 4YRRA 3ILSA 1JHUA 1V4BA 4Y2XA 1QU2A 3NDBB 1YKFA 4PZEA 4H1UA 4JNCA 2D3TA 4Q4AB 2IF0A 1QFJA 1OWNA 1N6RA 1WXGA 3O8DA 1ZUIA 2PSFA 4HKTA 4DQVA 3VX3A 4BVGA 4A91A 4HN4B 3I6BA 4BFSA 1E9VA 5E1DA 1Y81A 1GZDA 1X7XB 4IQGA 5J43A 4HFNA 1HLDA 2I6TA 3UMRA 2B83A 4C4ZA 2WJGA 2JH9A 1U0LA 2WYHA 2I67A 4HEQA 3AUAA 3YASA 4IGIA 3AHHA 4I1IA 4KLRA 2BP7B 4C2AA 2G6BA 4WXRA 4FOSA 2IPLA 1RWVA 4ZK6A 4IZIA 1U4OA 2Q5QA 4PC7A 2Q99A 3CN9A 2FWAA 1YI1A 3PHHA 5JCZA 1K7SN 2VNKA 2ZT6A 3P0EA 2R00A 4K1XA 4A6XA 2W2LA 1VOTA 4TZ0A 1D2AA 1Q84A 1SQSA 4L57A 3E3LA 4LMBA 2OYSA 1TDJA 3CVUA 1XCPA 2Q4EA 4CE6A 5C1BA 1NW3A 3KO8A 1U8ZA 4C1BA 3GO4A 4ZCSA 1K4KA 2OHVA 4A3SA 3ABOB 2P5YA 4MQBA 4P34A 2PX6A 5LFAA 3KPUA 1YZYA 4HXEB 2BI4A 3T3MB 2GK6A 2Y0BA 1XV5A 1K8ZB 2GPAA 3MS2A 5C31A 1OTYA 2B37A 2E2WA 2LCFA 2Z5LA 5EE1A 2B1RA 3KUUA 1NULA 4LDNA 4QU8A 3KQYA 1E7MA 1EWYA 4IQ8A 1X15A 5D1NA 3HY3A 3W79A 4EGCB 3KJXA 4DUYB 4WOBA 2FR8C 3ZLBA 5JI3E 2HK8A 1GWNA 3E9NA 4G4SP 2DY0A 3U0VA 5JMPA 2XWQA 4EW3A 3N3AC 2GUWA 1RCUA 5I4BA 8ATCA 2YNMC 3PR1A 1QP8A 5FUWA 1OU4A 3MINA 1UBGA 3DBRA 4JEHA 3ZWOA 1W8IA 3ZHTA 2ZJOA 1YF3A 1T9KA 1HLGA 3N0XA 3QELA 4UVGA 4K05A 3GFGA 3PE4A 2X3FA 4QARA 1T15A 1UJ6A 4QUDA 1R18A 4JLOA 4CZ2A 3F67A 4JH0A 2VT7A 1AV6A 1PHRA 3BD7A 1E92A 5LZ2A 2QN7A 2J3JA 1QNLA 2JZNA 4KGZA 5LZ8A 4JJGA 5LMUB 1JX6A 1COWD 3J7TA 4MAAA 5EJAA 1VPWA 2L69A 4IFTA 2D5CA 3J80A 3BWMA 3IPYA 1F2TB 5LMZA 2O8FA 3S4YA 1AD2A 2NXEA 4BVAA 2O0HA 2ZAOA 1TKBA 1Z68A 4LWOA 4H31A 4BJHB 1E3SA 3IO3A 2R68A 2IV2X 2FW9A 4WDQA 3N2KA 2PPVA 2Q2QA 3EPKA 3H17A 2PLAA 1PX2A 5DK6A 2BIFA 5KBYA 4INPA 4GOJA 3IAM1 3D02A 4WKNA 4FEAA 3ZZ0A 2ZAGA 2IEDA 4M54A 3GZNB 3K6JA 5G0SA 2BGTA 4MW7A 2VS1A 1Y3DE 4BATA 4F9GA 2C84A 4IIUA 3IULA 3QWHA 1RD4A 1D2RA 3DEFA 3L6EA 2R4UA 1KBOA 4L02A 4R6WA 2QF7A 4WI1A 5FKJA 3RRJA 2CFOA 2L42A 4N0PA 3U26A 3ONWA 2QI9F 5EJ9A 3Q72A 1RVV1 3QSYA 1DAMA 1I3MA 1OXBB 2IP4A 2XSZA 1U3FA 3IUQA 2WHPB 1DC6A 4HDRA 4KN9S 3WY9A 1Z8DA 4E5YA 5BVHB 3DS8A 4RVGA 3ZI0A 1E6UA 4B7ZA 1VHLA 1CJBA 4EUNA 1QQ7A 3I04A 1TM7E 4QQ8A 5D51S 1BWRA 3IVMA 4PLZA 2QG6A 2WDPA 3ZQJA 3QXXA 3X1JA 3OFJA 2GD2A 1SUSA 2QZPA 2Q5FA 3JQ8A 1HSOA 3S2FA 3IC5A 4LQ4A 4TYNA 5B1HA 4B6GA 3QX8A 1KS9A 1ETUA 1GDTA 2VAMA 5IC6A 3CX3A 3PGXA 4BIIA 4W5RA 3BK2A 3HE3A 4Q19A 2ZZNA 4HGNA 2D1RA 3KOOA 3EQ2A 3L18A 4G89A 1Z0AA 2NSHA 1PV2A 2X0IA 3VNBA 5GGYA 1OWOA 3NUZA 4G81A 4DNOA 1SXPA 3BKWA 4YAGA 5K3SA 3T7RA 3AEZA 1BFKA 2XE4A 5EP1A 4MLDA 5G2OA 3OJ0A 2Y1OA 1M5UA 4QRIA 1F5NA 2O1WA 3CT4A 3P0HA 4K3VA 4MS1B 4WK2B 4RQAA 2BR3A 4OHOA 2FFHA 1N9ZA 2CMKA 1URPA 5U4XA 2PGOA 3R3SA 4TWJA 4UBOA 3K9CA 1I3NA 2WHRA 2F8MA 4L51A 2M1ZA 3RTGA 4JC5A 4AP6A 3GLGA 1H9AA 3L4BA 3C6QA 1DTWA 2EDCA 4IP0A 4CL0A 3CKLA 1KEEB 4YJGA 5CFLA 3PC6A 4QPCA 2VEDA 2GD0A 3HEMA 5CCEA 1NUSA 2OTCA 3VR6H 4WOPA 2Z6QA 3R0XA 1D6JA 1E1QD 1JTEA 2UYOA 2WW8A 4XUGB 1USKA 1T3LA 4P83A 1YRLA 2WKPA 1Z0DA 4RK1A 4DJ5X 1U0HC 4MIEA 2EKBA 4U2FA 4RESA 4Y1FA 6PFKA 1XXHA 5M04A 4WZAB 1VBFA 4OHMA 5FT9A 2CUZA 2XMSA 1DIOB 3UT5A 1DAPA 1PHPA 2WDZA 3OE5A 3WKDA 1G38A 1Z2EA 2POQX 3D2BA 3C85A 4ZVLA 1G2OA 1YR9A 2ZIGA 4MRRA 2F8LA 4TRMA 4YRQA 5CDTA 4GOKA 4QEKA 2QMZA 5FO0A 2DFLA 1M72A 1O9HA 1OAAA 1QORA 4CMEA 1OX5A 2H11A 3AZQA 5EUBA 2ZYVX 1XEXA 4RANA 2BLLA 1JKJA 5DM1A 1ZIPA 2HXSA 2WSYB 4BNVA 4CPDA 4O4JA 1W94A 1Q77A 1YZFA 2FSPA 2XUJA 4RMNA 5DI3B 4MQ4A 5FULA 1Y9EA 2YMMA 4ID9A 3H0EA 4E07A 3CVXA 4RFSA 2XDYA 2WZDA 1ZCFA 5KDOA 3DE2X 3K16A 4YK7A 1E66A 5ECGC 3Q15C 4YPOA 3OY2A 3WLLA 1IVSA 3EVCA 3I6QA 3D8HA 4G37A 4B81A 2G4LA 2JGDA 1YO6A 2Z1MA 2GUGA 1L4NA 1Z7GA 1JNXX 1DOHA 3MWDB 3QVGA 3U9TA 4DCCA 1Q6ZA 4WW0A 4FYYA 1KDYA 1EHYA 2XF2A 4IDPA 3ZW8A 1WEKA 3CO5A 2HIMA 4WY8A 4AO8A 1KAEA 2FPMA 5B3JA 4ZMBA 5H0IA 3BE8A 1JT2A 1VBMA 1RZUA 2Y27A 3I2FA 1PVVA 2QRZA 4QDXA 2H2FA 3RC3A 2IU6A 3ZHCA 5EHGA 2VPWA 4MVJG 4R0MA 2XEDA 2PT5A 5FBQB 1XROA 5IVKA 4UDYX 3FPJA 1BGWA 2CLHB 3AI3A 2IHZA 2YIJA 4PX9A 3V1UA 3DP9A 4B4OA 1PNVA 3NAZA 1M1XB 1QYVA 1RXYA 1XRQA 3P2YA 1GKKA 4MA4A 3TW8B 3DCJA 3ENZA 4MMYB 4FYWA 4IIVA 4N40A 4TQUS 3H0KA 4GMHA 4MKGA 2E0IA 2DT8A 2MR5A 5G4LA 3NHSA 5TLSA 3AV0B 3T7TA 4EHLA 2FWNA 1OOEA 3L93A 3RU7A 3O4IA 4JUDX 3LKVA 2PUHA 4KBYA 4MCIA 1DCMA 3HU2A 2CJYA 2QM7A 2H08A 5BOSB 2LE0A 2H1FA 2PUDA 3ZJ4A 4MS3A 2LKCA 1E0DA 1XAIA 3IA2A 4UOQA 3U19A 4H3SA 2AZDA 4DIBA 3D3QA 3GVXA 4LAFA 4CTNA 2DLCX 4KVFA 4HMPA 1KIFA 2BW0A 1BKDR 2XNDD 4UTRA 3CMMA 5C5CA 5F5LA 3JQ7A 2BGUA 5BPHA 5LP6C 3C15C 4JKOA 4MA5A 1H4TA 1QHYA 4MS4B 1LC3A 4X8OA 3TI9A 2HSZA 4QXAA 5G41A 3D8UA 3KQTA 2VYNA 3H1EA 4J7XA 4DVJA 3RAEC 1Q1BA 3TVYA 1VDMA 2ZRIA 3C8ZA 4J1SA 4QOJA 4CLRB 2C3YA 4DCOA 1QHIA 4B74A 4PBSA 3A6PC 2D5BA 3AUKA 3WP1B 4D7AA 4MUAA 3CUVA 3IOBA 1Z13A 4HXFB 3N74A 3EIFA 1NKSA 5JAHA 2AN3A 4OJTA 2ZJAA 4LOKA 1J25A 4KR3A 1ST2A 1Y1TA 2G7MC 4I9GA 5BQXA 1BOFA 3LT2A 2Q9CA 4LGVA 2YFHA 4MVJP 2AR0A 3D4IA 2DBYA 2BTQB 2IYFA 4M98A 3VOBA 3H1PA 1QHHA 2FZGA 3EXEA 1RJ9B 2W8BB 2W00A 3HB1A 3LRTA 3P19A 3SC3A 3EXIB 3QY0A 4K9LA 3UUEA 4EY8A 1I7DA 4MHTA 3L8MA 2WJJA 4J7AA 1E3WB 2A5FA 2JFPA 2K7ZA 3HKEA 1YRAA 3BH7A 4NBVA 1U1GA 1XEAA 3N05A 4H17A 4BPRA 1O4VA 5JNSA 4PN3A 1WXEA 4QDJA 5IJ0B 3FDJA 4UMEA 3LUBA 4ZJPA 4WV3A 3T4EA 4IVQA 4TRJA 1A9TA 1NX6A 1TA0A 1WCIA 2Q6IA 3AGQA 3DJYA 3GPBA 4ZT3A 1ZUHA 1UBOS 1X7ZA 2GJ9A 2WD7A 2ZIFA 3BOSA 5SYAA 5IWAB 5DHAA 1LS6A 2ERYA 2JCYA 3L82B 4LY6A 3ZVRA 2RIRA 5AVSA 2Z9BA 1WQ3A 1PT9A 1YFKA 3VSAA 4PFSA 4D9JA 5D5PA 3MGBA 4GRAA 1KVUA 5C5EA 2JJ2D 1MB4A 4ENUA 1LLUA 2ZWVA 5EUCA 4GECA 4Z53A 1V5IA 3BDVA 2QM0A 5ECWA 2G3YA 3KELA 2AI2A 5F3DA 2AMJA 1KZ7B 3KQVA 3OCWA 4CDRA 3VVBA 2ZI9A 2NVWA 4NJMA 2IPXA 1R7RA 3PTZA 4R1UA 2ZRFA 3PVCA 3HCOA 5C8YF 4O8CA 5K45A 2WT9A 4DEXA 3MJHA 4XPIB 2MSCB 1GZVA 3KYDA 1O0CA 1YVPA 3MUEA 4N3AA 3LBHA 3ROEA 3WSWA 3W9SA 5F23A 2B1JA 9LDTA 2QS9A 5DJ5A 5DM70 3KQNA 3CINA 2EARA 1ZMTA 4BUCA 2ZVQX 4KKVA 3RWOA 3JD4A 4R83A 5DNDA 4OXNA 2ZTVA 4DC0A 1HNNA 3DZHA 4AS1A 1EVYA 3K8YA 3OTHA 1XF1A 1YCFA 3HM2A 4KMSA 3GPLA 3I2JA 1XCOA 2QGZA 2ZR8A 3HCRA 3LLMA 3RVKA 3SZGA 3BD8A 4JI4B 2IA5A 1LCIA 4RWEA 4RKYA 1P2DA 2BF7A 2ZJ3A 1LX6A 1L3CA 2EF0A 1OV6A 2I1QA 2IHTA 3NHMA 4LF5B 4X90A 3R3HA 4XASA 3OLQA 2XYRA 1QAQA 3UWPA 4ALIA 1WPXA 1P7PA 1TYDE 3UZUA 4XLTA 3UHAA 4F3YA 5A3JA 1R3DA 2NVBA 4N7RA 4C04A 4KQ6A 1NW9B 2C58A 2WIGA 3HY4A 5K0SA 3DONA 3SI7A 3COSA 3NH6A 5J1SB 4W99A 1B8OA 3AEUB 5ALHA 1TIBA 5A05A 3ZN2A 1QE3A 1RYZA 2CDCA 4FYJA 4WK4B 4DUZB 2HN9A 1KL7A 1PD0A 3CB2A 1Q92A 4GU5A 3VYTB 2PMFA 2YC2C 1CEQA 4DLRA 5MF6A 1SRQA 3H1TA 4IGEA 4NDZA 1IBMB 4EA8A 3W2GA 2WJPA 2YHUA 4KO1S 1X80A 1WB9A 1XVAA 4CKXA 4CIVA 3DOEA 3IT0A 3CNHA 1O8CA 5ALTA 2JFYA 2ZK7A 3EH2A 2X7JA 4RLQA 3VNAA 4CG2A 5JT1A 3LUJA 5HCUA 3QRWA 4YROA 3AOEC 4BFCA 5IX8A 1VG1A 5K3CA 3W0LB 2FCRA 3SNKA 2INGX 2GJAA 4URHA 3AK4A 1HRKA 1RJWA 2PMBA 1DO2A 1AKYA 3OHSX 3HKCB 3O2JA 4ZHQF 3ZCVA 3KPJA 3QKRA 1Z2PX 5JDCC 4HF7A 5A4JA 4QQKA 2VPIA 1YRQA 4HXYA 3TDNA 4L8GA 1HG1A 2ATIA 2ZT8A 4IZOA 2FR1A 1U2EA 3I64A 3L0BA 4P4NA 4WWHA 5J5CA 1WPGA 4M9CA 4CM9A 3I01A 3HZZA 3KKLA 4RA6B 3P71T 3V8MA 5KSPA 4E2FA 5BW5A 2V7VA 1JSXA 1Y6FA 4R3UC 1FP6A 2A1UB 4BNIA 3U3KA 4MKIA 5GTDA 1O96B 3RIHA 5JZ9A 1Z5WA 1VYHA 2YZ2A 3EPRA 3TTYA 3WB2A 1PDVA 3GRZA 2CFIA 2KJQA 3ISTA 1QIGA 2I8CA 1KI2A 1V9CA 1QYIA 1LLFA 1HTTA 1SVLA 3FNGA 3G6KA 4S2UA 4V0ME 2CVPA 3VZCA 2NTNA 4MV8A 4IMJB 3O2SB 1YJBA 2GKOA 1DFIA 1N2JA 1PWYE 2XT6A 1B2RA 2V9PA 3BEOA 1R1DA 1SVMA 2QAGA 3FWNA 3KSMA 1VC2A 1HDIA 2PSHA 4CVNA 4P4SA 8MHTA 3CLSC 2HGZA 1DADA 1P1RA 1XQ9A 3TK1A 4IQ0A 3TZEA 3WO1A 2VSFA 4MDEA 2ZI3A 4N01A 3VC2A 5LNK1 2OYCA 3PCTA 5D2CA 5AVUA 4C78A 4C4TA 2ZIUB 1JI0A 1XL1A 1XKQA 2OUIA 3CE6A 3FKSD 3P2JA 3QLUC 1A82A 3AL3A 3LTEA 1T0UA 2XHEA 3A05A 3X0DA 1Q3HA 4LYHA 2MCFA 3PDCA 3GPCA 4OV6B 3PC8C 3CV3A 4N5DA 4PRLA 3AY6A 4R69A 5IKOA 3MILA 1LWOA 3CXRA 3DKVA 3G9UA 3B3AA 1JLMA 3DFZA 1ISJA 1LPBB 2C03A 2WIKA 3DQQA 5AJWA 4PLGA 4GRIA 1ZD3A 4PRYA 1WB4A 3QEMA 4V0SA 3PTAA 2X77A 4ZOLB 3A9RA 5FNVB 4C05A 5K0CA 3AL0C 2JGJA 3FIUA 3LDFA 5C8DA 721PA 1DDOA 2K87A 3NJRA 4XLZA 2O4UX 1MAUA 2YCLA 2L17A 3ASVA 3WQQA 3NPAA 1WZUA 3A6KA 3A3YA 5EWJA 4QLAA 5BT8A 1NXVA 3KQUA 3DH0A 5B5SA 1LXCA 1KOGA 2WTMA 1ORDA 2HTEA 1IN6A 1EUCA 5ALKA 3QLTA 1HE4A 2JBAA 2WAYA 1XE3A 2AMYA 3C7DB 1PDWA 1P9OA 1KQGA 3QA9A 1DBPA 3CEHA 3TLMA 5JYEA 5AMXA 1KC3A 2IXAA 3DZBA 1ANKA 3EX7C 1ZY2A 4OHXA 1C3JA 2VOEA 4A5OA 4LC9A 3GEDA 2NG1A 2RH9B 1ZNYA 3AU9A 3D8RA 4B5KA 2V0GA 1POXA 4L9WA 2VJBA 3GA5A 3SPXA 3SJBA 3QNMA 3UIEA 3WAGA 3I30X 1J0BA 2WYOA 3G1WA 1TTTA 1G6Q1 3DE3X 4XGIA 4CMGA 2XUQA 3O6VA 1RBQA 4P84A 4HNAA 5JDIA 1NYLA 3UAZA 5KDLA 3ECAA 2IPMA 4ZGWA 3ZDFA 3SQXA 4F9TA 4DRZA 3JZFA 3TMKA 4AC9A 1L3BA 2KWIA 3OWOA 4TSFA 1NYQA 4ZKEA 2IPOA 2BGNA 4X1YA 4F1JA 3AH8A 1AMOA 4RK0A 3F5MA 4KQ1A 2JH8A 1JG1A 4LJSA 1E1YA 2WABA 4HAOA 4DV2B 1MH9A 1C2YA 1VKNA 2ZE5A 3R3XA 4G5XA 1N6IA 4BNXA 3DMNA 3QJYA 3H9GA 1Z0KA 2ECFA 1J1ZA 4F4CA 5FI5A 3EPHA 5B30A 4MJLA 2FSVA 4Z4HA 2IZ7A 2QUIA 4Y0AA 2ZCVA 5B6PA 3CPSA 1K0UA 3K6SA 2VNHA 3D8NA 2ORVA 1WVGA 3OPYI 2GZ1A 1XHLA 1JDSA 2ERXA 3C3AA 3JPYA 3BFJA 4HDKA 1HNXB 2IEZA 4I5DA 4DJFC 1MO2A 1JECA 1CQWA 1A9OA 1M1NA 2WILA 3ISJA 4J2HA 4P7KA 4RZQA 3QA3E 5DP2A 4AKGA 2AD5A 3ZZUA 5A6VA 1L3IA 1RR6A 5KC8A 1IK4A 1YVUA 4YGXB 1MO3A 3AETA 1PZFA 4RGYA 3SZRA 4PANA 1OROA 3EIXA 3QENA 2IPNA 4FYXA 1WUKS 5K1ZA 1R6UA 2WPNA 4JGGA 3BORA 3QPWA 1UWLA 2LDBA 2O8EB 1M10A 3MFYA 1S7GA 3NVMB 1I4DD 2W58A 3KL2A 4MEAA 3AIIA 1J8YF 3EC7A 1NMXA 2C5GA 5FBKA 3UHJA 1MEJA 2WB2A 3WMEA 2W6QA 3M1YA 1CQIA 3MT8A 4P08A 5ALSA 3E15A 1ZNWA 3HO8A 3F1KA 5ALXA 5KREA 2PH5A 1MVOA 4MKXA 4E13A 1FFSA 3ZXSA 2YUIA 2BCEA 2Q6VA 1Y7LA 1NVUQ 4TKLA 4ILEA 4W8HA 2LCQA 1JIXA 3QTBA 5EHNA 1AKMA 1G17A 2VAPA 5HRAA 4RKRA 1G21A 2I4RA 3C45A 5ITZB 4UNQA 5DKFA 4JI7B 4XUEA 3P9YA 5F98A 2GBIA 1F0PA 1K4MA 2GZMA 4LVNA 1WKBA 2PUGA 2D0IA 3PDIA 4RV9A 1MG0A 5I9MA 3VU9B 4HL6A 1IQPA 3TTXA 5F7OA 5LP1A 2H92A 1CEYA 2F3UA 1AX9A 2I2WA 5BWMA 4PPGA 4JVNA 4PHHA 3C8HA 3TG2A 3GQBA 2VDUE 1FXUA 1BSVA 2DFDA 1V1MA 2GHRA 3OTGA 4NIMA 5DLQC 4EF5A 1E3JA 3P4UA 3QVLA 4GZ5A 4UUPA 4LXIA 1T8SA 2GN6A 1C1HA 1U7UA 3FNBA 4PGGA 3DMGA 4FYPA 2B3DA 3M6UA 4EMTA 3RK4A 4UM9B 5BNWA 1G0OA 1LBTA 3NTVA 4FHZA 2FUG1 4I4IA 4N1AA 3WLOA 2DPHA 2REQA 2E89A 3OT1A 2XMQA 4ZPJA 4KOEC 4CN9A 4RBNA 1IBSA 3Q7QA 3HGMA 2IODA 3G8DA 1HGXA 4AAYA 3K35A 2NZ2A 1MBZA 2VDRB 1JVSA 4B33A 5ILOA 1FVOA 2X0DA 5JTTA 1N5IA 1S2OA 2IKSA 3NBFA 4QSHA 4AUMA 4D82A 3FFWA 2NUTA 4OK6A 4H6WA 3JQGA 3UFXA 2WV9A 3B7WA 2Q5HA 1UMBA 4HQFA 2XVXA 4YRLA 5A03A 3I37X 3TZCA 2VDWA 4K9MA 3LQYA 4FZ3A 4HGZA 3PNLA 2WFAA 2IT1A 3CH5A 4N8DA 1XCGB 5IZCC 5JSUA 4QYMA 3IDQA 2FEWB 2VATA 2W9XA 3WWOA 1Y8QA 4LNUA 2P9YA 2VPXA 4JL5A 4MWDA 2ZJ0A 3CTMA 3OHMA 2HNAA 3O26A 4RK6A 1MC4A 1WR8A 2HO4A 3GRFA 4TS3A 1GKYA 4ZMRA 4ROTA 5HQ3B 1ULAA 2G1KA 4WNIA 4PZLA 1P2GA 4NS4A 2GWRA 4B46A 4BV2A 3NQ41 1PVOA 2X15A 5I9IA 1DIHA 4A2CA 3DHEA 2C7QA 2OCIA 2ATVA 3ON5A 3ZPXA 3AF3A 4XWYA 4KH0A 1IXKA 3K32A 4QDZA 3RUCA 3QSGA 3HBAA 3ZEIA 5JD4A 1R0LA 2YY6A 2TECE 4K88A 3SHWA 5FWAA 5T8KC 2FNAA 2PWZA 3SZLA 4HYTA 4DNPA 3OOSA 4XDZA 3R5HA 1QFMA 3DV0B 1J2EA 1WF3A 4HWGA 3DF7A 1EP1B 1E3MA 1NOIA 3H2BA 3MJEA 4CM5A 5A5FA 1KMMA 1XZJA 1E1LA 1RHRA 1LFAA 2GFHA 2ZDQA 3PGA1 3SIPA 4RD2A 4TGLA 5C8YB 3PX7A 1AO0A 1KAQA 4K9RA 3ORQA 1DWPA 4QDTA 2QG4A 3D0KA 1DG9A 3AI2A 5ARBA 4JI0B 2YJ3A 2IITA 4IQ4A 4QBKA 3HXMA 1P1FA 3W04A 5BR1A 1JV2B 2HKIA 4PYIA 3IBCA 4V03A 3TOVA 4AWXA 5FWYA 3RYTC 3ZYZA 3K6KA 4OQDA 3PQ2A 4RV4A 4QICA 5MHTA 1IIBA 3I6MA 3VX4A 5JROA 3K0CA 4ZRNA 1RADA 1E4VA 5JG7A 4NBLA 2AK2A 1FYDA 2L0XA 1EM6A 1ZBQA 2I2DA 1CDZA 1UPBA 1JJFA 2E48A 2GTIA 2KPOA 3AP1A 3TAHA 2PLNA 4CKBA 3KXIA 5JAQA 3RUFA 1U8UA 1DEKA 4MUGA 4P4GA 4OKIA 3KYCA 2P9HA 3EQ9A 3DXYA 3G5MA 1OKKD 5AI9A 1CPYA 1GFSA 1AH2A 5AW8A 2AOWA 1P4HA 2BMAA 3I8XA 5AR1A 5ESWA 4RHXA 4YJ3F 4RZ3A 3L4SO 3LUAA 5FOSA 1JLLB 3U49A 2PEZA 4ZQHA 1OV4A 4NY1A 3UPDA 3RV3A 3PA6A 3OQMA 3FHTA 3GZJA 4P93A 2Y1WA 3PA8A 1AKRA 2OPBA 3KLOA 4PSCA 1EM8A 2CXQA 3RF6A 4Q4CA 1LK5A 1YBHA 1SOVA 3PBKA 2OO5A 2X8JB 3WLNA 5IT9A 3MUOA 2QUZA 3FUWA 3MOIA 4E08A 3NVKI 5JQGF 5CA1F 1MKYA 3U7QA 3CCCA 1DC4A 5ELXA 1BX0A 5I7VA 3D1JA 5LOVB 3HRKA 2RG1A 4TLCA 4CU2A 5IDVA 4CLDA 3IQWA 1DHRA 2IOYA 3BXPA 3EQ8A 4YCNA 5GADl 4RADA 3PYXA 3TLKA 1Y5IA 5JXGA 2Q4TA 1ITZA 3LVFO 3B9PA 5CK4A 3UGQA 3E8SA 1BN6A 2NM0A 1NBOA 1CUXA 4JB8A 3ORSA 2XMPA 3CA8A 4K9QA 3EF3A 4IL5A 2V58A 4YRBA 2IUUA 4AMUA 3RFUA 4AJPA 5FPSA 2V9ZA 3L1UA 5EKUA 4MRMB 4RGQA 4HWKA 3UHPA 3SEZA 1TGYA 1I6KA 4G5SA 3N8GA 4AJ2A 1QIDA 4URVR 1H6CA 1FFEA 1KQPA 1VTKA 2CD7A 2FSUA 2J1LA 2R6FA 3E61A 4HMQA 4KE6A 2C5AA 3JS5A 1Y8AA 1B0PA 5T3YA 3L8GA 5CUQA 5A3SA 1Y4ZA 5LLSA 1RWBA 2ZBGA 3GPDG 4ND2A 1D8TA 1U9CA 1MOSA 2OBFA 1M7GA 4BV3A