4L0MA

Crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from borrelia burgdorferi b31 bound to adenine (target nysgrc-029268 )
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
MILIISAMQEESEEINKILDNKEEIVLNDYLENKKIYKGKILGKDVISLTTGIGKVNAATWSSQIISKYKITHIINSGSSGGIKENSNLKILDIIVSSETAYYDFDLTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLETIKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Borrelia burgdorferi B31 bound to Adenine (Target NYSGRC-029268 )
rcsb
source organism Borrelia burgdorferi
molecule tags Hydrolase
molecule keywords putative 5'-methylthioadenosine/S-adenosylhomocysteine nucle
total genus 79
structure length 237
sequence length 237
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l0mA00
3SCZA 3OOEA 3K8QA 3DF9A 3UAVA 3K8OE 1T8YA 1K9SA 4H1TA 4M1EA 3BGSA 2RJ3A 4DARA 4L6IA 1A9TA 1PBNA 1QE5A 4TXLA 1CB0A 1U1EA 2BSXA 1V3QE 1T8SA 2OC4A 4EARA 3FB1A 4D8YA 5CXSA 1A9SA 4TTAA 3FAZA 4OF4A 4GKAA 1B8NA 3PNSA 4D8VA 2AI2A 1RSZA 3DPSA 3OZDA 1ULAA 4F2WA 3GB9A 2ISCA 1JDTA 1I80A 3DJFA 3UAWA 4DAOA 3C74A 1PWYE 1ODIA 2GUWA 5F76A 3MMSA 4YJKA 4YNBA 1RFGE 3OCCA 4P54A 4R2XA 5F7XA 3BSFA 4MCHA 3F8WA 3OZCA 4F3KA 5EPUA 4G89A 5ETJA 4JWTA 1SQ6A 3P0EA 1RXUA 5DK6A 1VFNA 1Y1SA 1N3IA 4YO8A 3FUCA 4R2WA 2OXFA 3E9RA 3KUKA 1RYZA 4E1VA 5F73A 4PNPA 4TXJA 3QPBA 3TL6A 4F1WA 4MCIA 1ODKA 4L5CA 4FFSA 2HN9A 4KN5A 3IEXA 4OEHA 3FWPA 2A0WA 1U1FA 4L5YA 1OTYA 3U40A 1PF7E 1PR0A 1U1GA 5IU6A 1TGYA 2IQ5A 3KVRA 1RXCA 4DANA 1TCVA 5CXQA 2HRDA 4LKRA 4DA7A 2XRFA 4EB8A 4TS9A 4RJ2A 1YR3A 4WKCA 1YQQA 1T8WA 2H8GA 1JPVA 1NC1A 4DABA 5FAKA 1ECPA 1TD1A 1V41E 5B7QA 1FXUA 1YBFA 3E0QA 1ODLA 4D8XA 4MARA 4DAEA 1Z5OA 3MB8A 1RT9A 3PNPA 3NM5A 1RR6A 4WKPA 3KU4A 4JOSA 2HSWA 1Z37A 4NY1A 1VMKA 5CCEA 1RCTE 2ON6A 3PHCA 3ONVA 3OPVA 4LDNA 4X24A 4GLFA 1Z38A 1V2HE 3BL6A 3UT6A 2OECA 1Z34A 1V45E 5F7OA 3NBQA 5F78A 1SJ9A 4I2VA 4BMYA 4NSNA 4DA0A 3OZEA 3IOMA 5K1ZA 1PR2A 1SD2A 1Y1QA 1OUMA 4K6OA 2I8AA 4UC0A 4QAQA 4D98A 4OGKA 4DA6A 1Y1RA 3EUFA 4QASA 2P4SA 1JYSA 2OC9A 1U1DA 1U1CA 1Y1TA 3UAYA 5CYFA 3LA8A 1Z33A 3P0FA 1B8OA 3LGSA 4G8JA 1A9RA 3FOWA 3OOHA 4IP0A 4WKBA 1OV6A 3KHSA 3ENZA 4DA8A 2A0YA 4WKNA 1Z5NA 1YRYE 4TXMA 1YQUA 4TXNA 4U2KA 1T0UA 1XE3A 1ULBA 3INYA 5F7JA 5CYGA 4BMZA 1A9QA 1JE0A 5EUBA 5F7ZA 4YMLA 1ODJA 2AI1A 3O4VA 4F3CA 3T94A 3D1VA 3LBAA 5B7GA 4QFBA 4WKOA 3UAXA 3EEIA 1PR1A 4PR3A 1WTAA 3DDOA 4G41A 4TS3A 1T8RA 1OVGA 4BMXA 2B94A 3BJEA 4JP5A 4GMHA 4M3NA 1JDVA 2QDKA 5I3CA 1Z36A 1JDUA 1A9OA 1NC3A 5C80A 1M73E 2QPLA 1LVUA 1Z35A 3DP9A 1CG6A 2AC7A 2A0XA 1VHWA 3FNQA 3EMVA 2QTGA 1JP7A 4OY3A 3KVYA 4M7WA 4ECEA 1JDZA 4OGLA 3E9ZA 4TTJA 2QSUA 1A69A 1PW7A 4QARA 4QEZA 4GLJA 1JE1A 3OZBA 1LX7A 1PK9A 5B7NA 1G2OA 4TXHA 5B7PA 1Z39A 1LV8A 3GGSA 1C3XA 1K27A 1Q1GA 2PGAA 2A8YA 1RXYA 1ZL2A 1V48A 1K3FA 1TCUA 1Z5PA 1SD1A 4BN0A 3ODGA 3PHBE 2HWUA 2Q7OE 1PKEA 5EFOA 3OF3A 1Y6RA 3NM4A 1PR6A 4LNHA 4D9HA 1NW4A 1RXSA 5CCDA 4F2PA 1A9PA 1PR5A 5JPCA 4L5AA 4L0MA 4LZWA 1OU4A 3NM6B 1ZOSA 1V4NA 4QATA 2AI3A 1TGVA 4TYMA 5F77A 1VHJA 4LNAA 4OJTA 1OTXA 3O6VA 5IFKA 5KB3A 3EUEA 1Y6QA 4R31A 4NS1A 1PR4A 1PK7A 2I4TA 4TTIA 3KVVA 3UAZA 2QTTA 1JDSA
chains in the Genus database with same CATH superfamily
1DHRA 2HF7A 1KRHA 4JBLA 5FD8A 2O2XA 2XGMA 3G85A 5IPFA 4DCPA 4I4NA 3GDGA 4DEXA 2IV7A 1BFUA 3PL5A 3JZIA 1J5PA 2FSIA 3KOWA 5EXEA 3PUKA 5TDHA 1M2VA 4B71A 5ALKA 2XUAA 4HR7A 2YUIA 3G5AA 5LBTA 1HZJA 3HKDA 3CISA 3EA5A 1GY8A 1GPAA 4XXHA 3TS1A 3L6UA 1WTCA 2B4YA 4L4RA 2Z6VA 2NN3C 5CVJA 2OOKA 1FBTA 2GCPA 5L51A 4DCTA 1OMOA 2EJTA 1E6CA 2BFCB 2D8AA 1KK2A 4R5MA 3L49A 3RO7A 3RVSA 2AN5A 4GVLA 1Y6FA 3TSOA 1NNLA 4ZJPA 1MZVA 2EOAA 2JZNA 2OC4A 3GRRA 4D3YA 3JZFA 4FQ8A 4PHHA 5JI2E 2NZJA 3SE0A 4GEKA 3K1TA 3AXSA 1J42A 4OMFG 3MUNA 3THXA 4DUPA 3KPYA 5A5DA 5A9SB 1X1QA 3PEFA 4R1UA 1XU7A 4V0ME 1D2NA 1JBEA 3KPVA 1YC2A 1XJ0A 4GKAA 2VNSA 1X38A 4I3HA 3U7EB 5K8LA 1RABA 1RE1A 2I1QA 4BNVA 3UJ3X 3CBGA 2JLXA 4NAVA 5AXAA 1Q7BA 4CT4B 4DLYA 4JXXA 2D5LA 2XNSA 3E3AA 2OE2A 3KWLA 4HBGA 4AJHA 4EQZA 5KVAA 4G9BA 3ZGOA 2PH1A 4BJ5A 1P4JA 1LDGA 1EJBA 1QTRA 4R9UC 2D1TA 6ADHA 3QLVA 5JXHA 1DEKA 2ZBPA 1M6YA 1OA1A 1GNQA 3DJFA 2X4GA 1RXIA 3L46A 4GS5A 5EC8A 1PBTA 1L5MA 2OCAA 3ND7A 4ACBA 4OXNA 1L5ZA 4KBYA 3WGIA 2P68A 4N54A 1AMNA 2D1RA 3GXBA 2XZDA 5K0JA 1KARA 2QL7A 1T36A 3IEPA 1B1AA 1MO6A 1KJNA 4L76A 5CW1A 5BSMA 1CUFA 4QJBA 2IS6A 521PA 4GI5A 5L3SB 3KPWA 5F7XA 3AI2A 3ZXUB 4BCCA 5J2TF 4UUAA 3OZCA 3LI2A 1U80A 4H16A 4NNPA 4H1HA 4BIMA 2P6NA 3CM0A 3Q7SA 4NIMA 5E7MA 4MWOA 1KFKB 1TX4B 1WCIB 3IUBA 3NU1A 4HEHA 5EJ7A 2XCLA 3H1TA 4X93A 4EY4A 1QK4A 3WLOA 4ETIA 3CVYA 2LRHA 2VJDA 4OA8A 4U9HS 4X63A 4DYHA 1NQ5A 1CRPA 1J1IA 1C1XB 1OBVA 2YVUA 4OYLA 4REOA 4XIFA 1IY1A 3V1MA 4CIDA 2QBYB 4YO8A 3BE5A 4WMLA 5EZ6B 3EIQA 1S8FA 1TT5A 3ANTA 3ABSB 3T3EA 2NSYA 4C89A 5GJBA 3OC6A 3N9IA 5AK4A 4Z0HO 1GGHA 3JYLA 2AOWA 2FQXA 1YHYA 3GARA 5EP2A 3RLFA 4M98A 1NONA 3W3AD 4B6RA 4F91B 3WYNA 2JLRA 1DQPA 3EUAA 3LBIA 2IWHA 2QLFA 1O03A 3A31A 3L0IB 4LQCA 3BXFA 1OFUA 3GDWA 4IQ0A 2A9OA 2I2WA 3F6BX 2OQRA 1LDMA 3O0DA 2HDOA 2V55B 4JLMA 4NJMB 4QXOA 4WZBA 4DPMA 1J22A 1OPXA 1U8CB 3GJYA 4ETNA 5IJZA 5IHXA 1KAQA 4LEIA 2O3JA 4BTVA 1ENPA 3DTNA 3RW9A 4B34A 3GBVA 3KOMA 4HL6A 2Q4OA 4JOQA 3FNEA 1RWBA 4OHMA 3LTEA 1OTYA 1ACLA 1J8MF 4C20A 2PUEA 1LA2A 1VSTA 5F5XA 3NUQA 2AD5A 2UZ1A 1Y33E 4NDNE 5KYTA 2VQ6A 1V8DA 4GEGA 4LYJA 1E1NA 2WTXA 4CUJA 4Q4CA 3DHWC 3ZWVA 1TGYA 1PZFA 4GC9A 4O33A 1XLWA 5DMHA 5DLDA 1Z73A 5IVPA 2M2IA 2R6ZA 4HVAA 1E4YA 2Q5QA 1RKXA 1W76A 2QY6A 4MWBA 2O8NA 1QX3A 2A9VA 4B3BA 3GFVA 1E64A 3IJ5A 3RYHB 2BV3A 4LWQA 4BLTA 4R68A 4KMMA 1SBCA 3OOSA 3S6JA 5C31A 2B37A 3S2YA 3UT5B 4YRAA 1THMA 2Z0MA 1QE3A 5BQFA 4LXHA 3HDVA 1R0WA 4PLYA 4KZPA 1N4AA 3IQHX 1CEQA 3SZGA 4RZXA 2O7NA 3AILA 4Q19A 1X1RA 4FGWA 3I6MA 3HXKA 3UB4A 3LU1A 3C8MA 1U0SY 3H97A 2BHNA 1DUSA 2ZAOA 4FT4A 1AGXA 3K0HA 4YGYA 2NUTA 2ILTA 1VG8A 4UHCA 4YP1A 4NPHA 3I1FA 2E6KA 1OX5A 1QUEA 2POCA 2VAMA 2WJAA 3B9RA 5JADA 3KSZO 2IBTA 2R79A 2R1VB 2QX4A 1B43A 1KNXA 4IOJA 2GPWA 2BGUA 3QYJA 4JOBA 4AZSA 3E0QA 5CBPA 5LD2C 1CQIA 4YP5A 1XVTA 4MARA 4DNPA 3VR3A 5MDHA 1D2HA 4OUDB 4C4YA 5BORA 3SJAA 3V7NA 3L8YA 1OOEA 6AT1A 3KETA 2FZ5A 1Z0SA 2WFLB 3LKVA 3D3NA 3ZE9A 3K5WA 4BQQA 3GLGB 2IHBA 4B6SA 2ZQZA 1KKLA 2BF7A 4A2WA 4YJFA 4Q9NA 3IQFA 4G1CA 1M8PA 2OZEA 3H5LA 3A4MA 4WXYB 4Z3KA 4JB2A 2OYCA 1FUEA 4LVCA 3WE7A 1WVGA 5MHTA 4OBBA 5TT1A 5CLFA 5K4GA 2J5QA 4AY6A 4E11A 2P9YA 2ON6A 3GRCA 3KEGA 1OX4B 2HU7A 4XWAA 1RXWA 3PD0A 2AT1A 1NP6A 5DNWA 4X8MA 5BUZA 1SQSA 3LOQA 1T4CB 3H1PA 4L08A 5AESA 3OECA 4FC6A 2HOQA 5KVQA 3T1VA 4MB0A 2GILA 3JQDA 3MGGA 4ARZB 3SPXA 2CMKA 1SQ5A 4HADA 4OQDA 1ZUIA 2YHUA 2B2CA 2WJJA 2AWNA 4L85A 3U7QB 2CXPA 1VSVA 3LUKA 3WR5A 2HSGA 4BBJA 3CLRC 3QVVA 3OWXA 1COWA 3LDAA 4HXYA 3S5UA 3KSBC 1RBZA 3OLZA 4JXZA 3I9LA 1QHEA 1ZOIA 5GONF 4MDYA 3ZDYB 2WJGA 3O91A 5AVSA 2OXIA 5HQ3A 3D6HA 3ND8A 1ZA1A 1BVUA 1N5RA 1WKVA 1Y1QA 2IPOA 4X94A 3G2MA 1XCBA 3SXJA 1DIRA 5HBGA 1DU4A 1MRSA 3QE0A 1J9GA 2R44A 1YB1A 4UD6A 4M37A 1YDWA 2OORA 2FOXA 3DTVB 2VA9A 3E3NA 3PJEA 5T3YA 4UDYX 4BO6A 4EG7A 2DTEA 1NBAA 3BGDA 4KP7A 1K7YA 4QT0A 5L4NA 1POXA 3HDJA 3BGWA 1EIZA 4P4GA 3TNLA 2P3SA 3NTRA 5DN6A 1YQEA 4OQXA 5AW6A 1SU7A 3QX3A 4IG4A 1Z6AA 2CUTA 3K05A 1BVRA 3MJDA 1W36D 1C81A 2G5GX 3QVJA 5B2ZA 3QVUA 3TRIA 3UK2A 2GPJA 4U2DA 1DT3A 3ZJYA 5E7QA 4QD3A 3PFNA 1MC8A 4YUVA 5JCXA 3PX7A 5KU1A 4P7GA 1MVOA 3GGJA 1Y1TA 2YXPX 1VIVA 2PRJA 4R0MA 3PQ8A 3BB3A 3UGKA 2XUZA 1YR8A 3ER6A 5JTUA 4ENTA 4B17A 3U7QA 1EVYA 1RCUA 2H7VA 1OXBB 2JBAB 2PKXA 2DULA 3S44A 5ICGA 1FFXA 1YSCA 2XD9A 2ZSKA 2GZDA 5CDSA 3Q5GA 4EHJA 4HH1A 2O1XA 2E4AA 4JGIA 5EP1A 1NRJB 4A8JA 4RTMA 3SF0A 2BGGA 3AVXA 8ABPA 2VNIA 2W2OA 4MDEA 1NSYA 1VXOA 2D5BA 2JCXA 1UBTS 5FOVA 4TXMA 3WGUA 1ESEA 1ZPDA 3P8ZA 4Y1EA 4Y7DA 4BX3A 1CQZA 5WRFA 4ER0A 5TEVA 1YGPA 4M89A 2GM9A 2NAFA 1HYHA 1HNNA 1JFLA 4I7EA 3B70A 3L8MA 4H3SA 1E2BA 2X9GA 3RAPR 4Q00A 1CSEE 1EB8A 3GLHA 4TSRA 3G5TA 3DMPA 1P45A 3ZG6A 2J3QA 1MC4A 2BGWA 2D54A 1J1UA 4M49A 3G88A 1G5FA 2RHBA 3STXA 5KWSA 2R97A 1F17A 2A1TS 1JE0A 2ZSUA 4TM7A 1GIAA 2B9VA 3N87A 2CYAA 4AY4A 2GLXA 2ICAA 4K6MA 3D3WB 3PWSA 5LQAA 2PV0A 2AL7A 3IBCA 1U8FO 3FKJA 2FWIA 2QP3A 3MT8A 4JUCA 3MS7A 5AW5A 1M75A 2JI8A 1PG2A 3PSAA 3ZTYA 4D74A 3DLPX 2XOKD 3KAPA 5CFOA 1SVLA 4EI2A 4OATA 3FYTA 4KXMA 2COKA 2GZ3A 1DZIA 4E03A 2DTXA 4YCCA 2FW7A 3S1AB 1DEAA 2XB8A 4MGHA 4D02A 4QM7A 4LOJA 4NFLA 1G9TA 1KYVA 4EYQA 4MUHA 2Y99A 4R7TA 4CYMA 2F17A 2IIBA 4Y0NA 4MW5A 1I3KA 1NASA 2ZCVA 4GMXA 3ELYA 3AVTA 1M2WA 2UYOA 2GJ9A 4RLSA 1Q21A 1E2DA 1B6SA 1CLEA 3PR3A 5J4HA 5ED0A 1DAKA 3R8CA 3AHFA 5EXSA 3ASUA 3CNBA 4XAQA 3N0VA 4N6NA 3TIGA 1PJCA 2EZ9A 4YR7A 3BGVA 5FPQA 1QG0A 2FRVA 2BMJA 3BILA 2EKQA 5AKEA 5EHGA 1E9CA 5H1YA 3V8PA 2XUFA 4KI0A 5FUYA 2LBPA 3H5VA 4NXNB 4LXYA 1KFCB 3QUCA 4WCDA 3WKAA 4YBZA 1N6RA 3GT7A 4PX5A 1HSOA 2OQVA 2P2NA 3E0XA 5TF0A 1U7TA 2ZTMA 5TPWA 1ZK4A 1X86B 1GGNA 4ZAFA 1MA0A 2GJAA 2VAPA 2XMRA 3B78A 4ABYA 3DM9B 1OI2A 3IHKA 3QBVA 3RIHA 3AFGA 3BJZA 3ABIA 1DQNA 2A9FA 1IUOA 3KVYA 5FBKA 1FJGB 1U94A 3B2QA 1ZONA 1QJ4A 4F56A 4CCYA 3W1VA 4RGYA 3HB7A 2ZJOA 2EKPA 1Z28A 4PLGA 1WOYA 3LQQA 3NOXA 4D4IA 4E33A 3GNQA 2OK7A 1GCIA 3GRAA 2IYFA 4OK3A 3RKRA 3D9QX 3RDPA 3H19A 1OBOA 3L06A 4GLJA 1SH7A 5ALPA 4UOEA 1E3LA 1RQ2A 4BQPA 2JH8A 3VNBA 3IILA 2UYHA 3VJRA 3SU8A 4B31A 1S2IA 3CINA 3MAGA 4TV9A 4CKWB 2VJBA 1K7CA 3W79A 4U2CA 1KZYC 2EYQA 1XPJA 2E1PA 2BLNA 4QPNA 9ABPA 1I5RA 4CM4A 3LXMA 4QTYA 4MVYA 3C3PA 3AY0A 2O14A 2ZPUA 3WWOA 4ZVOA 1XRNA 1OWNA 3QVTA 3WGHA 4EGQA 1LV8A 4FC7A 3Q3EA 1A4RA 4QYWA 2L2QA 3W34A 4MGYR 3R3ZA 5ALGA 3C3MA 4FGJA 5DGIA 3G6WA 5C5CA 3N75A 2X4DA 4M22A 4FYJA 3TD6A 3TZEA 2O4CA 5KYYA 1K5GA 2JIMA 1N7GA 2ZYWX 1H4VB 2NQ8A 1AZSC 1QSGA 2MOKA 4CQNA 2JJ8A 2CNBA 4OQYA 5IEBA 5KMGA 4ZU3A 5LP6C 1FYEA 3VO2A 1EUDA 5BWOA 3F8TA 3LLMA 2HWUA 4PQGA 4RUKA 4G0VA 2QTNA 1WMDA 2J9ZB 1GM5A 3L6CA 3I53A 2Y1WA 1ZJ5A 2G4VA 3ZZNA 3PQDA 1A8IA 2CJFA 2A2ZA 4FBGA 4FHDA 2HT6A 4JVMA 1DAOA 2Q4RA 3MNFA 3RKUA 3QXXA 5EOVA 4D8TA 1HEIA 3O3OB 3UW3A 2GX6A 5I7HA 5HTKA 3OIUA 3K73O 4NKRA 4N3BA 1KEVA 1U8YA 2GKGA 4YALA 1TA0A 1XI2A 4A6XA 5I01A 5CRIA 4ZMBA 1R0BA 4HNSA 2NT4A 2OFXA 4ARZA 1H65A 3Q3HA 2B5VA 2DKNA 4LISA 5M04A 2XBUA 2HDHA 4D43A 2GM5A 4EG4A 1KZ6A 2WLSA 4MV3A 4DZZA 2MINA 4EJSC 3QRWA 3UV3A 3HDGA 3RK0A 4DV7B 3A1WA 1M2OA 4K81B 3LZCA 1HSZA 5LNK6 4RL4A 1YIDA 3NC1C 4Z53A 4HQ0A 3HB9A 5JJLA 5HVNA 4RSGA 1TGVA 2Q6IA 3T6KA 3U4QB 2C9BA 1WQ4A 1V3TA 2R00C 4NHEA 3N5KA 3IP8A 3QPVA 4PYNA 5JWHA 1Z6GA 3KT3A 4W9NA 1B16A 1FSFA 2CKDA 4YP0A 2YICA 1A8HA 4JP3A 1SB8A 1EBBA 3EUEA 3EQ2A 3H11B 4L7VA 4AJ4A 4XIYA 4G67A 3WDKA 1DAGA 2B4AA 4KC0A 4U4AA 3K1JA 1JIIA 1T6YA 4G1FA 4J0DA 5ER6A 5F2KA 3SR3A 1W30A 1NVEA 3KVVA 4L6AA 4RIHA 5FI3A 4EYOA 3W1WA 4G8DA 4LOIA 1OZAA 2AHRA 1LK0A 2TMDA 4ARCA 3CB4A 1XTQA 4DDUA 4F7WA 3L7YA 4LYYA 1GILA 4GXQA 5EI5A 4NJMA 4XJSA 3AVPA 3PWTA 5K4AA 3Q5EA 4C7XA 1KJ8A 3OBBA 4ZI2A 5KOHA 4FNAA 2QNIA 5FEUA 3SYMA 5DH9A 3FI0A 3SYTA 5IANA 4KPEC 1Z0KA 1D4ZA 1M10A 4C0BA 3P9QA 4D99A 1MXHA 3ESAA 1FP7A 5CM9C 2ZJ3A 3QFRA 1VA5A 3LFHA 3D0OA 1T8YA 5EY5B 5C7LO 3CZ5A 3KT6A 3W05A 4CEHB 3UHOA 5AM2A 2DFTA 5ENDA 3FPJA 3M6UA 3K2BA 3QGMA 1N92A 3P27A 3OOJA 4FB5A 2C7PA 1A9TA 3KQNA 3AF0A 3PQCA 4DMFA 1CB0A 1MF7A 4ILEA 5CYOA 4C4AA 1XFAA 2ZJ1A 2IP4A 4LQ4A 5ALRA 4C29A 4PSVA 1P5JA 1XDWA 1R4MA 3EOBI 3KJQA 2P2DA 4GECA 1M67A 3A4NA 1UAAA 3BE6A 1PG0A 5MF6A 5HCNA 2RB5A 4LQDA 3KLPX 3FIUA 2E5LB 4MLPA 4UMVA 3ICPA 4DJAA 4L3WA 2PUGA 3H9JA 4RQTA 4QO8A 3VPFA 2HEIA 3R7SA 1CV2A 1UJBA 4UNRA 1YR6A 1UOOA 5SICE 3T5CA 4D8VA 4EMUA 4S1TA 4Y6RA 3FIJA 4F2HA 5DTJA 3AERA 3NFRA 4H4DA 2R8ZA 3NHKA 5ALTA 2KHZA 3GLFE 1H2XA 4GPEA 4IIDA 2P9EA 3GJ8A 3ILHA 4HN2A 3M6LA 4HQOA 3P9RA 4JDPA 1DJQA 4TV8A 3E3LA 1IG0A 1MT0A 1NQAO 1GUZA 1BA2A 1UZMA 1ZC3A 2XUKA 1GLVA 3B6JA 3HLYA 1EU1A 1I7DA 3DO5A 2CXQA 2XYVA 1NBHA 3U5ZB 2PD3A 3BMXA 3KEQA 3VH3A 2PSSA 1LK5A 2HRRA 4E08A 4HN9A 4WK2B 4DMLA 4WNAB 1KWKA 4MJ7A 1TO6A 3PE3A 5JCOA 1ZAKA 3P2KA 4Q9AA 1DTWB 1M2KA 3EHDA 4I55F 4RCZA 2GN2A 4DQUA 4EPTA 4ER3A 4YJKA 2IPMA 1HE3A 2QTVB 3IPCA 4E5PA 4CEHA 1NU8A 2HMYB 2IY9A 4DCVA 1EIWA 4JN6B 3O2JA 2DJ5A 4W4TA 2ZYUX 3T3OA 3F8WA 3M6AA 3SJBA 1SG0A 3CKMA 3D3JA 4OJNA 1FS5A 2YJ6A 4ONEA 4AQYB 5FXMA 3HB1A 4RF5A 3ZY2A 3EMKA 1KKMA 3TVTA 1E2PA 3AW9A 5HZGA 1K4KA 4RQUA 4AMUA 1J5EB 2GAAA 121PA 2V5UA 5HS6A 3GHHA 2VLBA 3TAXA 2OSVA 4NPAA 5FTKA 3HDQA 1RXUA 2A5YB 5KKAA 4DMMA 3ZYCA 3HYSA 4P4NA 2CXOA 4QGBA 4RHTA 1SBNE 2RI0A 2H7CA 2BGIA 3BD7A 2XF2A 2X3YA 1ISSA 2FZVA 4MRMA 2B83A 3U1VA 1JKJA 4FE4A 4TV8B 2JIZA 2AMLA 1CZHA 2JRLA 1P4HA 3B9PA 2OM2A 1EJ6A 1KC3A 1B0UA 1P0MA 2FVXA 2I80A 4TMYA 1V8PA 2PXCA 2GTIA 4X9XA 4BLRA 1CR6A 5ADUS 4BY9E 2ZCUA 3QTBA 4X20B 1PL7A 4IMRA 4NABA 1N5IA 3G23A 1RPTA 4RD2A 2P9GA 4YCNA 5T64A 5CDYA 2C3YA 2REXB 2A7QA 4R40A 4Q48A 4YIHA 1N2CE 2I34A 2R7AA 2PUAA 3P26A 1QWSA 3U7IA 4DSOA 2LWIA 3F67A 3C1OA 4BB5A 2AZXA 4E6PA 1DQRA 2HSDA 3GNSA 3GVCA 1L8QA 3P2EA 4UVDA 4YV1A 3MXOA 1WEHA 2DECA 5ARDA 4YAGA 1PR0A 3N8IA 3AJRA 2QAIA 3I2IA 1H93A 1I9GA 4GX0A 4OFXA 4R1SA 4WNIA 5T67A 2QD2A 3SR0A 1OGIA 3DE0X 3WIDA 4BQFA 1QIJA 3KVRA 3ONDA 2QZJA 2HJRA 4JJFA 1HDZA 1V1MB 1MJHA 4KWIA 1U0RA 5DWDA 3TE7A 4ZHQB 3UPUA 1IATA 3GELA 3DCNA 1MVNA 3CSDA 4NYJR 1DIBA 1BWSA 1W0JD 2H85A 1J0EA 3N39C 4V0KA 1JHDA 4BOYA 4EK9A 3HV0A 2QT1A 4LY6A 3FRHA 3IUNA 4KXYA 3WWEA 5HEKA 4DCOA 5ICEA 5KNDH 1KJWA 1QVRA 1Y3IA 4ZYUA 2OGSA 5E38A 4MQ5A 4Z7JA 3H8VA 1L4UA 1ZI6A 2VOEA 2V7QD 3D6NB 4L9RA 3B6KA 3FTPA 4HDKB 2JCGA 4OXQA 5BQOA 1E8MA 1SZPA 4OJQA 3RVPA 4LMAA 1FYDA 2YWHA 3CH4B 4BZWA 1SZDA 3A9VA 3OEYA 1YK1A 3DCYA 1VJ1A 4IHAA 2Q9AA 4C4ZA 2OMKA 5LQUA 2PS9A 3B6IA 5AK6A 3L6RA 3OIVA 2R87A 2O6LA 5EIBD 4ZI7F 3QMWA 3UJBA 2D2EA 1N8KA 3OM8A 1U02A 1HF3A 1GTMA 2G07A 3FDIA 1SKBA 4NYIQ 2VQSA 3ZHQA 3F2IA 3RSGA 4FB4A 3REGA 4N9QA 1I4WA 3U48A 3QG1A 1TVKB 4N1AA 1QP0A 2ENWA 1SKQA 2XMDA 1B76A 2VHZA 1TZCA 3DCIA 4MP6A 1PFQA 2WAMA 3D0QA 3WK5A 1NUQA 3LCMA 2Q3FA 4ZC8A 2YDYA 4OMCA 1I2BA 1H0RA 3E9YA 2WWIA 3QPCA 1A5SB 2VZEA 5G3YA 3NHPA 3QKTA 3GDOA 3HJRA 2XZOA 1Q1BA 5HM8A 3KQPA 1VFPA 3ONVA 4YJ3A 5D6OA 3HGTA 3WLJA 1RKQA 1ZNZA 3D7NA 4IDCA 4C01A 2QRJA 1FMLA 1TM3E 1XZJA 3BA6A 1RP7A 3UG7A 5AJXA 4DXHA 3UT6A 3JARA 7ADHA 1AMOA 1IOLA 2RK4A 3KOYA 3WLIA 4F4JA 2BUBA 2PVCA 4JMLA 2ZRFA 2ZLBA 4MI6A 1E9FA 2IZ1A 4E5KA 3GL9A 4FZVA 4NQRA 3R23A 3OA0A 1G0OA 1GN9A 5F78A 2JARA 2WR8A 5EEGA 1U28A 3DOUA 1SQGA 1BVYF 1ADBA 1B14A 2V7QA 1S9HA 3KU1A 5AK3A 3WIUA 4AJLA 2VTVA 1C29B 3AY6A 2J9RA 1MH1A 3OZEA 3V4PB 1TADA 3HY6A 4YJHB 4TKVB 1UK7A 3N0XA 3DPIA 5IKOA 3VJMA 1O58A 3L7DA 1H0SA 2FW0A 4G8CA 3BH6A 1UBJS 1C7RA 4KWHA 2HD4A 1ESMA 1HOXA 4J0IA 4DVJA 1XZAA 2H4JA 2PT6A 1I7PA 2Q6OA 2ZIUB 3GUCA 3C4QA 4LOHA 4QOFA 2VH5R 3B85A 3RRNA 4YXFA 3NJ4A 3TL2A 3OPQA 1L1EA 1ZS9A 1SXHA 1C3EA 2ZKIA 1BA3A 4ADSG 5J63A 2UKDA 4IIFA 5DV9A 5LXTF 1PGQA 4AZ0B 3BEOA 3L8GA 3NHSA 1Q44A 2XXJA 4DA6A 1ABFA 1Y1RA 2DKOA 4IMIB 2OLKA 1QNFA 4OP2A 1B2RA 5LKAA 2WVGA 2RGXA 3GJQA 4HNVA 1JHYA 2QAGC 3QXCA 4BVKA 1GCUA 2JVJA 2QZ9A 2XZLA 4IL5A 4TMXA 1DAFA 2HF8A 1NTRA 2PCJA 3T9DA 3EASA 3JQ6A 3QM1A 3R9XA 3Q98A 2IPLA 3ZE0B 1VOTA 3ROFA 4Q9JA 2CUZA 4EJ6A 5JW6A 1FTYA 5ALHA 3JQ8B 5GP1A 3WADA 1J70A 2VATA 1L7VC 5HUHA 4QJIA 2Y2UA 3P9CA 2GO1A 1ZEMA 2AW5A 5LXTB 2J3JA 3ONWA 1AUXA 5BNTA 1EB9A 2A0FA 1LPOA 4GZ3A 3I9NA 3K53A 4P08A 2FEKA 3E8SA 3QMVA 1XMQB 3HYNA 1QXSA 1KGDA 2X41A 4V03A 2PJZA 1HC7A 4M88A 2DCUA 2ZUBA 3E5NA 4E3WA 5I8WA 4FX2A 4G84A 3VDXA 2HIMA 3PBKA 4EI8A 1OHHD 1YCDA 2EBHX 4W5JA 1JJBA 1RAHA 1XRMA 3OE7A 2IHVA 4WW0A 4HF7A 5LM3A 1Z0ZA 1G2QA 3E18A 3TEMA 2WIGA 2Y2VA 4JNCA 2PEZA 1O4WA 5FDFA 2XGJA 2XNDA 4LMPA 2V74B 1ZSNA 3RGGA 3ZKAA 2GEVA 1IDOA 4Q3AA 2QMOA 4CDGA 4DQVA 4EITA 5A5EA 2IU3A 1U7WA 1KL7A 2HCRA 3Q9NA 2OZLB 1NXTA 1DO0A 3GLKA 3QW2A 4HQFA 2XZTA 1Z5ZA 2BGLA 3CUSA 3OX3A 5KKNB 3QU5A 4K03A 4M8KA 1TLLA 4F3CA 4ZDIA 3OKFA 1F6BA 1D2EA 3I2JA 2G72A 4LN1A 4X91A 5LOVB 1D3AA 2BJVA 3KAQA 3OE5A 5BWMA 3U44B 2PN1A 1H6CA 4YRMA 4WKOA 1OA0A 3ULKA 4CM8B 2XHZA 3AUKA 1WZIA 1JECA 2PCLA 4TWJA 3AV3A 2BFFA 3B8HA 4V0RA 4H6PA 2V3VA 2X0RA 3PHIA 3T7TA 2Q5IA 3AGQA 2CLFB 3PPYA 4IHJF 4EVIA 1Y7PA 3S8EA 1BXKA 4KE8A 3T9BA 3THWA 4UPEA 3CMCO 2QTHA 1G7SA 4F6RA 2NO6A 4DFDA 1JA0A 1LS1A 3TIFA 1YJBA 2X6TA 5CW2A 1G2IA 4BQNA 2XE6A 2B94A 3A1UA 3QA9A 3T7IA 5K01A 1PJTA 2YV2A 3EDMA 1U2TA 1SY7A 3EAQA 1PV1A 3NTOA 3OIGA 4XM1A 3T1NA 2H1HA 4GU5A 2Q6VA 4ITUA 4IIHA 2M6LA 2BKEA 4PAQA 3U7HB 4W82A 1GXSB 2WF5A 1PJSA 1ZI9A 2ZUCA 1L1FA 1T26A 2C5AA 1JDVA 1EEHA 2HBZA 2XYHA 3I5UA 2ZRGA 2V1XA 4RMJA 4BNJA 5IH7A 1G64A 2VP0A 4REMA 4AQDA 2C2BA 1JDUA 1V2GA 4TM8A 1W6UA 4BVBA 4UCWA 2OZLA 3RC9A 3WB9A 3WV5A 5I7RA 3KRTA 3IPLA 3M2TA 4XKJA 3SKVA 1FDVA 3BULA 4JHXA 3ZJ4A 4A5OA 3O4HA 2ZUEA 3C5EA 2XRZA 4ARUA 3AFOA 4HXEB 3E1SA 4ERXA 1N2SA 2XF8A 1ODSA 4G5GA 4F4UA 1C3VA 5C1IA 1VHWA 4HQ6A 3TPCA 3WGYA 4NU8X 4DWVA 4BXOA 3LYHA 4OH1A 2YFKA 4O4LB 1JTEA 1R0ZA 2AG1A 2WTBA 3NWBA 5EJFA 4P7BA 4EENA 1K8RA 3LQYA 1DKQA 4N3NA 1OYOA 2VOJA 1V8FA 4MW0A 5E9WA 4HVLA 1EDDA 1EZZA 1XKXA 2QENA 5KTKA 1DJMA 4IIEA 1VBMA 1NXXA 2HBRA 3I0MA 2BFEA 4QXRA 3AUYA 3SEQA 4ENRA 3QKRA 3AIIA 1FFHA 1J9EA 3AHGA 2A0KA 2XB4A 3GDFA 3WY9A 4WA8A 2JFHA 3WFZA 1FFGA 3FTCA 3KLOA 2WE8A 5AJYA 3OF2A 5BSGA 5ISMA 2CDCA 1CY1A 3AR7A 3M6FA 1IHUA 1TUBB 3RSZA 3GEBA 3BDVA 5IT0A 2GSDA 2NPFA 5J5CA 2Y66A 2Q50A 4DR1B 4PZZA 2Z8YM 9GPBA 4M8NE 4MR7A 3K72B 3IA2A 4UBIA 3I3SR 3UW1A 1JKJB 5DGTA 1QP7A 1FU8A 4QLBA 6YASA 4IGKA 1WHTA 5IDYA 1Z4NA 1K7XB 1L1RA 4MMYB 5CJJA 5K0FA 1WXQA 2DE0X 1T0IA 1KY5A 4JQCA 1U81A 4ZI3A 2PSDA 2ZR7A 5E1OA 1QANA 2Q0HA 1JQEA 3E2PA 4U7TB 1L4MA 5IAGA 1NWCA 2QVYX 5BSHA 2CCKA 5JCPA 4LVUA 4JB8A 4P2GA 1JRLA 1PKEA 2NYAA 3PJFA 2O1EA 4D0SA 2IP1A 1DRVA 2J3KA 1EFHA 3I04A 2R8OA 2H07A 2QW0X 1NMXA 1VLVA 1OXKB 3L8HA 1MOPA 5E6UA 4B2LA 1NBMD 4OQNA 3LHIA 3PFHA 3AF5A 1QH8A 1PD1A 3ZWKA 2ETVA 3GPDG 3QFTA 5BSTA 4JC8A 5LYJF 5H8WA 2UUAB 4BUZA 1JF8A 2GCGA 4LNHA 4X95A 3SLRA 1ULZA 2G83A 1LZKA 1GTZA 1RLTA 1ES9A 3PC4A 1K7SN 2FQWA 2QTBA 3I1IA 3O93A 3GH3A 3FSGD 3WOHA 4BJ1A 1GAWA 2FZ4A 3EMBA 3MVEA 4B46A 2A4MA 2FP4B 3BOSA 3KJHA 2H2GA 3A26A 3EIOA 3R4CA 1Q91A 3EDQA 3AU9A 2I3DA 5K9ZA 4GM0A 3I83A 4QUGA 4JLWA 1E2NA 2WZQA 2IYOA 2X5OA 4PGAA 2VHVA 5I7SA 1OU4A 1X94A 1P73A 4PHTA 2RAVA 3K6RA 4JA0A 4P36A 4QATA 4QDXA 5CNIA 2BWJA 1MNAA 5EWMA 2HZ7A 4YQZA 3LY7A 1CDEA 3EZYA 4G63A 3N3AC 2DT5A 2A5LA 5IMBA 3TPFA 1JLKA 3O95A 1UZLA 4BP3A 2H2DA 1T10A 3DWIA 3MJCA 3HVIA 3QBEA 2H65A 2Q9BA 1IUNA 2WHRA 3TLAA 4NECA 1Y5LA 5EIEA 2AOUB 1ULUA 1Q50A 4HLNA 3X1YA 5I7OA 4AURA 3EPLA 3SKYA 3BE8A 1C1HA 4ND6A 5EJAA 4X1KA 4O4HF 1LS6A 4GX2A 2W2TA 1E4EA 4ND1A 1UJ6A 3DP7A 3UH0A 3K9HA 1G291 2ET6A 4RHUA 4A8PA 4DC9A 2B7LA 4XVQA 4I55A 1W47A 5JISA 2ZBDA 2XT6A 3VTKA 5A5FA 3L8EA 1B42A 1L9KA 1Q17A 4ZVTA 1OTHA 1QCZA 3KB8A 5D85A 4OHBA 4NE9A 5E0OA 5GGXA 4YAOA 3P9NA 3RVNA 3I6IA 3RHFA 1MG0A 2YYAA 4YAJA 3LTNC 3GJ0A 3CE6A 3JCZA 2B9EA 2MSNA 3RS5A 4QBFA 2IYLD 1K9SA 1ZM4A 3SNHA 4G65A 2CV0A 4KDFA 2VSXA 1I6KA 1GITA 5DGCA 4XSHA 2BF4A 3W6NA 2BBOA 3QKSA 4O2BF 3JQ7B 1JIJA 2Q6LA 2W9XA 2IE8A 2ZKLA 4B82A 2J9GA 1TAUA 1NPYA 2YWRA 5DSTA 3RFXA 3OZFA 4HYTA 3AF1A 3IRUA 3BH0A 5B58C 4NZNA 4D6PA 4KHZA 4EO4A 2PSEA 2DPYA 5B6IA 3X1MA 1SBQA 1UDWA 3OPYA 5HE8A 4HUJA 4BNXA 3AHHA 3S8MA 5M7EA 4FOLA 2QLBA 1A9SA 3EC7A 4OF4A 5EXXA 3IJRA 4B32A 3ZLVA 1N34B 3SQWA 1VHDA 1RADA 1ZD9A 2YWCA 2VRBA 4TQAA 3V1LA 2PH3A 4IHJA 2J31A 1PEAA 5JY1A 3BDAA 2O8BB 3EXFA 3MJTA 2H00A 1DWQA 2OCBA 1MGPA 1SXGA 1WOMA 1WSAA 4GI7A 1P7PA 1VL6A 2GHRA 4J03A 4PINA 4L72A 3GB9A 3TO5A 4YRFA 1GSHA 1Y6JA 4RPKA 1I80A 5H9VA 2XD4A 4DAOA 2XDAA 2FA9A 4E46A 5T4BA 3M70A 4DYDA 4J8PA 1T9KA 4E2WA 2PSJA 4Z3DA 4C0XA 1P17A 4KQ6A 1XCOA 3LYLA 1GTJ1 1AUOA 1U2DA 2R5WA 3A4VA 3G2OA 4KVGA 3C3KA 4RORA 3ZNOA 4CF6A 4LZJA 1GTRA 2ODEA 4GPZA 1VHQA 3ANMA 3QOYA 2V0CA 3JPYA 5GOTA 1G38A 2V98A 3HCRA 1R8YA 1G0NA 3UOWA 4BQOA 3G0CA 3GLIB 1QG2A 2QF7A 3K9NA 1JIVA 3U13A 4XSVA 1SOUA 2CGEA 5ECDA 4OSEA 4DY4A 1CIVA 1L7BA 2O0LA 4PIMA 2A9KA 1Z45A 1RS0A 2GB4A 1TYAE 2O6HA 4AMVA 1R27A 3N74A 1JJIA 3KHUA 4NARA 4MICA 1YZYA 3CJRA 2OUIA 3A1DA 1XRQA 5IP5A 5FWDA 2QIOA 3MMXA 3EWAA 2WHPB 3FKQA 3ICWA 1YB7A 3ET5A 1BKSB 4IV5A 3SC6A 4BEJA 1J00A 4HWRA 4REQA 1G6Q1 5CT8A 2JFFA 4PM4A 1GRVA 2JIQA 4YRDA 3IAHA 3K9CA 3SI7A 2AW3A 4FFPA 2BFDB 3IGFA 1YT5A 2J33A 4Q34A 3VZDA 3OPXA 5EPOA 3MTGA 6NULA 4DBZA 3V8BA 2QVZX 4HNAB 1BN6A 2PU7A 3AR3A 1RWXA 3NEPX 2VDRB 4LHYA 4DQ0A 5IKEA 1MXFA 2HCFA 2BE7A 1EFCA 1ANKA 4YK7A 3N59A 1HMPA 4IOKA 4YS6A 3RRMA 4DZTA 1YBVA 3AIMA 3NEJA 2Z2KA 2GLUA 4RQAA 4ZZ2A 3FDJA 2GVDC 5H83A 3IEXA 1GUAA 4M1OA 3MM4A 2E5FA 3QLJA 3ZCUA 2VF5X 5GV8A 3Q40A 3FSJX 3IUSA 4H6WA 2GWRA 4O59O 2QP4A 3P9PA 5AIBA 1SIOA 2LKCA 1CDOA 4WQMA 3TLXA 3F0TA 1F2DA 3FYDA 3TJZA 4BMOB 1E1CB 1R5NA 3LXXA 2I1VB 4G4SP 4UVIA 3BYZA 3BWMA 4TL9A 3TTWA 1EHYA 2BGNA 1ZH0A 4J43A 5CXQA 1GA6A 2H16A 3QVGA 1YVRA 5IH3A 2GN9A 2NWQA 3TQOA 2GN1A 1KPGA 1R12A 2KLBA 4OXXA 1M2OB 5FFMA 3RUPA 1XF1A 3TF5A 4BTEA 1KDOA 3PFIA 3Q6IA 3G8DA 1Z17A 4JBHA 5FLYA 1IBSA 1M5RA 1V7PC 4LE1A 1FP1D 3FVVA 5LUAA 1F2TB 3R2JA 3GJ5A 4ARBA 4YQYA 4BZQA 3O31A 5CTJA 5G40A 2GPNA 5A62A 3BWCA 1G19A 1J90A 3IE2A 1JHQA 1W4CA 3FPFA 4CF4A 1YQQA 5L4LA 3FMPB 5C52B 1RPNA 2W2LA 1F8XA 1HYEA 1DJPA 3HNOA 4HC4A 1SKAA 3ES9A 1K08A 4WFKA 3TQIA 2I6XA 3DMTA 3WSTA 3OFJA 1KXJA 1ZKMA 4BE7B 4C2UA 3FTNA 2Q4EA 1MH9A 4KDEA 2EW2A 1WU7A 1OWMA 5GAJA 5BURA 1DJOA 2R85A 3E1GA 4IIXA 3HZZA 4CFZA 4QAJA 4D3SA 2A5FA 2ATXA 4J0JA 4O4LA 3OEED 4DN6A 4V3CA 2CYBA 4FS8A 3V55A 5DLQC 3CZ9A 4U0JA 2RGWA 2ZBEA 3ONEA 5G4KB 2BAGA 2P8JA 2FR1A 2SECE 1WVIA 4EX6A 1Y8AA 2IZOA 4TL8A 1E92A 2WUDA 4URHA 3QBJA 3L6BA 3ZBTA 2I4LA 1OZ0A 1WW8A 4IDDA 4B6GA 2HQRA 1WPRA 2QG6A 3UUGA 3VGJA 4MKFA 5M5BA 4I1UA 1DAPA 2CNLA 4YDRA 4KQ9A 1DC5A 4B2YA 1OASA 2RHDA 2IY7A 2D7JA 1AS0A 1FXSA 2XUPA 3REFA 5KAMA 3IUEA 4YDQA 3OLXA 3CX8A 5FTJA 3W77A 1IVYA 4KLRA 3AJEA 3U62A 1MKYA 1EDBA 2WUWE 4EA7A 3M1YA 4LX8A 5AFSA 5ECGC 3JAKB 5F7OA 4DR6B 3SF8A 1OHHA 4E30A 5DGDA 2Q1YA 3N05A 1X7YA 2CLIB 3CW2A 3OE7D 4CIAA 2VDKB 1YWGO 1ZITA 2DWPA 2XBLA 2YOFA 5EAIA 3K9BA 2PSFA 4R98A 3QU4A 1K9VF 7ABPA 2H06A 1JV2B 3T0GA 3F3MA 1GQYA 2CD7A 1C8BA 3NHZA 3Q3GE 4PWZA 5K1ZA 3S4YA 1AV7A 3PXEA 1Y3AA 2WYVA 3RIEA 4M9CA 4XEHA 1F7VA 2ROQA 2B4KA 2AK3A 3U9LA 4UC0A 1OW3B 3QE9Y 4G5HA 5JZ9A 1G7CA 3NYQA 3TZBA 1G3IA 4YAIA 1CP3A 4KX3A 3MB5A 4JY7A 1FVXA 3CRQA 5JH7B 2D5IA 2I2BA 2WD7A 1IYZA 1XN1A 3U7JA 2KPOA 1GPMA 4O63O 4NR0A 2GK4A 2WRZA 2YWEA 1DFHA 2AJLI 4RVDA 3CN7A 3DTYA 4MI9A 3T9AA 2GAFA 4CKZA 5DJ5A 1CYEA 3ZNNA 4TROA 4ZREA 1UZUA 2WIBA 3OEEA 3WXBA 3DAOA 4DE5A 5G1NA 4K9PA 4HZIA 1J23A 3KZVA 1QONA 3OX4A 4MJXA 2BGRA 1MDFA 2ZP1A 4JH0A 1AH2A 2Y1EA 2F43B 2H2FA 3S1AA 1UR5A 5L40A 1GADO 1ZJ6A 3IAFA 4NU0A 1GPDG 1FUKA 4PZUA 1DV2A 4ROSA 4WEOA 4GYWA 4B84A 3FI9A 3O9ZA 4Q4LA 2VC2B 2P6UA 5GMOA 3VVBA 2ZS9A 3P0FA 1VRCA 1XTBA 4WGFA 3TNDA 4DV0B 3HO6A 2CE2X 1A0OA 1I4LD 3REQA 1ICEA 3LDGA 4NWIA 3G17A 1AQNA 1FQKA 3BSWA 3P5SA 3UJCA 1YA8A 1BU8A 1S9DA 2BM9A 2RG7A 4WKBA 4X60A 1IB0A 3E9EA 2ZYGA 2H5LA 4KR9A 3W04A 2PQ6A 4ZT3A 3PQFA 4CODB 4YI5A 4EECA 3OUZA 4F11A 1SG6A 3LCCA 2WBLC 1IDN1 5JS6A 1V47A 1KEUA 2R66A 4IF6A 2YXLA 2QGNA 1TTPB 4LHEA 4P5DA 3LE8A 5TMPA 2V7PA 1XZKA 1Y8RB 3AR2A 1KS2A 5AW3A 5JQWA 3I8XA 1SWWA 2CVZA 2AFIE 1DUIA 2VI5A 2W2PA 5CG2A 1ZJ4A 3NHBA 4IDEA 2VCEA 3DE7X 1THTA 3FWYA 3K4QA 3EZGA 2RGEA 4JENA 5DCUA 3RANA 3SZ3A 3ZZMA 5AHOA 4NONA 3LO8A 4QKQA 3ZH9B 1Y7TA 2V0NA 4B47A 5CYGA 3HKCB 2HHLA 3IPYA 4TYNA 1OSNA 5DZSA 2OCYC 3A1TA 4P3XA 5F7ZA 1VPWA 5FTMA 4CKBB 1P60A 1K89A 3IBTA 2XDQA 1WLYA 3SYRA 1IUKA 2EC5A 1XZBA 3T0FA 4I81A 1SUIA 1WPXA 5E6SA 4C0HA 1DHTA 1RI4A 1O77A 3DBRB 2QE7D 1ECBA 2GK6A 4Q3BA 1R18A 1Z47A 1ZP6A 2R60A 4QFBA 5CJPA 2P2SA 3KO8A 1XTZA 2ZUDA 3L7OA 4IIUA 1YI0A 2JHAA 3TLGA 3WJAA 4B43A 3LO5A 1NGSA 4EUSA 3DH0A 1GEEA 4B79A 4MUYA 3VOSA 2V6FA 4C7OA 2GCNA 1EUCA 2I7VA 3T38A 4EABA 5B57C 1K8ZB 4FGZA 3QPAA 1GV0A 4Q9IA 4DXDA 1BO6A 4OOEA 2QUBA 3DVAB 4NENB 1H2BA 5KEIA 4GRIA 1XNHA 3M9XA 1JHMA 5BT8A 4WDRA 2W37A 3MW8A 4GP6A 2IJGX 1RQPA 1MPXA 1JPJA 3M81A 3M4NA 4L51A 5DCLA 2B98A 2FB9A 3IOEA 1AKNA 3DXZA 1O0SA 3F9CA 1TVMA 2VUSA 4YUYA 5KSWB 4F3YA 3THSA 3QA3E 2YIMA 1EP1B 1THGA 1CUWA 1SBZA 2Z98A 3UFBA 2E1RA 1NAHA 1WF6A 3LVBA 1LLFA 1WVMA 5AO9A 3OTOB 1TJ4A 4MKZA 3EB9A 1XZPA 2A92A 1EUDB 2X8JA 3LF1A 4RLQA 2QPLA 4LF6B 1L5NA 1GYPA 4XR9A 3BMOB 3NBXX 5A4JA 3CNQS 1MIHA 4C05A 3A7DA 4HNQA 4LFCB 1E3WB 1BWRA 2VSFA 4TMFA 1PDWA 1SVMA 2Z5VA 5G4KA 5CDUA 1P2GA 1QC5A 5BR1A 3ISVA 1NJFA 1CS0B 4I1YA 5K3SA 1VKRA 2YJZA 4RCYA 4RABA 3KWJA 2COUA 4UUPA 1W85B 3I04M 4U7HA 4URWR 1ZRHA 1QIDA 2EHDA 3ZLBA 2OBMA 1V71A 4W6ZA 3PRYA 4OQEA 3QWFA 4M9SA 4HDSB 4Q4JB 4BB9A 1MVLA 3T4UA 3N8KA 1Y1PA 1RFLA 2I9KA 3MLAA 1HDRA 2F1KA 4XYLA 2QTCA 1R16A 4OSPA 4ZTZB 2X9VA 2BM0A 4BMSA 4QM6A 1PT7A 4ZOQI 3C7DB 2PLFA 5CFRA 3RS9A 2NVWA 4MIKA 4TWAA 1VJTA 3EWSA 2LE0A 4B9AA 5J43A 1LX7A 3HSYA 5JAUA 1VE6A 3RTAA 1T2NA 2PX3A 2JI6A 2W8BA 8LDHA 1G2OA 3NBAA 3NAZA 3ZY4A 2GI4A 5GONB 3W5SA 2VPYA 4NMHA 3OTHA 2B1JA 3H3XA 2PZMA 4Q7KA 3LKDA 1IH8A 2AF4C 4HN4B 4W8OA 3TI7A 1D0SA 4RX1A 4YRLA 3WL8A 1QH1A 4X7RA 1Z4OA 3WZ2A 2AC2A 4OQ4A 3MJVA 5JXGA 5J3JA 1F8UA 1XT6A 4WA7A 4JI4B 3FXAA 2OO5A 2YMQA 1QGAA 1FZQA 2QD5A 2RIRA 3KLBA 1M83A 1NAIA 3V8NA 1ID8A 3UJDA 3PRKE 3L6OO 3OMXA 1KI7A 2IDJA 3C3YA 4S04A 2Z56A 5B37A 1CZOA 2J0QA 3IV9A 4BEWA 1BKYA 1Q22A 2GTHA 4RY0A 5KU7A 2YMLA 5DTQA 3IUYA 5IJ0A 2JGLA 2JFUA 2PX6A 4NAHA 4FN4A 1EJ0A 3OP4A 3DO8A 1R4NA 1W4ZA 1AHHA 3GU3A 4QOJA 4CMHA 1A4IA 1Z22A 3DL4A 3H1BA 1IZ9A 1YDGA 3OPNA 3BH7A 3IBFA 4ZEOA 2WIKA 5IBQA 2I4RA 4CTMA 4KSYA 1ZIDA 2P69A 2P75A 1NXOA 1WP9A 3BRCA 3GVXA 3O47A 2A0UA 1GPWB 3OIWA 4OJMX 2BFAA 1BWPA 5KCMA 4BCDA 4ZHQF 4POAA 1E1RA 4IG9A 1PR5A 4KQWA 2W4MA 4X84A 3U61B 3VPAA 2BCGY 3HEBA 1Z63A 1LBHA 4RW0A 2LXNA 4OAOA 3LF2A 4FWTA 2Q5OA 4BL5A 4KACA 4DJJA 4RZHA 3ZWOA 5LQCA 3GH1A 1B15A 3U4CA 2EARA 2DFNA 4QJ3A 2B5WA 3HP1A 1LQUA 1XKTA 4GOLD 4HGPA 2PYDA 3OPYB 1ORTA 1YMQA 2BKUA 3FB4A 1TQDA 4NCXA 4Y7CA 1Q1NA 3H9QA 2FPPB 2MSDB 4IJVA 2OO7A 5E4FA 2RARA 1Y3CE 4F96A 2G06A 3WGVA 5KB3A 4PTZA 1S7GA 1IWPB 3CSUA 5F2NA 2FPRA 4YRRA 1NBEA 3P9ZA 1E99A 1H2WA 2XIJA 4LK3A 1BS1A 1HQCA 2A1UB 3TFWA 1IBLB 1QCYA 2Z4SA 2XUHA 2VXOA 3IMCA 2AEJA 3SHWA 3WLNA 1T2FA 4O4HA 3RYCA 4LRUA 3A4YA 1UXKA 4U2FA 4LJLA 4NPCA 1T0HB 4FYVA 2B30A 1ZUD1 3F6SA 3X3HA 3ZW8A 4RAOA 3SCZA 3LGAA 4RENA 1IVNA 2TRSB 3H5NA 2ZATA 3DEJA 3HCOA 4DV4B 3EVBA 4I4TA 5CB4F 4QODA 4YJGA 1S6YA 1ZOPA 2CYCA 2NQTA 4IY1A 2OFWA 4RJIA 5IVHA 4ALJA 1CIPA 1JB1A 3LUAA 1WP4A 2J41A 2HPZA 1WZEA 3NBKA 1O9GA 3AFMA 2BVNA 1DBVO 5FPPA 1HWYA 1U3TA 1L5GB 3NANA 1YF3A 3P32A 2Q4DA 1Y4ZA 3F6EX 3HKEB 2WKWA 4A36A 3GMTA 3I2YX 3R77A 1V37A 3HSKA 1HV8A 4NBKA 5EZYF 2A5DA 3RV4A 1I1NA 1P1IA 1NHWA 2WQZA 3SJCA 1J24A 2X1MA 2FPPA 4M7PA 4RZIA 4CEJB 4DSZA 3DOFA 2JAQA 2R7LA 4KODA 3VPGA 4CCSA 2ERXA 1PNOA 3GFSA 3TOXA 2IUEA 3HUDA 2H3HA 3LNTA 3ZHBA 4QYSA 4RA6A 3WLFA 1LEHA 4TTAA 4REQB 2FW6A 2YQ4A 4HAYA 1B8NA 2A1TR 2Y05A 3S8YA 4Q12A 3PV0A 4LF9B 4Q0MA 4B48A 4OLFA 1YAHA 4Y3UA 2HFJA 1KBZA 3FUXA 4L4ZA 5C5EA 1P6QA 3Q2IA 4MR9A 1QK3A 1P6UA 4BMNA 4UBOA 1V1JA 4XFKA 2C59A 3E03A 2PLRA 2RAPA 1NN5A 1V16B 1ZM7A 3H4TA 4CQMD 4F5WA 3LFTA 4Y18A 3RIMA 3TXYA 3VM6A 4A23A 3AR9A 1CS0A 1XDSA 5AOVA 1KFJB 3MCZA 3N7TA 1KJ9A 4PLCA 2CHVA 1WDTA 5E9JA 3V4OA 1Y42X 1ODCA 3P20A 3FG9A 4RA9A 1XMXA 1G7TA 4TTVA 4PGMA 2PR7A 3RF6A 3PD7A 4JBYA 2ZJAA 4PHGA 3D8UA 3M89A 3U9TA 3OZTA 4LI3X 1NZJA 3DLCA 5A0TA 1VP9A 4E2ZA 3G0GA 1IPEA 4H7HA 2ODNA 4GD3Q 3LLVA 3E2MA 4A10A 1MQ8B 2MR5A 3CCBA 1QNLA 4UW9A 1HTBA 1G6OA 1AN0A 1WWKA 4Q3EA 3RH0A 2BHLA 3NUGA 4W8HA 1F06A 1PT8A 4GOOD 5IC5A 4HMPA 2VNHA 3KP1A 2XTZA 5ED4A 1JVBA 4WCFC 4EHFA 4KAAA 4JI5B 1MAWA 1NMZA 1RHJA 3KZ1E 1ZK2A 2QVBA 5DI3A 3SBEA 1K68A 1SBIA 2HQBA 3DGFC 3E9RA 3PRJA 1VLHA 2QHXA 3UH1A 4D92A 1GZUA 4MR7B 1CD5A 1CJUC 4KGZA 1UIMA 4M0DA 1KZ7B 4AKHA 2CNOA 3HXQA 3D2CA 1Z4JA 1BE1A 3A06A 4DQLA 3NHUA 3KSRA 2HJVA 4NOKA 3HM2A 2GH1A 3EULA 3QOWA 3KKNA 3OD1A 2ODAA 5A03A 2LD4A 1KO4A 1QH8B 1UBRS 3FTDA 4GZMA 4TRMA 2WVHA 1NVKA 5AW2A 5FYDA 2PA3A 2E89A 2ZI9A 1NQTA 3D3EA 3PVZA 2FRDA 4DLSA 7MDHA 2I0FA 1Y1LA 1FRZA 2G4LA 1QTNA 1YDMA 3BXHA 3H5OA 1QFSA 3GO4A 2FMKA 1O5IA 1IZZA 1IG3A 2X6QA 2WSBA 3ZIAD 1GPYA 3ZVKA 2QU7A 3CF0A 4CQLA 3K0KA 1YJ8A 1L5HA 1B93A 3EISA 3YASA 3A1NA 4FQ5A 2X6RA 4ZEMA 2MTBA 1JDBB 3I1YA 1H8HD 4I9UA 3E6AA 4I6JA 3RVMA 1P18A 1VLMA 5FOTA 3WLAA 2XRFA 1ULTA 3FJYA 4WJKB 5F64A 4J2HA 3OCUA 2F9LA 3BHIA 3M83A 3MPOA 2N0SA 5CLHA 3BL8A 5CBKA 3IODA 2VZ9A 3GJ6A 2BFPA 4EW1A 5AXCA 1XZDA 1PN3A 2Z1NA 2ZYAA 3CA8A 3IDZA 4P84A 2HGZA 5JCOC 4WXPA 4CU2A 1T91A 3TQTA 3KVOA 4HZUB 1DMRA 2H4XA 2WUEA 1R4MB 3PA8A 1OBFO 4X8LA 4OHXA 3TM5A 4C7KA 5JMTA 3QEAZ 2YWGA 4R1NA 2CF6A 3RUEA 2C0CA 3R3XA 1HEYA 1X39A 3KTOA 3HP7A 4EZEA 1Z3IX 1E3SA 2V0GA 1TMGE 2QPOA 3L3BA 3VJKA 1L7QA 1PGNA 3IHWA 4EHHA 1SBHA 4KREA 1U5BB 4FIZA 1D2GA 2AG0A 2CFIA 5D3QA 4PLPA 3NDPA 3HA3A 4FINA 4UDNA 1RWOA 3A6PC 4ZVQA 4FE7A 5TQJA 3JD4A 4MPRA 1R66A 3HR7A 1Z5OA 3F7NA 1ZOOA 3BWVA 3Q2OA 1SCJA 3WK9A 2Q27A 1SIBE 2V7WA 4G5SA 5ALYA 4NC9A 3V97A 1UJMA 2VRWA 2ZPAA 3AB8A 3ZD7A 4IQ8A 5HF6A 2B25A 4OXIA 1NZFA 1RYBA 3L1HA 1OAOC 1CNEA 1PP4A 2VDJA 4PYJA 1DC8A 3ZC3A 5C4IA 4R6WA 1XDUA 2A14A 4M0EA 4P93A 2XDQB 3M4XA 5JATA 2EW1A 3A6EA 5DU2A 1VI2A 4JJ6A 5CCEA 4HG2A 3KIPA 5F21A 3D8RA 5EKSA 1CDDA 4ZAVA 4DDTA 1X0VA 3DKRA 4YAWA 4G0ZA 4Y2UA 3HJUA 4PYLA 2EQ5A 3K9GA 4MOWA 4FS3A 3BL6A 1VMIA 1VCIA 2XTAA 3O3CA 3PXCX 4RDHA 3K6KA 5FI0B 2EW8A 1I9CA 3DHEA 3KXKA 3P4XA 2GT1A 3UMCA 1XAIA 3D8NA 5AHKA 1BW9A 5CFNA 4EGJA 1YS4A 2HEGA 2W00A 3OO0A 3SYLA 3U7RA 3TQRA 3PIDA 4M53A 1JFTA 1M3SA 2JCVA 1YFJA 5KNLA 4YAUA 4XZ3A 4X6LA 1RLMA 1PJ8A 1QO9A 3E4DA 4LJSA 4QGSA 1A98A 2OV2A 3RC3A 3OURA 5D3MA 1WNTA 4URVR 1Y98A 5IASA 2VH1A 2IYYA 1CJSA 3FPLA 1OT5A 4TZ0A 5K05A 2OHHA 3JS5A 4RPGA 1NJ2A 2RAFA 2ZVPX 1RBMA 4C4OA 2P11A 5LLTA 3KSMA 4CKEA 4B3IA 4HI0E 4ZOBA 3CJTA 4IDBA 4BCBA 3SQMA 4E14A 3DV0A 2ASEA 1OH7A 3ORHA 3PJGA 2H5JA 4X45A 4BX8A 2AYZA 3JRNA 3OO1A 4Q1DA 5D51S 4D5GA 4E21A 3FZQA 1DIAA 4OHVA 1P0CA 1R5BA 3DJYA 3RYTC 1M2GA 2JGIA 2P0EA 3TWOA 4CKBA 3GQVA 5IYZF 2QEQA 5E4JA 2J0UA 3RI3A 3CJQA 1R8XA 3WSVA 5IK2A 3UO8B 2ZXUA 3DO6A 4OX9Y 5JQGA 4ID9A 3VZPA 3L40A 4MA5A 2BEWA 2NNWB 5CVUA 2EVWX 3PNBA 4DDVA 1X7ZB 3H8WA 3WISA 2V03A 3G68A 3EVCA 1UQRA 3U1TA 4C4TA 3ZKWB 1UADA 3DT6A 1LC0A 4NG4A 4NU6A 3KQOA 4P92A 1AV6A 2XT9A 4Z3OA 1DKNA 1MFPA 3W8FA 2OA0A 3ZEAA 3ZDAA 2GASA 1GRRA 1G16A 1L5VA 4RKWA 3P45A 2C29D 1H1DA 1OLOA 2IE0A 2QT0A 2ZJBA 2P2GA 3E05A 3KOOA 5J2UA 1ATZA 3KXPA 3SC2B 1FP2A 3FH0A 3OZXA 1E9VA 1JG2A 1ORWA 2CXSA 5FV7A 3AHDA 4P3NA 2A0YA 1K5HA 4ALIA 4NJEA 4XQCA 4PRZA 1CUAA 3FKSA 4J7AA 4EHKA 5FA5A 4AO6A 5B3JA 4CLOA 2NP6A 1TUGA 1S2DA 2JGAA 1KYIA 1EVZA 3EPRA 1A76A 1NV8A 4AN1A 2WIDA 1L6IA 1Q1AA 5K0NA 1DE0A 4AN4A 1UKEA 3NGXA 4MYUA 3UIEA 1G21A 5M3BA 3SSNA 3P94A 1ZI8A 1JR3E 2BEKA 3I2GA 3QNWA 5KJEA 5F7JA 1C4OA 3TSYA 5BUQA 1JEOA 3KS9A 3DEHA 3Q1LA 4JLOA 3K0CA 2BBWA 4YMLA 2W71A 4YRKA 1AO3A 2C2HA 2PE5A 4B7AA 2DQ4A 4EBFA 1L4HA 5CA1F 1LNZA 2P41A 2QD4A 3A70A 3V1UA 1JZSA 1UFOA 1U4OA 3ELUA 4Z9YA 3D4NA 2QLJA 2B1GA 1YVEI 3K8ZA 2QN8A 5GZ1A 3T34A 4P4SA 3UYKA 1QP4A 3BRSA 3QE4A 5AKGA 4X41A 1DQZA 2NU8A 3A37A 4IZ6A 1XTUA 1NXPA 5AQEA 3SS7X 1TJ5A 4WN3A 4YRIA 1G20A 4TV9B 2UU9B 1A9ZA 2V1UA 3C7CB 1PR1A 1SM4A 2J85A 1PVVA 1WTAA 4QICA 3ZU4A 1JQDA 2A5JA 1K75A 5FTNA 2MSKA 2O3TA 2GAJA 3ZDZB 4F5ZA 4R8MA 4O2BB 4EHDA 2W48A 3EZ9A 4YACA 1O5OA 1O8CA 3WG9A 1P2FA 3NONA 4ZTUB 3ACCA 1VDZA 3U0VA 3TOCA 4FEEA 4JVNA 4ZAWA 2HK9A 1RYMA 3LY5A 3BQNB 2FMHA 4NFYA 4XX0B 1GL6A 5JPIA 4A92A 5F9HA 4M3NA 2P40A 3V00A 2JDID 3VKVA 4HOYA 2ZR9A 3CLUC 3K2QA 3K1YA 4I6GA 4R7GA 1OB2A 1UBOS 4U0KA 2F8LA 3ABOB 3H9CA 3L4SO 3FYUC 3WL3A 2OBXA 4O2AF 4N49A 3JQCA 4TSFD 3SZLA 2IBSA 2HB6A 3OT1A 3AEKB 4PQYA 2VDPB 3ONFA 5J5AA 1HT0A 2HJWA 3JYOA 3RVOA 3UZUA 1Y3HA 2YZ7A 3FNQA 4C4SA 4RVGA 4IXMA 5EP4A 3V9PA 1FSGA 5DFAA 5M29A 4MMXB 1ZCBA 2FPMA 3H1FA 3NT4A 5HZKA 2QX7A 4DGQA 3FA2A 2NIPA 3QP9A 2ZYDA 5B4TA 4X62B 5FUMA 3LVQE 3V80A 1NRIA 2CK3D 2CUNA 3C8ZA 3WLMA 4C6TB 1VGVA 1CF4A 1RJWA 4V0MA 1QAQA 1AGPA 4H4CA 4NOJA 4QGFA 3T5BA 1G4HA 2B61A 3W4IA 4UTNA 3A2KA 3WNCA 4JEUA 1SPXA 2C00A 3DT9A 1ETHA 1XJQA 3PXBA 3FVQA 4C7MA 5DHFA 1NN0A 3COVA 3FNFA 3OLQA 4CMKA 3TLKA 2YCLA 1RI3A 2G25A 3B1FA 5C3UA 3DXFA 2PLWA 3BTSA 4L8VA 4ZOEA 3G0HA 1XHFA 4QUBA 1CF2O 5ALNA 2W6MA 4AWBA 1NW5A 1K3UB 5KNBD 2BP7A 1Z39A 3V8QA 4AAYA 4D4GA 1KA9H 3J80A 3L7LA 5CJ2A 1MJGM 4OIFA 2BI8A 3FGOA 3VAAA 3DVLA 3GUZA 1HL7A 1F4LA 5FPYA 1BWQA 4UJ3A 1GLNA 1QFXA 1EVEA 4IV0A 4IYRA 1Z26A 2OBFA 3CONA 1TEHA 3IDOA 3X1ZA 5C1DA 1EXDA 2NU6A 4ZIRA 4BLVA 3M7IA 4CTJA 2AFRA 3HCNA 2GA8A 2ZJ6A 1CJBA 2FKAA 1SD1A 3IP7A 3LUPA 3PEEA 1HDYA 2JIPA 4RKFA 2ISSD 3WGJA 4OL9A 3LXRA 3PSHA 3EODA 1F4PA 2V6IA 1QWOA 1NI4A 2OKGA 4M9QA 2R8YA 2Y0BA 1JQ3A 1NM5A 4NF2A 1EX1A 3V4SA 4OTZA 2G63A 4EB0A 2DCMA 4TMKA 2BR3A 2KM1A 2OR3A 1XA3A 1AXGA 2C5LA 3NP9A 2QRKA 4FGSA 3J7AC 5I7WA 5P21A 1HQYE 1FTSA 2O8CA 1J06A 2H31A 2JFXA 1GQSA 2IV3A 2DERA 3GVHA 3T5GA 1Z25A 2VF8A 3LVFO 4RV4A 4S2EA 2Z2IA 2AX4A 4RA9B 3OAAD 1QMGA 3TRDA 3V8VA 5KSZA 5DBFA 1KDTA 3WMFA 1N2XA 3E5HA 4LFAB 5J4KA 1S2OA 2VBIA 3ZN2A 3LX5A 1U0BB 1XCPA 2EJUA 2KBFA 3RAGA 4MUGA 3PXUA 3SFZA 4F0JA 4WJLA 1ZK1A 1E6UA 1XXLA 3DE2X 2OV3A 4WTOA 2I67A 2Y1OA 4J4TA 2WFAA 2PX5A 4Z8XA 3ABRB 4LRYA 2VYND 2CVQA 4IIJA 3LUHA 2CNWD 3NKLA 1I2MA 4RK5A 4DSAA 5BQXA 3LJKA 4GBGA 3UHAA 1LY1A 2G0NA 4GZ5A 5JHGB 1T8TA 4RJTA 3F5SA 3T5MA 2VJPA 1ZRSA 1I32A 2W0MA 4L1KA 1VPEA 1FP6A 3LAWA 1VHJA 4FYWA 4JJEA 1PI3A 5F77A 5KNBA 5L8VA 5HJ5A 2UYYA 5JDIA 3O6VA 1G8KA 3IALA 4C4PA 1CRLA 5CURA 3MYRA 1U5BA 4ZHSA 3NKFA 1V8ZA 4NS1A 3VYSB 3LY9A 4CFYA 1ZGJA 4X97A 2V9CA 3AK4A 3DWFA 1UJ2A 1UZAA 2G80A 2ZIWB 2H59A 1NX9A 4PLVA 3UAZA 2MSCB 4AB1A 1HLPA 5LQDA 3HO8A 4WT7A 1YFLA 1BNCA 2B4QA 2CXXA 3FFAA 1XZQA 1HGXA 3QEMA 4O8CA 3IEIA 4OGGA 5BSEA 1WSBA 1D04A 2CXTA 4GOMD 1OILA 1M1YA 4R0NA 4PLHA 1DDGA 4YYEA 4AW9A 3D2LA 2ZUFA 1FZTA 2VP2A 2RH9B 2XSZD 4M0PA 3G5UA 4MEBA 4OLJA 1LDNA 4NH0A 4CLDA 3A2LA 5DIFA 5TQ2A 1YK0A 2D6FA 3CUUA 2PV7A 1S3FA 1DKRA 1O97C 1JSZA 2D4HA 1GFIA 2F4NA 2WTAA 1P5RA 1RC1A 1PZXA 2XIQA 2F1RA 5HUQA 2PT9A 1KMHB 2R6CA 1JHVA 3Q3IA 5EL0A 2YTZA 2N3ZA 1Q20A 3FHLA 4MW7A 2W2VA 2Q5EA 2BHSA 3C6BA 3VC7A 5ENZA 4G2NA 3RTDA 3F6YA 4TXLA 4JLPA 1HNWB 1LUAA 3BIJA 4NS4A 1Q83A 4OK5A 5G0UA 2WZCA 3IH5A 3BMCA 4IDNA 1Y37A 3KYIB 3GRPA 3WIBA 1GZSA 3B1XA 5BRAA 1N2BA 1L4GA 3LQFA 3TQQA 2BEUA 4RLHA 2ZXFA 1F14A 4JKOA 2RI1A 2I4NA 5TMBA 5JARA 1KQOA 5DEOA 2JEYA 1C9YA 4CMCA 1NVTA 2Z43A 4LVNA 4JJ8A 2C82A 1UFKA 5HS4A 2Q3DA 2X2EA 3B6ZA 5BSVA 1DS6A 3LOUA 1PSDA 2NUPB 4FBMA 4QPJC 3E9QA 2BGTA 4HPJB 1PJ3A 4FGKA 5BNZA 3H6HA 4XWWA 3H2SA 4U9UA 1DT5A 3TG8A 2VZ0A 2D3WA 5MFZA 3KJEA 4DPKA 1Y5IA 1JHRA 4DV6B 1OIXA 2N9UA 4Y1RA 4KQMA 3TH5A 5JYEA 3NTLA 2C4KA 1E3DA 3R5KA 2XWPA 2QRGA 4QBHA 4XDGA 2Z9DA 1VDMA 3G2LA 3OJWA 4UM9B 2FU5C 1ORDA 2Q1WA 3M8KA 4AO7A 1V5EA 2JIOA 3INRA 1KVSA 4P3OA 1T9BA 4KVAA 4F5YA 2FZLA 3ZE2B 1BEZA 4EP1A 4EG6A 4EJFA 5CA0B 5JSZB 3QVGB 4LYHA 4KE6A 3F5FA 1L5HB 2RMKA 1IE3A 4I5FA 3PFWO 4IVQA 4RD0A 4WLFA 3JX9A 1IJBA 2ONYA 3IVGA 1MO5A 2H18A 2J5RA 4AN0A 5EXPA 4WXRA 5HW0A 1UBUS 3S27A 1BS9A 1H23A 1RMTA 1UM9B 4LHXA 4PLFA 1IBRA 1XRSB 2X2OA 3JZAA 4J6EA 4U7JA 2GEUA 3M9WA 3FYUB 1MMFB 3PDJA 1NVBA 3MLBA 1RZRA 2VYVA 1EUYA 1D6NA 3DBHA 1GDDA 2CMGA 1WB5A 2BUAA 3KYDA 2BSAA 1KY3A 4NBVA 2BTEA 1E59A 3MZ0A 3OZGA 1A4UA 3KDPA 4N0DA 4ZQFA 5KJ1A 4PEVA 1YIAA 5EJ9A 1EGAA 1OCEA 3GUUA 4CV0A 1Z15A 1UDXA 3JZDA 4FD2A 3MQ4A 3GBPA 2JLWA 4DV1B 3QMPA 2CLOB 2VJAA 1U65A 1UEJA 2W2NA 5F73A 1WV1A 3WQRA 4E1VA 1G21B 1TFUA 3RREA 3MT0A 3QXSA 3L8DA 4TXJA 1TK2A 4WUTA 4B35A 1QFYA 4IXNA 2O59A 2YVAA 4PX3A 3WMXA 2FEMA 1QRUA 1NYQA 4A9AA 1QHGA 5IEJA 4RE6A 3A36A 3QOFA 4RMGA 3TX6A 1CVRA 1OKKA 5C51B 1HK7A 4HGYA 1Y9DA 4S1PA 4CKXA 3R75A 5EGNA 2X8WA 4QOEA 1PFUA 3P1JA 3VDMA 2ECQA 3K70B 3L7JA 1UC8A 3D1LA 3EG9B 2C4WA 2VBCA 4IJKA 5I6DA 4J1NA 1RXCA 2D0PB 2X5KO 2W22A 4RKYA 2WWXA 5EQDA 5FUBA 2GM3A 4NH4A 1HXHA 4IHKA 4JB3A 1SCKA 1LX6A 3I3OA 3UWKA 3DE6X 4B9EA 5KTSA 4DJFC 2HWYA 5DB4A 4F7DA 5DF1A 1G1AA 4ZMRA 1EWKA 2JA1A 4L0QA 1VBFA 4ZO4A 5D7NA 3RT9A 4XD7A 4Z1MD 2EDCA 1K7FB 2BCEA 3C48A 5LVAA 2JC3A 1RD4A 2ONCA 2OGWA 2R7NA 4QGGA 5HIKA 2XW6A 4XPZA 1PV4A 1GU0A 3NVAA 3V4ZA 1AX9A 3ZV3A 1C9DB 3EZ2A 2WINI 2O3QA 3G8CA 1JDBC 4FCCA 5BVGB 2Q2OA 3PK0A 2H8GA 4MPDA 4ECAA 4G81A 5J47A 1YL6A 5EMMA 5K20A 4AY2A 1FB5A 2VJQA 1OLSB 4EGSA 2OHVA 2A1UA 4DG9A 3C3XA 3IKJA 1TD1A 5LQKA 2P0AA 3FOEC 4ZO8A 1YMUA 2R8PA 1SUDA 3ESRA 3IAS1 2PMFA 4O4HB 3EZLA 1UH5A 1L7RA 2H29A 2EGGA 3OFKA 4CV3A 2Q4BA 3C14C 2IS4A 3QH4A 3SBOA 1IN8A 1T3HA 3UB3A 4B3HA 2XGOA 1VJCA 4GBJA 4F04A 1A2KC 3AUTA 3O2NA 5G0WA 4OU4A 1D9ZA 5AXBA 5B1EA 1I5EA 1PS9A 2IITA 2JD2A 2BOVA 4TS4A 3WFJA 3PLAE 1Z37A 5DW3A 4RIGA 1O4VA 1OKKD 4ISCA 2WTMA 4LMRA 2ATEA 2X1LA 3NDRA 4R1TA 3ETHA 4U3JA 4XJTA 3AUUA 1O94D 3PUIA 4BLWA 1CEXA 2PMBA 3USES 5JNRA 2FUCA 2ORVA 3OKAA 4M7OA 1DCMA 1FDUA 1Z16A 2BGJA 2P67A 3V48A 1H1LB 4MS3B 2IU6A 5KHLB 2FUG1 4UMDA 2BEVB 2Y6VA 4C7JA 4CF7A 5KREA 5KVVA 3S1LA 3UBTA 3T3NA 1L7OA 3GMIA 2R48A 4V1CI 1IY0A 4OLAA 1U8ZA 4M6WA 1H2HA 1T2CA 5H68A 4B8WA 2QBYA 5T5QA 1Q0QA 1BOFA 3NBQA 1TD9A 1VJ5A 4U2BA 3SHTA 4UUBA 1PR9A 2XWJI 3EAGA 3KOUA 621PA 4CWAA 1R3DA 1EXNA 1TM4E 4R9SA 5F52A 2D7CA 2P65A 2W2KA 1MW8X 1WPQA 7REQB 1LJ8A 3DVRX 4WXEA 4EA9A 2VBFA 1T5BA 5PGMA 2D0OB 1P29A 5HM6A 1RWVA 5CLJA 1A5BB 4TGLA 1YQTA 1VE3A 2OGZA 4KGXA 4RSHA 5DKFA 4DIDA 4JLSA 2NV0A 1G18A 4UREA 5IWAB 1JQKA 3S2IA 4L73A 4G9GA 4Y2JA 4D98A 1QVAA 1V9CA 3EDCA 1PEYA 1VPDA 3CSSA 5ESDA 1GKKA 2OORC 4BKPA 4UUOA 4YUZA 3CVXA 1RAFA 1H9AA 3DZKA 3JRXA 2OV6A 1KYWA 3OJLA 3I6YA 2Z2XA 3QFFA 4EJSB 3TI9A 2HDNB 3HJNA 5UKDA 3ZWNA 5GVRA 1UKYA 4HDRA 4MUEA 2EZ8A 1ZIOA 2VUTA 1Z0JA 5J4YA 2ZR8A 3F4BA 4HDSA 2G9VA 3VU8A 4HH0A 5CYFA 3PUWA 4P3KA 2NV6A 1T43A 4UPVA 1EESA 1SU6A 5DYGA 4RACA 5JNUA 2YYZA 3D5TA 4QTTB 4L8WB 4EAAA 1CUVA 4XLTA 3VBCA 4GKJB 4QUHA 2WVAA 3CR8A 4KSCA 3H16A 3CF4G 4YXWA 4DSUA 1W8DA 4WZAE 4NYMR 4O0LA 3CKLA 4AY3A 2JLBA 3DWGA 4DUGD 1TTTA 2AJBA 5FOUA 3K5IA 4WFQA 3NH9A 4EYKA 1GNLA 1FP4A 4A26A 1RYEA 1U7DA 5TY0A 2XXAA 2FX3A 3E58A 1II9A 1TIBA 5MGBA 1XRLA 3QPWA 4HUTA 4A0GA 1FFDA 2E55A 4Q7LA 2PKCA 3DEFA 3PIIA 4EUHA 4AZTA 1JR2A 2VHWA 4WOKA 4WWHA 2IW3A 3FPCA 3K4PA 3EPKA 2GBGA 1YCFA 4D9NA 3IURA 3EXG2 2JASA 4UM5A 5H5JA 5IVKA 1VKJA 5CT4A 4DS3A 4BRSA 4KFUA 3VPDA 2Z3VA 4EAQA 3MWFA 4K1XA 4MWZA 5H9WA 3O4VA 4JUBA 4DGSA 4I1OA 3RU3A 1NDQA 3MJEA 3WIOA 4CMIB 1ISHA 3D7KA 3NHYA 3UV7A 2OZPA 5DHSA 1BMQA 1XMIA 5DHAA 2FJ0A 1XF9A 5DNCA 16PKA 1TDJA 2O8DB 3ZQKA 5BN3B 3C6KA 5GPBA 1SC3A 1YOVA 1Z83A 5DYYA 2CW5A 3WK8A 3QYAA 1S2MA 3GMSA 2UZ4A 5HQTA 3AHJA 3BCRA 1Z5UA 3E70C 5KVCA 3GN2A 2ODPA 1Z2DA 1YRAA 1KZ4A 3TAUA 1SOAA 3RVQA 4CGZA 1OLXA 4O08A 5U4QA 4QUJA 2HQOA 3KYCA 1ZGBA 1AVTA 2X8AA 2UYCA 5FBHA 2FPLA 5HFNA 3SEZA 3HEMA 3OJEA 4KDCA 3QXHA 2QMZA 1II0A 3ETGA 4LDJA 3VC3A 4OHKA 4R16A 4X6YA 4BQSA 4BKOA 3ZW9A 2C5EA 3E2IA 4EY8A 3GHYA 3AIKA 4KLAA 1KEEA 1MHTA 1Z36A 4MHTA 1FPQA 4LCBA 3BXPA 1U2PA 2W8ZA 2XXBA 2PNFA 3R5XA 4ZO7A 3H7AA 3LYAA 4QL3A 4MTCA 3U3OA 1BE6A 4BFZA 1HI9A 4Z9BA 5BO5A 2GPSA 2LDXA 2INGX 3D54D 3HB5X 3IUMA 3O9MA 2C4NA 2AC7A 4G4JA 4R3NA 4HHEA 2BR4A 3SLGA 1TIPA 1NDHA 2ATIA 5BW8A 1EUQA 2E18A 1DKUA 3HUFA 1G8JA 1DWOA 4NEQA 3C7KA 3EVEA 5DWQA 4G2TA 5FWXB 1FNDA 4KX5A 1DKMA 1GKIA 1Z4IA 3ROKA 4UAGA 3CH7A 3NZEA 2EFDB 3C15C 3LXUX 1Y9AA 1IM2A 3GFOA 2O48X 1KK0A 3IT0A 4KK4A 2IXEA 4CM5A 5ALQA 4CQJA 4MWGA 5A2GA 3VTAA 3BIXA 2AS0A 2AYXA 4RTJA 1BW9B 2JS7A 4FONA 1E0SA 2GRJA 4IDQA 4L2IA 1Q2UA 4RTKA 4YAFA 4TLDA 1N2GA 1R3UA 3A2NA 4PYMA 4FJ2A 4XA8A 5L53A 3F98A 5SYNA 2VQFB 1ECCA 3TKYA 4RZSA 2FPGB 4P2BA 2HA7A 4MPPA 4MR8B 3H2ZA 4CNQA 2FLWA 1AF7A 4MLDA 2E0IA 4KTTE 4EX7A 1UKAA 1GQQA 1JLSA 3ON5A 3TSZA 1VI6A 4FHZA 3LIIA 5BR7A 3JATB 1TRKA 2FP3A 2Y67A 1N25A 2L42A 4QULA 4UFPA 1ZUNB 3I37X 2ID8A 1DAMA 1UBMS 3OZRA 5JWRA 3F9IA 4Z4QA 1J33A 4XDYA 1CUCA 3OOWA 4G5YA 3WJ2A 4OHUA 3ROGA 1P81A 1AT1A 1XDDA 1YNSA 5KOJA 3I64A 1SQ0A 2GXSA 5K5EA 4I4CA 2HDWA 3DMNA 3OWHA 3QEMB 3G8YA 5CDFA 1FFWA 2Q6TA 2FYTA 5KYNA 1YB4A 2GBLC 2O2HA 5CUQA 4Z54A 3DLHA 1YA4A 1U28C 3RS7A 3U37A 3ZDCA 2P9QA 1S89A 3P4YA 3ZNPA 1FL9A 5B12A 2V5VA 4GDMA 1WCWA 1UBEA 2XQJA 3HABA 2VDNB 3R0VA 3EIHA 4MW2A 4TKMA 3IUQA 2Q3LA 2PS3A 1K06A 4MO2A 4DV5B 2YC4C 3HMQA 2C4HA 1NSFA 2JL1A 1ZO8A 3IIKA 2BFFB 3HVKA 3C6YA 3WDMA 1ISGA 4M0KA 1AZWA 2O3RA 3T0IA 4C0LA 4D6XA 4JI8B 5K4HA 3VFDA 3I76A 2L69A 4IZOA 5FBLB 1NVGA 3PPXA 1FFYA 2WDPA 1E0KA 5IDVA 4IBOA 1GTG1 2PS1A 2VKTA 1XFDA 3JAWB 2L19A 5LB4A 3RSOA 4PG6A 1G63A 3F71A 1SELA 2IYEA 3EXEA 3RTGA 4E15A 4LDRA 4DUZB 3NTVA 1RM5A 3EJWA 4N8SA 2VYNA 4AJEA 1MEJA 4AF6A 4BN4A 3WBKA 1I51A 3VR2D 1BJRE 2UV8A 4BWYA 4FFNA 1T8PA 1W9HA 3MTEA 3S7TA 5HPYB 2F00A 5IFKA 4LSMA 3QY0A 4MRSA 2DOKA 2G9QA 4DQKA 4KRYA 2PM8A 5JDIC 4EQ6A 1VCMA 5DN6D 1NL3A 1DO8A 2Q1SA 1ST2A 1D8AA 1RP1A 3PKIA 4FDVA 1DWPA 4JEHA 2RHJA 5CVEA 4B7UA 1UWLA 3NQ41 3KJZA 2FFJA 4GYKA 1OAOA 4Y67A 5GV7A 2JGDB 2DU8A 1QQAA 4G36A 3GD5A 4RTQA 4K5QA 4B3GA 2DFPA 5T3UA 5AICA 4RM2A 2YY7A 3C5WP 2PVPA 1HO3A 4IXDA 4B6OA 4FHCA 5A3JA 5CIYA 2V6GA 4BLOA 1LI7A 1D2MA 4XARA 3RT7A 2XSZA 3O1HB 4L15A 4KQXA 1A3CA 4DC1A 5JRJA 1QAOA 4QRIA 4AVYA 2FXVA