4L0ZA

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
159
structure length
147
Chain Sequence
VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRGSLSFSERLSELEQLRRTAMRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 147
sequence length 159
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4l0zA01
2PCXA 4LOEA 2J1ZA 2IOIA 4MZRA 2GEQA 3WTUA 3VD1A 3EXJA 1IO4C 4IJTA 3Q01A 2X0VA 4AGLA 4IBUA 4KVPA 1TSRA 4LOFA 3VD2A 2J1WA 2J1YA 4MZIA 2AC0A 4G83A 1EANA 3KZ8A 4QO1B 2J20A 3WTYA 4IBYA 4IBZA 1CMOA 4L18A 2IOMA 4IBWA 5LAPA 1GZHC 5LGYA 2P52A 4XR8C 3KMDA 1E50A 3Q06A 4AGMA 3EXLA 2X0UA 2VUKA 2XWCA 5AB9A 4L0YA 3ZMEA 3D0AA 4GUOA 2BIOA 2RMNA 4AGQA 4G82A 2OCJA 1UOLA 1HJCA 2J6WA 1YCSA 4A63A 5BUAA 2H1LM 5AOMA 4IBQA 2BIMA 1H9DA 2ATAA 3D06A 4AGNA 3US0A 2J1XA 5AOLA 1EAQA 2ADYA 5G4OA 2J21A 1TUPA 2BIQA 2XWRA 3WTVA 2FEJA 4HJEA 2MEJB 1KZYA 3D05A 2BIPA 4IBTA 2IOOA 1EAOA 3QYNA 2X0WA 3WTWA 3TS8A 3WU1A 5KBDA 1HJBC 1CO1A 5G4MA 2AHIA 4AGOA 1HU8A 3Q05A 4AGPA 1T4WA 3WTTA 2WGXA 5G4NA 3D09A 4L0ZA 3IGKA 3US1A 1GZHA 5AOJA 3WTSA 5AOKA 3IGLA 3WTXA 3D08A 3QYMA 4IBVA 3VD0A 4IBSA 2BINA 1LJMA 2YBGA 5A7BA 3D07A 4GUQA 5ECGA 5ABAA 4LO9A 5AOIA
chains in the Genus database with same CATH superfamily
4PB0L 1AGCA 4LQ1A 3TA3C 1R4XA 3WLBB 1JZ3A 5A43C 2GJZA 4IM8A 1I9IH 2G5BB 5T1MA 2P8PA 2WUBH 3B6SB 4G8GE 2Y25A 1M4KA 3CHRA 3QUXA 5DZAA 5SV3A 3VRLE 5HHOE 1A7RH 4F8LA 5HDBE 1QSEE 3QNXA 2CCVA 4FABH 2J88H 3WFHB 3ZDYF 3QHFH 1OAQH 4YDLC 1LQSR 1SLXA 3LXBA 4FNTA 3ASOB 4LSRH 1QQDB 2VJ0A 3CC1A 3RPIB 1CXHA 1W6WA 3AS0A 4FABL 4F7PA 4Z0BH 4H1LH 5D1XA 2R29L 1UB5A 4CVWA 2P52A 2A4EA 4GKNA 3ZKXB 5J57B 1KSRA 4PGDA 3GRGA 3SYAA 1UOKA 1UT1A 1JF1A 2A6DA 3EO0A 4G8IA 2HRGA 3AABA 2DWXA 3PL6C 2NNXA 4FQQA 4G43A 5BV7H 2ZOKA 1GYAA 1NCCH 2QADB 3Q8BA 2ZUQB 2QVMA 4PUBL 1WK0A 3BUBA 5GGQH 2R69A 3NYKA 1L9QA 5ID1A 1MZYA 5J1AA 4ZW6A 3U79A 4MD0A 5GGQL 3EJUA 3ARGB 4WW2F 1FGVH 5EZLB 2MQ3A 1CCZA 3K81A 4OLYH 1VADB 4XX5A 3C6LA 5I1AB 4XWGH 1MCPL 1S9VB 2EDTA 4JG9A 5IHUL 3DRTB 4WTWA 5HHMD 1ZLSH 2RB8A 1SY6A 1LNUA 1AIZA 4OLYL 3V0GA 4XWGL 1A7PH 3TVMD 1JYVA 2BS8A 1P1ZA 3F00A 1F8TL 1TJGH 4KROD 3ALPA 1AJ7L 2GTZB 4YBLB 2A6KA 3L5IA 5C0CE 2FQGA 2YAFA 2YEQA 3HN3A 3KL3A 4OJCA 5JHAA 2COQA 2VC2H 3GEFA 3MUJA 1BFTA 3BUYB 2VW4A 3FO1A 1AAJA 3QHTC 4O5LL 4TUOB 5JW4N 3LKOA 1I7UA 3WNJA 2LR4A 2A6IA 4XOAA 2E6QA 5IK3B 3SDYH 1XB8A 5D1QE 1CQYA 4C4BA 1HU8A 3LXAA 4U1LA 2Y7MA 3GSXA 3QUYC 4JE4B 2DI8A 4OF3A 3ZKMC 4ECNA 5HDLA 5CGBA 1NEZG 1TO5A 2NY7H 3IXTB 2E27H 3IJEB 3MV7A 2XT1B 1X5LA 2P1YA 4HIHB 1UWGH 2XZCL 1MRFL 5DZOA 5LCVA 2E27L 3IGAB 2QSCL 2VDQL 5HVFB 4JG0L 1P5UC 2D31A 4OVUA 2DB8A 1WAAE 4FNQA 5CBEA 3DX6B 5ISZD 4J8RA 5IMLA 5D7EA 4UTAA 1OTTD 1INEH 4NOFA 1NAMB 5HGDB 2AXGA 5HJ3B 1EXUB 1FRGH 4IRSA 5C2UB 3N42B 3QCUH 5L7XL 3N0AA 4U0RB 5HHPA 2DWYA 1VPOL 4YHYC 1INEL 2I32A 5FUZH 3AM8A 1F0LA 4J3WA 3RTQB 1G1YA 2Q7AA 5JR1L 3HUJB 5HPMB 3DO7A 1G4RA 3MGTA 1BFOB 4FOMA 3S34L 4FXKB 3GMPA 5EG6C 3Q6GH 4F93B 3AG2B 1SXSA 4PJ8A 1OP3H 4BFJA 5CJOH 5TPWH 4Z7VE 2B4CL 4ZSOB 1CLCA 3VAEA 1U8PA 2PABA 3L8QA 4X98A 1DVUA 3KVDD 4PWHA 2KLRA 4KVNH 4WKZB 3T0EB 3IN0A 4EI6B 3Q6FA 1CD8A 2YPVH 1FLTX 2J56A 1JN6A 1MIEH 5EFIB 4NP4H 2EDXA 4KVNL 3MBXH 4JUTA 3VFGH 4HZAA 3TWCH 3CZFB 1BVNP 4KRPC 5E8OB 4BELD 1INQA 3B9AA 2BNQB 5AYTA 2ORBH 4Q2ZA 3V55A 5AVUB 4Y16D 2R1WA 2YQ3A 4OVVA 3P2DA 2MTPA 1KTJA 4FQXC 1BQHB 3FUMA 3ATEA 4ALAC 1F11B 2IADB 1IEBA 1LP9B 1G6RA 4LAQH 3JWOC 4JL1A 4ZYKA 1MAML 2YR3A 1GVIA 2XYCA 3CFBB 3QPQC 3RE0A 3QWRD 1L5GA 4KXZH 4TVPE 5I1CL 1HOCA 2WXRA 1M7IB 5F7LB 4LAQL 5AKVA 1MJ8H 1JS4A 5JQIB 3W82A 3V52H 3QZPA 4TS6A 2X0WA 2Z31B 1MCWW 5K9QI 3L13A 4J28A 3SD2A 5DFAA 5SX4H 4YSRA 3EYVA 2UY7B 3UEZA 4EN3B 4H7VA 1MJ8L 3V52L 3AG3B 4M7JH 4TLTA 1TYRA 1CO1A 43CAA 2WTRB 2PP9A 4BFBD 1JGEB 4X5QA 2E9WA 4TSCL 5FB8A 3ETBF 4JN2A 1KELH 1EDHA 3LEYH 4JZOA 2ZYIA 5DJXB 5DURD 1I8MA 1B6DA 3WELA 2AI0H 2R23A 1K5NB 3UBFA 3O0RH 4BDVB 3TBSB 2GTWB 1IGJA 2IAMD 1H5BC 4QUOA 1JWMB 3WEMA 3FQTA 1NGXB 3BWUC 4FXTA 2AI0L 1DEEB 5GGSA 5B3JE 3BUDA 4QRPA 5G5DA 1YMMA 4M9PA 1ZLWK 4PGCA 1MLBA 5TF1L 4J3SA 3STLB 4AIZB 4XOEA 3GS4A 4NQXA 4N2DA 2XKSA 2QPEB 4H8QA 2V9RA 1KIRA 4B50A 2E9BA 1PKQE 3W37A 3WFDL 3OV6A 3GO1H 1CF8H 3O3BA 4GXUM 3RWGA 3FQUB 3JV4B 3GWJA 5ANHA 1FIEA 3ZT7A 1JXKA 4HT1L 1EZVY 2R39A 3RWCB 1IGYB 4QRAA 3VO0A 1E4XI 2CHZA 3P0YH 1XXDC 3ESOA 3TESA 5I8CA 4BK5A 4HD9A 1OSPH 3LYRA 1FZKA 4OJDH 3MRJB 2XN1A 3BE1L 3P0YL 1UM5L 1S9YB 5I1GL 2W0LA 3O6FA 2OJZL 3P77A 5I16B 2UV3A 1PJ9A 4XCCH 1NCUA 1QG3A 4DO4A 3WFBH 4QXVA 2YD6A 2NPLX 4MDRA 2AFNA 4GOSA 2QGDA 4B9PA 4KKCD 4ANVA 3QR0A 3TO4B 2OL3H 1LO3H 5F7EH 4CJ1A 3L48A 5HHOA 3SQBB 3BQUD 1AGEA 4AENB 5B22A 2G2RA 1NFDE 5F7EL 5J13B 2QPFA 2ALWA 2ZKMX 3D39B 1L3WA 4LDCA 5G4OA 1JBJA 3FSZA 3NCCB 3WE6B 4MQXD 2ED8A 2ZXGA 3HCVA 5IHHA 1KB3A 4WI6A 1MEXL 1ZHKB 5K9OB 5E5UB 3KJ6H 4P4KC 3VWKA 4WUUA 3WHXA 2HPOA 3OAZK 3GKZA 3W11D 2WINA 5CCJA 5K39B 4HKZA 2JLLA 2LFGA 1MHCB 3FT2B 1AR2A 3IDGA 2Y06L 2HKHH 3CFTA 3C75A 4PLKC 4QNPE 2VN3A 3FQRA 3MLYL 1CD0A 3A4AA 2NW2B 43C9A 2G60H 5D7IB 3FQNB 2I27N 1YYMH 4YGVA 4YHPA 4BGLA 4Z77A 1P7KB 4GRLC 2E7LA 1E9PB 2HB0A 1GGTA 3O2WH 4UDUA 4KUZH 2VLKB 1YYML 3AS3A 4NJAL 4I13B 2EVIA 3OC5A 5DJ2A 5C7ZA 3BMVA 3RZWA 3Q5OA 4BYHA 5FGCE 4G7YL 2ICWJ 2NY0C 2ZWSA 4OUUA 3WTUA 2K7QA 1J05A 3HG1E 3FMGH 3K7UA 1R3JA 3MJ6A 4M1GL 5DMKB 1TETH 3O81A 5KEZA 2OX5A 1DBBH 3PWVB 4OR1A 3VD2A 1MW2A 1J1OH 3BX7C 4PJBE 5J4MA 5CAYB 2VDNH 4IOSA 1EGJA 2BOBA 2X6MA 4NKDA 5LGJA 4DHLA 1HKLH 4JW3A 5AYUH 2YMXH 1QAWA 2E8ZA 5DVNA 3ZSSA 5DHMC 1FH5L 1IBZA 2DM3A 3HPLB 2D9CA 3KWTA 4N22A 1HKLL 2H3NA 5GS1A 3FL7A 3TO2B 4U1IA 1F42A 5AYUL 2ODHA 3QWNA 4ZMAT 4XR8C 2F2HA 3H7BB 2ENQA 4I9WD 1KCBA 1P2CB 3MV8E 1I7RB 1OPGH 1V7NH 2DQIL 1U2YA 5GS2D 2B3RA 4ELKA 5AB0A 2P8LA 1MW3A 3FFCA 1R5WA 3WGVB 5CLYA 5T1DL 2BNRE 4AJ0A 1V7NL 2W65B 1MIML 5C0ND 1I85A 1KY7A 1R24B 1OIOA 3RVVD 2FGWL 2VIRB 3KPSB 4O4YH 3QW9A 5DJ8A 4YAQA 4XP1L 1HINL 3KLLA 1V5JA 2AJUL 3SPVB 2H47C 5EH1A 1GYUA 3VXRE 1RZ8A 3DIVA 3CXDH 2MMXA 3OJMB 4O4YL 3FU3A 1E4WH 1OB1B 1CPUA 1U92B 3MRPB 2R56H 1HHJA 3BVNB 2KDGA 3CQFA 3BFOA 2CBQA 5BZXA 5C6TH 2AS5M 5C0AD 3FUNA 4BFRA 1A7NH 5D1XC 1XD1A 2AZUA 2VN7A 4V2BA 1DBJH 3HLAB 3MA9L 4M1CD 1ODUA 2VRKA 2Y3NA 4XODA 3GDBA 4YDZA 1AANA 4FQ1H 3UIZA 1A7NL 3QUZA 2AABH 1T5WB 1TQBC 3BN3B 3W38A 3ET9F 4XN4A 3V0EA 1NCAH 5EN2B 1QUNB 4Z7VA 5DUBB 4MFHA 4DETA 3BKJH 1JGUH 3CQPA 4CNIA 1OSYA 4I18B 5LNGA 4HOXA 3MV9D 4FHBD 4K15A 4M7ZB 3T8XA 5MEOB 1LEKB 1ZIAA 3M1CA 3NJLA 3QUMB 5D7KE 4WAFA 4Z7QB 5I73B 5K93A 2WO3B 5CLTA 3S3DB 2Z4QB 1AGDA 5KSUA 1DN2A 3VRIB 4H1LA 3NG5A 5ANME 2ZXQA 3LVTA 2A4CA 2NY4D 5JNYB 4KZDH 1FQ9C 4JFDD 2SEBB 2HX8A 1BOGB 5A7BA 2GUOB 5DJZB 3C6LC 3IDJA 5DJ0A 3WIIH 5C9JB 3S4SA 1E28A 3T2LA 3IETA 2DEWX 2LT9A 2WBKA 3D1MC 3LPWA 3O9WB 5KBMA 3QJSB 25C8L 2EINB 1ODAA 1NBYB 2JB5L 2XQYG 4WHDA 4XNXH 5E8NB 5AEAA 2WOBA 1BAFL 4P9HH 2ZWNA 4I87A 4WDIA 3WXWH 2V2TA 3V4VB 3VFWA 4FN0A 4FNPA 5DWUH 5C09A 1RJZA 3FT4A 5AG8A 5IJVB 3WO4B 4FD0A 4ZUSB 3VXUD 2XBZA 2VDMH 4JFUA 2V2WB 3L3JB 4HS3A 4LARH 4R84A 1N9PA 1TYEB 5FKAB 4HIIB 3JTSB 4L3CB 3ABGA 2V5SA 1Q72L 3ZDWA 4J12A 3C5ZD 5I8OL 2XWTA 1JF5A 4G59C 4JPKL 2FSEB 5CP7A 4RMRA 5ITFA 2YOAA 1Z2KA 1TEGA 2PO6C 4OF5A 2NDGA 4HIJA 1VCAA 3O2VL 3V9EA 4BIKA 4AW7A 5DTFA 5I0ZA 2UWEA 4QHKI 4F37K 3B9KA 1J12A 2EIDA 2TAAA 3ARBA 2WYZA 3O4LE 1ZPLA 4H26B 2X0UA 1UWFA 2FEEI 2Y6SC 3B7TA 3PFQA 3VI4F 1CDBA 2WXPA 4HAGA 3WEOA 4BE5A 4OZIA 3SCMD 3R8QA 3EOBB 2APTA 4L0YA 1BW8A 2MCAA 2GSIA 4G82A 4YE4H 1NM9A 3LS5L 4LNRA 1BAWA 5E1AA 4HBCH 1LE5B 4PY7B 4MDIB 4F58H 2WQVA 2VR7A 3CVHB 2HLAA 1OSZA 4NO0D 1HHKA 4JHBA 1VFAB 4QTHA 2XZQH 3ILQD 4QY8B 4X7EC 3AM8C 4OCYH 1P4LB 3GSNB 3VYPA 1MFDL 3BUIA 3QZWA 1HHIB 2D7TH 2CO2A 4NQVB 1W8OA 4X9HA 2BRQA 4UAOB 2CNZA 4ZS6D 5TDNB 2FL5B 2BS71 2RA1A 3BLKA 3VWJD 4PJ8C 3LZPA 1J9RA 2OMWA 3VFSB 2G4EA 5D71H 5ICYA 3VQLA 3DMMD 3CUPB 4AQEA 3RZCD 5AW3B 3WKYA 3NFNB 2QVIA 1NZRA 5CNHA 4AVJA 4P46B 2DTML 1BXAA 3N44B 4LF3B 3A5VA 1SEQH 5TK4A 4PRPA 4Z7OB 1G7JB 4H5SB 4LSVH 1BF8A 3MXVH 2WLLA 3LN9A 1CG9B 3K8LA 5EIVA 3MZTA 1D5BB 5E8DH 3CU1A 3DRQA 1NBCA 3FU7B 3O4OB 3WKMH 2FX8L 3MXVL 3QFJA 4LSSL 1C08B 4NIKB 3TNNB 4WWKB 3HG5A 3MOBL 1SXBA 3QDGD 4IRZL 4BK8A 3ZE0F 4BGDA 1CICB 4X5WB 5BRZD 2I5YH 3M6DA 3LXCA 1W72B 2YPVA 4E5XA 1MXGA 3DOIA 3PV7A 1T1YA 4R4NC 1JV5B 4TV3A 3U30B 2D73A 1B0GA 5JA8B 4AGLA 5KVDL 5DK0B 1ZY9A 3BPNC 3DNKA 5KANG 4GBXB 3IFPA 3KE0A 2VLJD 4GH7B 5C0BA 1A7BA 1B2WL 3L1OH 4EN2A 1FNFA 1W0WB 2QMJA 4HEMA 4LDOB 4BUGA 2OMYA 1OAZH 1RZKC 5F3BA 5KVEH 3WUWG 2ARJQ 5DZPA 1CFNA 3VMPA 1ZS8B 1JK9A 3JWNG 3IDYC 3BGFC 3TYGL 5F0MB 5KVEL 2VABB 2W07A 2WNKA 1RHHB 1UASA 3HHRB 4WSJA 5T5NF 5B1JA 2D3JA 4PVLA 4BEIA 3X17A 5BOPA 4TNWF 1Z9PA 4Z7UB 5DFVD 3KPLB 2CIIA 3DUHA 3KPRD 2AKRB 3HAEH 2UZYA 3PWNA 5C3TA 4U1SA 1SVCP 2K3HA 4PJ9C 3GSVB 2EUZA 5HJBA 2BFVL 2YMTA 3R06A 4LGRB 1IE5A 1T1XA 2KPWA 2ITEA 1JFQL 3UPRB 4PJBA 3PWUB 1ZANH 3FB6B 2BSSB 3G08A 4HAFA 1M71B 1CI5A 2GIYA 1BYPA 2P5WB 1KYUA 3HUJE 4JDVA 3GKWL 5IQNA 1GL4B 4CADB 5ABDE 1ZTXL 4IRJA 4A2DA 1KJ3H 1U6AL 3OKLA 3V6ZB 2IOOA 4ZSOE 4A2MA 1CBVL 2AEWA 4OZHF 3TS8A 1VZIA 1NFIB 2BSRA 2OULB 1T3FA 3CPLB 2W0FB 4N8UA 4P3CH 3W1ZA 5GS0D 3T0EE 1S46A 3IMBA 3TFKD 2VISB 1IM3B 2UYLA 4DEUA 5TF0A 5DD0L 3KWWA 3O6FC 4NQSB 5C0EA 4MCNA 2PW1A 3MGAA 4H40A 4XO8A 3BKCH 4OD1H 3V0VA 1R3IH 5JYLA 3E9TA 4X4XA 2X9XA 3PAVA 4XXWA 2CMRH 4TKWA 2BNQE 5HYSA 4QHLB 2MOGA 3GZOA 5TH2A 4OD1L 5E56A 2WZPD 2GAZA 4YXKH 1JZIA 5SWQA 2GC4C 3W5NA 4YSPA 5I0DA 5IMMA 3HI1A 2IGLA 1WEJL 1IKFL 1SYSB 3GMRA 2OYPA 5L8KB 1LP9E 4NQEB 2H0JA 5TK2A 4JY5H 3PHQA 4NRXA 5HGHA 5EU3B 2JJVA 5T5NG 4OM1L 5I18H 2VLMD 5FCSH 3CV5A 1FO0B 1I3RB 1N7MH 2F1BA 4G3YH 1YJDH 4WTQA 5EO0B 1BXXA 4ZFZA 3VWKC 4JK0D 2EYTB 3C60A 1E3ZA 1CE1L 4PMFA 3WLWD 1D5ZB 2AQPA 2AQ1A 1TKWA 5I18L 1MFAL 2OL3A 4ZTOH 3OHXC 2HFEB 1ZHBA 5D7LB 3MACH 5B1CA 2H0PA 5I19L 5L2KB 2UVFA 3QDHA 2R0KH 2FD6H 4J4PA 1U21A 3JT0A 2F5AL 3BMWA 1RP9A 2VZ1A 3MACL 4J3XA 1E50A 2ED6A 3GXIA 3HA0A 4K5OA 1ZLVH 2FD6L 3T71A 4ISVA 3TF7C 1OTSC 4P9MH 4NLHA 1NM4A 3ZR5A 3DVGB 2E7LC 2JCCF 1AD0B 5F7UA 4PCTA 5F72S 4AX3A 1B6UA 1PYWB 1BJ8A 3P4LA 2B20A 1M2VA 4DN3H 2HT4C 2BSCA 1VFBB 2XZAH 2MCPL 2R7EA 3VYNA 3QJVB 3C08L 4P49A 1WP6A 4DN3L 4GAFB 1QTSA 4AYDC 1QLEH 5IG7B 4IYKA 1ACZA 3FU9A 1YCSA 1KV3A 2Q2EB 3IDIB 2Y1VA 1BIIB 1NEZB 3K5RA 4OD2B 2XN0A 1BZEA 1FG2B 1RZFL 1CBJA 4LMQE 4IOIA 5LKNA 1OSEA 2JXMB 5GS1C 4GQPH 1OZUA 2HTLD 4JFFA 5HYQB 3TJPA 1NCDL 3ULUF 1J5OL 1BA9A 4KK8C 4M8QB 3CFEB 5GRZA 3B5TA 4U33A 3PS6A 3RWJA 3V6FA 1KBKA 2R4SL 5E08L 3ULUD 3ULSB 1TJIL 1V3MA 2H32B 5TE6H 4D0BB 2WAHA 3O4LA 3MGOA 3W9DA 1I85C 1G5GA 2H26B 5HHQA 1QI4A 4ZFGH 3HE6D 3GLZA 3WLBA 3HRZA 4N2NA 4R0LB 2DLFL 3OTTA 1S3KL 2XTJD 4U1KB 2Z93B 4V1DD 2VMCA 4N20A 5HHMB 3B6SA 3H7LA 1E9QB 2HX7A 1VENA 4BFIB 3BH8B 4P2OD 1VB9A 4FC3E 3TVMB 2EIMB 3VYOA 1ZLDA 1RJLA 3II2A 2ATKA 4I0PC 4ODUA 4KROB 3WFHA 3ZKSD 4FFWC 1E2WA 3BLBA 4PG2C 3MAWA 3U9UA 1B2YA 3QXAA 3D39E 1JZ8A 2C9AA 1M05B 3RPIA 3B9VA 4OF7A 1CR9L 4TOYL 3UPAA 4PJDF 3OAUL 1JNNL 5E6ID 3DXAD 4GMSH 5EEZA 4FMVA 2ZG3A 1DVSA 5JMOC 3QUZC 5EF0A 4DZ8B 3BAIA 1D2OA 1Z3GH 3REWA 1KXQE 1RZ7H 2WYHA 3FO0H 3O8XB 3Q2CA 1Z66A 3BISA 4XVJL 1HDMA 2QLVB 5HYFA 3LZLA 3Q8CA 2QFRA 1RZ7L 2P80A 4LFHD 1FSKC 2YGPA 3GI8L 2VN4A 4IJ3B 1IGTB 2CXKA 1H8SA 2Q8AH 2KYIA 2XWBA 5D7IE 3FCUB 1C12A 2B16A 2QVFB 4R3SA 4XCFH 1VF5C 1USQA 2IWGA 4YHLH 4EAEA 1AXTL 5ISZB 3QJHB 4S1QL 2X4QB 2V2XB 3ARGA 2VLKE 5E5MB 5T1JA 1B4JL 3CSYA 4Q52A 5DK3A 1VADA 3VRJB 4BSWB 3TYFB 1S9VA 5I1AA 2RAMA 2BVYA 5BOJA 5BV7C 1U8HB 1RUQH 3BVWA 2I7SA 1OL0A 4RGMC 3X11B 2BWDA 2CBMA 5J6GB 1H3XA 2XPYA 1PG7H 3BWAA 3EOTH 4AK1A 4LLUA 3MMEB 5E51A 2DI9A 1M6UA 4NWUH 2ZNWA 4ZW3A 5KYNA 4XMUA 1X4ZA 3SQRA 1SHWA 3DDFA 4PJEF 4XBGB 3CX2A 2ATAA 4AGNA 1MVUB 1N6VA 3N85L 4F7KA 1GYCA 3FB5B 1RULL 4UUJA 4YUEL 1O9WA 2X3AA 2IQAA 1CIDA 2B0SH 4NM4H 1H15A 2AP2A 3FT3B 1QFWH 4N0UA 4JRXB 3CC5A 4NM4L 1T1WA 1NGZA 2ZYHA 4Y16B 1W0VB 2CHDA 1H3GA 4LFHG 2JJUA 3US1A 2F68X 3KPSE 3VFOB 1UTDA 2VUOA 4ZO8A 1Z5LB 1WHOA 3AREB 1OGTB 1X4YA 5I9QB 5SWSE 5CLWA 1BVZA 1NAMA 3D07A 3IRCA 3K4AA 5HGDA 5HJ3A 3UJTL 1F1AA 1FFQA 2VOTA 1L0YA 3MCG1 3T04D 4ZUVA 1LM8V 4YC2C 2RIKA 4LOUC 5B8CA 3SDXB 1T6WA 2GITB 1BFOA 1DJZA 4YSDA 1MCQA 2EDNA 4FXKA 2PWHA 2ZOUA 2B1OA 4Z3HA 4Z7NF 1R0AH 3WFCH 4AYMC 3HZYB 4GINA 4RMUA 1J86A 4U6YB 1FH2A 2E74C 2JKLA 3KGUA 1C9SA 1Q1PA 2GKIA 1K6QH 3WFCL 2HG0A 5HI5C 4WHYH 3DK0A 4WKZA 1ZT1B 5DURB 4PS8A 1ND0B 4GMTL 3N0PB 5A3ID 4N2CA 5I75C 4Z7QE 2DQGH 2X4OB 1K6QL 3I84A 4UV7H 2VSCA 5EFIA 4WFFE 2JKWA 4OI9A 2IAMB 2MHAB 4UV7L 2FHCA 5CR8A 4UM9D 1QNIA 2BNQA 1A6VL 2KUTA 3BXNA 4AH2B 3CX5J 3ABLB 3NIDF 3FSAA 3OLEA 2Y7OA 1XF3B 3DX0A 2ZF9A 4Y0GA 3RHWF 2Y36L 4GRWB 4JJOA 5T5FA 1M1XA 2AQ2A 3ZHLA 3QUKA 2IADA 2RMNA 4FXLA 4JL2A 5L88L 3SJVD 2I9TA 2H6PA 1RFDL 1UOLA 1HEHC 4ZFFA 5G2NA 1T22B 1XF5B 8CGTA 4G7QB 2DW5A 4A63A 3CN0A 4OT1L 4NNXA 1TR7A 1EX0A 2I25N 4HA1A 1TZHB 2BRRL 2V3EA 2Z31A 5AQ0A 3KGTA 2FHBA 1YNLH 5J8OA 1GIGL 4XO4A 2WKOA 2UY7A 1RIUH 1A14L 2PPEA 3DGGB 5FV1L 2CZNA 1JDAA 3A24A 3EFFB 1J5DA 4X8XA 1IZJA 1E5UI 3HZVB 3MLUL 3O11A 3SPGA 3ARFD 5DD3H 4JHVA 4KZEH 2Y7SA 3VSVA 3L5WB 2V8LA 1J0JA 4YIQB 1V7MH 5HJGA 5FFLA 5DD3L 1BGXH 5JQ6H 1K5NA 4H0IA 4XE0A 2IVFC 1JYNA 5DO2D 4YSEA 4M61B 5F9OL 3H9SA 3TBSA 2GTWA 5EUOF 1RZIB 3GNML 1V7ML 5G4NA 1NGXA 5JPMB 2MPAH 5JQ6L 1KJVB 1R75A 3BQUB 3DYOA 4QF1A 4PREB 4YSAA 4H8VA 3VD0A 4JM2A 4AQOA 2YLHA 2MPAL 3BZFB 4U1NA 4YHZH 2DEYX 3DX7A 5FUCC 3STLA 4AIZA 4IW4C 1MFBH 5CLXA 1CK0L 3FO2B 1O6TA 4DP8X 5AVXB 5ESQA 4N6QA 4YHZL 1NDGA 4YDKH 2EYRB 4A37A 3ULVE 2J1ZA 3GMMA 3T4AB 2RD0A 4N24A 4ACPA 3BZ4B 5E6ZA 3EZ8A 3GBDA 1ORQB 4QRBA 2EEDA 4YDKL 5IB2B 5DZLA 4IRJC 4LKCB 1TG8A 3HAEA 4UQ3A 4AQ1B 1A4AA 3RWCA 1IGYA 4QRUB 4UOQA 2OW6A 2H45A 4WO0A 2AJSL 2R8SH 3SPIA 2CRYA 2RGSA 1NINA 3PAZA 2BZCA 3N9GH 4UAHA 5KJRH 4G80B 3PHSA 4Z7OE 4UB0H 1T2JA 3MBED 3MRJA 3JTTB 4PGEA 1OGAA 4AITA 5F89B 1YDPA 3N9GL 4RAVB 4XXWC 1CTMA 4LEBA 2V8MA 5F88A 2JQZA 3MC0A 2E59A 5E1HB 4U6XB 1QNZL 4GKOA 4Y9CA 4F9LA 4JR9L 1SBBA 1BHGA 1SRDA 3TO4A 3N50A 4EQ3A 5I1KH 3NEOA 1OARH 5KSBF 1X7SA 1CLOH 2Y23A 3FAWA 4AENA 5D7JD 5E2TL 3GK8L 4Z8FL 1FBIH 4MA1C 4PVBA 3CZUB 1ZJBA 4F7EB 2ZKXA 3D39A 3V0WL 4JFPB 4QDGA 4WNJA 5E2WH 5DRWB 1FBIL 4QHMA 3KD4A 3OKOB 2Z8WC 2J6WA 4XNDA 4ZUWA 4DF9A 4APXB 4YX2L 2C3WA 4GW1B 1SEBB 1A6ZB 4RAHA 3QULB 4ZMZA 4NKMA 1FNLA 4PV1C 3K3QA 2BH0A 5C0JA 2JJSA 1VGEL 4X5XB 2UZIL 1R3LA 1KXQA 3LB6D 1M53A 5K39A 4CN6A 3NCJL 1UYWL 1W8NA 4PRNB 3ZMNA 4LSTH 1UH3A 2O5NA 1MHCA 1ZOXA 4QRFA 2DQUL 1NDMB 5KSAA 2A38A 1LVEA 2XA3A 4J3UA 5EV7A 2F61A 5F7MC 4UNIA 1TNNA 3CZGA 4MBRA 2R0ZH 3TL5A 5GJTH 5D7IA 3FQNA 3L1EA 2B1HH 4PJ5D 3LIZA 3KBFA 4XBMA 1U91A 3BDYH 5GJSH 1PX8A 5C6WH 3Q7JA 3I74A 4ZNEE 1E9PA 4LASL 4DTGL 2PWGA 5CCKH 5GJSL 4EI5D 5E1IA 4OJFH 2WQUA 4Z7UE 4EIGB 2PCPB 3WSQH 5I5RA 2X7LA 1A25A 5CCKL 1DFBH 5E00A 5CIPH 1GMEA 2OK0L 1E7UA 4OZFG 3I02A 1X4XA 4N2EA 1JGLL 1SOQA 1YC7A 1CYGA 1DSWA 1AQKH 1DFBL 1KXTA 1FN4A 2P5WE 1JXJA 2PXYC 3QXWA 2CDFA 4GAGH 4JRYD 2DQEL 2FSDA 5CGYD 3IMRA 4Z3FA 1ONQB 5I6NA 5FHBH 4AJWA 3FH8A 3HPLA 1J0IA 2OMZB 2NY6C 3EGDB 1QWNA 4ZZKA 2H8PA 3GHBH 2ZOLB 1MJUH 5FYLD 4YO0B 3TO2A 1E9OB 4A6YB 4DP7X 2GCYB 2AJVH 2QJDA 1KXHA 2LU3A 3H7BA 3VGGA 5I0VA 1QZ1A 4Y9EA 3MRDB 1P2CA 4U6VH 4P5MA 3TA3D 2VR4A 1X5JA 4MYWB 3W9EA 1R3HA 3WS3B 4B9YA 3E6HB 4JFDB 2NTFB 1A6PA 4HV8B 5FX3A 3NCYP 1YN6B 2CGZA 5FUOH 1QACA 3HLKA 3HRZC 4QPEA 4ZFOB 4FG6D 4WJ5B 5IEKB 2VIRA 3KPSA 1HC1A 5FYJE 5LBVA 3SIKA 5D5MA 1C5BH 4JKKA 4WNQB 3NIGF 1J8KA 5GRWA 5SWSA 1TSHA 4KTEL 1X6LA 4KV5E 4WFHE 3KWUA 3EGSB 3MRMA 3VXMB 2X28A 3KLSA 4D0CA 2X4RA 1SHMA 1MFCH 1MELA 5DR5H 3L9EA 1KZQA 1SZNA 2VUKA 2WQSA 3BVNA 4Y4HB 4Z7WB 4Y19D 1IE4A 4NQEE 4R2GC 4M6NH 3VXUB 4AIOA 1BEYH 2DQ6A 2VW7A 3GUFA 1SDYA 3BUTA 3MRKA 4XPAL 1A6UH 3QO0A 2Q86A 4XTRC 5F9DC 1OANA 2P4AB 4LKXA 4LLWB 3ZKXC 5DFWH 3AACA 3MCLH 3PL6D 3C5ZB 2ED7A 3LZNA 3RGBA 5EIIA 2X4UA 2IPTL 4OY9A 5EN2A 1QUNA 3BW9B 3V5DA 4ZQKA 1GTNA 5D7LE 3UBXB 2JK5A 5L2KE 2NYYC 4I18A 4K4KA 4G9DA 3QRFM 2GEEA 3QIUA 4CN4A 2EDKA 3BWZA 1A4JB 4ORGB 3FT0A 2GT9B 4B9GA 3QCTH 4HS6A 3OKKB 1UD2A 4GKZB 3SCMB 1S8DA 4WEEA 3VG9C 1FFOB 2GUOA 1PLAA 5T3XD 1R46A 3FOMB 3NJJA 2O6FA 2UZXA 2L8AA 4M03A 4DOHB 5K5YA 1JK8B 2WGXA 2ZF8A 1ADQL 3O9WA 4NO0B 1YG9A 3ES6B 4AEHL 2IPKB 2VMEA 5LVEA 1U8MB 1NCGA 1KLUB 3A21A 4XNMB 2D03L 4YK4C 2P7TA 3D08A 1DJIA 3FU6A 1XGQB 3V4VA 3MQIA 3MRBA 3WUWB 5A16A 4WY7H 3DHJA 4FP8H 5AB1A 3QEHB 4JO8A 2YPKB 3VWJB 1WE5A 4ZX6A 4HEPA 2DOCA 3QUYD 3ZKMD 5I5IA 4FP8L 3CE1A 1R9FA 3DMMB 2H1PH 4L3CA 4TVPL 1IC1A 1O5PA 3E80A 2ZUXA 4RMBA 1ZGLP 2QZ5A 1I7ZB 2UUDK 4HW6A 4MNQD 4P9HC 4E41B 5CD3B 2FSEA 5GGVH 3QDJD 4RX4A 4Y2OB 3A22A 3MLWL 4PW3A 3ZZQA 1SN0A 1A4CA 3O2DL 1EANA 2J2ZA 1LEGA 2V9UA 4OCWL 5GGVL 1ET8A 3T2NH 2GIXA 1AZUA 2PTTA 1QABA 1P69B 2Q6WB 4X9GA 3EJPA 5IQOA 1UGNA 1IUZA 4ZW8A 3T2NL 1DFXA 3QDGB 3SGEI 4MQ7A 5EOTB 2CM5A 2NT0A 5BRZB 2IGTA 3QEUB 5HHME 3A6CH 3MXWL 5DRXA 1H9VA 3TASA 3MYZA 1ZEAH 3BH9B 2X87A 1MCJA 1LE5A 4PY7A 4L4TD 1UH2A 4R8WL 3QEGL 2BZDA 2Z0BA 3MNDA 4QY8A 1ZEAL 1J0KA 3NEXA 3RKPA 5B8CC 1KB5L 4KJPC 5D70H 2YQBA 2VLJB 3FN3A 2NLJA 4PJAA 2XTLA 5HTSA 5AW2B 1E67A 4AVKA 4WI4A 1R47A 2ADIB 2XUWA 5DS8A 4WWPA 5D1ZA 2FL5A 4Y5XB 5TDNA 2IDUA 3KAAA 4AJVA 3H3BC 3QBTB 3VFSA 3PWLA 3GBML 1PFCA 2CKBL 4LLVB 2G5RA 4XGZA 1E3FA 1FFNB 2ZUYA 2COVD 4P46A 3DWTA 1DVXA 1FP5A 1OZTG 4KRPD 3LZOA 4LF3A 3V7AG 4JNXA 2E7DA 4CSSA 1G7JA 2BVPB 3QIBB 2VRQA 2MEJB 3CVCA 1CG9A 1I53A 4Q6IA 1GZQA 5ISZE 2Z3FA 2X9YA 4M62H 5ILTH 2ICWB 3KPRB 4I3RH 4LCYA 1C08A 4QT5B 4WWKA 2CLRB 4PYGA 3NN8B 4GKSB 2DQMA 3HRPA 4Z0XA 2C7FA 4M62L 5E95B 4WTZA 5EEWA 2EO9A 3HKFA 3HNTL 1ERNA 4UINH 1W72A 3UYPB 4WGWB 2XWEA 3H1ZA 1SHXA 3NQIA 4NDMB 1HCYA 1X6NA 2YD1A 1GHFL 1NMBH 4OZGA 2BVQA 2ZSVA 2CUIA 3B2VL 5CJQL 4UINL 5IBUG 4JG5A 5DK0A 5GPRA 1SF5A 2GW5A 2MH4A 4HCRH 2Z31C 1M7UA 2XN2A 4HJSA 1O7DE 1Q0EA 3VFPB 3U0WH 2XA8H 3RJDA 3M7FB 4YDVA 4X7DC 4FX5A 2JB6B 1KF9B 1X5AA 4J7RA 5CMAB 5JIMA 1Y6KR 1CC3A 2XXMB 3BWUF 3IPBA 4KQ4H 4RIRA 3VGFA 4A55A 2I60H 1CU4H 5TDOA 4CN1A 2DQTL 3LQMA 2WYIA 1BV8A 4JRXE 2I60L 1I1YB 2UXTA 4KWUA 5JMRA 3ECVA 4KMLB 1RHHA 4DCQB 3V9FA 1OPOA 1CMOA 1IAKA 3RL1B 3LDBC 1LO5A 5IB4B 1KGYE 4U7MA 1DJWA 3V0FA 2XY1A 1J9CT 2EE2A 1KCWA 3QI9A 1MWAL 2I24N 2YA2A 5ACLA 4JM2C 4I88A 3ECUA 2ZE0A 2FIRT 4G11A 3GM8A 5C0IB 4JFXA 3GSVA 4EUPB 1PQZA 2VDOH 2RALA 3C5JA 3U2SB 1GSMA 3D30A 2YBRB 4ZBJA 3UEQA 5AUMA 1N0LB 3E2HB 3FB6A 5CJ5A 5ESVB 1X5KA 3SDXE 3SGKA 3CXHJ 2C3VA 2H2PD 5CM1A 1RZGB 1UA7A 2E6JA 2NR6A 4CADA 2RQ8A 4ODVL 1AZBA 5K9KB 2M1KA 2UX7A 4F9PA 1O9VA 3VI3A 1WDAA 3B5HA 2YRBA 3GYRA 3QA3B 4HALA 3FQXB 2VISA 1IM3A 5F8RC 3NZHH 4PS7A 4B95C 2MWCA 1WICA 4NQSA 1A7OH 2WLKA 5D55A 4YSOA 1AXSA 2OMBA 2LGNA 4HHAB 4RRPG 2OQJA 1BXUA 4FJ6A 4F9LC 5EF3A 2VXUH 2HSIA 1A7OL 5ALCH 3RKDC 4LRNH 1AC6A 3BYYA 3PHOB 2YC1A 1IRAY 3FYIB 2FO1A 5E94A 5JOPD 1NLDL 5ALCL 3KYOB 1EO5A 1IGIL 1KTKE 4GRWE 1XSOA 4HLZG 1EO7A 1P5VA 1G7IA 1SYSA 4P4KD 2G2NA 1PG7W 4K55A 2OSLB 1TTFA 1OP4A 4YHMH 1NPUA 2A1WL 1LJMA 1CT8A 2CJUH 2APVA 3MA7A 4MAYB 5EO0A 3VNZA 1NUFA 1YPZF 3HR6A 2EYTA 1HWGB 2ADFH 3GXDA 2ZSWB 3TLRA 1BMZA 3L2NA 1I31A 1NC4A 3T6QC 1QBLH 1OAUH 3NFSH 2LHAA 2D0GA 5HDQH 5E9DD 3VD1A 5D7LA 4ELMF 1I9RH 4POZC 3UO8B 1NC2D 1LEIA 5L2KA 2PP7A 3B56A 3MTRA 5KSAC 3Q1SL 4LNVA 1ZHLB 2EABA 5CSGA 3WIHL 4IBUA 1S7XB 4GRLD 2LVCA 4H0LC 4NQDA 2HT3C 5ICZB 5IW6B 1I9RL 2ADJB 2VMDA 1YJDC 4TRPL 1OAJA 4OLEA 4HVBA 4LLYA 1JJUA 2NY0D 5ADOL 4YFLF 1F41A 3DGCR 4M3JA 2NNAA 3OLDA 4V1DB 2F54E 4NUPA 1PYWA 2IH1A 4XN1A 4ZO6A 4P2OB 4DN4H 4QOKD 3G6AA 4XN5A 3BP4A 2GYSA 4ODWB 1OM3H 2YUXA 4TSBH 3VDAA 1EEZB 1XZ0B 2Y69B 2W9LA 1CGWA 3LS4L 2XQYK 1BD2D 2LU7A 3BSZA 5TE4H 3SB3A 5FA4A 3BP6B 1UACL 5GRUH 2VDLH 5IG7A 3DSFL 4KH9A 4NRZA 4QKTA 2AANA 4RWYH 2AQTA 3QG6A 2Y7QB 5CXPA 5E6IB 3DXAB 3IDIA 4Q89A 3AQDA 1W91A 1J48A 3NSJA 5GRUL 4ZMPA 1QOKA 3A0OA 3ZY7A 3SY0B 1YAZA 1RURH 4N5EC 3ZZ1A 2OCJA 2IGFH 4YHOL 2DY2A 3PAUA 3WUZA 4DGUA 4PWJA 4OM0H 2VRAA 2QQNL 4XC1H 1UB6B 1GC1L 1Q9OA 3LEVL 4EDXB 1T7VA 4P3DB 2O30A 4M8QA 3CFEA 5CIPA 1UATA 2X2HA 3S88H 2WBWB 3LHPL 3DVFA 2OR8A 4A2LA 3OLGA 4KRNA 4MSWA 5IQ9A 4XCYA 3S88L 2H26A 3KPQB 1KZYA 3ZXAC 4UV4H 2BIPA 4OD3H 1NFAA 3KBPA 4R0LA 5I0YA 4U1KA 3MYJB 1X7QA 3CHXA 3BKYH 3BAWA 4P5TA 1WWCA 5D1XD 4HXAH 5KOMC 1URIA 2VH5H 2AHIA 1FNEA 2YQGA 3VXTB 3QJXA 2NSQA 3FTVA 2QGEA 3OMAB 5EZIL 3WDIA 4ABQA 3V4PH 3MNVB 1OM9A 1M05A 1SM3L 1KGWA 1U2HA 4S1DC 2ICEA 2WNXA 2D7PA 2Q3AA 5BZWB 3VB9A 3QCVH 2UXVA 4IHBA 1ACCA 3PGFH 1JI1A 1RUAH 2AQSA 4PJEB 5INCB 2FR4A 1DUZA 3L7EB 4EVNA 3GSOB 5HGAB 3O8XA 3EG9B 4I9WE 4E9LA 1RUAL 4IK7A 2NY2C 3KPPA 2HFFA 4L1DA 3UC0L 1VACA 3QIUC 3TJEH 1PY0A 3L3KA 3PP3H 3PDOA 1CGXA 3MX0A 3OXSA 3C6LD 2IFFL 1RZPA 1IGTA 2EDYA 3NT0A 3TCLB 4HXBH 2TRYA 1BZ9B 4E42B 3L5JA 1L9NA 2KZKA 3IFNH 4HP5A 4A66A 4CW1B 2B1AH 1JHKL 2X4QA 1XCWA 3WJJC 3FN9A 5GHWH 5LWYL 3C9NB 4IEFB 4HJUA 3TURA 4J3BA 3CFIC 2IG2H 2J4WH 4P5RA 4M48H 2VXTH 3MRCA 4UYPA 1DBAL 4KDTC 5GHWL 5I30H 4DGVL 3X11A 3VUAA 1XCQA 3S2AA 5L0QC 2BSDA 3U4EB 2IG2L 4DKTA 3IRPX 4LPUA 2Z92B 4FRWA 1T03L 2D0FA 5SX5H 4Z3EA 4Z5RB 2GABA 1U95B 3V10A 4RQQB 4M4PA 4I2XB 4YDJA 4OW6A 3VX1A 2PO6D 4P2CG 4PP2A 3MV7D 3U6RB 2DRUA 2E56A 4D0DB 5EBLB 5BMFH 2Y5TA 3K6OA 4LVOC 4L8DB 5FO8A 2YA1A 2DLGA 4IDJL 3MCKB 1K2DB 2OCCB 4U05A 1GYWA 2Y6SD 2EVJA 3MRIB 3SDDA 3FT3A 2DQFB 6FABH 4PP1C 1KLGB 2PYFB 2E7BA 4KKPA 2ZCZA 4JRXA 2QSQA 4L3ED 1C5DA 5DRZB 1LD9A 2F5BL 4JFDE 4UM9B 3WGUB 4RSYA 1PIFA 3W57A 1JGDA 5LJYH 4Y89A 1W0VA 2JF1A 2WB7A 3QNFA 5GGUB 2WVVB 1ANUA 3DECA 3VFOA 1EEYB 2FK9A 3F12B 3NZ8B 3AREA 2X4TA 5A2JH 3MLPA 3DLQR 3LRHA 4MD5A 2NQ3A 3VXME 3AAZA 4G6FD 3NIFF 3O0LA 4LLDA 4Z7WE 1MJJB 3F85A 3SOBH 4AGPA 1QHPA 5FM4A 3D09A 4PJ8D 1R5VB 2CBTA 1ES0B 1RXLA 1KNOB 3WTXA 3QARA 5BVPH 1GYVA 2R2HA 3SDXA 2DMKA 2GITA 4IBSA 1NCWL 5D1ZC 5I6XC 3HR5A 2EEXA 1EAPB 3P4OB 3A6BH 4KXCA 4AYFB 1FZOA 3UACA 2VJXA 3PG2A 1TZIB 2A7BA 5DJ6B 1JERA 5ITBL 1BJ1H 2WW8A 4UIMA 1BQSA 3KR3H 3S3PA 3QRGL 1MPAH 1VHPA 1YUHA 2Q1EA 2VDKH 4NHUA 4P46C 2X4NA 5I6KA 1ZVSA 3ARFB 5TQ2H 4EOWL 3M46A 5I1DA 3BP7B 2XFGB 3EW3B 4FGMA 2X70B 1MI5A 3KR3L 4HMCA 3DDGA 4TL4A 3RFZB 1A1OB 3GBEA 4TSAH 1XX9C 4K7PY 4UQCA 1XGUB 1TSRA 3QC6X 3H4HA 1HNYA 4R97C 4Q6IC 2XX1A 2IAMA 5FFOA 2J1YA 2XJKA 2MHAA 4TSAL 1T0NB 2JKNA 4HK3J 4M5SA 4YVNA 5JIKA 4L8SB 4KQ3H 5D93B 4M43L 5EUOB 5CZXC 4R4ND 4Z95H 1ZSHA 3UTSD 4DOHE 1OAXH 2ZCHH 1H3UA 1XGRA 4L3AA 4N2MA 3GSUA 2C9RA 2DIJA 5E9NA 4G9FB 1JIBA 1SXCA 4YBQC 4ZFQA 3K72A 4Z95L 1KACB 3I6KA 2HMIC 3NJFA 2ZCHL 4LRIA 3U30C 1PEWA 2XHNA 3EDKA 3WEBA 1AGBB 2CPUA 3E3QC 3MO1A 3MRQB 4XVUC 2HVJB 2K4WA 1D7FA 3JWNE 5T5FL 4MXWL 1A3LH 3NZUA 4TNWK 1TZHA 4YNYA 4L1BA 2J3SA 1EV2E 5IWLA 4I85A 4QJ4B 2EH7L 4E41E 3V8OA 4LIQE 1XR8A 4FQJL 3DI2B 2M26A 4ZMXA 1P1VA 1NCTA 1F90H 2NNCA 4E9XA 2HUHA 2DM2A 2P42B 3GRBA 1L0PA 2NUTB 1NLBH 4HCRA 4UIKL 4QRPD 3UGUA 1YMMD 1R34A 1REIA 5KYUB 4OZFB 4ZW5A 5J06A 4FEIA 1F90L 3INOA 5D96C 2F54A 3RY5A 4M61A 1JGIA 2XNAA 4FQCH 3QDGE 3QI9C 1RZIA 4PJ9D 4WUKL 4NI6A 1C5CH 3DBXA 5L2JB 1VDGA 2GVYA 3HVNA 5BRZE 1CFBA 3WTWA 1DP0A 1OD9A 2F8IA 3BQUA 3NEEA 4NYLA 3SDCA 4PREA 1BMGA 1YN7B 3FUFA 3IVKB 4X9IA 3BZFA 3BJ91 5KSBB 1KBWA 4JFQA 2Y1AA 1U8LA 2FJGB 4ONFH 4DO6A 2AV1B 1C7SA 3DO3A 2ZT9C 4ONHA 2YAEA 2ZKWA 3V79C 3V6OA 3VU1A 2VLJE 4OJAA 3NACH 4PW9A 4ONFL 3VDCA 2IEPA 3P1VA 2BINA 2EXWC 2NR6C 1ZGLM 3NCEB 1ORQA 4NQUA 3CLWA 4WWNA 3L3HB 1I1RA 4F9PC 2BCKA 1JMZA 5KVFH 3LZRA 12E8L 3O6FD 2X6AA 1CTNA 4HUWA 2YGVA 2GJ6A 3VRLF 3I9IA 2KERA 1N6UA 3UMTA 4G80A 4PJ5B 4K71B 3IF1B 1T04B 3TEUA 1CE6B 1ED3B 1IJNA 3JTTA 4QEGA 3K71B 2WN2A 3S3SA 4PV9A 3KLDA 4N1CA 4FJZA 1S9WB 3WFEH 1ZS2A 3BAXA 2HKFL 4EI5B 5BO1H 2CSPA 4U6XA 1LQBC 5TD4A 3KPRE 3B1TA 1SUJA 1DL7H 4AZUA 4DT2A 2WSPA 4G8FA 1F02I 3GQFA 2WLIA 5FIEA 4XP6H 5CEZE 4PJHB 3JV5A 2XPZA 3FHEA 3VWKD 4WUUD 4FFYH 3U1SL 2XLLA 1MQKH 1HWWA 3MJ9H 2NT1A 4LOVA 2G0KA 2J6EH 4WSKA 3A3YB 3TBTB 4FFYL 2I9LB 4JRYB 5DRWA 1XF2A 3MJ9L 4RZCA 5ALBH 1DQQB 3OKOA 2E3VA 4NZUL 1DDHB 4AUUA 3F01A 3MSPA 1EVUA 1YEJH 3DPBB 4APXA 4GG6A 1RU9L 1SEBA 1A6ZA 5AVTB 3QULA 3RQ3A 1UWEH 5EUKA 2XVLA 2J43A 1FNGB 1XGYL 2QT6A 4FTVA 5HSFA 4KZ0A 1UWEL 5PAZA 3TA3B 4YN3A 1OTSD 5B4MC 3UZQB 4RMVA 3Q2NA 3D33A 1ZDQA 2FYVA 5K59E 2H4EA 4YLBA 1YEEH 1XO8A 2HT4D 3BVDB 4HKJB 1I3UA 1E4KA 3QZOA 3G6DH 3W2DL 3P3YA 2DMHA 3A67L 1WA0X 2ZPKL 1YEEL 1FC1A 4UBDC 4YDLB 1GS7A 3LQAH 5CJBA 5BVJB 2DJMA 1WBZB 2BIQA 3G6DL 3GSRA 4L4VA 3K91A 1LWJA 5JORA 3LIZL 1X9UA 4H8WL 5F8QC 5GGSY 5JO5B 4IOSD 1HIMH 3B2DC 2Y4SA 3EHBD 3SKNA 1DLFL 4Y19B 4N87A 4F8OA 2X6CA 5J1SC 3FUIA 1OGSA 1MHEB 4DKEH 2OXGB 1MJ7H 1HIML 2F08A 4ZS7H 1HQRB 4K5PA 4JCWA 2OI9C 2UVEA 5EDXA 4XC3H 4IIQA 4XZUA 4DKEL 2P44B 3PL6B 1AD9B 4K8RH 2GBVA 2FBJL 3EYUH 3VMNA 4MB1A 4KK8D 4KKRA 4XC3L 2X12A 2M8XA 3L5XL 4K73A 1XSKA 3FFCD 4L5FE 4Q8BA 1TVDA 5IZ7A 1WAAF 2AEQL 5AWNH 5IFJB 3CDCA 3L9YA 1E9OA 4YO0A 4A6YA 1H6EA 1Z7JA 5IVXB 1CDIA 4Q4EA 5KBLA 3MRDA 4R7XA 4DPBX 3G5VA 1HXKA 5AWNL 3ARSA 4L9LA 3M1OA 9PCYA 3NA9H 1IM9A 1KYAA 2GHZA 5FECB 2X3BA 2FNWA 4JHAL 5IVOA 2ODIA 1TVHB 4ABUA 4LL4A 3VE0B 4WLCA 3RVUC 2HN7A 4GFTB 3HS0B 3RIFF 3KCPB 2J12B 4WJ5A 1E42A 2BVOA 3D51A 3ORJA 4GI8A 3ZTEA 3ZR6A 4BQBA 4FFWD 4NJ9H 4X8JA 3HNSH 1HZKA 4AWJC 4WNQA 4P5TC 3KZ8A 1IAOB 2GTQA 5F1IB 3NVQA 1NEPA 1SJMA 3K6IA 3VXMA 3NJKA 4Z7VF 1QTYT 3D18B 3HNSL 4LHJB 2BHZA 2RJMA 4JFOB 4Y4HA 3QUZD 1G9MH 5ADPL 2A9NL 1LK3H 3UO1H 2ICEC 1PZ5B 3QUYB 4LEEA 3GSWB 1OE2A 2FNBA 3K0YA 1U33A 1LK3L 5DS2A 3MJGX 5DQDL 1CIUA 3Q2VA 4N8PA 5D72L 3ZTNL 1TVBB 3P4NB 1A4BA 2WO4A 2ZYRA 3QDJB 5FAAA 5E0FA 1NGPH 4PI0A 1QP1A 3UBXA 1JF6A 1P5UB 3VSQA 3V4PA 3ULUE 3ZTJH 1QO3B 1FYHB 2VXVH 3C8KA 5CLZA 3VXPA 1NGPL 4LQFH 2UY6B 1KDIA 2VQ1B 5DYOB 2VXVL 2YXFA 2FQDA 3OKKA 3UCQA 4GKZA 2YJQA 4GW5B 1A7QL 4F1SA 1B9ZA 4V1DE 3QUML 3G04B 3T1FB 4YHYB 1MUJA 1KN4L 2JJTC 3IYLW 3WIFB 4FYRA 3QZBA 5C09D 3WTVA 1RH8A 4M93C 2QEJA 1DLHA 4M7LH 1JK8A 4N2AA 4NO0A 5I0WA 2DS4A 4XOCA 5DC9B 3U4BL 4HPYL 3BT2L 2IMNA 2D8KA 2I07B 2Z7UA 4MRCA 2Y5EA 5IQMA 5LB1A 3QQ3A 3REVB 1PTZA 2O5ZH 1N19A 1IT9H 4HKXB 3DXAE 3R4DA 2UWEF 3LV3A 3NOIA 4JLRA 3KPNB 1AY1L 3APMA 1KTDB 3U7AA 3VWJA 1FZJB 3LY6A 2M2DA 2C1PA 3CN3A 3NUKA 4JY4A 3TV3L 1TQCC 2E9IA 3QFGA 3SKOA 3VMOA 1O0VA 3ZE1B 4OZIF 4KRPB 4E41A 1I7ZA 4U3HA 3DTXB 2CDGB 4J2XA 1QYGH 4YWGL 4XNYH 3SDDC 4BFFA 2HFGH 2CO3A 3SGDI 4GQQA 3TZVA 1FC2D 4JKPH 1SQ2N 1PZAA 4BD4A 4OTXL 4KTYA 3EADA 4XNYL 2XX0A 3S9DB 1U8JB 4FQXB 4H1LG 2C4FT 3BFWA 3KDPB 1I1AA 3H56A 5FEBA 3ETTA 4LESA 5CN2A 1NFKA 5EU6A 2EADA 1KT2A 1YAIA 4JO1L 3QNYB 3BEVA 4RBPK 2P5EA 1U8KA 3E8UL 3CMGA 4P57B 3S4SG 5IEKA 3GF8A 4JPVH 1I75A 4LOUD 4Y5VA 3BH9A 3OMZA 2OZ4H 1J1PL 4FFZH 5LN4A 1ZE3H 1JDDA 1N5AA 4G71B 1GPOH 4H20L 4JPVL 2YHGA 1BZ7B 2OZ4L 2GFBB 3UTZB 2XG5B 5I26A 2VLJA 4XB3A 4NQTA 4D9QD 3CVHL 1OXYA 4Y1TA 3SHSA 4PRIB 4DQOH 5HI5D 4PRPD 4PJEE 3GSNL 3RHWK 1E0OB 4NZTL 3UXFA 3ABMB 2YK1H 5IR1A 3ULVL 1RUPH 3RFRA 4GQ9H 3MRHB 1FFNA 1Y7VA 4UU9B 5CKGA 3HZ3A 1H5BB 4CVZB 1FNSH 1R1CA 3AS1A 1UJTA 4DAGL 1WLHA 4KO5A 5TFSH 3ZL4H 1NGQH 3QFJD 4QR7A 4XRCB 3UJJL 4UMSA 3QIBA 4LBAA 3ZX1A 3BOVA 5K9JL 5KJ4A 5ENWB 5E23A 4MJ4A 1OQOA 4L1LA 5B1KA 3E1ZA 1MFNA 1X9LA 1E8YA 3PXLA 2OYKA 3S98A 2LVEA 4U1GC 3FH7A 5DSCB 4X2UA 5EBWB 2BSTA 4GY4A 1G7MB 5DZJA 1H0DB 3NN8A 5DJAA 3D87B 4GKSA 1A8ZA 1S7TB 1GAFL 4XHQA 5F70A 3SOTA 2BOLA 4TXVB 5EWIH 5JIDA 1MCOL 5C0BD 2X1OA 2YZ8A 4LRIC 3UYPA 4OFYD 2PMZA 35C8L 2R9HC 3RNKA 1DANU 4QNPF 3ZSTA 1DQML 3GMLB 2XIDA 5E4AA 1JTOA 1QSZA 4LEXL 2RCSH 3QZWG 1QW9A 1U93B 1ASPA 1XIWC 1N12A 3UFIA 4I2XE 4URKA 2YUVA 2PPCA 3VA2C 2DKSA 3ZDZB 2QBWA 3F7YB 5IHBA 5BS0D 4LHUB 4CDHA 5DJCB 5F6IC 1GGBH 2PNDA 2B2XH 4LT7A 5IWLC 1N59B 3U1QA 1AO7A 1NCJA 5CMAA 5CCHE 4UQDA 1GGBL 3L3GB 2AAAA 1DVZA 5EO1A 1ZLEA 5EZJA 5T3ZE 4KKNA 3L6FA 3TBWB 2A6JA 3NABL 2HG5A 3ZK0A 1J0ZA 4YE0A 1SN2A 15C8L 5DD1H 5E5RB 4G70B 4DFIA 1JZ5A 5DJYB 1FAIH 1QKZL 1WFJA 4DCQA 4PJBF 1PKOA 2J44A 3H3PL 1S5HA 3FCGA 4MHHI 3VQ1C 2N0MA 3SDCC 1TEFA 2HJLA 5EO9A 3SE8L 1ECZA 4L8BB 1BPLB 4DP4X 4P4KB 5D8JH 3NPSC 3WTYA 4PCKA 4E5XG 5TGBB 3OKNB 5C0IA 1U42A 1U8IB 2FWOA 4NBZB 3IFLH 4KMTL 3LKPB 1FVEA 2ZWLT 1RK7A 2YBRA 5D8JL 1M1SA 4IRJD 3V6OC 1N0LA 1TXKA 3ZKQD 2WPGA 5ESVA 4K3EL 3RDJA 1KB9J 1S7QB 2DQHL 2CIKB 3Q9QA 4NO3B 2ZIDA 3CCHA 3P11H 2IBBA 1D5XA 1RZGA 1YPZB 2VLRA 3QQ4B 5F7DB 1UCBL 1LO4H 2H0EA 1NC2B 2ZCLL 1KFAH 4FFVC 4MNGB 4GRLB 4H88H 3PQYB 2IWKA 4ELMB 1UM6L 1YMHB 1YEHL 2Z65C 3QA3A 2WZ5A 3FQXA 3OKYA 3WN6A 3BDBA 3OB0H 4YR6B 2NY0B 1Z9SB 2AJYH 2W59A 2Q2LA 1T0MB 2ZOTA 3EBHA 4R90H 5AW9B 4ADIA 3TEZA 1RMFL 3DPDA 3DARA 4X9YA 1S2EA 3A4DA 3DTDA 4QOKB 2WXHA 4HHAA 5IMOA 4JZNB 2AJYL 1GSKA 3M17B 3KW8A 1IEHA 3ZE2B 1A2YA 4MAZA 1JWSB 5IF0B 3NRFA 5FYJH 1BD2B 5EUOE 3BPLC 3HB3D 5TQ0L 2EIEA 5DF0A 1XQ4A 1JZ6A 3CDFA 1OT1A 1WTLA 4XPFL 1WAEA 5FYJL 3ZRCC 4F80A 4G9FE 5HVHC 1OEZW 2K70A 3AXHA 4HJ0C 1U3NA 2WQ8A 2DYSB 4EZKA 5LG1A 3KL5A 1I8KB 5IB1A 4EXKA 4EQ2A 4ZX4A 2ZCKH 4MAYA 3OKDA 1G0XA 1U8OA 3VXOA 2ZSWA 3A4EA 4I89A 4KAQH 1BF2A 4NXKA 2Q9OA 3PNWB 4HZLB 3ZO0A 3NDZE 5I76A 1XMWA 1HEZB 2NDFA 1FO0L 2GJZB 4TPRH 5T1MB 1KEML 4LP4A 1ZHLA 2BS9A 2IO5A 3DJZA 1S7XA 1T2XA 4BSJA 1NWPA 4UDTA 1ZSDA 2ZQKA 5ICZA 5IW6A 1JWUA 4JFTA 1E4KC 3AROA 3QXTA 2OR9H 2ZX7A 2CD0A 3BC9A 3QNXB 4MHHG 4WI3A 4RWHA 1DCLA 1FA4A 1NL0L 4V1DA 5JZ7C 2OR9L 2O4EA 1EZVX 5I71B 1N5YH 1QLFA 3AY4A 3BHBB 3OR6B 5HYSG 3K8MA 3D9AH 5MHSD 5D1XB 3L7FA 1UB5B 1WJ3A 3Q8EA 1MCNA 3BO8A 1JZ2A 3VD7A 4JN1H 1TQBB 4PGDB 4OBSA 5KSBE 1IQWH 3F8UB 4LCCA 3MFGB 3QGVA 5JA9A 4GSXA 1V3KA 1JF1B 4G8IB 5E6IA 4JFEA 2ZKHH 4IIQC 4JFFD 4JPIA 4TTDC 2NY6D 3T6ZA 1IQWL 4G43B 2ZOKB 4RGNC 2L7QA 3BPOC 2WXJA 5D7SH 1CDCA 1MRCL 1Q0YL 5L9DL 2IDQA 2OW7A 3PUCA 5MEPB 1CLZL 1JZFA 3L3DB 1D6VL 1CDGA 1GY2A 2QQQA 1J88A 5J1AB 3L4VA 3UMNA 4KNTA 2RR3A 4MD0B 5F9WC 4EIBA 3BRGC 1E30A 4LLAA 3EJJX 3U0PB 2VL5A 1CL7L 3C6LB 4L9LC 3WY4A 4RFNC 2VQUA 4WHCA 4WI9A 4PJ5E 4YMPA 1WIPA 4EF3A 4I0CC 4JM0A 3V4UL 4GJTB 3VXNA 3STBA 3K2MC 1AZRA 3DTUB 1MLCA 3KPQA 5FK9B 3I9GL 1J0YA 1KENH 2N01B 1DE4A 4OSUH 4FLOA 2EJ1A 3EO1A 1JFHA 2A5UA 3K4DA 5FHAL 3S5LA 5FF6A 4JGUA 4KJWC 2YJLA 5KTEH 2DKMA 2ADYA 2O1AA 4Q56A 4Y5YA 3IJ7A 1MCEA 4ZAKA 3FO1B 2ID5A 1GRWA 1YEGH 4KY1H 1I7UB 4PJHE 4XTRD 3VXTA 1NOFA 3CX5K 2W80C 3SYPA 5IFHH 4YQXH 1RIHH 2XY2A 1XXFC 3QWQB 3MNVA 4U1LB 1ADWA 1YEGL 3GSXB 4K3JH 3B2PA 5JIPA 1UWYA 2YAPA 4JRYE 3GTTA 4HHWA 3SE9H 4ERSL 2PO6B 4K3DH 1RIHL 3MR9A 1K8IA 1A66A 3MV7B 4K3JL 1Q8MA 2FAUA 2P80D 2NYYD 2IALB 4JDTL 5E2JA 1XGTB 4BQ8A 5FYLE 2BWQA 3L7EA 7CGTA 2N3JA 2DI7A 4UT9H 3QDMB 1AQDA 5HGAA 1ZMYA 5GZNA 2R4RH 3T0VA 3PWJA 3S0PA 1HXMA 2D31B 2QV4A 4KJYA 1QLRA 1KGUA 5FFGA 5CBEB 1PEZA 4L3EB 1ZT4A 2YBGA 4J8RB 1LXMA 3QJOA 5IMLB 1HHHA 1SLUA 3ARGD 3DYMA 4P5KA 1KPVB 4U6HA 3RVWD 4FDWA 2AXGB 2V0AA 5MENA 5KZCD 4MMXA 5HHPB 4E42A 1DSFL 1KTRL 1CD9B 5DZVA 4CW1A 2QV2A 3H53A 4W9CC 5BUPA 3GHEH 3GB7A 4KRMB 1NBQA 4Y4FA 3T8VA 2B14A 4G6FB 4MA8H 4D8OA 5ABZA 3EYQC 4HUCA 1D3CA 3FRUB 4HJTA 3GMPB 4Y19E 3SZKC 3L2LA 2YD2A 3STZA 5IGXL 4QGTA 3T2OA 1URZA 3L16A 1U8PB 4L37A 1K3ZA 3NJHA 8PAZA 2SODB 4X98B 3CAFA 4KK6C 3JTBA 4LHQB 4Z5RA 3AU1A 3IU3A 1U95A 3FUKA 1KEGL 3Q6FB 1U0QA 1MAKA 2DTSA 4CRPA 2VO5A 3CH1A 1M42A 2K1MA 3U6RA 1F4WL 1L9SA 1SOSA 5EEUA 1INQB 2ALAA 4IKNA 4D0DA 2AEPH 5EBLA 4Q2ZB 4YXLH 3CVBA 3H42H 5IVXE 3TBBA 1K2DA 4LL9A 2DPKA 1TYJA 3TZVC 3FTGA 1E8WA 3T6WA 2A77H 4FQIH 1SBSH 2EH8H 3VX0A 2PYFA 3H42L 3ENEA 1BZOA 2EDQA 1GMIA 1I1AC 2L7EA 3BKML 2A77L 4FQIL 1IEBB 1JNHA 3DHPA 1YYLH 1BFVH 1FJ1B 5FM5O 1G6RB 1DDTA 4LSPH 2WZ6A 4LEOB 4PQXA 5GGUA 1OLLA 3UTSB 2BIMA 3APFA 1HOCB 2YRLA 4GXVL 3NZ8A 5L4IA 3BPNB 4XB8A 3JUYA 4Y5VC 4BE6A 4KJPD 1K5WA 4CMMA 4EZMA 3EYVB 2I7OA 3BN9C 1XBDA 1B9KA 3ETSA 1M9SA 1PSKL 1MCIA 3KEDA 1WISA 3BESR 43CAB 4DGIL 1AMXA 5FB8B 3VFTA 4JN2B 3X12B 1KNOA 4N0YL 2VXSH 4J5VA 2QDVA 4RISH 4JZOB 5DLLA 3BGFB 2Y9RT 4ZTPL 3RJQB 4FHJA 1I8MB 1EAPA 1SMAA 4RAUA 4PJ7B 2IQ9H 5MEQB 5DJ6A 3QDJE 4A39A 1L7TL 1IGJB 4LCIH 4PH8A 4OGAC 4UILH 3IGLA 4HQQL 5GGSB 1MRDH 3BP7A 3FB8A 3BIKA 3FF7A 3MLVH 3MV11 3QIBC 1A1OA 1YMMB 5MP6L 2YD3A 3KXFA 1JHLL 3NFPA 1X5MA 4LCWA 1FFPB 1BG9A 5BOZG 4PJ9B 1JZ4A 5JW3H 4JKLA 3HVDA 4PJIE 2WNGA 3A23A 3UBGA 2DD8H 4Q9QH 1KIRB 3VW3L 2HRHA 3K4ZA 2WD0A 1BQ5A 1IC0A 1YEFH 4D9LH 2WKOF 2FJFA 3O3BB 4GRMB 2DD8L 2NY3C 1RVFH 3PIQA 5GRJH 4G9FA 2Z31D 3GBLA 3EOYG 1YEFL 3NSYA 1AE6H 3OWRA 1AGBA 3IMVA 3OR7A 1UGKA 5GRJL 3PJSB 4F15C 1BZ8A 2XQBH 3UCRA 2HVJA 2KZWA 3UGEA 1FZKB 5LAPA 5F7YC 1FYTA 3KYKL 1WVZA 3S35X 2B9BA 1NCHA 2XQBL 2Y2YA 4XMKH 4XPBL 3O6FB 1JG9A 4UQ2A 1D5MA 3ZE1E 5DUPL 3MRGA 5D2LB 3GJFH 4ZMQA 1CFSA 4LMQI 4OAWA 3H9SD 4G1MA 5CU5A 4JM2F 2JKRM 4Z3GA 3ARUA 1OK0A 4HS8H 3P54A 3RYMA 5DMJB 1AGEB 2OTPA 5BZDA 2NUTA 2G2RB 4QKXB 1OAKL 4NRYB 5IJCC 4JM2D 4RRPM 1MG2C 1HE8A 1RUKH 2C3XA 4UTBH 2YEZA 2PR9A 3HCVB 2QHRH 2A9CA 2FX9H 2YXVA 3VWKB 4WUUB 4MS6A 1G84A 2EDBA 4Z23A 4V2CB 4G5AA 2C34A 3VFMB 4CSPA 1E4XH 2WINB 5CBAB 3WNIA 5C6PB 3OHXB 3RX5A 4U7KA 2AV1A 4WI8A 3VFNA 3I3BA 2EIBA 2VXQH 5D9SA 1XZWA 4FADA 4IBTA 2YLKA 5LGHH 3FQRB 2R0WL 3HFML 3VU2A 2PCYA 3CBRA 1G9EA 4PRIE 4TNGA 1OAYH 5LGHL 4YGVB 4YHPB 4Z77B 2D3NA 1OGAD 4TF4A 5AZEL 3AQZA 4NQCA 4UDUB 4X6CB 1OAYL 1DBMH 5IB3B 4G6JH 1UFGA 2CCLA 4QRRD 1XH3B 3GJEB 2EEBA 4O02B 5DJ2B 1KWGA 1GR7A 1NQBA 3BAJA 3IF1A 3RKDD 4TQEH 1T04A 1B0RA 4XI5C 4G6JL 4JO4H 4UOZA 3ASNB 3TO4D 3EKCA 5F71A 1R3JB 4XWOC 4S11A 1WH0A 3N55A 2OX5B 1JOIA 2QHLA 5K1VA 3AY2A 5CP3H 4MJIA 2AQ3A 4XBEL 3D39D 4IKKA 2BOBB 4NKDB 5LGJB 4N2IA 5HHNB 3II1A 2ZP9A 1GZPA 3ARDA 4JANA 4JZJA 2GB2A 2B59B 4Y2LA 2WIMA 5F1SA 4NERA 4PJHA 3MLSH 2G75A 4DNLA 3IMSA 2AF2A 2H3NB 5GS1B 1IIKA 4U1IB 4KPHH 3F7RA 1JRHL 4X6BB 4UT6H 1TLMA 2IC2A 3MLSL 5F6HI 5JIQA 4OLVH 3TBTA 2J20A 3P3RA 2EACA 3CLEH 2H5UA 4MAYC 1DQQA 1MCDA 5CJ8A 1BYNA 1KYFA 5D7IF 4M5ZH 2P8LB 4JS7A 4K9EH 4POZD 4UT6L 3FFCB 1R5WB 3HMXH 4MASA 5KSAD 3ZO9A 3S8GB 1UUSA 3BUPA 2P9RA 4OLVL 3AJ7A 3ZDZE 1QX1A 3L2MA 4M5ZL 3HAEG 4K9EL 1LE9A 5KUKA 1BQUA 3HMXL 4MA7H 6TAAA 1Q90A 2IDSA 4UCFA 3VCLB 4K5LA 4B0MM 3VFUA 4YAQB 4DWHA 1D5IH 3W5MA 3DVIA 3UZQA 4DVRH 3EYOA 4NUJA 4XCEA 3OHMB 4MA7L 1RZ8B 3EAKA 3OD3A 4N1EA 4R7NB 2EC9T 3S35H 3IGFA 4WEMB 4XPHL 1U3HA 4HKJA 4I0PB 1HHJB 1VJSA 4U0QB 4J1UA 3AY4C 3CSFA 1Q1JH 5JHLA 3GUTB 3EO9L 1WQVT 1WBZA 1BYOA 5DJDA 2L4OA 3GD1C 1G9NL 5JOPE 3L4WA 4FI8A 5JO5A 4Z7AA 3QUZB 5DMGC 2FB4H 2GSGA 2N56A 3MDJA 4LCCC 4OJEH 4ILDA 3WYRA 4JRWA 1MHEA 2K9FB 3HNVH 2OXGA 3C87A 4N5ED 5CGTA 1HQRA 1KIPA 5FC9A 4CNIB 3LPFA 1WZLA 3LQAC 3MN8A 4JBSA 5LBSA 3NSXA 2B08A 4JM4L 5BXFA 5C9KA 1AD9A 1CXLA 1FSKB 1N0XH 5AYQA 3TEXA 1HCZA 1AGDB 3OXRB 5KSUB 4H1LB 4K23H 2A9MH 5DLML 1CUOA 1IL1B 1YPZE 4FG0A 4BQ9A 2FVNA 4W81A 4W1TA 4C8XA 3CSTA 1JPGB 2HWZH 1ASOA 4M02A 4MNGE 5IVXA 2W92A 3PQYE 3V95A 5DJ0B 3KJ4C 4XMPL 5I23A 3KPSD 3S4SB 1E28B 4ELME 1HNFA 1WYJA 1V3LA 3O6KL 4K8RC 1HCVA 4W6WB 5CSZA 4A6YL 5BV7B 5SWSD 5IOKA 3KLQA 4RGMB 1TVHA 3IJHA 4WWOA 3ILPB 1GOFA 4M7KH 4N8CL 3HS0A 4NCC2 4WDIB 5FGSA 5IROA 5C09B 4QOKE 4LO9A 1RJZB 3FT4B 4TYUA 5DUJA 4AUJA 4Q6YA 3IEAA 5B7MA 3ZE2E 4Y5YC 3GM0A 4D3CH 1BD2E 3CZJA 4AYEC 3MREA 2WMPA 3R0NA 4ZAKC 2GI0A 2Y24A 4ODTL 4YOKA 4ZFOL 4S1DD 1GGUA 3D18A 3RDTC 5DK2A 3PV6A 4OLXL 1FVDA 4JFOA 4TVUA 1UOWA 5LHDA 4BK4A 2PW2A 1K4CB 5CP7B 2AC0A 5MERB 2VUYA 4JPWH 4Z7QF 2O5YH 4ZPTA 1NAKL 2EAEA 3IKCA 4HIJB 4WGKA 3NSDA 2NY2D 2UWEB 4UWQB 1CI3M 1RPKA 3RWEA 5J89A 3QIUD 4GI9A 3C8HA 4I5BA 1KC5H 4OGYH 2KQNA 3SKUD 3LQZA 2EO7A 2VC2B 4J6RH 3TGXA 3CHPA 2JNZA 4YSTA 4OGYL 4OZIB 1UKSA 5HD8C 1CZ8L 2FJUB 1G9MC 4LDEB 1FLRL 2GSIB 2P46B 4BZ1H 4DP1X 3DV6B 4EE2A 3KPOB 1QO3A 1RLWA 4XAWL 4LNRB 3C5SB 2UY6A 1WSST 4MMXC 2HLAB 1OSZB 4K5NA 1HHKB 2ESVB 1QI5A 4QTHB 1BSIA 4AQ8C 4PY8I 1HL5A 4FQHA 1NGWB 3QFDA 4PJIA 4Y4FC 3G04A 4N2KA 1Q9WA 3QZWB 4YC2B 3NJMA 5FLUA 3GHPA 5D1XE 4S1RH 3PDDA 3FO9A 4C4KT 3GZKA 3LMJH 2FWUA 1WZAA 2OMWB 4W70A 2I07A 5KVGE 1OB0A 2C26A 1PAZA 2B77A 5ICYB 2B9AA 2XSKA 2XWJA 4WI0A 1J9SA 3REVA 3RWHB 1E40A 2XRAL 3QHZL 4HKXA 1I3GL 4ZW7A 2QSTA 2W88A 4PRPB 2A0LC 4LSQL 1BM3L 4RX4D 2MQCA 1T7ZA 5I75B 3F5WB 2WNWA 4NNPL 3NP4A 1FZJA 3P0VL 2WLLB 1E7VA 2FHFA 5EIIG 4PP1D 1YY9C 2WGNB 4FXGA 2V17H 3DRQB 4BH8B 2FEEL 3L95A 2VE6A 3ME0B 3CXHK 3QFJB 2CDGA 5D1ZI 5J1TC 3I75A 1UOVA 4N9OB 4DP2X 2V17L 4HC1H 2WBXA 1T66C 1CFVL 2EZ0D 3E7JA 2X42A 5EPMB 2YWYA 1NCBL 5E8EA 4E5XB 1JVLA 1JTTA 1U8JA 4FQXA 4HC1L 4DPAX 5GZOA 3QR1A 1C16B 3IDMA 1KG0A 1T1YB 2R2EA 4FKEA 4NBXB 1KGIA 5CZKA 3V4LA 5C0FA 5KBPA 4B6ZA 2DDQH 5CFHA 1TTBA 3DIDA 3V0HA 1GGIL 3HN8A 4CMHC 3T0XA 3CFJA 3IFPB 5C0BB 3CMOH 1YQVL 3FXIC 1AGFA 2CNYA 5JXAH 2K9UA 1ACYH 4AYGA 3I6LE 5D1ZD 2OMYB 3VTTA 5HI3D 5CN3A 2WY3B 4XNQA 1CDUA 2EKSB 5F0LB 5F3BB 3N44F 1N3NB 3IAGC 4HPOH 1BZ7A 4HX1A 5DUML 4XVOA 1H6TA 2GFBA 2AVGA 4ODHL 3DETC 4KVCL 1CFNB 5DD5L 1JK9B 5BS0B 2A9BA 2NZ9D 2WJ5A 2CRZA 4KOBA 1JCVA 4HEPG 4P46D 4PRIA 3MV7E 4KNUA 1BVLA 4KITB 2IH3B 3PLYA 1FL5B 2DIAA 5GRXG 1UT2A 4HJJH 3QDME 4JO2L 4OQTL 3U7YH 4UU9A 3SE3A 2I85A 4W9IC 2CRIA 4L3EE 5FGCB 1NCOA 1ZV2A 5JIIA 4XMXA 1PLCA 4PLJC 3PJLA 4RNRB 3PWNB 2GUYA 3PY9A 4XP9H 5CZXD 2NTSP 1IBHA 4OZGF 3K6SB 3R06B 1JVOA 1T1XB 5CS7A 2GC7C 2R1XA 4OH2A 3SPHA 3A4FA 3TT1H 3I6SA 3OJDB 3S6CA 3G08B 3L3OA 4TNEA 1K8DB 3EFDL 2HMID 2BHYA 4XNUH 5FCUL 4J27A 3SGJA 3WE1A 4XVUD 2Q87A 4JB9H 3QB7C 3HC2A 4XH2B 4A7QA 1D9KC 1OOWA 4IRJB 3CZSA 5I1IH 4X83A 3QXDB 4P06A 1VFUA 5GGTL 4JB9L 3GMLA 1M7DB 2BSRB 5JIHA 1OT2A 1JYXA 3DA0A 3QQ9C 3X13B 3POHA 5IFAH 3ZTDC 5CD5C 1HS6A 3RPKA 3UAJC 1A1MB 4AYSA 1S9XA 4LHUA 1A6TA 2PW1B 1QMUA 4GP4B 5DJCA 4AV4A 1OF2B 5IFAL 3AB0C 2MFNA 4X7SH 3RGVA 3V0VB 2AW2A 4X4XB 5C08A 1R19A 5IHZB 4MMZA 2BIHA 1EJFA 5HYSB 3QS2A 3UZEA 3L3GA 4DGYH 4X7CC 2VKXA 4FCHA 2BY2A 4K0OA 4KHTH 4W9GC 1ETB1 3EYSL 3TBWA 1N4XH 3KLAA 5SV4A 3LKSA 3QI9D 2OYLA 4DVBA 1GZHA 5SWQB 5GS0L 3HI1B 1N8ZA 4CGTA 1QFUL 2ROYA 2JVUA 3LEXA 4LSUL 1PCXA 1ZPUA 3GMRB 1EHLL 2Z4TA 1N4XL 4RGOH 1S7RB 2DF3A 4MA1B 2XN9A 3PHQB 4NRXB 5HGHB 2JE8A 4FMFA 4XPTL 2LU5A 3KHOA 4XMWA 3O6LH 3UTSE 1T20B 2W0KA 4B9JA 4J3OH 3CK0H 4ZFZB 3GJFA 1DQDH 2QKIA 4L8BA 4RZKA 1KN2H 4WTZG 4S1SL 1TKWB 4MZRA 4DKFL 2OL3B 3FF8A 2P24A 5CUSL 3VI3F 3VFVA 3AT9A 2AJ3A 4NZDA 2EXWD 1E4HA 1ZHBB 2NR6D 4HK0A 3LKPA 4ZO7A 1AZVA 4G6MH 4KHXH 4PB9L 4DP0X 5ELIA 4EBQL 3K1KC 2Y72A 2XWZA 4HUUA 4OKVA 2A83A 2Q76A 1M9WA 4UTBA 5LG6A 4JJ5B 2GJPA 2JFCA 2Y22A 3PRZA 1EJ6A 1N68A 3B4NA 1IM3D 3S36X 5F7DA 4HWNA 2EXYC 3C2AL 4ATWA 4PJ7E 3WAJA 3Q2WA 3V7MA 4OF0A 2D7QA 2WCSA 1EXGA 2O6EA 1MZZA 3LN5B 1V55B 1ZVYA 2A74C 4GRLA 2FZ3B 1M2VB 3PQYA 4RDBA 3US9A 2NNFA 3HPJA 4UOW1 1IBGH 4QO1A 1AR1C 2L04A 5F7HA 5DGRA 2BP3A 2X40A 1D6EA 5FYKE 1YMME 1WFMA 4YR6A 1Z9SA 4NFCA 3VGAC 4NAMA 4N3UA 1XSJA 4ZD3H 3EJCA 2XWCA 3BGAA 1QVOA 3BGMA 2ED9A 3R1GH 1T0PB 5DT1H 4HH9A 4ZD3L 1JWSA 3SSGA 3ARDC 4JZJC 1DYZA 2F58L 5EIQA 2PXYB 5LNDA 3GGWB 2FX7L 3ZHDA 3MLZL 4IOIB 5IT2H 3DJ9A 4B9FA 5HYJD 1BVOA 4JFFB 1NC4D 4I3SH 4QCIA 4YZWA 2NQDA 2K6YA 4OIFA 5DHVH 5C71A 6PCYA 2O6CA 4ICWA 5D7LD 2V4LA 1I8KA 4LVEA 2CXGA 3GS0A 4ANXA 3V6FB 4J6IA 4DK3A 5CP3A 4PB0H 2VGLM 2VDNB 4NQDD 3MGOB 2LFEA 1YEKH 3WY2A 3N1FC 4ODXB 1CLVA 5IESL 3PNWA 1FNAA 2FECI 5ICUA 3QYNA 1A3RH 1FORH 3GFUA 1U41A 3IU4L 1HEZA 4JQXA 5D2LE 3HRZB 1IIIA 1C7TA 1YEKL 3PREA 1CL7I 3KH4A 1MREL 1G7PA 3OPZL 1A3RL 1FORL 4UBDD 4XO3A 2VZ3A 4MMYB 5D6DC 4X4ZA 3Q05A 1U3HC 1RJLB 2ATKB 5H4YA 4I4WA 4ODUB 2FUTA 2ZKYA 3A6OA 5C1MB 2F7OA 5FOBB 3U9UB 2YA0A 3ULUL 2R29H 2HKAA 3QXAB 3SE6A 1K3IA 4R2GB 3CSPA 1CWVA 3BHBA 3OR6A 5F7WC 4GUQA 4FL4C 3RY6C 2DV6A 3RL2A 3RG1C 4WUUE 1KJ2H 1FUNA 1U30A 1Q9KA 1N18A 5CGMA 3REWB 3IAPA 2AERT 2C9UA 1HDMB 1KJ2L 4PUBH 4AKPA 3RIFK 4Y9FA 3II3A 4MWFA 3UTPD 3ALWA 4YH6A 3CDYA 1KULA 5AB2A 2FEDD 3T6VA 2MKLC 1ILSA 1FGNH 1K9TA 1OGPA 3E38A 4APQA 4DSYA 4GG8A 3NK4A 3OMIB 4JEGB 2XWBB 5DEFA 1UZ8B 1C12B 1QTPA 4R3SB 1UXLA 5MEPA 1RP8A 4FYQA 1FGNL 4OU3A 3L3DA 3AXLB 1MCPH 4Y2DA 5IHUH 2MIZA 3JBG7 4X6CE 1E5BA 4JQIL 3VG9B 4HGKC 3RVUD 3U0PA 3CSYB 3FHQA 3AVEA 5AKRA 4QD2E 5KZCB 1F8TH 1AJ7H 4P5TD 5AAWA 3BWAB 3HS0C 4YK4B 4LLUB 3BD5A 1NWOA 5IROC 4D94A 4ZG1A 1J87A 5C3IA 4XPGL 5FK9A 4FG4A 3S36L 4Y4KA 1FHGA 2CUHA 4O5LH 3B43A 2HYMA 5EZOH 3HI5L 1F86A 3UAEA 1OLZA 3QVAA 1TEYA 1VKXA 4PWEA 1KXVA 3MBWB 5EZOL 4UUJB 1KCRL 3NCFB 5GQBA 4DH2A 1ETA1 2G3XA 4U2ZA 1XCTB 5FO7B 3T8MA 3O8XD 4W9LC 2IQAB 4CJ0A 2XZCH 1IX2A 1H15B 1MRFH 4N0CC 3UTTA 3IK2A 2PO6A 3M7OA 4HK3N 5J11C 4FAAB 1WFTA 2QSCH 3FCTA 3UX9B 2VDQH 4N0UB 4FMKA 3FFCE 2IALA 3CC5B 1XGTA 1HN1A 2JQAA 4JG0H 1T1WB 4NWTH 1NGZB 2VDMB 3ILEA 5JOEA 4WW2C 2B5IC 3QDMA 5JUEH 1EAOA 5BJTA 3UPCA 3P69A 1EH9A 4NWTL 4U3SA 4F7CB 4L3EA 5JUEL 4AW4A 5L7XH 4JKMA 3QPXL 1VPOH 1KPVA 2Z7ZA 4GKLA 4Y88A 3PP4H 4U3CA 4YSSA 1JPST 1E2ZA 3DOSA 4XX1E 1NIDA 2I26N 5JR1H 2XBTA 4QRTB 4LCUB 5JW4M 4PLNC 1N6QL 1X9QA 3PP4L 3KM2A 4ZUVB 2BX5A 2W9DH 2H9GA 3MUY1 4KKAD 4M5YL 3S34H 3S96A 1FFTB 5B8CB 4RFEA 3DJTA 3GBNH