4L0ZA

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
159
structure length
147
Chain Sequence
b'VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRGSLSFSERLSELEQLRRTAMRVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 147
sequence length 159
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4l0zA01
4L0ZA 3WTYA 2PCXA 3D07A 4IBYA 4XR8C 5AOLA 1T4WA 4KVPA 4AGOA 5G4MA 4IBZA 3WTVA 2J1XA 3D08A 1HJBC 4IBTA 3VD0A 1IO4C 1TUPA 2ADYA 2H1LM 3US0A 2WGXA 3EXJA 5AB9A 5ECGA 1LJMA 4MZRA 2YBGA 3WTTA 3Q05A 4IBVA 3IGKA 2BIOA 5LGYA 5BUAA 5ABAA 4GUQA 3Q01A 1UOLA 2X0VA 2XWCA 4IBSA 4IBQA 4L0YA 3TS8A 3EXLA 4GUOA 3KZ8A 2AC0A 2OCJA 2RMNA 4LOEA 4LO9A 2IOIA 4AGQA 4IJTA 4A63A 1EANA 4LOFA 3ZMEA 2GEQA 2XWRA 2J6WA 3QYMA 2BINA 2IOMA 1HJCA 2X0UA 2BIQA 4HJEA 2J1ZA 2J20A 4G82A 5LAPA 3WTSA 3QYNA 3US1A 2BIPA 5KBDA 1YCSA 3Q06A 2FEJA 5G4NA 3WTXA 5AOIA 4AGPA 2J1WA 5A7BA 2IOOA 1GZHC 1H9DA 2ATAA 1E50A 3D09A 4G83A 3IGLA 4AGNA 3WTWA 5AOMA 1KZYA 3D06A 1GZHA 2VUKA 5AOKA 4AGLA 2BIMA 3VD2A 3KMDA 4IBUA 1CO1A 1HU8A 3D05A 2P52A 2J21A 4MZIA 5G4OA 1CMOA 1EAQA 1EAOA 4IBWA 2MEJB 3WU1A 1TSRA 3WTUA 2X0WA 2J1YA 4QO1B 3VD1A 4L18A 4AGMA 5AOJA 2AHIA 3D0AA
chains in the Genus database with same CATH superfamily
3QORC 4D0DA 2X6MA 4PIRF 3IFPA 1EZVX 4QHMB 2AGJL 1FL3B 2DIEA 2VITA 2YPLB 3GEFA 4CU8A 4E9WA 5CM1A 4UM8A 3NIDE 3QEQD 1YPZA 4OLXH 4M61A 1U8MA 3D2UD 1ZT4A 3LZNA 1T0PB 1A4CA 1QZNA 2GBTA 3M1BA 4JN1H 4JO3H 3RWGA 4ZFGL 4PJCB 1U0QA 4NQSA 3OG6B 4AL8L 1S2EA 3L9YA 4ZAKD 4U7MA 2F54A 3SE8H 5CSZA 4LARL 3WTTA 2I9LA 2IGTA 2YA1A 4ZUUB 2BJMH 3RDJA 4YH6A 4WWID 5GGUA 4K2UH 4NCDA 5ITFB 2X0VA 3F7VA 4FTVE 2VZ3A 4GI8A 4GO6B 2VL5A 1CFQB 3VRLF 3VFNA 5A6LA 4PV9A 2A6DB 4H2CA 2J72A 3DLQR 2YJLA 3CFCL 4H2AA 4PRHA 4GY4A 4M8RA 2WO4A 4GI9A 3C08H 4KKLD 2Z31D 3U48A 1TNNA 3GSXA 4OGZA 5HI4D 3QJUB 3HZYB 4N8VB 4JRFA 1FZMA 3CLEH 2DEXX 3QUXD 3UADA 4F1SA 3O4OC 1A64A 2WIMA 2ZXBA 4PJFB 4XBEL 1NIBA 5IROA 4YXHL 1GJUA 5CP7A 3SBWA 5E1GA 3TEZA 4X4ZA 3S88H 3V9FA 5L9DL 4H1LG 2E3VA 1H15A 5E6IB 3FULA 2GFBA 2GTWB 2XY1A 1KYUA 3LZOA 3KCWA 1HOCB 2LQRA 3RNQA 1S8DA 4LFHG 2C1OA 4HJTA 3THML 4XGZB 1NIAA 1EWHA 1M2VB 5B4MD 3W39A 4Z7OE 3OG4B 2ZP0T 5F9JB 4A6YL 2YOCA 1YNTA 1ZLWK 4K7PX 3TVMB 4I0KA 5GZNC 2R0ZH 4KHTL 5AB0A 3MR9B 3SDDA 8FABB 2J8UF 5ILTH 1W72H 4LPCA 5CEZL 3W9DB 4F24A 4JNXA 2BX5A 4Z0BH 2Q2EB 4FZ8L 3A67L 2NSQA 1KTKE 5K9OB 4L4TA 3IDGB 4L37A 3L6FB 3B9KB 2L7JA 2LABA 4WENB 2AW2A 5AW8B 4CNIB 3BJ91 3RX5A 1JPGB 3V6OA 1OSPL 3I84A 3US9A 1FL6B 2E47A 3HE7D 3LIZH 2FD6L 3OLEA 2EXSA 2M2DA 4E9XA 5CBEA 4J6IA 2F2HA 2OMUA 1FDLL 3BO8B 3NCYS 4YK4C 4AK1A 2BVOB 2PTUA 4IHOA 2GI7A 1YUHB 4ZFOB 4B97A 3DDGA 1DVTA 4FG6C 4YQXH 3B2VL 5ICZB 3CZFB 2PWEA 3WFEL 5E9DA 3IKCB 3FT1A 2V5MA 2HLFD 1WF5A 1TQCB 2WUBL 5HHME 5IWLA 1UTDA 1L7TH 2VDRB 3WS3A 1L9QA 2JTDA 5I1HL 2NR6C 4AY0A 1BQHG 2QPUA 3GHEL 4EI5D 4Y5VA 1QSFB 3GBDA 1CD8A 1WA2X 4D3CL 2QGDA 5GGSB 2NZ9D 4IBTA 2ICEC 2IFGA 3DIFA 3L5IA 2YD9A 3BEWA 2ZKWA 3NIGE 4HOZA 1YAIA 4K23L 4NQVA 3RU8H 2OYLA 3UDWA 5E5UB 4BE5A 3R4DA 1YNKH 1EMTL 1KJ2L 3EXJA 3OLGA 2CMRL 2VRKA 1G7IA 2NY5C 3FUDA 1WE5A 2EINB 5HHPA 1J1PH 1X5AA 2E9BA 3AJ7A 3QJFB 4ZUSB 4LLUB 4TUJB 5FUOH 3WLBB 3DXAD 1A7OH 1ZVNA 2IO5A 2QHRL 4JZOA 4OBSA 4W6WB 2UXFA 5FW7A 3ILEA 3N2JA 3PWUA 1YZZA 1J1OL 4LIQH 3PGDB 3LDBC 4PJ9C 1K4DB 2YXMA 5JIQA 4MKMA 4HF5L 5TFSH 4OGAC 5A2CA 3CVDA 3CXDH 2HRLA 4FRWA 4HZAA 3AQDA 4W9CC 3NIDF 3TWYA 4FQ2L 3GI8L 4FYQA 1IBZA 3HCVA 3PF2A 2VWEC 4FNLL 3SYAA 3CCHB 3A21A 3IDNA 3WKNA 2UWEF 3ZT6A 4R84A 4AEIL 1KIPB 3QULA 3MLRL 3TWCH 1R0AL 4BQCA 4E0RA 1T7WA 3ARFA 2V37A 4MLIA 2NNFA 4JRXD 4LLMB 4PY8I 4HPYH 3BVXA 3VWKD 4YDVA 1IT9H 5E1HB 5C86A 4M7KL 1N19A 1N26A 3B9DA 3NTCL 1YCSA 2ZD0A 3FQYA 4MNHA 1D2OA 5LBSL 4KTEL 3VXMA 1PKQB 4PHXA 1CBVH 3MLPA 1N3NB 1T2JA 3TT1H 3NFNA 4HG4J 4ZAKC 4APQA 2EAEA 3OXRB 5D5MA 2X3CA 5A7BA 3DURA 2CLRB 2WAQA 2ZQKA 3LVTA 1N0LB 2Y1VA 3G08A 4JFUA 5F1IB 2I69A 5F88B 3DIVA 2AZUA 3GZPA 4M43H 4OFKA 4Y5XA 1P5UA 3MTXA 3KMDA 2VDOH 3D87B 1TKWA 3RVUD 4KKLC 2Z31C 4MDRA 1YEHL 3K6OA 4MB3A 1OCZB 5HI4C 2R7EB 1WBZB 4I2XA 3F12B 3FU9A 3H56A 3MRFB 3GSWB 3QUXC 4YHYB 5CKAA 4JM2C 1OEZW 4MAYD 4P59L 1CF1A 1TQVA 3IJEB 1IKOP 3MFFA 4J8RA 4ONGH 2RJMA 3KYNA 1NM9A 2VDOB 4HUUA 4QO1B 4Z7OF 5J6GA 5I2IA 4YHNB 1XGYH 4RBPK 4L0ZA 1CYGA 1CICD 4OZHF 3LEYH 4W9JC 2JJWA 3DRQA 4R97C 2FJFB 2M26A 4JPSA 4NQCE 1NMCB 5BRZD 5L2KE 4ZW8A 4IGBD 5BS0B 2EDRA 4C59B 4IBZA 5FGBA 1NIDA 1PD0A 3HNVH 2MCMA 1BQLL 2R2BB 4FTVB 1JK8A 1QRND 4YHLL 3ROOB 4FX5A 4BUHA 4YXKH 5IR1A 3AXLB 4WI6A 4Z77B 3V6ZB 4AYSA 2LTQC 1G7QA 1UENA 4RMQA 1XWVA 2RCSL 5E2UH 3GMRB 3NG5A 2MNUA 2BOCB 2ZX6A 2RR3A 4GIOA 4POZD 1IRAY 5EZJA 2O61A 1P7HL 3GQFA 3R1GL 4EQ3A 4PVNA 3VFMB 3NCFB 3F5WA 1K2DA 2YC1A 3MCKA 3O0LA 4LSQL 1ZSDB 5IB4A 2BNRB 3OWEA 3RNKA 5DJDB 5IG7A 5JMRA 4KNQA 1T22A 4FQIH 2C9PA 3L95A 4MYWB 2RFXB 3HHMA 4LO9A 4EZKA 1MOEA 2H8PA 2F19L 4YBLB 4PWJA 2C4FT 3U1SL 3ESMA 2OTWB 1IBYA 3BPNC 1ERNA 3VXQA 1HNYA 5CLWA 3NIGF 3L81A 1E5ZA 4Y2LA 4FAAB 1ZV9A 1OZUA 3UAJD 2Z64C 1S5HA 3ARGB 2HLFC 1FN4A 4L23A 4WSJA 5HYSB 1YY8B 4YHIA 1IBBA 3RQ3A 3NN8A 4EI5C 4O9HH 3ES6B 1AZBA 2NZ9C 5J6SA 4RIRB 2G3MA 4ILDA 2ITCA 2Q86A 2EYTB 3WELA 3LPFA 4DEUA 2W65A 4FP8L 4KFZC 3QO0A 3GSNA 3VCLB 2CUAA 1G9HA 1VA9A 2PYEE 3A6BL 5DLML 1FAIL 1CB4A 4LBAA 4IMKC 4U4IA 5EU3B 3OHXA 2FO8A 2Z8RA 1XB8A 1VFBA 5TDNB 4XCYA 1G7PA 1NC2B 4GKNA 1KENL 1QSVA 3Q43A 4G83A 2CGRL 4BFIA 3X11B 5F7YC 1T3FA 4X0NA 3TYFA 2H26A 4N0UA 4P5MB 3SE9H 1BQSA 5CR8A 1ZTXL 5FUCE 3S37L 2OFQA 4S2SA 2FIKA 3IMVA 2CR0A 2CAKA 5H2BA 4GP5B 5ISZD 1DSYA 3HUJE 1PZ5B 5HHMB 4DO5A 3EO1B 1DQIA 1KCVH 3BVDB 3VM7A 1HSBA 4LLDA 5DFVD 3PXHA 1G7MB 1KGCD 3QQ9C 4OD3L 2HLAA 3SDCB 1ZV2A 3IJSB 4L8DA 3CXHK 4BYHA 4PJ7B 1JK9A 1NOLA 1DBML 3DUUB 3X12B 1J5OL 2WBXA 5IW3A 4B7IA 1T0NA 4XNAA 2O5YH 1BVLB 3I9IA 3S5ZA 4PRIE 3VNZA 3EGDB 4WI8A 1E4XL 1YEFH 4FFZA 2JF1A 3ZDXB 5DMGD 3FFCE 4OZIE 4C83B 5DMYA 3ENEA 3VWKC 35C8H 3AB0C 1JJUA 4QUOA 4HBCH 2LR4A 1MJ7L 4J1UA 4P2QA 1RK7A 1DVFD 5KAQF 3GFUA 1IKFH 5F0LB 3NJFA 1M4KA 2EIZA 3DO3A 2ZOLA 3GRWA 1JE6A 3ILPA 3UPAA 3QDMB 3UTSA 2NY3B 5LO7A 1JPTL 1U58A 3MBXH 2VMJA 3SKNB 4C4KT 4RLDA 1HC1A 3RG1C 1BZEA 1JTOA 3CWGA 1IC4H 2Y25A 3QNXB 2J55A 1S7QA 2C3GA 1MQKL 3GUFA 3QISA 1KCRL 4JO2L 4MZ3A 4H0HB 3D9AL 5IV2B 3KR3H 1Q0YL 4KJWC 5CZRA 3AT9A 3VWJA 2HWZH 3TZVB 3PHOA 4JPWH 5C71A 4JG9A 3RVUC 4NDMB 5IHUH 3K8LA 3MLSL 3G6JE 1T1YB 1EXUB 4MZ2A 1PLAA 3STLB 4NO0B 4EI6B 4Z3IA 1HSAB 1JUFA 5MEND 3TJPA 3VSVA 4X6FA 1K6QH 4MAYC 4NN5C 2AJUH 4K9EC 1AKPA 1JNHA 3RIFF 3B7SA 1L5GA 3FO1B 2X6AA 5KANI 3WAJA 3DX7A 1YVLA 1XZWA 2A4EA 3QJSB 1CICC 3AQXA 5BV7H 4CILA 4BFFA 3K0WA 1CQYA 4DZBA 2WNGA 3QQ3B 4IGBC 2R69L 1ML0A 1S9XA 5BQDA 1BVNP 4FGMA 4WWNA 4YSCA 3VXPB 5T33H 2IC2A 2IWFA 3UIYA 3BP4B 3RAJH 5FA3A 3QR1A 5DYFA 5D2LA 2B59A 5EF1A 3JWOC 5BV7B 4GAFB 4AJWA 3MJ8B 3P0YL 4ZNCD 4Q56A 4V1DB 4XBMA 4LEXH 1KN4L 5IVXE 2WLNA 2R4RL 5C0JB 4ZMXA 2WWKO 5JO5A 4XWGH 1S7TB 4FQQB 32C2B 4POZC 2ADJA 4DNLA 4P9HC 3VAEA 1R5IB 1UOKA 3NJIA 4AYMC 9PCYA 4JAMB 1XCTB 4XCNA 3AM8A 2WOBA 3QIBA 3BRDA 4X9YA 5FFLA 1IBGL 3L3JA 3QIUA 2EE0A 5DK3A 1FL5B 2AQ2A 4XMVA 3O4LA 2UZXA 3UBXI 1K5NA 1HU8A 1TO4A 3WD5H 4MHHI 3AU1A 3HR5B 3JVFC 3GMLA 4HC1A 5E1AA 5HP5A 3MNMA 4APXA 3CFEA 1TF4A 1SDYA 3VFUB 1AGEA 1OV8A 2KYIA 4NRYA 3LS5H 2JJSA 3GLEA 3K3QA 1TZOA 3BPCA 4HK3N 4N90D 3V4PA 4FABL 4K3EL 2P4AB 1XH3B 4H8UA 2K6WA 3HHRB 1BFVL 4WHYG 4JDZA 3MRMA 5I75B 5J13C 3QARA 3VA6A 2AJXH 3VSQA 2VLKB 3HAEH 4IRSD 5JZ7D 1SOQA 2R9HD 1D5IL 4MA7L 4OD2A 2VDKB 3MRQA 3JXAA 1AE6H 1HI6B 4V2BA 2ZCKL 3UTTD 5C7XL 4IRJB 3EJQA 3MDJA 4I3GA 3DK2A 3HAEB 4P48A 4RAVA 2R0WL 5E03A 4OM0H 2VJ8A 1AR1B 1KY7A 2X4NA 2FUQA 2ZOUA 2X28A 4GKSA 1ACCA 2A73B 3B9VA 2X44D 3P77A 1I1AA 4HU2A 3RGHA 4RFNB 5D2NC 1E3FA 4YFEA 4TUOB 4LESA 1OTSD 1S7WA 1OARH 5HGBB 5C0BE 2VDMH 3ZMRA 4U3SB 2KZKA 3FJTA 4LT7A 5DFVC 3WJJC 4P9ML 3H55A 1NCAH 4AEEA 3MXVH 2IAMB 2X2YA 5I9QC 4NENB 4B9GA 4Z7WF 5I1EH 1U8PA 1CLVA 4GP8B 4XAWH 1V3JA 1D5ZA 3EBHA 2PYEB 5I1AB 1TR7A 1BECA 2ID5A 5D1ZA 5FCUH 4PBXA 4YZFE 4D9RE 2IWGA 3DX8B 3FMGL 3ZHNA 3PP3K 5DMGC 2C7FA 4ZBJA 2C4XA 2YA2A 4HCRA 2CD0A 4ODHL 3WTSA 2GY5A 4GMSL 1FZKA 4UUJA 5ALBH 3B5GA 3GGWB 5LLIC 7FABH 2NY0B 5AAWA 4CUCA 2H7WA 1PG7L 1SHWA 1SJEB 3EFFA 4KMTH 4ODSL 3HUJB 1ZLWH 4TQHA 1VSCA 1F58H 5H94B 4FQJH 2I85A 3UYOD 1ZA3A 2YGPA 4LFHD 1YAZA 5AYUL 3SE6A 4DP5X 3EH2A 2ZCZA 3WL9B 3WFDH 5AWNH 4W4NA 2TSBA 4FXKA 1NAKL 4O58H 5DD3L 2KPWA 5E8NA 3TONA 4XNQB 3EH5B 4OCYH 5DVNA 1T2XA 1WWBX 5CJ5A 3D12B 1BPLB 2ADIA 1A1NA 4GAAA 3WEAA 3FFCB 5F8QC 4OZIB 1O7SA 3TBTB 4XXDB 4EUPA 4A7SA 1H0DB 2EO1A 4MCYB 2PPEA 5GGVY 5C0CA 1CLCA 5DMKB 4BFJA 5JHAA 2P5EE 1M42A 1M6OA 5IQLA 3KBPA 4XP1L 2ZWSA 2C3HA 1FP5A 2B39A 2J71A 3UBHA 4HIHB 3WFBH 1LO3H 4ZYKA 3BT0A 4W9HC 1Q94B 3U0TB 1BG9A 2APVA 2HFEA 4HDIA 5ALCL 3CVHL 5LDSA 1HHIA 3VB9A 5INDB 3EOTL 1QYGH 1S9WB 3CU7A 1U6AL 2J88L 3SO3C 2QV2A 4B7LA 2X89D 1MFCL 3G6JB 1XQ4A 1CU4H 5FO2A 2WZPA 3P3RA 2BIOA 2AKRA 3M8OH 4KY1H 2QR0A 5FHAH 4I48A 1GKEA 3DK0A 4QRPA 5B38G 5B8CB 4KKAD 4XO4A 4HOWA 1SYSB 2JKRM 3BI9X 4JB9H 3RBGA 2AXGA 1DQQB 3NGBC 4PJGB 3BSGA 3L4ZA 1CGYA 4IU3A 2V3DA 5I1CL 3K8MA 1UVQA 3FUFA 4NBYB 4YSRA 3BIKA 4L1LA 2XNAA 5TF1L 2OMXA 4BJLA 4KK5D 4GO8A 4O2CA 5I19H 1QFWL 2XIIA 1TEYA 1TETL 3VFRB 2WKOA 3VVVA 1UKTA 5ITBL 3VUAA 2R56H 3LKSB 1CIUA 1SZNA 1KCSL 2XYBA 4UANA 5IVXB 4X6EA 1UCTA 1TT6A 4LAQH 2WIIB 5D96C 2XQBH 5CO1A 5FYLL 1BQ5A 4IRSC 4PGJA 1J0ZA 2XQ0A 3ERXA 1BLNB 1ED3B 5JZ7C 3FCSB 2E27H 1EIBA 5FYJL 3ALWA 4BHUI 4D9LL 3ZRCC 1C1EL 2R9HC 4W4OA 4N2FA 4BQ6A 1RZIB 4MD0A 3OR6A 5A6MA 2WO2B 5KWYC 1ZLVK 4KU1A 4MMZC 3SKUD 4PJAE 4F7TA 1IM9A 5C8JB 2BERA 5D72L 4RMSA 5BZWA 1X5LA 4PU2A 5TGBB 3PWLA 3H42H 3VTTA 5FLVA 3FFOA 4FULA 1PG7W 2WLYA 4P4RA 5LCVA 2J25A 3BDBA 4XH2B 1YN7A 2ZXDA 4X83A 4PRHD 1UFGA 2DMGA 2KL6A 5E24E 5K93A 3RVXD 3AMLA 1A6WL 3T77A 4IBUA 3LKQA 4YZFF 3AREB 1JNJA 1E4HA 2J4WL 2NTFA 3K2IA 1QO3B 1JS4A 1J11A 3ECBB 3TA3B 3TFBA 3CIQA 3ZE1B 5IROD 3QWQB 3TO4A 3TM6A 1HXYB 1RLWA 4JPKL 3P0VH 4OIIH 4UIMA 3OKKB 4ZXBA 5T5FH 3IRPX 3EO0B 3ZE2E 1GC1L 3VH8A 1QBAA 1BZ7B 3QUKB 2B0SL 4AQAB 1NEZB 2GC7C 2QPDB 4RBPH 4WUUA 5HDBB 3QZOA 3ULVD 3QEHB 1F3RB 5I5RA 4BKLB 5KSAB 3FO9A 1AGBB 3EOAB 4PGDB 1A7PL 2NYZA 3KPOB 5DQDL 4WHTA 4TQIA 3RVWD 3L48A 1F90L 1CC3A 3OKMA 3QXDA 3SDDD 1UFUA 4YX2H 1OAYL 2KMWA 5A3IC 1SVCP 3PHSA 1X5HA 4ONFH 4EPSA 4EUPG 3L4CA 3RFZA 1JPFA 1NTDA 5C0BB 3A23A 1IQDB 2JKJA 5JW3L 2HJKB 3ARZA 2VNCA 3PFUA 2KC0A 3MA7A 4L4TD 2CUMA 3D0LB 4HSAC 5H35B 3FH7A 3V0IA 3DUSA 3E6HB 4O4YH 4OJEH 2EVGA 5FYKL 3LNEA 2F5BL 2P46B 1JAEA 4DVRL 2OCJA 3MC0A 5KYXB 4NKQB 5KZCD 3V4VA 1P4LA 4YNYB 4BZ1H 3SY6A 2JKTM 5E9DD 1LO5B 3EHBD 3HRZC 2QTEA 3PGCB 3WDIA 4ZMWA 5BOJA 2CJUL 3REWA 5FDWB 3ZHLA 4R7DB 4JJ5A 4MNGE 4OV5A 4KXCA 3IU4L 2H45A 4NZTH 2K1MA 5HYIA 1E7UA 3FT2B 3KPRA 5DQ9A 4A2DA 5EO9A 2ITEA 2RQEA 4BSJA 3CFDA 4M1DH 2ICWJ 4KJYA 1MCPL 2CRMA 5DJZB 1H8NA 5J1AA 5C0AE 2Z92B 4DQAA 1DQML 3A24A 3SY0A 1TNMA 3BSHA 4N22A 1CK0L 2G3ZA 3CZGA 3S4SA 5J11C 5DHMC 4JFZH 3OKEA 2XA8H 3CHOA 1TTUA 2X70A 1UM5L 4KVCH 1NL0H 4HGWA 1MVUB 4Q6IB 3GMOB 1JRHL 3LKRA 5AVTB 3SDCD 5F3HA 3MUZ1 1AKJA 4GNKB 1I8KA 3L7EB 5BW7A 1NBZB 3LAFA 3D33A 3FUJA 4I9WE 2RACA 2Y7LA 4KKAC 1R3LB 4F20A 4MCZB 2P5EB 4CADA 1OGTB 2IGFH 5AVWB 4PUBH 1IJNA 1UXWA 2V4LA 2QEJA 2XX1A 3K6DA 3WSQH 3PQYA 2EIEA 4XPFL 1DBKL 2UVFA 3QNZB 5IB1A 1CT8B 1MF2L 4XP6H 3ZKMD 3T04D 2LT9A 4Z23A 4KK5C 3OQRA 3W57A 4LASH 4U1MB 3V4LA 4PH8A 3UX9B 2Y36H 4EO5A 1U91B 2D31A 4G1MB 5IMMB 3NFPA 3PFQA 2CU9A 3ARFD 1BEYL 2GB2A 1A9EB 3FU8A 1A47A 2I07A 3CC5A 4PJAF 2XFXA 1KB5L 2NXZC 1AQMA 1VF5C 1JV2B 1NFAA 2VMCA 3OF6A 1AQKH 2BSRA 3HEIB 3VXMD 4YHKH 5LN4A 1F18A 4GAJL 4BD4A 4DKEL 1CTNA 5I8CB 5AW7B 4BFKA 2NX5E 1F2XK 2DJUA 2MQ3A 5F7FA 4APQD 1U3HB 3TZVD 4FMFA 3GYRA 1VACA 1TYEB 3ARQA 3K91A 3L3KB 4YL9A 3VXUE 2HMID 3KLLA 4HFWB 1BXVA 1RUKL 5F7LB 3OKNB 1YYMH 4X6BB 5EZIL 3MLUL 5F7EL 1DDHA 1TZGH 3DWTA 5E56A 1YEDB 4NKMA 4PTTB 5D6CA 5B21A 3VH8G 1MWOA 5D7EA 3WNLA 1JCKA 3A6CH 2Z35B 2W81C 4FQHA 5CCHE 1WP6A 4GUOA 3R8QA 4LKCB 1V05A 3EBGA 3RVXC 4CSZA 2C9XA 2OJZL 2W60A 3N41B 1OM3H 5I71B 5HVWA 3WIHA 4PJIE 4WW2B 2AJZB 2E7HA 3H6AA 2LU7A 2R39A 3IDYB 4AJ0A 5IROC 3FH5A 3ZL2A 4ZTPL 4DT2A 3TH2T 3SBWC 1T1ZA 3QAQA 3V8OA 4PJ6A 1GZQA 4YR6B 2FCBA 1AQDB 1DLFH 4R3SB 4UDTA 4HS3B 4KHXL 5LXVA 1OAZL 3VE0B 4JFQB 3ULVC 2MSPA 5GS0D 1WFUA 5INCB 4GPVA 3UJTL 4TL5A 1QTYT 2BIHA 3U2SB 2RD0A 4MDIB 4S1DD 3WKQA 4D8PB 4UQBA 1XGUA 3RVWC 4X7DC 3SPVA 5GS2H 1IFGA 2YQGA 4TQEH 1EHLL 4LNRA 3SDDC 2KZBA 4NC2B 1SDAB 4CKQA 1H3WM 3UFIA 1RXLA 2HT2D 4B50A 3WKPA 1VPOL 3D4YA 5FUZL 4XHJC 3DETD 4EDWH 2Y69B 1PFOA 5B1BB 3HZMB 4L1BA 5AVSB 2FEDD 2WBKA 5SX4H 1OF2B 1Y18A 4JY6A 3V6OC 4J2XA 2F74B 1BGXL 3U2IA 2J6EL 3ZE2B 3M7OA 1A6ZA 4ELKA 2BFVL 5ADOH 3MRLB 2J73A 4LLWA 1E6OL 4ZUTA 3RWHB 1I4FB 4WNQA 3IWUA 3TNMA 2ENJA 4GMTH 3HI5L 3FQ4A 1ZGLP 1LMKA 3EHBC 5AQ0A 3H1ZA 5IWLC 1G7JB 3HG1A 5DJAA 5CEZE 4FG0A 2X0WA 2EE9A 2RALA 1L0XA 3H3PL 3HI6H 4R8WL 2N0MA 1JNNL 4Y5VC 1EERB 2HLEB 1KTLA 4QMEA 5BZDA 4F91B 2ICWI 4G5AA 1CWVA 2HG5A 4WCYH 4IDLA 2ZYRA 1WSST 5IEKA 3UDWC 1B4JH 3JZ7A 3D30A 3HS0A 1T04A 1RUAH 5GZOA 1L0QA 3GK8H 4PJ5A 3MKGA 5CEXB 5AZEH 1JF6A 1TPXC 2G2NA 3TL5A 3ZKQD 4F57H 4ZQKA 4LCYB 1R3HA 1XF3B 2P26A 3V95A 4DESA 1BOGA 2NPLX 2AJ3B 5JXAH 1G6RA 4UNTA 4TS6A 2H1PL 4ACTA 1QSEE 4BE6A 3E8VA 3Q8FA 4NO3B 1NFDE 2IAMD 3QZWB 4LQFH 1XGQA 1FYTE 1NJ9B 3WMQA 2Q10A 1KMGA 2YK1L 2GIMA 3LD8C 5I73C 1JMZA 3EYQC 4MNGB 4R4NC 3ATAA 2W94A 1U8OB 4Q6YA 1R5VA 4X5LA 4X2UA 4KBPA 1WFTA 2AVFA 1KEGL 2FRGP 4CVXA 3ZKMC 2GK0A 4IJTA 1YNLL 2YEZA 3GEWB 1U8JA 2AV1B 1SHXA 3SDXA 3ARFC 4EIBA 5C08E 1BW8A 1FWXA 4WTXA 2VXQL 3O45B 4TSBL 5HYJA 2D03H 1QNZH 5D7JC 3ZZLA 4UMGA 4P2QD 2COVD 4UTBA 3PP3H 4F58L 1ID2A 2XY2A 4YBQC 1LWRA 4N8CL 3O6MH 3BLKA 4G70B 4HAKA 3UTSD 1YECL 4APQC 3IXTA 2V2TB 1PLGL 2VLJB 4ODBD 5EA0L 2HMIC 1QBLH 2H0EA 2CM5A 1B2YA 3RIAK 3ZTDC 1AXSB 4AQZA 5DA0B 4Y5XC 1P5UC 4D0BA 1E9QA 3VWJD 5FFGA 4ZOAA 4QHUA 2JELH 2WYIA 3FPXA 3OJ2C 3B2DC 3QUGA 2R23A 3HC0A 3IDXH 4HK3J 5DJYA 3G04A 3FCUB 4GQZA 3VXNA 4FKEA 1GGIH 4CL7A 5K9JL 1AQ8A 1T4KB 5IB5A 1JWUA 4ZUWA 4URKA 3NOIA 3VFSB 2R0LL 1TU2B 1CE1L 3G7TA 1OOWA 4QXTB 4W68A 5I26A 3IGFA 1UZ8B 4LPVA 1M3JA 2VR6A 1TSRA 3SE3A 1AI1L 4KRLB 2F58H 2NX5B 4B41A 2AGJH 2A9BA 5DD6B 5IHZA 3O9WB 5FGBC 4IW4C 1N8ZA 1VB9A 1INDL 3BAYA 2D3LA 1NBVL 3W0WA 2XVLA 1N5AA 2G3NA 4ZFGH 4S1DC 1BIIA 4HIIA 2VR3A 1IC5H 2OPCA 1KNOA 2NUTA 4AL8H 3FOMB 1IAOA 2CDFA 4LARH 4AH2B 4KTDL 5FM4A 3ARXA 4JREC 2V7NA 5HBBA 4P2OA 3RBSA 4JCWA 3X1BA 2HT2C 1FUNA 3NEEA 2I5YL 2DM4A 4PJIB 4NHUB 3DETC 1XEUA 1A22B 1XR9A 5D7KE 2OTUA 1MHPL 3QIBD 4RX4A 4U4BA 5BXFA 3QIUD 3CU1A 2FEDC 4QIRA 3U36A 3EGXA 3P40A 4X6DA 3ABLB 3O4LD 4H8WC 3HR6A 3KL0A 1GYUA 3VI3A 4NP4L 3AZUA 1DCLA 2CXGA 5EIIA 2MQCA 2RMNA 4LOEA 3CZEA 3KWVA 4XBEH 5IKCB 4YXHH 4P3CL 3U82B 1TQBC 4OT1L 2YD6A 1I3RB 3MJ7A 1Z7JA 5L9DH 2L7QA 5EO1B 4MSWB 5I6XB 1BZOA 1MCSA 5HPOA 1I7ZB 3S96A 3WNIA 3TEUA 2MKWA 3H9ZA 5E8OB 4GT0A 5GRZA 4XGZA 1SOSA 3THMH 3CBKB 3O3AB 5JNYA 3U1QA 1JGDA 1I7UA 4HMEA 5F9JA 4X4YA 3DX9B 4HBQA 1NFDF 4A6YH 4FFWD 3BVTA 1XGPB 3IJ7A 3OHXC 5F7HA 2WB1A 2YQ2A 3GLAA 4KHTH 3ZJAA 4DKFH 1A5FL 1RULL 5CEZH 3G9AB 5K59E 4FZ8H 3V5DB 1U93A 3KL3A 5IOPB 1LD9B 4GRLB 4PV8B 3ASOB 3B9KA 4A6YB 5EU6A 2AABL 4YHZL 43C9B 1BAGA 2CJTA 4XN2A 4C56A 1W72A 2I25N 3LY6A 1E2VA 1OSPH 3BH9A 1I1AD 2UX6A 1J8HA 2FD6H 3UC2A 1LE9A 5C70A 1FDLH 5EDSA 1TXKA 1JWMB 3II3A 2BVOA 1FE8L 1Z1WA 3NUKA 3T6QC 1R47A 2VXTL 5E8EB 3NIFF 5SX5K 4QRUB 5AB2A 4X7EC 5HGHB 3B2VH 1GGTA 3WFEH 3LIZA 3BPOB 1CFSA 2Z1KA 3CDZA 3CSGA 2WUBH 1PU0A 3CK0L 3L3HA 3QH3B 3PNRB 5I1HH 3EJSA 5D1ZD 1LGVA 2G0KA 2J1YA 3GHEH 1SY6L 2X2HA 1MLBA 3BEVB 4D3CH 4GKLA 3RE0A 1TJGL 4NP9A 1M71A 3O8XA 1ZTXE 1BQUA 5J9PA 1SHMA 3QPXL 3U7WH 2V7HB 1HEJC 4K23H 2WUCL 3QZLA 1SHSA 1HHJB 2XQYA 3HBGA 3NPSC 5ID1B 3L4VA 1EMTH 1KJ2H 4QRAA 2CHXA 2A38A 2CMRH 1U33A 4JGJA 4KTGA 1FYTB 2J8UA 4GT7A 3VGAB 1W0VA 3IJYA 2V17L 4R4FL 5T1DL 1RURH 2YRLA 4KQ3L 5CU9A 3NZ8B 1SJVA 2QHRH 2BXZA 2WGNB 1BBJA 1HXMA 2NQ3A 1J1OH 1KJ2B 1U8LB 1CFBA 3MRCB 3P9MB 4HAFA 4N68A 2O5ZL 2HT4D 2WVVA 5C0IA 1BMZA 3VWJC 4F92B 3FQ1A 4DPBX 1GSMA 2IMNA 2XJKA 3PV6A 4L8BB 2D7MA 1KBWA 4HF5H 5DZOA 2B5IC 2IBZY 2N4IA 2X2UA 3WNJA 4KKRA 2D0HA 1OAUL 2F6AA 3V6FB 1IKNA 1CFVL 3QFDB 4FQ2H 3GI8H 3F58L 5JIDA 1XGZA 4KGJA 1XMEB 3FRPB 4AEIH 1J48A 5GRVL 3AS1A 1A3LL 1R0AH 3MLRH 2D8KA 2EDNA 4HKJA 4LEOB 4BK8A 3UYPB 5J12B 2XWRA 3G5YA 4K94L 2ZG1A 5JXEA 5AVXB 2EDQA 2IOMA 2Q20A 2BHYA 4NM4L 3T0EB 1KPUB 2YPVL 3BKYL 2WWMC 3LN5A 4M7KH 5LBGA 3VDCA 2AP2A 3VMNA 4PRNA 4WFED 5LBSH 4KTEH 4G80B 5DEGA 4DERA 1NKRA 1JYVA 3KE0A 2R1XA 3EFOB 1HQRA 5EIIG 3HBQA 2CBOA 1UM4L 5KVGL 4XNDA 1A4JB 1J1XL 3PAUA 5G4NA 1LL1A 2WZPD 3DECA 5F89A 3VDAA 4ZFQA 1RUQL 2BC4A 2I32A 2VTFA 4XPTL 4ENZA 1R34A 4NC1C 4AUJA 3AM8C 4Y2OB 3QIBC 4IQHA 3GM8A 3QIUC 4QRPD 1X5XA 1UATA 5KYUB 3D4GA 4YSDA 3LNDA 5IMLA 1GYCA 2ARWA 3N0AA 1YEHH 3QCUL 1TO5A 2IXQB 3ARSA 4UT9L 5AOKA 1M05A 4JRYA 4IOIB 3R18A 4MCMA 1Q9WA 5LWYH 1GGUA 3ZO0A 5EOTB 1VZHA 3ATDA 3NCEB 4IU2B 1JZ2A 3C09B 3D05A 4P59H 1JXGA 1FIEA 4NZRH 2UWEA 2Y1AA 3DHJA 5EUKB 2JJSC 2YS4A 2IQAB 5GISL 3HG5A 5CLYA 3T6XA 4PR5B 2XU9A 5JLZB 3K6NA 3D69A 3JV6B 2KKQA 3K8KA 5GGRY 2HP4A 4NYLB 3CZNA 2YAQA 2NTSP 4QTIL 4YSOA 5I1DA 1BQLH 1FFRA 1A6TA 1ONQB 4KUZL 4YHLH 4ZOEA 4X4ME 3E8UH 1W80A 2F08A 2X4RA 3D4CA 1MEXL 2WCSA 3DTXA 3FFDB 4FFWC 4JS7A 4P2RE 3TC9A 3WFCL 1SFDA 4J6RL 4P04A 1V3LA 3QXWA 2W88A 1N8OE 1SJHB 1SOKA 1IM9D 2HJLB 2WVSA 4NPKA 2X4TA 3V0VA 3KYMA 4QHPA 3QFJA 3U6XS 4PVMA 1MRDH 3O6LH 3R1GH 4RGNB 5GHWH 4A7QA 2OKMA 4FQ1L 3KLAA 4DFIA 4B95C 5DJDA 4LSQH 4E41A 2K6YA 3UAFA 1RERA 4G8FB 1JSYA 1I1AC 3TX4A 1S7RA 3PWPE 1QATA 2BCMA 2F19H 3NZHL 1X5YA 4KY2A 5FECA 2D3JA 3GSVA 4UAOC 3U1SH 4Y1AB 4R83A 4B0MM 3PWVA 3SPCA 4BZ2A 3TO4D 3Q48A 3RPIA 1RLBA 3C9NA 3ZL1A 4OGYL 1FGNL 2FX9L 2XICA 4FXGA 4XN5A 1YY8A 4YPGA 4Z7UE 5T8IA 4OZHA 1QI3A 4ZXBD 4A63A 5GS1A 1ZS8A 3DX4A 5D1ZC 1SF5A 2O5XH 4UV7L 4DZ8B 2VC2B 4U6YB 1JYXA 3GO1L 4WUUD 4X6CE 3S0PA 1QKZL 3OKOB 4XZUB 1G1CA 1QBML 1VLXA 1Y0LB 3FHEA 4FP8H 3CN2A 4GIAA 3LPWA 4XOBA 3RL1A 5DLMH 1GKOA 1W15A 1FAIH 5AAWC 4YDLB 5JHDE 1HAUA 3QQDA 1DJIA 3R0NA 1XBRA 1JXFA 3QZMA 1UH4A 3K1DA 4KKPA 3U7AA 1KENH 2ERJC 2I26N 2BOBA 4H0GA 2CGRH 4N25A 1A3ZA 2P5PA 2Y07L 5E5RB 1JN6A 3NACL 1YMME 1ZTXH 3S37H 2HT4C 2HX8A 2Y0SA 4DOHE 4FXKC 3I02A 2E4TA 3VYNA 2V5TA 4PFEA 5JPNB 1G7MA 1BZQK 2Z93B 4FYTA 3K6FA 5FX3A 2CQVA 1QA9A 3FC8A 4U7KA 4TLUA 1BDYA 1EHKB 5IQNA 1A3RL 3C8DA 4QWWC 2J43A 1MG2C 1DBMH 3P30L 1J5OH 4ZX5A 2W91A 5GJTL 1EAOA 2RHEA 2WBWB 5IGXL 5J3HD 2Q76A 2XKUA 1NCBL 1E4XH 1SMAA 2EE2A 3KPRD 2WNXA 3MROA 5I23A 4LLVB 2WXKA 1BVNT 1TEGA 3WTYA 1BIHA 1MJ7H 2E6JA 4UOW1 2OMWA 2XVBA 4P5TA 3AG2B 5EO0B 3JWDC 4Y16A 1NMBL 3MAWA 1JPTH 5DU7A 1IAIM 1LQBC 1FVDB 1PZUB 4WSKA 4XNZC 1MCOH 2HFFB 4RAUA 3MO1A 4GXUN 1L4IA 4NHCL 1QI4A 4OB5L 1MQKH 4JO2H 3VXUA 1KCRH 4AJVA 1Z5HA 1AKJD 4IS6B 2ATKB 4XVSH 5KUKA 5DQJB 1E42A 1Q0YH 4YJZL 2WM0A 2HXAA 4BCYA 3QIWA 2IPUK 5CGYD 5DUPL 1PZAA 4IEFA 4LBEB 4PP1D 1B4LA 2FATL 1NAMA 2CHNA 3MLSH 4WI0A 5EU4A 4BXSV 5B3NA 2E7LA 2G60L 3QQNA 3ABMB 1A7QL 4GIPD 3PQYD 2D4DA 4BA8A 4OZFH 5I66A 2ROYA 3OLDA 3RWCB 5EC2A 4BQBA 1M56B 4AQ1A 3FQUA 4XNMB 1WCBA 2V2XA 4K8RD 4OLYH 3RIAF 1ETJA 2DYSB 4DPAX 1HQ4A 2BVEA 2N1TE 1BFSA 5JQ6L 4PRDA 5CIPB 2FO4B 2R69H 5E8PB 4GW1B 4YVNA 3EGSB 4ODXA 5E94A 5HHVL 3OF6D 2X05A 3GTTA 1I75A 2H3NB 2WLZA 3P0YH 5TH2A 4W4OC 1EHXA 5CKGA 2BHZA 1TVBB 2VQ1A 1HXKA 1KN4H 2W0FB 1IE4A 2V9QA 3DGDA 2R4RH 1CD1A 1KG0A 2BSTB 2Y6TE 4ORGA 1I8MB 2JKNA 1ITCA 3KGUA 4LVNC 1F1GA 1NKGA 4RMTA 2ZSWB 2VJ0A 5KVEL 4ISVB 1IBGH 5AW6B 1DZ0A 1KXTA 4KRPD 1CL7L 4Z7IA 2JI1A 5AOMA 5HJ3B 3NZSA 5TJWK 2EXWD 4QJ5B 5E00A 2XXFA 4NQCA 3T65B 1JYNA 5FYLE 3O3DB 1AOZA 5L2KA 2ATPA 1HHHA 2DWSA 1ZT7A 5EF3A 2NW3A 3UACA 4WO0A 4X6CF 5FYJE 4YS4A 3LQZA 4ZPTA 3AS2A 1L9NA 3TO4C 5FR3A 3EYFB 3N50A 3V5HB 3HS9A 5ACZA 5T3XD 4H25A 4WFHD 4E9SA 3HG4A 4L1SA 2RA1A 4ZXBC 5BRPA 4P2RB 3BQUA 4A1RA 4FABH 5DSCA 4K3EH 4ZJ9A 3KPPA 3RP1A 2XVKA 5EBWB 1BFVH 1JYWA 3VXTB 3B1UA 4IYKA 1FFTB 3FTZA 3OR7A 3ZTNL 1YMHB 2TRHA 3A3YB 4DGUA 2P7TB 3LKOA 4JFXA 1FG9C 4Z76B 2BIIA 5C09E 4FL4B 4MXVF 2JXMA 2CIKB 3FL7A 1KIUB 1D5IH 4MA7H 1IEHA 4Z95L 2C9UA 4I0PB 2FYYB 12E8L 2EEFA 2ZCKH 3T8XB 1NLBL 3G5VA 3HAEA 3PWPB 4P46B 5C7XH 1OWWA 5I6LA 2GG1A 3CZLA 3SQRA 2R0WH 4HISA 2RAMA 3F7RA 4PB9L 3ELAT 1NUDA 4HJGB 3AQZA 1FA4A 1AO7E 1F3DJ 4Z7UB 2BXYA 4MJJA 2XN9E 3RTQB 1QPPA 3SZ6A 3SPJA 4CN4A 4Z5RB 4MMXA 3B8YA 1L3WA 3RWFB 2DWDA 2H3XC 1UG9A 3VGHA 4OBRA 1QMUA 2WXRA 4NQEE 1DJHA 3ARDB 4WSGA 5A2FA 2FL5B 2QMJA 2JJTA 3HG1D 4MHHG 3K72B 2GSGB 4FXTA 5J3HC 5D1QE 4P06A 3FMGH 1JMXA 5HDOA 1LILA 1OK8A 3GXMA 2LLLA 3D85B 3TV3L 4NBZB 4ODHH 3RDTB 5T1MA 2WO3B 4CN1A 4GMSH 3BUYB 2D7OA 5FYKE 2DN7A 3IMTA 1NDGA 4RMUA 4E9TA 5GZOD 1YMMB 3ABGA 4PJ5D 2DIJA 4MS6A 2A6JA 3PHQB 3WXWL 4DOHB 1PG7H 1Z5LA 3QYNA 4ODSH 1NGWB 3BRFA 3C60B 4KZEL 2IANE 1CR9L 2DQFB 2OJEA 1KB9J 3BP6B 3R4RA 1GGYA 4ZS7L 3WTXA 3VFOB 1QLRB 4OM1L 2VH5L 1AIFB 4FLOA 4HT1L 1A7RL 4ICXA 2IDUA 5ESQA 3SSGA 5ENWA 4KMLB 1KFGA 5BW7C 4PWHA 5AYUH 4ODVL 2WLLA 5CGYC 3RUGF 5IOKA 4PP1C 3PL6B 2VIRA 4PPTA 3EBIA 1CTMA 1NAKH 4TUKL 2YEQA 4LXFA 5DD3H 1B9KA 2FJGA 4QF1A 3UBXB 5KAQG 4PRIA 3ZQXA 1KBVA 1LP9E 1QEWB 2MJWA 4K9JA 3LQAL 3DX6A 4N2HA 5DVOA 5EH1A 5HPMB 4JFTA 4Z7WA 4KRNA 5FGRA 4K8RC 1W9XA 4QTHB 1OWRM 1PYWA 4BFGA 2GTQA 2QZQA 2XTJB 5JIMA 5SX5H 4XMXA 4K71B 1HKLH 3ZW3A 4XP1H 1I8IB 1F3DH 1I7TB 4PJ8A 3MRHA 5I6OA 3SE4A 3Q3GA 5HYJD 2DTSA 1RSYA 1Q94A 1INQA 1DHKA 1HL5A 1KBBA 1TTBA 5CN1A 5ALCH 4LHUB 3CVHH 4NZ8A 3OWRA 3DPDA 3VXOA 2IFFL 4WGWB 3EOTH 3V55A 4H8VA 4QHKJ 5CBAB 4X5QA 3D08A 1U6AH 2J88H 2XBZA 1EFXA 2WLIB 1D5XA 1VFMA 2IADA 1IO4C 4Z7QB 4N9GB 3WNNA 2N56A 3AS3A 4P07A 1ROWA 1GOHA 3H9YA 1IGIL 5B8CA 1TZIA 4QRBA 5FW6A 4EI0A 3P4OB 4KRPC 4MD4B 2WWKT 3BUQA 5IW1B 3J27A 2EXWC 4NPYA 5E2TL 1MQ8A 4JQIL 4YN3A 4OVUA 4HFUL 3V79C 4PRPB 5FK9B 5I1CH 1D5MB 1RZ8B 1DJXA 3QDGB 3VQ1C 5TF1H 3HZKA 3BSZH 3F83A 2GJZB 4M03A 2X41A 1QFWH 2YSSA 3HAEG 1TETH 5EG6C 5FCSH 1KCBA 1NGPL 4LL4A 2ODIA 4GBXA 5ITBH 1YRKA 5CP3H 3Q9QA 4AXWB 4HH9B 1ZPLA 1KCSH 2O5NA 3V4UH 3IF1B 1JXDA 2X4SB 4NWUL 1CI3M 3VGDA 1GGBL 3QYMA 2ZF8A 4PGBA 4QHNB 2LOEA 3W0WD 2GABA 1EHNA 3MBWA 3JWNG 5DD5L 2EYRA 3UPCA 1Q9KB 2NUPA 3OGCA 1SMDA 5FYJH 3KL5A 3H0TB 1PAZA 2JIXA 4D9LH 1GMIA 1C1EH 2Y7QA 3WNKA 1P1ZB 3F01A 1ZLUK 3TEWA 1KTDB 4UQCA 4KRMB 4X0KA 1XCQA 1U4EA 2B14A 3B6SA 4L3FA 4PSRA 4WNSA 5T3ZL 5J7CC 5L4JA 3FTVA 3MODL 5EIQA 4P2OD 3FYIB 5D72H 2YUZA 1NGYB 1XR8A 5GJSL 1KZQA 2J1KA 3Q7JA 4Q4IA 5TGBA 3S98A 3DHMA 4HEME 2DYPA 2PMZA 2DQDL 1FVCA 4RX4D 1FV1B 1W0WA 2VR7A 1WFIA 1ZJBA 2XA3A 3ZTCC 3FQWA 4EKJA 3D50A 3R8BB 2ESVA 2DICA 2VISA 4UU9B 4S0HA 3U6RB 2ZWNA 2W8CA 5I0YA 1A6WH 1LDPL 3AREA 1OCRB 5DJ8A 5HHOE 4HKZA 2K3TA 3D18B 4H44C 2J4WH 1HN1A 1N12A 2AMUA 4F27A 4PJHF 1RZGB 2QSTA 3QQ4B 1VEOA 4ODTL 2GW5A 2FAUA 4JPKH 3EKCA 1WK0A 3N1PC 2OSLA 3DGGB 2X3AA 4OZGE 2TAAA 3C5SB 3KYAA 4G7YL 1GC1H 3GLDA 5HGAA 5DURD 4F1ZA 4HJUA 1A3QA 4IBWA 1M3IA 1RIHL 2YMXL 4R2GB 1FYHB 1K9TA 4G9FA 1A7PH 3MNVA 5T5FA 5DQDH 2VYRE 3HS0C 1E27A 1KBPA 5GZOC 2VABB 3CFBA 1F90H 4CAGA 2EUXA 1OAYH 1AO7B 1FSKC 2XN9B 3LRSA 4LRIA 1DBBH 4HKXB 5ESVB 3WY3A 3HTLX 1LP9F 1N10A 3GPEA 3L5HA 3LEXB 5JW3H 3MBEB 1TQUA 1W16A 1K8DB 5EU6D 3FS9A 4Y4FB 4MBRA 3LEVL 1ESOA 4C56D 1A4KB 4ZZKA 4NQEB 1J0KA 5M95B 4H0LC 4XAKD 2PW1A 2J56A 1A6VL 1BXXA 3MCG1 4JN2A 1J8HD 2OQJB 5FYKH 2F5BH 4OKVA 4Y0GA 4DVRH 1UOLA 4R5XA 1T5WA 1BYOA 2ARJB 3QUZA 5GRVK 5I8OL 2Z65C 1MHHB 1J9QA 5D7IE 3FZUD 4XPGL 1EUTA 1FZJA 1FFNB 4ZW3A 3Q9PA 4R7DA 1Z3GL 2CJUH 4XVTL 2VLRE 3V10A 5F1NA 1GZPB 1JWSB 1QFUL 3IU4H 1EANA 3PYCA 1MW0A 3O8XD 4PHZA 1NEUA 4BZ1A 2BS8A 4QHKI 3IMBA 1FF5A 2GIYA 4W6XB 2NY4B 1NGXB 1MCPH 2XSKA 1DQMH 1MCNA 4KK6D 3FQNA 2NNRA 3LMJL 2FEEL 4TLKA 5CGTA 3KBEA 1OALA 2M83A 3US1A 3LV3A 3I6SA 3BZDA 1XTMA 5GSRB 1UM5H 4G6FB 5FIEA 2I60L 2OSXA 2YD8A 3IMUA 2ICCA 1JRHH 2IPKB 5DEFB 2EDBA 1J87A 2J1WA 1DJYA 1UKSA 3E2HC 1P53A 2BVPA 1WBYA 3BKCH 5I30L 2F8OA 3R7QA 1OLZA 3NJNA 2QZ5A 3BKJL 5KVDL 5I6NA 1PZ2A 4K7FA 2R29L 3T4YB 5IQ9A 3ZTJG 5M7QA 4M3JA 1PX3A 4IHBA 3I3EA 2Y06H 4MNQA 4XPFH 4HJIA 4HZLA 1DBKH 1MF2H 1BM7A 2X4UB 4HUCA 1Z9SB 3WHE1 1EAPB 2Q3ZA 4FFVD 3U4EA 5T5NF 1ZA6A 2NY6B 4F8OA 2XG5A 2J21A 1J8SA 3SE3C 4U1JA 3ECUA 4MA3A 2VCOA 4LSVL 2G0LA 2W1NA 4J4PA 1HDMA 4P2AA 5EUOE 1X7TA 3VFPA 5JXED 3TCLB 3VD4A 1KB5H 1DLHA 3OXSB 3KPMB 1Q1JL 1L0PA 4N0FA 1B9ZA 2D4FA 3JWOL 4KH2A 4GAJH 4F37K 2NLJB 3QS2A 1WS7A 3GSQB 4DKEH 1U3HA 5DJCA 3FSOA 3IS0X 1JZHA 3MLTA 3R06A 5EMYA 2FR4A 3EYUL 1HHGB 1YEWA 3EG9A 3GB7B 3WJLA 1JZ5A 3KXFE 4P2OC 3PABB 1RUKH 2IBBA 5DDHB 4UDUB 2QELA 4X7CC 5EZIH 3MLUH 5F7EH 3SDYH 3ZT5A 3B2PA 4GSXA 2DQCL 4JFHD 3ZDYE 4OLWL 4Q6KA 4H5SA 3LNIA 2V2WA 2X6CA 1E8ZA 4HKBA 4PS8A 5F9OL 2X87A 4OZGF 1VZIA 3RY6A 4ETQB 4F15C 5I0ZA 4I1NB 2IBGA 2OJZH 4JRYD 1ETZB 5BUPA 1MJJA 5IVNA 4XC3L 2ICWA 3FB5B 3PCYA 4U7SA 4M62L 3SKMB 3RKDD 1DQVA 2HRGA 3WOVA 1N18A 1KIRB 4AMXA 4BA0A 1XB6A 2ZF9A 3T1FB 4U1SB 1U36A 4P2YA 5GQBA 4EVNA 1WZ1L 3ZIMA 2WYTA 2EQDA 4GXVL 4PJAA 4D8OA 1OAZH 5BJTA 2ZKXA 5T1JA 4NKDB 1FBIL 4AX3A 1G9ML 4OLUL 5DJXA 1JD7A 4F33A 3F6IA 3UJTH 4G72B 2R2EA 1MXDA 4NXKA 2JI3A 4DWHA 4EE2A 2OV0A 3FCTB 1EHLH 4PVLA 5DRNA 4HIJB 4QRQB 4WU5B 5MI0B 3ZU8A 3IJHA 5BVPL 1MIML 4LGPB 2WINA 3QFJD 5HHOB 2CDGB 4I87A 5FUZH 3ISRA 3B9KC 5FF6A 1U21A 3QHZL 2HKFL 1V3KA 1DQJA 4E41D 1IL1B 1MWAL 3SJVE 4JLRB 1QASA 3C2SA 3ARBB 1PQZA 3ARUA 1G7HA 2OSYA 1CXHA 2JCCF 5K1JA 1G7LB 4DK5A 4J3OF 1CI5A 2J6EH 2BFVH 4E68A 4ZDHB 1E6OH 5GRWA 4JK0D 4HUXA 1HILA 3VD7A 2BW4A 5HSFA 4ZMQA 1OO2A 5J56B 4X5WB 3WE1A 2OR8A 4LCWE 1P7BA 3EF4A 3HI5H 3FZUC 1KN2L 4RNRB 2VJXA 1MN4A 1PZSA 4KXZH 4BFBD 1H19A 5DJ2A 2UZYB 1GTNA 1ROCA 3FQTA 4TTDC 2Q6WB 3N1GC 5B3JE 2XWEA 3INUL 2MRYA 3Q2NA 2A99A 2OXHA 3H3PH 5L2JB 3TESA 1JNNH 4N2IA 4UM9B 3GSOA 3O8XC 5F1SA 3RA7L 1O7DC 3WBDA 3WTUA 1GIGL 4HWUA 4LK4A 3EADA 1JFHA 2PKDA 5H4YA 3UTZA 3BYTA 5ELIA 5T1LA 5FB8B 2WCPA 2LFGA 1EEUA 2LFEA 1Q4NX 2Z7WA 3QUYA 4HZ1A 4ZMZA 2FH8A 4KK6C 3KVPA 1NGQH 2GUYA 3LKNB 5DK2A 2OM5A 4NO5B 3UMNA 5J4MA 2A9CA 1F0LA 4J3OH 2G3XA 1KTRL 2H1PH 3H7BA 5B1KA 2KBGA 4XXWA 2MWCA 5D7IB 5HYQA 3MRNB 4ZUVA 4HULB 4QCIA 4F7EB 1U8HA 3DC0A 2BY2A 2YK1H 3PJSA 1WT5A 3IGKA 2VLRB 3G6AA 4M48L 1FVEA 4I3SL 4MQ7B 1ADWA 1IKNC 4L0YA 5EUOF 1CJYA 1DFBL 2P24B 2X4PA 3BLBA 3QG6A 5TK4A 4QYOA 4G6AD 4JKPL 2AXFA 3V0DA 4LCIL 2AV1A 1EO8L 2EECA 1YNLH 2GY7B 5JHLA 1T20B 4DN3L 4FFVC 2J5LB 5C0AA 1N4XL 3KNBB 2VKWA 3TIEB 3L3DA 3S35X 1ASPA 3I9PA 2DJMA 2BZCA 2WZ5A 2VXQH 5JXEC 1CN4A 4TSBH 5HVFB 1ZSHA 3HPLA 4PLJD 2BDNL 2FQEA 2P8MB 1HCYA 4F58H 3OJMB 3FRUB 2ZSVB 1AAJA 4P5TD 3ZDYF 4N8CH 1CXEA 4P4KB 4Y16D 1GPOL 4QOKB 1YECH 1MCFA 1PLGH 2R1YB 4GG6E 4MDJA 5EA0H 1M6UA 4KXZI 4K55A 1SVBA 1KBKA 1YEJL 4HXBL 3EAKA 3VXUD 1M1SA 2KI6A 3K5RA 5FA4B 2EVHA 4KZCA 3ZRFC 3NCMA 4K7PL 3VXRE 2YARA 2F8VA 4OR1A 5BCAA 1MFUA 5I28A 1UJ3B 3QIWD 5DXWA 3STBA 1DUYB 3H2QA 5K5YA 3V8CA 1M7IB 3KPNA 3R7RA 1DL7L 2OL3A 3S5LA 3IYLW 2QSQA 4R4BA 5PAZA 5SWZB 4A68A 3ZZSA 1K3ZA 3CDCA 4H26B 3UTPD 2VXVL 5SV4A 3HB3B 3GSRA 2H0FA 3RKDC 2R0LH 5KVGE 2F53E 3CUPB 1CE1H 2XKNB 4JG0L 1TZHB 4I18A 4RFEB 3KGSA 4MJ6A 2G9KA 4DGIL 4YGAB 3WE6B 1AI1H 1SJXA 2Y7NA 4XVOA 2W9EL 2HN7A 4AWJC 1R5WB 4GUPB 1DSFL 4P3DB 3FDWA 4X4XA 1INDH 1NBVH 1KBGL 3GZOA 1UB5B 5IF0A 3HHSB 3ZDZF 4C58B 2MOGA 2P9RA 3MLZL 5JW5B 3Q5OA 5G5DB 5AOLA 4JDVB 4KTDH 3X13B 2VDLL 1A6PA 1XF5A 2AZAA 4KTYA 3OJDB 3EDJA 3LOWA 5LAXB 4PJDF 4PRPD 5DS8B 3TT3L 2I5YH 4WWKA 1FFOA 3WAKA 3CSYB 3JTTB 4B9IA 4Q2ZB 2BPBA 5AUMB 3MRBA 1MHPH 5EBLA 5I1JL 2G5BA 3BUPA 4PCYA 4MJ5B 2V8MA 4QY8A 4TYUA 4YEFA 4LPWA 4NQCD 3WHXA 5B1CA 2YAPA 4LP8A 4NP4H 1NICA 5L2KD 2RGSA 4XVJL 1OGAA 1LE5B 1S7SB 5HJDA 5IJDC 3K4AA 4P3CH 5CJXA 3VG9B 4FXGC 4OT1H 3MRRA 3HE6A 3P2TA 1DQTA 5GS1C 4TUUA 1S9VB 3BQUD 2L7EA 3B83A 4YHPA 4TOYL 1JZ3A 2H2SD 1V5JA 3LB6D 2MHAA 5DFTA 3NA9L 4DP0X 3QZBA 1A1OB 3L1EA 2Q7AA 2Y5TA 4M5SA 3N43F 1FCCA 4U6XA 4QHLA 5I1GL 3NBNA 3TBSA 2WXOA 5EEWA 3BQVA 1KGIA 1EXGA 2A83A 3VXSE 2HRPL 4L05A 3CHPA 5F97E 1A5FH 1SDDA 3EJCA 1RULH 1ZHLA 1MCHA 1ZLUH 2CLZB 4L0PB 3FT4A 5DHEA 2CO6B 1PF3A 2AABH 4YHZH 1MHEB 4LCWB 3LPGA 4TXVB 1OD9A 1MREH 4CA4A 4JQXA 2VDRL 2X3BA 1OIOA 3AT8A 2DTML 3CVCA 2UY6A 4YHOH 3GWJA 5CCGE 4XBGA 2YD4A 1C8QA 3PWNA 5AKSA 1FE8H 2P48B 4LHJB 5E8EA 2VXTH 3BFWA 4G6AC 1XGTA 4L29B 1ZANL 3GRBA 4MMYA 5I0VA 1IEAA 4BSVB 2IPTL 1HCFX 1Q1PA 1DN0B 1WVZA 2ORBL 2VRQA 3JV5A 5H37H 3CK0H 3IAQA 4QRSB 2B8OT 1CVRA 2OI9C 1JDCA 4BH7B 2FWLB 1DVQA 2L7UA 5J5EA 1SY6H 4FERA 3KPSE 3NJGA 4G8GE 4Z7NB 5DHVH 4GG6F 3FYEB 1TJGH 1PLBA 5I8EA 1B2WL 3ELQA 4PLJC 2XUWA 2WUCH 1QSEA 3K0YA 3N42F 2NSXA 3S5LG 3L3GA 2FT7A 5LDUA 1NFDA 2Z9TA 4P5TC 2Y7OA 5IHHA 2NY3C 4Y16C 1FYTA 4YUEL 5E9NA 5EEVA 2GT9B 5D5MF 1GJWA 2VERA 3B37A 4JKKA 4NUJB 2V17H 3PWJA 5SWSE 4K4KA 5T1DH 1LEKB 2V6HA 4ZFZA 4KQ3H 3WENA 3UP6A 3WYRA 4Y5YA 4QRFA 3FTXA 4LVHB 5D4HA 2ZXEB 4ZI8A 1J7VR 4L8CB 2O5ZH 3QIWC 1ACXA 3VD9A 5DJ6B 3WUWA 3NQIA 4W9EC 2H47C 4KI5E 3Q8EA 2E7LC 1T21A 5FKAB 5C08A 5IBUB 3QBTB 1OAUH 2Z0UA 3UZVA 3F58H 3JUZA 4D9QD 4AQ1C 4HUKB 3AMKA 4Y2DB 1A3LH 4L3AA 3UYPA 3L4WA 3VMPA 3KYOA 3MGTB 4PW3A 2YRBA 1AYOA 1RU9L 3P73B 1MCIA 4U1LA 3RZCB 3KWTA 3C8KB 1R75A 2HVKA 4BRJA 1GGCL 4C4KO 3VGFA 4NM4H 5B7FA 3BZEA 1CLYL 2YPVH 3BKYH 3X14B 1EAJA 3TP4A 1FIGL 5AB1A 5FO9A 4PGCA 4Z9KB 3VXRB 5HHQB 4HCGA 4WTQA 4F7PB 1FZOA 1YEIL 2C34A 1UM4H 4N28A 5KVGH 3ESOA 1EFXD 3F7YA 4MAUL 1J1XH 3W1ZA 4KX7A 3OM3B 4WVRA 1MCEA 4K07A 1ZVSB 2CZNA 4GEIA 5LBSA 4MXWL 5IMKB 5F9WC 1RUQH 4XPTH 1QR4A 3RVTD 2NXYB 1ACZA 5B39B 3WXVL 2FEJA 1THCA 3IVKB 2VN6A 4Y1TA 5EN2A 4F37F 5HVHC 4NAQA 1PJWA 4QXWA 3AVEA 5F3BA 3QCUH 3L3IA 4UT9H 2CDEB 4HJJL 5FO8A 2DQEL 1KPVA 1GAFL 1E8YA 4BDVB 3QCVL 4M02A 2EKSB 4JANA 5C07B 5IFHL 1P7QA 3KPLB 3UO8B 3SB3A 5CCKL 3TASA 3F62A 4ADJA 3K7UA 3QG7L 3MRJB 1S3RA 3GBNL 5GISH 3BQUC 4GBXD 2X1PA 2YAEA 3QWOB 3LB6C 5DJ0B 4AIEA 3Q5TA 5EEYA 5E5MA 3OAUL 4QTIH 5KVEE 4XBPB 1A21A 1EVUA 4KUZH 3WU1A 4NNPH 2AQ1A 1MEXH 1KPRB 2JIXD 3MLYL 3WFCH 3ZL4L 4J6RH 4PWIA 2C7UA 3AROA 3IDJA 1TJMA 3EJRA 2V5SA 4LNVA 2H6PB 1HJBC 1IIKA 2H32H 5I82A 4HWZA 1CF8L 1GRWA 2KDGA 2FJHB 5CJOL 2DYPD 3TXAA 1CDBA 3LRGA 1P9MA 4FQ1H 2XXMB 1JTPA 4KQ4L 3JWNC 5AB9A 2ESVD 5K1VA 1F00I 1IC7L 4E2OA 1HT6A 3LRLA 3UBGA 2ZWLT 4HIEB 2AEWA 2O1AA 2A9AA 4OLEA 2ZPKL 4MMXC 3NZHH 2H32B 4NIKB 4PTUB 5BUAA 4F7CA 1TTFA 3P3YA 4JHUA 4AVJA 4FLSA 3SEPA 3KHOA 1T0OA 3OPZL 5KSUB 4OGYH 1FGNH 2FX9H 3T2NH 2JJTC 4B3EA 3EOBB 3CXFA 1CZ8L 1IGYB 5J1TC 3U46A 2XZQL 1L3NA 1NMAL 4UV7H 5IB4B 1T6VN 2OBGA 3GO1H 4NSKA 3GBML 2PABA 3VXSB 5JYLA 3S36H 3U9PL 3QJQB 5DUBA 1QKZH 4PLKD 3WUWG 3NSDA 3RGVA 3S3SA 4G9FD 2XIDA 1QBMH 5HVGB 1IE5A 4EIUA 1G0XA 2V33A 1XF4B 3F7LA 4Y4HA 2CXKA 4QEGA 5IK3B 3QO1B 4LLQA 1WYJA 3RJQB 2QVMA 1MAML 1EDHA 2PCPB 3ZXAC 2ITDB 3BVUA 2D7PA 5KJRL 5HY9B 2YKKA 1YJDL 4EIGB 2R1WA 2Y07H 3NACH 4JFEB 5ADPL 1G0YR 4FLRA 2CBQA 5FM5O 2DM7A 1MI5B 3ZR6A 2UY7A 1JPST 1NKOA 1A65A 1A1MA 4HK0B 3MUHL 4WJ5B 1JZ4A 5E99L 4LPXA 3IXAB 2ZXAA 4N8UA 5HDWA 1UD5A 2BNQE 2HAZA 3QUZD 4LU5L 1B4TA 3H9HA 2FO1A 4GG8B 3RWJB 3FO2B 3MNZB 5AYTA 2EH7H 3FHQA 1A3RH 1MFBL 5BQ7B 3MRPA 5ERWA 3D7PA 3GM0A 3P30H 5L8LB 3BP5B 1G1YA 4AT6A 5GJTH 1I1YA 4PJ8C 5IGXH 4RETB 4HMCA 1IFHH 3GXNA 3SE4C 3QEUA 4YDKL 5SWSB 3W11D 1DFXA 3Q1SL 1ITBB 3MRIA 2A4CA 5C1MB 3M17B 3K2KA 1K72A 2FJSA 1N67A 3E9UA 3QDJE 1KJVB 2WJ5A 4JM4L 1SVZA 1CDCA 1NMBH 3HFML 1S7VA 5L0QB 1AD9B 1SN0A 2VSDA 3DMMB 3I75B 4Q74A 3G5XA 4PG9B 4L3EE 3NRQA 4U1HA 3HFFA 4OB5H 4ZMOA 4G9DA 1OAKL 5DQJA 3GXPA 4HQQL 1Q72L 4R0LB 3DRTB 5EU5B 3RVTC 4NBXB 4DO4A 5B8CC 5F0JB 2FBOJ 4EIZC 4WF7A 1BPVA 3AG1B 5E6ZA 2B77A 5DUPH 3BUIA 1A9BA 4EZMA 3QEQE 1SEBA 2FT6A 1URLA 1D5BB 2FATH 3IFOB 5HHNA 1S78D 4GFTB 2G60H 5GGRA 3REVA 1A7QH 3EF7A 3TH3T 4MNQD 3P2BA 2DEYX 4O2EB 3MLWL 3MUGA 5I6MA 5HDQL 3DX0A 1IM3A 4YDMA 1MCJA 2QVFB 4X8GA 4GBXC 3APFA 4JDTH 1JGIA 2JB5L 3CDFA 3GD1C 5E4OA 5JQ6H 4OZFA 4Z7VB 4J4PD 3QNFA 3NDYE 4AG4H 5GS0L 3FCBA 4LF3A 3EGSA 3B7YA 4I4WA 1IGJA 1NC4A 1I8UA 2BY0A 5HHVH 2G75A 1VIWA 2B4CL 4ZODA 3QORB 1GS6X 1EEZB 1F4YL 2GUOB 4H7VA 3O3EB 3RHWK 5CMAA 4F2ME 4LPUA 2NY2D 3H3KA 2C5DC 1ZIBA 2O6EA 3GJEA 2R69A 5KS9E 3MMEB 1EQWA 2A2QT 4K5OA 5CCJA 2BIQA 1ZTMA 5ID0B 1JF1A 4QI3A 1C08A 3PHAA 3UAEA 3E0GA 4OIFA 1MAKA 4KAQL 3K71A 5IVZB 3DVNB 5KVEH 3Q06A 2XKSA 1C12B 3GZQA 1PZCA 2WTOA 1CL7H 1T5XA 4X9IA 1X7QA 3AREC 3CBRA 3F7PC 2E9IA 2ZYSA 4NZDA 4XPBL 2NNAB 5ETUB 1IAMA 2BRRL 1JNLL 2GJRA 4P0DA 5GSVB 5T3ZE 3S2CA 5CD3B 3HI1A 2MPAH 3WG7B 3N1FC 5LQBL 3W5NA 2BMKB 2VDKL 4K73A 4LE8A 4PGEA 5CEYA 2SEBB 3HPJB 3O4OB 3CN0A 4HIPA 1ZHNB 4B53A 4PLKC 4UQAA 3I50L 1A7NL 4ZOCA 3TBBA 3ZTNH 3NSXA 5FOBB 3I9GL 3SN6N 4L8SA 1TCRB 4Z3EA 1KIUA 3ZUCA 3KLSA 3BAJA 3VI4B 2ZJSL 3GJFK 2YBRA 2X1XR 1D9KA 2ZAIA 12E8H 2PW2A 3PWPA 4ZPVA 1KYOJ 3LHPL 5BOPA 1KCKA 4LRIC 1NLBH 4YSAA 5IB3B 3WIFA 1QLFA 2CO4A 1ET7A 1AGCB 1HZKA 1XIWA 1WISA 3MV7E 1U8KB 3TCTA 1UWGL 1R3JB 5MERA 2APBA 5CSGA 4PB9H 1A6AB 5KYWA 3NABH 2VMFA 2DWEA 1ZGLB 2EXYD 5AW9B 4XP4L 2NW2B 3QUZC 4X6CA 2PO6D 5LKNA 4ZTEA 4G8IA 4XO5A 2DKMA 3C6LA 3CMGA 4UOW0 4JRWA 1F6AA 4L2YA 3WS6A 1QWHA 1SGKA 3MV9B 4X80H 2P49B 4JGMA 1WS8A 1RV6X 4YK4B 1JGEA 5JHDA 2Z91A 4AVIA 2F68X 3HMXL 4FFZL 4BUGA 4NRZB 4HXAL 2I9TA 3W11C 4ONOA 2OMTB 3VSTA 2P43B 3TV3H 1CL7I 1ID5I 1I1FB 2HTKD 1PZDA 5AW3B 5T1LD 3UTQB 3QUYD 2QADD 3KS0J 4ELME 3QXUA 3GSUB 5ICYB 3QWNA 4TKWA 3HMWL 4TVSa 1AZRA 3WXWH 2LVCA 3ECWA 3BP7B 2ICEB 2UYLB 4I77L 4O02H 5JA9A 2A77L 2DQFA 2IVFC 5CJBA 2MQ0A 2C3VA 4KZEH 3BGFC 1CR9H 3L5WB 4AVHA 3O6FA 2BNQB 3KH4A 3CH1A 4OM1H 2VH5H 4HT1H 2I27N 3UYRL 1A7RH 1QWNA 2VQTA 3RWIB 5C0FA 4OZFG 4M6NL 3FTWA 4ODVH 4JRXE 5C0GB 4KOCA 2HJFA 5F96L 1Q9LB 5I6PA 4IMLB 4TUKH 4YO0B 5IVOA 1KLUA 3D5OF 2GSMB 3LNHA 1S78C 2CBMA 1G87A 1BJ1J 1QHOA 3LQAH 3T5WA 1HH9A 1NBCA 3LDBB 1MJ8L 2YLKA 4TL4A 2WNWA 4PJ9B 4RZCB 2ZUXA 3SKOB 1JTTA 4LSSL 5C0AD 5C0DB 3O0RL 1FNGB 2BSEA 1URIA 1UOVA 3FSWA 3MN8A 3UPRB 4ZFFB 3AWEA 2IBZX 4J4PC 5KS9F 5MEOA 2L0DA 3FT3A 2DI8A 4ZTOL 4OQTA 1CMOA 2ZNWA 5E4EC 4B27A 2XWZA 1CD0A 1DTUA 1LEGA 3DO7B 2H41A 3N9GL 2P5WE 1LNUB 3TBVA 5KVDE 2IFFH 5TPWL 2NY1D 1U3HC 5BVJA 3KYKL 2R51A 3HC3L 4NOBA 1AD0B 4QT5B 4Z3TA 1F8TL 3MGOA 3QEQB 3WLWD 3PJNA 4NZUL 3WJLC 3T0AA 3OKLA 3D2UB 1WDAA 1E9PB 3CVHA 1MHCB 2V5YA 3L5XL 3PNWA 3QNYB 4NO2A 1IQWL 3WUZA 3JZYA 4GQQA 1R46A 4HPOH 5AW1B 5KSVA 3WTVA 2ZNXA 2Q7YA 4J3WA 4U0RC 5EC1B 4E9VA 2PTTB 1F3JA 1WUZA 1IGIH 3KS0H 4GSUA 4ZAKB 3RUGA 3UGUA 1JI1A 1SUJA 3RY6C 4W9FC 5DF0A 5E2TH 4JQIH 5KYYB 2Z4QA 1D5MA 1QRNE 1R33A 1SLWA 2VZSA 3QJRB 4HC1L 3GMMB 1KT2A 4S1RL 2B1OA 4AIZB 3BW9B 3RB5A 4BWTA 5KSBE 4U6VL 3S97C 3P4MB 5DRWB 1EFQA 3BISA 1KJMB 1XL4A 2Z31B 4BV1A 2XWJA 3ETBJ 4ABQA 1ANUA 4WY7L 2F0CA 3QUXB 3HBPA 1X44A 4NWUH 4JM2B 1BJ1H 1GGBH 2BK8A 2XX0A 3BSZA 3KHQA 4BIKA 5C92A 1R3KB 3X3GL 1JIBA 2OMVA 5DD5H 1CXIA 2BSSB 2IH1A 5A16B 1UB6B 3GHPA 5CP3A 1GVIA 3RWEB 4I5BA 4R97B 4F3FA 5LGJB 3S8FB 2CA3A 4JDEA 5T3ZH 4M7LL 1RJZA 3IMRA 3MODH 4R26L 1CG9A 2AS5M 3QJHB 2EADA 3L8QA 5GJSH 3D25A 1RK1A 1PNDA 3HLAA 3KPQA 4WWKD 3ZUNC 2DQDH 2B1HL 3ETBF 3BFQG 3MYJB 1MCLA 3UL4A 3IETA 3QI9A 1NANH 4UU9A 5EORL 2LTQB 1BCIA 2ZIDA 3KLDA 5J06A 1ZWIB 1JDDA 1RUML 2CGYA 2EXYC 1LDPH 3RI5F 5IJBC 3SPIA 5HI3D 1OGAD 3BZFB 4ZOBA 1UA7A 1Y6KR 5FO7A 3QQ4A 3DBSA 1FJ1B 1QAWA 2YQ3A 3ZHDA 1O9WA 1P4IL 4ODTH 3OSVA 4ELMF 5C09A 3HE6D 4BQ8A 4B9YA 4G7YH 1HCVA 2EYSB 4XVUD 2YD2A 3OV6A 4RWYH 1CDGA 1OB1A 3BPNB 3KWWA 3K6SB 1U95B 1RIHH 2CKBL 2YMXH 4R7NB 4HCRL 1HVXA 4WI4A 2HTKC 5IUCA 5ISZE 3QUYC 2QADC 2F8IA 5AVQB 3B2MA 4HUMB 4AYID 5IMOB 3L4YA 3NP4A 4EI5B 5T1KA 1KGCE 1Z66A 2ZWYA 3WY4A 1K4CA 2AQTA 3TBWB 3UERA 4CRPA 1UZ6E 4QKTA 4QAWA 4X8JB 4JFSA 2FLRT 4P49A 4XXWC 1PDKB 3O2VL 4GI6A 5JOEA 3DA0A 3LEVH 4K5LA 1EEYB 3VACA 4L4VA 4G7QB 2HT3D 1W91A 1A6VH 3RL2B 4UWQB 5K69A 1E43A 2WW8A 1WT5C 2BNUB 3DXAB 3IU3B 5D1QA 3STZA 4K3DL 4ZNEE 3UEZA 3WN6A 1CGXA 3U4KA 4PJHA 5I8OH 2OMYB 1V10A 4XP5L 5ABAA 4YAQA 3TIDB 1PJ9A 4XPGH 5D6DA 1J18A 1OKEA 4A38A 2YN3A 1GTFA 4EBQL 4NQXB 4FEIA 1E2ZA 1GR7A 1GZPA 4KK9D 4A7VA 1Z3GH 1P84J 3D6GA 1QFUH 2WYZA 4KKBD 2DMBA 3JYBA 4LSTL 1WA0X 2CGZA 4GINA 3Q8BA 5MEQA 2IANA 2PCFB 2IDQA 4PRBA 2OLDA 1QSED 1LK2A 2DKSA 2OX5B 1NFIB 3ZE0E 1EDYA 43CAB 3ZMEA 2NY1C 4HWNA 3HZ3A 4JRXB 4M8UA 4WTZA 1A2YB 3LMJH 3LSOB 2N59A 4J12A 3WLWC 1VCBC 3VWKB 3FU7B 3AB0B 1LP9A 4QJ4B 1WFNA 1NBQA 2HX9A 4XNYH 2I60H 3L9RA 4PS7A 2GCYB 2D7QA 2DLIA 1X7SA 3IN2A 4CW1A 4M4RA 1WZLA 5KSBF 3AADB 1RHHA 1TZ8A 3B3BA 1HHKA 3CDGB 3M1OA 5I30H 2QPSA 2WXJA 5E6SB 1WBXA 4IDJL 5CHNA 3BKJH 3FPYA 3P1VA 5DR5L 5KVDH 2R29H 3T2LA 4KOBA 4LMQE 5JIPA 4YGVB 3T9WA 2ZWZA 1C16B 3HRPA 4IM8A 3TPUA 2OR9L 3I6KA 1J05A 5D7SL 4RQQA 1G5AA 3LTVA 5D7LE 2PYFB 4I18C 4NRXA 4GS7C 5TDOA 1Q0XL 3PIQB 2A6IB 4MAYB 2YEVB 2ZUUA 3OQ3B 4G8EA 4NN5B 3E3QC 1UM6L 4H40A 4E9QA 4YIQB 5D1XA 2DLHA 4JFOB 4NI6A 1TTAA 2AQQA 2UXVA 1Z3RA 1O6VA 3JWOH 1CICB 1H6TA 3FQRB 3MREB 4WU7B 2G2PA 4AENA 4PW9A 2YPLE 1PCSA 5BRZB 1AP2A 4IGBB 3COOA 1D7CA 1KB5A 2Y23A 2YD1A 3EYUH 2RIKA 1HH6B 3ET9F 3D3VA 1QRNB 5GRYA 3P4NA 4PJCE 4WWKC 2XN1A 3GIZL 1LWHA 4WFFE 1DJGA 4O51B 4AL8C 2DQCH 3FAWA 4RSYA 4X9HA 3F65A 3LNGA 4OF8A 1J0IA 2CPUA 4PJEE 1JVKA 3RHWF 3NK3A 2IEPA 3P0GB 2W38A 3AU0A 4MQTB 5HGDA 1ND0A 3OKDB 1KYFA 4TRPL 5HI3C 3I3DA 4XC3H 5DCCA 5E0FA 3WGUB 4M62H 5CJXC 1FRGL 1P7QD 1L9MA 3HE6C 5I6XC 1LK3L 2GITB 1Z2KA 1MSPA 4U6HA 2E8ZA 3NJKA 3N5AA 5DEZA 5I17B 2CCVA 1K8IA 1WZ1H 4GXVH 5IIEA 4PWKA 4QRTB 3MJGX 3BD3A 1FBIH 1G9MH 4OLUH 1UZ6F 1IEBA 4XXCA 4TVPH 1FNEA 1ES0B 3DIDA 4F2FA 1YG9A 2F8XC 5J13B 2FHFA 4J3VA 4CSPA 2VAAB 1MIMH 3U9UB 3I6LD 4KUCF 4GAYB 4HU8A 3AXIA 3KW8A 4GRLC 4AM0B 1AG0A 3C5ZA 2EDOA 3DV4A 3QHZH 5E23A 1IL1A 4LCCA 4BK5A 4N2EA 4PJXE 3HKZA 2AFNA 1G84A 5TF0A 2W07A 4UV4L 3SQBB 2XWBA 2K0RA 4JQXC 4OZGA 4WNJA 4BSWA 4OJYA 3CFQA 4GRWF 3DSFL 3AW5A 1ZHKA 2DZEA 4Q9CA 5SWQB 2UVEA 4R9HA 1J88A 2DKUA 2VB5A 2X5PA 2X7LA 3O11B 1QEXA 4D0CB 4WTZG 3GIVB 5E08L 1RZJL 1KN2H 1MWAB 3MNWA 5ISZB 3GUTA 5D2NB 2YPKB 3GNML 4KK9C 1SNRA 7TAAA 4JY4B 4QXVA 1QR1B 3B7UX 3KD4A 3ABKB 3BD4A 4KKBC 1GOGA 2MNWA 3VVWA 1KIQA 1X5MA 4HEPA 3RA7H 5I9QB 1GIGH 1WD8A 3RGVD 4UT6L 5KYNA 2XPGB 4OI7A 1XF2B 1DO5A 1VKXA 3U0PA 1T80A 4Y4HD 4DPRA 5FDYA 1R24A 1MNNA 1CFNB 3PPSA 2WY3B 3UG5A 5I0XA 1ZAGA 5CJ8A 4PJBE 3TBYB 4IKJA 4NNXB 2XV2A 3LZPA 4GW5B 1DVFB 3GJFH 4Y5YC 1UJTA 1U92A 1A6UL 3QRGL 2HVBA 4PI2A 1QOKA 1CBJA 1JV5B 3KCPB 4PWFA 1VFAA 4X50A 3WHE0 2KS0A 2BCKB 4NN7C 4R7VA 1WITA 5TDPB 4OGQC 2UX7A 3L9EA 2JCCA 4DP1X 3D34A 4N2DA 1GS7A 2XG4A 1F4WL 4XN7A 1E6JL 4M48H 2X9ZA 1DR9A 4I3SH 3EIFA 3S6CA 5FOJA 4AIOA 1DFBH 1T1WB 3L3OA 4JKPH 2JK5A 1PZ3A 1MJUL 1PEWA 4LCIH 1N64L 1EJOL 2WVUA 1EO8H 3PDOA 4K8RL 5DT1L 1I7RB 4DN3H 4G3YL 4M93C 3VGGA 3ZE0B 1N4XH 4ADGA 3SGJA 1S7UB 2XWTB 4R7XA 5MENB 2E56A 4AV0A 1NLDL 3O41A 2HKHL 5IW6B 3IAGC 3GXDA 1FH2A 4IJ3C 2BDNH 4N1HB 5L7XL 4QTFA 4PJCF 1M7DB 3SGDH 3H7LA 1GPOH 1U8IB 3ZPDA 2C3XA 5GGSY 2D7NA 5C0EA 2F1EA 4JRLA 5T5NG 3UZQA 1YEJH 1LLAA 3OKYA 3QZPA 3FN3A 4HXBH 4J3XA 2CO7B 5K39A 1DE4B 4LP4A 2IPUG 1PKQE 4PBDA 4A7GF 3IPFA 4K7PH 4JVUA 1YSOA 2OXGA 2YXVA 4JZNB 4WEUD 1RK0B 3SO3B 1YPZE 1B0GB 1NSNL 3UZEA 4DUXA 3SGKA 5EUOA 2ZUYA 3WIHL 1MRCL 3EJYD 4LKXA 4ZD3L 2VXVH 3C8HA 3EYVB 4PJFF 4OJDH 5F7DA 5EWIL 4M7LT 1IAII 4M29A 1IM3D 5I1KH 5T3XL 1FHNA 4JFYA 1OD7A 4JG0H 4U49A 4ODUB 3NGBB 2QVKA 2W9EH 3A5VA 5ICUA 1PIFA 1DSFH 3KM2A 3KXFA 3LN4A 3V5KB 3WJMA 3T3MB 3DBXB 2ZOOA 1NC4D 4R96A 1KBGH 1YN6A 3N06B 3EZ8A 3FB6B 5AYQA 3DOSB 3MUY1 2VZTA 3EYSL 5CXPA 4M8QB 3MLZH 3OD3A 4WW1A 4M8VA 2MEJB 4AYFA 1EZLA 5BS0E 2R2HB 4OF7A 4PJEB 2V0AA 1SEQL 2VDLH 4N8PA 4JO1L 3SYOA 1B0RB 3NJJA 5D96B 1UYWH 2F7PA 3BX7C 2I7OA 2E76C 5DTFA 4IRSB 25C8L 3MX0A 4XNBA 2K78A 4Q2ZA 4DAGL 2XI9A 2WSDA 4DVBA 1Z5YD 1P9MC 2W0PA 2P8LB 4DKTA 2DQTL 5I1JH 3F7KA 5F21B 1MDAA 1FG2B 4HEPG 1C5BL 5DGRA 4FLQA 2VDLB 4CVZB 4MMZB 4CU7A 3UTTB 4LMQI 5AALA 4FKKA 1IGTB 2DLFL 4KXAA 3UJJL 3L7FB 1IFRA 4JM2D 4P5KA 3S3JA 4U1IA 1I1CA 1KLGA 1OP4A 2BNRE 1QFWM 2E8YA 1OSYA 4WO4A 2WKGA 4X7TA 1GCYA 4JFDA 5HI5D 2DQUL 5FGCB 2QGCA 2A7BA 1N5YL 2AANA 1TMCB 5I76B 2K8MA 2DQ6A 4TOYH 3N55A 5H4ZA 3MLVL 3C5JA 1EJFA 4XC1H 3AT0A 3NA9H 1LEIA 4FZEL 3T4AA 1RMFL 3RGVC 3V6OE 1MFDL 2IOIA 4J3OG 3D0VA 4AGQA 5I1GH 4G7VL 1Y6NR 1F6LL 1UD3A 3SJVA 4JHVA 4Y4HC 5TE6L 4PJXB 5JDSA 3F6LA 2XN2A 2HRPH 1D9KD 3FF8A 1MH5A 4UQ2B 5GGQL 2DW5A 4AQOA 1AYRA 1CDUA 4PJDA 5LUMA 3X3FL 3MLXL 1P5VA 1MIEL 3G5ZB 4U1NA 1SYVA 2ZKHL 3E1ZA 4FNUA 2E5EA 4Q9RL 2W95A 5A2AA 1S7XB 5I15L 2VDRH 2WMPB 5AD0A 4A2LA 2DTMH 2VL4A 3L1GA 4H1LB 2FB4L 2AV7A 1T0MA 1MLCA 2FSDA 3PGFL 3B5TA 3HZVB 1T1XA 1TOXA 2X6BA 5LN8A 1T7VA 2H9GB 1TFHA 4LPTA 4N6QA 1ZANH 2E75C 3C6LD 4N0RA 4XPAL 1UQSA 2K70A 4WEMB 4FQPA 2IPTH 1TJIL 3T08A 2VM4A 3WTWA 2ORBH 1U3ZA 4WKZB 3FTGB 3VFVB 1UASA