4L15A

Crystal structure of figl-1 aaa domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
298
Chain Sequence
RAEPTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSSHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fidgetin-like protein 1
publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 95
structure length 298
sequence length 303
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l15A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l15A01
2FA9A 2ZJOA 3AVQA 3BXZA 2ZU6A 1KK3A 1Z29A 1GNQA 1P73A 4HLDA 5AR1A 3KQUA 1PZNA 4XWAA 3H84A 1ZUIA 1AGRA 1U2RA 4HYYA 1SVSA 3TQCA 2BCGY 2Q3MA 2AR7A 5HTKA 4YXWD 5GADl 4DCUA 1P2VA 1VCNA 2FPMA 4B3XA 2FH5B 2WJIA 2ZYTX 3K70B 4BEBA 4RD0A 1F2TA 4V03A 3MMPA 4OBEA 2FF7A 1AS2A 3CONA 4B71A 3D8BA 1GP2A 2VP4A 5EE0A 3LA6A 4LYFA 5DO9A 3ZD6A 1G7TA 2GWHA 4KJZA 4FWDA 1P60A 4Q4JB 5F98A 2JASA 2OCPA 3AVOA 2CHVA 4HDOB 3KQNA 3DM9B 1WB9A 4P0TA 5SZKB 3BORA 4QL3A 3QKUA 2EYUA 2W00A 1ZUNB 1MABB 2E1RA 4B3FX 1SKYB 3SYLA 3SYNA 2BWJA 3PENA 1RYFA 2ZSEA 3TLXA 4IOLA 5C18A 4JLMA 2E9SA 1LFDB 3WP0A 3TIFA 1WP9A 1QDEA 2W0MA 1N6HA 3W3ZB 3KKNA 3R20A 2XXAA 2ZI9A 4RFSB 2WOJA 1E96A 2C8VA 4ITRC 1L4UA 2WICA 1I2DA 5FBVB 1TX4B 1D5CA 3UMFA 3B9QA 1S3GA 5TVKA 1T8TA 4U7DA 4PHTA 1T9HA 2J5XA 2ODNA 2KE5A 4B2LA 1D2EA 1BYIA 1II0A 2LKDA 4FMCB 2ZITA 4LYHA 4J0QA 1ZAKA 3MWJA 3FFAA 3NBYC 1W0JD 4CEHA 2GDJA 4ASUA 4HUTA 1NNEA 2VP0A 2WMOB 3NVAA 4U00A 1KHTA 1OFTA 1XXHB 2J59A 3BH0A 4R98A 5AJVB 1R2QA 3I8SA 4A9AA 3J81k 1GL7A 4DLXA 2MSDB 4CGZA 1P2TA 3B7GA 2PH1A 3VR4A 4YQFA 1XD2B 4P4TA 1X37A 3GJ4A 4M8NE 4LY6A 5M04A 5FBQB 4OI4A 4YXWA 1YE8A 1R7RA 4QGAA 1EWQA 2J45A 1FW6A 1UM8A 2YHSA 3U5ZB 3A37A 4HZUB 1NVVR 2ZRHA 5DHAA 521PA 4R71A 2IXEA 1QRAA 2OFWA 1N0WA 2OZEA 2ZR9A 4B43A 1BIFA 4OHYA 3ONWA 3DOEA 3NKVA 1RZ3A 2D2FA 5SZIA 2ZI6A 5J4HA 3F5FA 4LRWA 1AQYA 2J0UB 4GZMA 2QAJA 3M1IA 3RS0A 5HCNA 4DLRA 5KDDA 5LD2C 1S9HA 1RJ9A 2ZREA 3CRW1 2CVFA 3OIWA 2V1UA 4LBWA 1CBUA 3LQRA 4MRVA 4WZAE 1VHTA 1IM2A 2CLSA 3GD7A 2IUUA 4ZI3A 1RRCA 3I8XA 3AP2A 3U7EB 3VLFB 1HA3A 4M21A 5FBRB 4TZ6A 3K0AB 2BBOA 3X2SA 2EWWA 2QMOA 2A9KA 3I72A 1LY1A 5J4VA 3U2QA 1W36D 2X8AA 1XMVA 3GLHE 4EFLA 2GAOA 5K8LA 4PC2A 2XZLA 1AQUA 4DC9A 2AFHE 1FP7A 5L3SA 3THYB 4A0GA 4QGFA 3ADCA 3L8YA 2A5JA 4JL5A 1Q44A 1RRGA 4UJ3A 5KSYA 3IHLA 1CIPA 2C9OA 3QJYA 1VHLA 4JL6A 2CK3D 2YOFA 4AYWA 3FGNA 3VU9A 4AD8A 5F9HA 3CX8A 5CDFA 1YKSA 5GVRA 2GBLC 2BCJQ 1G19A 1SULA 4G01B 1OIXA 4O3MA 5LBIA 1LF5A 1US8A 5TXGA 4LI0A 3AVTA 2DWOA 1COWA 4C7OB 4GZLA 4LPSA 3B1VA 4BLSA 3K0FA 4MRRA 1Z0AA 4B3BA 4BFSA 3Q72A 1E9EA 2FPLA 2IK8A 2ODBA 2WZQA 3MLEA 4PTLA 4UNRA 4KITB 1IN8A 2R6FA 2GESA 3JVUA 1NIPA 2C78A 2QBYA 3REGA 3IEVA 4LJ9A 5DHFA 3ZDQA 4M1OA 1ONBA 2C04A 4OQNA 1U0JA 3QXHA 4NBSA 4AIIA 1R4AA 2AWOA 2DPXA 2JJ8A 3F3YA 5JI3E 3ECCA 3OE7D 4LSGA 1E2LA 2XNDA 3QE0A 5KU1A 4DDWA 2VP2A 2JLVA 3QVUA 1G21E 1HT2E 2DFLA 2WWGA 3CWZA 1S4QA 4TL9A 4AKHA 3D6TB 1G17A 4BFVA 2W6JD 2CCGA 2WWHA 4I1VA 1P5ZB 2ZAOA 2VH5R 4Q9JA 1QHSA 4KFTA 5D3QA 2J46A 5FBWB 1NG9A 2F3RA 4ZI2A 3W34A 5C46F 2F1RA 4S2EA 1VG8A 4Q48A 3UG6A 5EE1A 1G64A 4EQ6A 2VHCA 4Q9KA 3L82B 3RRNA 6Q21A 1XMJA 5BWMA 1HT1E 5FOSA 5FH9A 2WKRA 3PEUA 2C99A 5HE8A 2GILA 3GLIA 3KFXA 3FWYA 4URWR 1NVXQ 1ZVQA 1P4SA 2GETA 2HEIA 4N0DA 1E79A 1M1YE 4C0JA 3SJCA 3AKYA 1A2KC 4NCIA 4PC7A 2C96A 1GTVA 4C0SA 4UQOA 4RZXA 1CRPA 4TYQA 2RKOA 3M0EA 1OH6A 4FXPA 2FEMA 2CK3A 2REXB 5AWFC 1ZD9A 3SI7A 3UK6A 2EFGA 2NQ2C 4IOMA 4Q00A 4GMDA 3OIVA 4RFVA 3KKPA 4EFMA 3FOZA 3U4QB 2IS4A 4QHTA 3A1SA 4AKIA 3CNOA 1NMZA 1QG4A 1IXZA 2D74A 1II8A 5F2EA 3IHWA 2PZEA 1P62B 5JHGB 1BOFA 3FYHA 1VYVA 3FDIA 4OQFA 4QGGA 1F5NA 4CW7A 2PJRA 4PPFA 2P6UA 4QFMA 2QTFA 4NZYA 3LXRA 2ZS7A 1RPZA 5DN6D 3LAWA 4Q4AB 4DT1A 3OE7A 1E69A 2KBFA 2DBYA 1XJQA 3ZIAD 1HQYE 1T5LA 2P3SA 1TEVA 2BEJA 3HP1A 1FNNA 4G0NA 5CK4A 3MG9A 5FPHA 4OI0A 1G3QA 2QP9X 2W6JA 1KY3A 4RZ3A 2WPDA 2WWYA 4MRNA 1XJ0A 1S0UA 2ZJAA 4TQUS 3SYKA 1JQLB 3U7GA 1QVAA 1YZNA 1X1RA 3BB3A 3EC1A 3P27A 3UWKA 4AKEA 1ZM9A 1HH4A 3IBYA 2IA5A 5BYKA 1VCIA 4M9QA 2A2ZA 1C1YA 2ZRJA 4ERNA 3REFA 4LHXA 4BRWA 2XTNA 1E9RA 1GILA 1XP8A 1E9SA 2IWRA 1ZC4A 5ELXA 3AP1A 4QBGB 4UNSA 1IN6A 3QVVA 1QVRA 3KQHA 1A1VA 3AKCA 3ZYCA 1M8PA 3L0IB 3OIYA 1MOZA 2P6NA 4PPNA 1KTVA 1DBSA 2W0SA 4ARZB 1B23P 1XD8A 1PUIA 1UJ2A 1EFUA 2O0KA 1W5TA 4IFEA 2RCNA 5H8WA 1L4YA 1NN3A 3GJ6A 4TQAA 1KI7A 5G3ZA 3V4RA 2F9LA 2YWGA 3AP3A 2PCJA 4P33A 1ZM7A 1GL6A 4IEEA 3IPYA 2BHRA 4RKFA 2JIZD 2GJ8A 1D9ZA 4M1YA 1KMQA 4NYJQ 4WW0A 1U8AA 1OXVA 3Q7QA 2IHYA 2A7QA 2A30A 1JXOA 2A5YB 1QG2A 4NL4H 2DFKB 3OIUA 1UAAA 2Z43A 4CEIA 4RSGA 1LW7A 4JKIA 3B1WA 1OFIA 1N3BA 4NDZA 2GTPA 2ZVQX 4ZIRA 4OI2A 1ZM3A 1EX7A 4C0LA 2P0EA 1KO1A 3D3QA 4X8LA 2ZJYA 3AUYA 2PT7A 2OHFA 2ZPTX 1C1KA 3CX7A 3H1TA 4DSTA 4BE7B 5FPSA 1KO5A 1F2TB 1NP6A 2FNAA 3QBVA 4Q03A 4TZ0A 2BKEA 3Q7PA 4EPTA 3Q9LA 1KJZA 3U6KA 3AJIB 4GOXA 4F92B 4MDEA 5EP3A 1R0WA 4CVNA 1FQJA 2JGNA 2OCYC 1SXJE 4FCVA 1R5NA 1W46A 2FZ4A 2GK7A 2VLIA 3VKHA 3EC2A 2BM1A 4JYBA 4WBSA 1G7CA 3GP8A 4JN6A 4MYCA 1G16A 2DB3A 3RS5A 1C9KA 2H18A 1JR3E 2QPTA 4LK2A 4OJKA 4MYTA 3BD9A 4A82A 2ZSDA 1GNRA 1NF3A 2XXAB 3MWLA 5AJYA 3CF0A 3DDCA 2D7CA 2JJ1A 5TARA 2QY9A 3K9LA 1G6OA 4QM7A 2GKSA 2ZIAA 5L3QA 3EXAA 1OH5A 2QNRA 1KY2A 3QF7A 2CDNA 3JZAA 1DAIA 4DLSA 4DHEA 5CIWA 3GLFE 3B9PA 4Z1MD 3GFPA 2QUZA 2JIZA 1M74A 4D4LA 3DL0A 4G5OA 4XD7A 3VKWA 3W5IA 2WWIA 2HCJB 3SDZA 1P61B 1OIVA 4DCVA 1VYTA 1GDDA 2ERXA 2YWHA 3Q8XB 5TV2A 1G8PA 1VCOA 3I3SR 4MUBA 4KVAA 2VF8A 2ANCA 1J99A 1RFLA 2V1XA 4A8JA 1KIMA 2GZDA 2HJGA 1V43A 4QRHA 2ZE8A 5BQ5A 1XTQA 3LBHA 1FMLA 1YU9A 4QJ4A 2V3CC 1IY1A 1RYHA 4DZZA 2HV8A 3T1VA 3H4MA 2BEKA 4Q47A 2EQBA 1GRRA 2ASEA 5JWHA 4IOJA 3AVXA 2I1QA 1NSTA 2OV2A 4ESVA 3C15C 4DB4A 2KWIA 2AXNA 3A58B 4TLAA 1XCPA 2GEUA 3UATA 4QBFA 1RJ9B 4JVNA 1U8ZA 2ZJBA 3U3KA 2H16A 1XU4A 2YOHA 1ZYUA 2G0TA 2ZSFA 4C2UA 3U44A 3LX5A 3K0AA 1VG1A 4DLZA 2BMEA 3AEZA 3HYRA 1TUEA 2XAUA 1R6BX 4MRSA 4TTQA 4FMCF 5DGXA 5B58C 3DVLA 2OLJA 1JECA 1Z6TA 1WA5A 3AV0B 2R65A 5B57C 1N0VC 3OEED 2V4ZA 3VHLB 3H2YA 1EFCA 2J7KA 3MAAC 4HAXA 2REOA 3I32A 4Q9LA 2F1IA 5GVSA 5L3SB 3A36A 1NN1A 3DKPA 4AK9A 2GJKA 2MMGA 4NTZA 4ZCMA 3W6OA 3VU9B 3RRMA 3I73A 4K81B 1VG0B 1GG2A 1H8ED 1J7KA 2QGNA 3AGQA 3CNNA 3GJ0A 3L43A 4X8OA 2IUSA 1US8B 4TYNA 1XCMA 2NOAA 2V7QD 4M22A 3K0EA 3LQQA 2W6ID 3K0FB 5CYPA 4KLNA 4M4SA 3RDPA 1SVMA 2J1LA 1G5TA 2G3YA 2FMXA 3P4XA 4GT1A 1HTWA 2WJJA 2BC9A 1E99A 4DVGA 4TLCA 3ICQB 3RHFA 2FFAA 1NMYA 2NO9A 2OUKA 1KI4A 1NIJA 4C30A 1W4BA 4WAUA 5A4JA 1BMFD 1IHUA 3LRPA 1NVUQ 4M53A 1Q3HA 4TN1A 2G9NA 1DAGA 2HF8A 2R44A 3PXGA 3FMPB 4D0GA 5EP2A 4HLCA 4ZCLA 1R5OA 5CJ2A 1YZQA 3SC3A 5H70A 4HB2A 4GOJA 1YJ5A 1GL9B 1OJLA 4M1SA 2H8KA 4LHZA 3TK1A 2V6ZM 1SZPA 2P65A 3NH6A 2GZAA 1DO2A 3U7HB 3GCGA 4EQ6B 2G1JA 3U3OA 5EE9A 4KXFB 1NN5A 3GLGB 1OT3A 3P20A 4L9SA 1WF3A 2PL3A 4FN5A 3KB2A 3C41J 1G5PA 821PA 3QG1A 2NO7A 2GJSA 1KK1A 1PV4A 1Z08A 4AKGA 4NHOA 4Q1FA 1LS6A 1E2PA 1R10A 3CRVA 3MFYA 3SOPA 4EJSC 1OKKD 4NCHA 4PSAA 4C0HA 4BEJA 4URYR 1UKYA 3QXCA 2ZRPA 4P4SA 5GJBA 2GEVA 4KAXA 3O8CA 2CL7X 3VKGA 1BH2A 2CXXA 4BRUA 2WTUA 3WNBA 2VIIA 2VA8A 1UDWA 2ANBA 4MGKR 1UEIA 4URXR 1VG9B 1WDTA 2CLDX 3U60B 1XXHE 2V7QA 3PR1A 3CZPA 4LWZA 1KAOA 3B5JA 1KZGB 1LNZA 2QG6A 2W6IA 4NYIQ 1II8B 3TQFA 2JJ2D 2NO1A 3WHKA 1ELOA 1N6IA 4NKRA 5JJIA 1OHHD 2QN6A 5DI9A 5C4MA 2OG2A 5FBLB 4CRWB 2O52A 3L0PA 3EWAA 4US0R 1RC8A 3SZRA 5EXXA 2YINC 2E87A 4V0KA 1MKYA 5CK5A 2QQ0A 4YLGA 4DBLC 1KMHA 4H1UA 1T4GA 3RC3A 2W2XA 1BMFA 1G291 1UKZA 2B6HA 2K5UA 4PPGA 4W5WA 2QA5A 4HLUA 4DT1B 3E5HA 2GEDA 3VNUA 4HZIA 2B8WA 3W3AA 3C14C 3CIOA 4Q4LA 3TSWA 5KNBA 4LJ7A 1ZINA 5IK2D 4JLNA 2DZOB 3ZS9A 1ANKA 3ZVMA 3WHLA 3PIRA 3RSOA 4FWTA 5DSZA 4D0NA 3UIEA 1E1RD 1R0XA 5JCPA 4CZ2A 1JNYA 3K0SA 1Q1BA 2ZQ5A 1ZNZA 4S35A 1N2CE 4PC1A 2P2LA 2ZYVX 1VIAA 1OIWA 5AJXA 3CPHA 3T5DA 3RS3A 2WWXA 1JALA 1MO5A 4R7ZA 2PEZA 5K8UA 4TYPA 2LWIA 3RANA 1KAGA 3DKVA 2N42A 1NI3A 4TTRA 3LBNA 3QUSA 4TLEA 3MJHA 5JWOA 1FTNA 2JCSA 1MO6A 2AHOA 3BFXA 4DDUA 2JLXA 4LC0A 4OL0A 1OSNA 1YR9A 2B8TA 1RIFA 2A5GA 3MGCA 3TAUA 4CYMA 3IILA 2DWQA 1MRSA 3QEJA 2ONJA 4PR0A 1T91A 3SQWA 5FUWA 1XJCA 2F1JA 4OJQA 4B76A 4C0KA 3GEEA 4GNKA 4NCJA 5JMTA 4O0MA 3KB1A 1Z0IA 4ASUD 3EZ2A 3MD0A 3GLHA 4BZQA 1GZSA 1B0UA 4FIDA 3EX7C 3I61A 1KJWA 4M1MA 4EFNA 1W36C 4CEIB 2B7BA 1Z28A 3THOA 2NO6A 4A92A 1P2SA 4ZIRB 1YR6A 4UJ5A 3FFBA 1DTSA 3TW4A 5IK2A 2ORWA 3IIJA 2V8OA 5FFMA 1XPUA 1W2GA 3CH4B 5LD2B 1T0JB 1HURA 2QTVB 1CJTC 5FUXA 3VQTA 2CVHA 3AF3A 1T8UA 3NBZC 4ZKDA 1E1RA 1DADA 1E9BA 2GXQA 4Q7LA 2Z5FA 4RD2A 3FTQA 2RGCA 4CEJA 1DO0A 1AZTA 3H0KA 4FW9A 4TWZA 3SNHA 2JATA 3I5YA 1UKEA 3CRRA 4HAYA 3BAFA 1G4UR 5DLQC 2I1VB 3E1SA 1ZNWA 2QT1A 4G5GA 3QF4A 3IDQA 1OH8A 3HR8A 3KXKA 2VSFA 4YMTA 2ZI3A 2QMEA 2Q3HA 3VHXA 1S8FA 1UBEA 2GF9A 4PZZA 4D4MA 4H1VA 2XZPA 2Z6VA 3EASA 2L0XA 1TQ6A 2BIFA 1X3SA 4B47A 1NBMD 2D3WA 2ZE5A 3B1XA 3W5JA 3CZQA 5L3QB 2IYWA 2GA8A 4GI7A 2IEZA 2FSGA 1G3RA 4DSNA 4DIDA 2RMKA 3THWA 3F8TA 3QKRA 2R6DA 4GMXA 2Z4RA 1DAEA 2VHTA 1VIYA 2JLSA 2IYSA 3NWJA 2AN9A 4PQRA 1U0HC 4LPKA 1ZM4A 4IW3B 1E2IA 2QT0A 3QXJA 3X1ZA 2OFOA 3KX2A 4JLOA 3LX8A 3LV8A 2OCBA 1DS6A 1GKIA 4DKXA 4P4UA 1E2EA 3CM0A 1COWD 5DIFA 1ESMA 4W5HA 4A8JB 1Z6AA 4AY2A 4BFYA 1U8YA 1EESA 3T5GA 4Q19A 4PC6A 5FTMA 2WIAA 4G5SA 4LDJA 1Z0DA 5JJLA 5JS7A 5L3VA 2EVWX 1JJ7A 4KFRA 1MRNA 1WXQA 1KDRA 1Z5ZA 2EFCB 4TL6A 3O8DA 2QROA 1PUJA 4RVCA 3U61B 3WMFA 4B3CA 2ERYA 1KI6B 2O0JA 2KB0A 3VX3A 3MRSA 2J0QA 2QAGA 2XNDD 1T3SA 3A1UA 1TU4A 1NY6A 1UF9A 1JEEA 1L2TA 4G3XA 2R9VA 3G82C 4WZ6A 3EA0A 2F43A 2RGNC 3LLMA 2VRWA 2NG1A 2WV9A 3BC1A 3NHBA 4LV8B 4Z51A 1AGPA 3U44B 5JEDA 1WQ1R 1HYQA 2GJAA 4QXAA 2XOKD 2C98A 3LBIA 3QQ5A 4HDCA 1XEFA 5JSZA 1XTKA 1NBMA 4BZPA 3G0HA 1G3MA 3QBTA 4L9WA 2O8DA 3ZVLA 1U9IC 4MUAA 3K70C 1E79D 4BGDA 4RZ2A 4GSYA 3BBPA 4MA4A 4ZCIA 4Q9IA 4B33A 4EPXA 5B30A 3AQ4A 2BBSA 1M7BA 3QKTA 1K5DA 4KFSA 1OB5A 5CYOA 1W7AA 2QGZA 4GPTA 3FMIA 1TQDA 2YYZA 2G88A 1AM4D 5FOXA 1OE0A 1Q57A 1Z2CA 1T0HB 1E0JA 1HEIA 2C9CA 3LFUA 4DWJA 3R8CA 4YONB 1AS3A 4Q1CA 3K09A 5KNCA 2HYDA 3SN6A 1O87A 1OXTA 3TUZC 4NU0A 3K9NA 2F6RA 2TMKA 1N6LA 2ZI4A 2WJVA 3I1FA 1DPFA 3JVVA 1YZKA 4YC7A 2HLDA 1VPLA 1KYIA 2O0HA 3C7KA 3PUYA 5E4FA 1E2GA 4HUQA 2J0SA 3G5UA 3RYTC 1PLKA 3M4YA 5A5GA 4IDHA 3LW8A 2DYKA 1HUQA 1S3SA 4BFXA 5AUPB 1Z6GA 4OI1A 3KUDA 2VF7A 3K0CC 1TL7C 4FMDB 2O8FA 1G9XA 3Q3JB 3TR0A 3KFVA 1I4DD 4IDPA 2WPDD 3FPAA 2JEOA 2YJTD 2Z4SA 1T5IA 3GJXC 4PSVA 4WA7A 1Z47A 4URVR 1G7RA 3HYTA 2GZHA 2GXAA 3AF2A 3QKSA 4KSBA 4E07A 3ADBA 2XOKA 1DAHA 2REBA 3SBEA 5J4KA 2XX3A 2G1KA 3DMNA 1NKTA 3V4FA 5CLLA 3GLGA 2BMDA 1S9DA 2NZJA 1P2UA 3CNLA 2HXYA 2WJYA 5JI2E 1N25A 3ZVNA 2HT1A 1CJVC 2IUTA 3QPUA 4JLKA 2IYRA 4Z8XA 4V0NA 4L4UA 1GVNB 2ORIA 4WIAA 4HDQB 5GJWC 1CR1A 3WRXC 1SXJA 3KUCA 3SFVA 2YNMA 4DLVA 3ZLJA 1XRJA 3B2EA 4KODA 4M9ZA 4P4SB 4IFBA 2OT3B 3HU3A 1CR0A 3UG7A 3GJ7A 5JS8A 1YZUA 2WJGA 1JR3A 3BE4A 4JBWA 4Q18A 5DNYB 1XZPA 4WOPA 4YMSA 1DARA 3UWOA 2OBMA 3ZZUA 1KK2A 4V0ME 2Q9BA 2ZUBA 3CWQA 1N5JA 4E22A 1Z6YA 4YMVA 4D26A 3AVUA 1NLFA 3AM1A 1KMHB 3GLFA 1VKJA 3B1YA 3FMOB 4FD2A 2XB4A 4XTCS 3FKSD 4KYUA 1E0KA 1S96A 3K53A 3QPWA 4JYCA 4YDSA 1G6HA 5AJWA 2ZRKA 4QBIA 2G77B 4Q7KA 1HE1C 4URZR 3SS8A 3O8RA 4EPYA 1D2NA 4LJAA 4C2TA 4UXJA 3TE6A 3N2IA 3DHWC 4IVQA 1YQTA 4HB4A 3LNCA 4BFTA 2GCOA 1ZCBA 2ZJ5A 4GITA 5JLJA 1UBGA 1QHHA 2QP4A 1K6MA 1NLYA 2WHXA 3OFNA 2RGDA 1D2MA 3LLUA 1KI3A 1XD9A 4OHXA 1BS1A 3UXMA 3NBXX 2AWNA 1BO6A 1Z0KA 1CP2A 2GVZC 4Z8YA 2JLQA 2ZI5A 1NVVQ 1P7CA 2H1LA 3U3MA 1DAKA 1XTIA 2ZRIA 5AUOB 1WMSA 1I2MA 2OAQ1 4MKFA 4F38A 1E1QD 2R8RA 2X2EA 3BS4A 1OLOA 4NH0A 4QC2A 3RS4A 2C5LA 2ZUDA 1G8YA 3PEVA 5IDVA 1JB1A 1Z2AA 1YR8A 4IVRA 4RD6A 4V0LA 2JJ1D 5L8VA 3LVQE 1J8MF 3PUZA 3K9GA 4DB2A 1T3HA 3SFZA 3WBJA 4QJ5A 2KJQA 1EX6A 2ATVA 4A0HA 1XX6A 2I3BA 1E9CA 1GKYA 2NZ8A 2KI5A 1UDXA 4JT4A 3EZFA 5CDFE 4NCKA 4ZDKA 1AJEA 3LY5A 3K9HA 1E2FA 4EPWA 4O25A 3GJ3A 1HY3A 4QNMA 3GLHB 3IIMA 4XD7D 2AD5A 2IS2A 4EIWA 2ZRGA 1JPJA 3HWSA 5P21A 2FV8A 3FKSA 5CIQA 2ZRAA 3SJAA 4QHYA 1YRAA 1YZGA 4KBFA 4PXAA 1R5BA 5FL7D 4LBVA 1A4RA 3NXSA 4BWYA 4KVGA 4Q1BA 4DSUA 3DZ8A 3HU2A 4NP6A 1YZLA 2FZLA 5B64A 4PO8A 2FFHA 3MWYW 2QENA 1W47A 4PAMA 4TMZA 4TYYA 5H1YA 1TU3A 3LD9A 2YWEA 2R6AA 4JSTA 5BXQC 1S1MA 3IEUA 2B21A 2RGAA 1A82A 1UPTA 4RJLA 2J0VA 2OFXA 5CB6A 3BWDD 1N6OA 2FGKA 2C2HA 4CEJB 4EUNA 2QP3A 2Q21A 1OPXA 1U98A 1TTTA 4MKHA 3CF6R 1GRQA 1ETUA 3QF4B 1E2KA 2GK6A 1SVKA 1YRBA 2PCLA 4A0FA 3W8RA 2NTYC 3WMEA 4XWOA 1E1QA 2ZRLA 4LX0A 5C2JB 4CT4B 5JBQA 2JLUA 3TGPA 2QTHA 3GLIE 1OXSC 2IEYA 2CE7A 3FE2A 1WBDA 2WKQA 4IJMA 1ZMXA 4DLUA 5E7MA 1KK0A 4XVRA 2HCBA 1IOZA 3RAPR 5IF9A 2GBLA 1KO8A 5KNDA 1Z6XA 3L0SA 1JQJC 2Y8EA 3THWB 4XSHA 3QKRB 2XITA 3SBDA 4ZDIA 4F93B 1W48A 5EXTA 1M7GA 4QNRA 1KO4A 1Z07A 2X77A 3WP1B 4JLDA 4YDHB 1TEXA 2DZNB 3EG5A 4XVQA 3FB4A 1XEWX 1ZJ6A 3NEJA 2IYTA 1GWNA 2ZRNA 2F3TA 4PFSA 1DELA 1KI1A 5FL7A 1RRFA 3UMSA 5FUYA 2PMDA 4EKDA 4DUGD 221PA 4TMKA 1Z83A 2IF2A 4IHQA 1AKYA 1QBKC 2ZETA 2OO7A 3ETLA 4BZXA 4WXPA 5LDDC 1ZNXA 2WSSD 3V00A 2AK2A 3QENA 4PZYA 5J5CA 4U5XA 3S1AA 3EW9A 4NPHA 3FHCB 1SVWA 2G0NA 2WBLC 4R9UC 4FINA 2XJ4A 3TR5A 1KI6A 2ZE6A 4OHVA 4QM6A 3EIEA 3T15A 4DLWA 3VNVA 4D0LB 2Q9CA 2QAGB 1N5KA 2D7DA 1J70A 4M2LA 2FE4A 3CLVA 4AYXA 2P6RA 1CU1A 4OQMA 1E2DA 3ZH9B 1II9A 2XNSA 4L8GA 2F43B 2IBMA 2OXRA 3T35A 1P9NA 2YKGA 2R6CA 2AL7A 3MHVC 1TF7A 5F9FA 3PFIA 4JLPA 4HB3A 2AD1A 3LWNA 4URUR 5EZ6B 2IX3A 1CF4A 3RS2A 5JSZB 5DI3B 4B6FA 3TAHA 4EDHA 1XBTA 2QZ4A 5FI0B 1FUUA 2YC4C 5HR5A 2CBZA 3AB3A 2O8DB 4IVPA 3WYGA 1XCGB 2IYUA 2OEPA 5FOWA 1KNQA 1Z8FA 2VP6A 2YWFA 2GXSA 3GJ8A 4RZUA 3GEHA 2VQSA 1G41A 4LHWA 4OK5A 3VR1A 3BRWD 1IY0A 4E03A 2MSCB 4NYMR 3EIQA 4HI0E 2GNOA 5A0FA 4JLJA 4DDTA 4B2IA 4AI6A 3CKLA 4LZZA 2PZGA 2F9MA 1DG3A 1ZCAA 4BFWA 2FDCA 4JJZA 1N0UA 1FNMA 5JZVA 2R62A 5FOUA 1D8TA 1FPMA 4FMBB 4DUGA 1OFUX 1ESNA 1XFAA 2GRJA 3GJ5A 5SZJA 5BN5A 1E2HA 1F6BA 1G4AE 3VFDA 2O5VA 2WSSA 5AUNB 4FWHA 5HKKD 3KTAA 2QSZA 3UKDA 1E94E 3TUJC 2DY1A 2V6JA 1XEXA 1E2QA 3WNDA 2ZU0C 4DEYA 3AUXA 2H92A 4GP7A 2IYYA 2ZS9A 3AF4A 4HUQB 4A1FA 2B7CA 2Q9AA 3A4MA 1XNJA 3NBFA 4TMVA 2YOGA 1EGAA 1HQCA 2QM8A 4QG7A 2MMCA 2CCJA 3RC8A 1KI2A 2HT6A 3AKDA 2JLZA 2A5DA 2O8FB 5KHOC 5KPDA 1NRJB 2EFEB 2VHUA 1CKEA 2W83A 1RE0A 2J9RA 2NO0A 2CL6X 1L7VC 5SZHB 3QKSB 4KU4A 3QY0A 2W2VA 4GP6A 2IW3A 1SKYE 3ZS8A 2GHIA 4W9MC 3IKJA 5EE3A 3OEHD 4BLPA 4DCTA 5FOTA 5HZHA 4HEJA 1W44A 3X1WA 1KJYA 1YHNA 1KOFA 5KTYA 3C5CA 3OHMA 3D31A 4M9XA 3PUXA 3EPJA 2VBCA 2H57A 4Q01A 5LB2A 1TUIA 1LTQA 1PLJA 4OHZA 1SXJB 1F48A 3RNLA 3QIAA 2PLFA 2BJVA 4O2RA 2FWRA 3NDBB 1W49A 3IGFA 3EWSA 3GFTA 4CF7A 3B6EA 3CR8A 1CJUC 1GRNA 2IF0A 4FWIB 2QI9C 2KSQA 1AZSC 4AC9A 1TF2A 2ONKA 2RGGA 2QE7D 2FJUA 1OV4A 1D9XA 5HKKA 1VDZA 3FMFA 1G1MA 1WBBA 1OXUA 1NJFA 2DFNA 4GFDA 2RGEA 3MCAA 4FMDF 2RHMA 4PO9A 3GLFB 3VR3A 2VSOA 1WRBA 3CBQA 1KSFX 1IJFA 1OYWA 3B8HA 5G40A 1P6XA 2A5FA 4BFUA 2F55A 1E6CA 3A1TA 2DR3A 4ON9A 2ECKA 3EPHA 1JPNA 2WKPA 4DCNA 1G3IA 1XPRA 1VTKA 1XZQA 5FR2A 1GIAA 4B6EA 5AUQA 2GCOB 3A6PC 2Z83A 4OK6A 1R0ZA 3KXLA 2ZXUA 4M1WA 2BJWA 1P3JA 1QHHB 1IONA 2PJZA 1E4VA 3O47A 4L16A 3IO5A 3RVBA 4D25A 5LB4A 1OB2A 2HYIC 1FX0B 721PA 2PT5A 4LJ5A 3OEHA 2EW1A 2ZRBA 3U3JA 3WMGA 1TMKA 1Y63A 2A3RA 3ZVRA 2JLWA 1Q1QA 4KHZA 1Z0FA 4B75A 4Q1DA 121PA 1T3LA 2ZYWX 2NMVA 4C0QC 3EARA 4MKIA 1EG7A 4RD3A 1U94A 1MT0A 2WOOA 4TT3A 3CR7A 2QMUA 3ASZA 2O8BA 1GFIA 4B34A 1RVDA 4I1OA 4ZKEA 3I5XA 2FSIA 1CS4C 1E98A 2QEQA 1X1SA 3NEYA 2ZRFA 2ZI7A 4ZDWA 2QE7A 2W58A 1MO3A 3P1JA 5FUVA 5JEEA 2WIBA 2J87A 2ZVPX 1J2JA 4AG5A 4MGIR 4OHWA 3FHTA 4HAWA 2PX3A 3EAQA 1VYUA 3H86A 3OESA 3VR5A 1JR6A 4Q21A 4BFZA 1IN7A 4W7SA 4IEIA 3DO6A 3AF1A 3MSXA 4JVSB 3A8TA 4JJKA 3ZZ0A 4RCYA 4LJ8A 4AWXA 2VSXA 3VX4A 4L15A 2HF9A 4DLTA 1GSIA 2ZRMA 1GITA 1P9RA 3QNUA 5FI1B 3TKLA 4PANA 3X1XA 1R0YA 2AKAB 3R9XA 4V02A 2BV3A 1LV7A 2IC5A 1JI0A 3W8NA 1SHKA 1LS1A 1XMIA 2GF0A 4OQLA 3BGWA 4P31A 1RRPA 3AKEA 2FN4A 5D3MA 2P5TB 4XH9B 4JMPA 2FPKA 4Q9HA 2H17A 4MDFA 5FPTA 1WCV1 4Q4HA 2X2FA 2CLCX 3WYAA 4P32A 4HAVA 2BMJA 4LYAA 1X8JA 3WY9A 1TAGA 2NIPA 3B82A 3GEIA 4D82A 1ODFA 1K5GA 2Q3FA 4GOKA 1PLLA 3D7MA 1JXMA 1FTSA 2ZSBA 3QXSA 3K8YA 3QSYA 2ZJZA 1OF1A 5JCZA 4IDOA 5BYJA 2UZ3A 1LF0A 2VP9A 4XVUA 4JZKA 5E95A 3BIFA 1W1WA 2C95A 4C3ZA 2XEXA 2BBTA 5G53C 1XB2A 1CR4A 4B2PA 1E2NA 2XJ9A 2BKUA 2FSHA 1IQPA 1NN0A 3KJEA 4TLBA 3I4LA 1IXRC 3L0OA 1TPZA 2G83A 2CL0X 4JBYA 1N6KA 2VTKA 2W2TA 4RD4A 2V6IA 5BN3A 2CNWA 4TL7A 1TQ4A 4I1UA 1SHZA 2ATXA 1MO4A 1R8QA 3DM5A 1E32A 1FL9A 2FG5A 4DCSA 3P4YA 3IUYA 4TQ9A 4JVMA 3ND9A 4KI0A 4LGMA 3SHWA 1IN4A 1CJKC 2BM0A 2PLRA 3VAAA 1RKBA 1IN5A 5GJVC 4A6XA 2XTMA 2PZFA 3TBKA 1P9WA 2PBRA 4JS0A 3S1AB 3DOFA 2HLDD 4PAQA 3T12A 1OYYA 3IQXA 4M1KA 4Q5IA 3VTKA 1LVGA 4V0MA 5JWRA 5H68A 3FHOA 3BERA 4IRUB 2ZRCA 3IBGA 3Q5DA 5K8IA 1W4RA 3ZZTA 4FWGA 4TTPA 1TQ2A 2D4HA 2WWFA 3UANA 1FP6A 1XPOA 4GRAA 3UPUA 4UNNA 4WVFA 4QOSA 1YZTA 4B3GA 4PQYA 1F2UA 4PPQA 5EUQB 3RRZA 1GKUB 3R7WA 1MR3F 4N3NA 3N2EA 2SHKA 1MH1A 4EJSA 2LKCA 4H9GA 1H8HD 2KRKA 2DHRA 1HE8B 2VYFA 4Q1AA 5DH9A 1TNDA 5DI3A 3THXA 5FTJA 1ZD1A 2NPFA 5FR1A 2AKYA 2WSMA 4RY2A 1SQ5A 4PO1A 1D6JA 1N6NA 3TVDA 3WRYC 4XIGS 4EPVA 5CJPA 1KDOA 3L8ZA 1QHXA 3AGPA 3B85A 5HPYB 1P72A 4V0OA 2BMFA 1IAQA 3BH6A 2Q0HA 2VL7A 1SXJD 2HJVA 4POAA 2FEOA 3AF0A 3O8BA 1GAJA 3ICEA 4L5BA 5L3RA 3U6BA 4NYJR 4LOAA 3DMDA 2PEYA 3P32A 2O8EA 2IYZA 1E0AA 4BUJA 1KSJA 1E2MA 1JR3D 1FMJA 3CB4A 3N70A 4HSEA 1SVIA 1YR7A 1VECA 2VHQA 3ADKA 1R8SA 4A2WA 5JRJA 5KDLA 4JT2A 3TUIC 2Q6TA 2DWPA 4YMUA 2BVNA 3SU8A 5FTKA 2JDID 2UZIR 4M0LA 2QM7A 3BFVA 1W0JA 3P26A 4ESHA 3KTAB 2I4IA 3U3RA 1XEXB 2CJWA 4ZV4A 1NMXA 4LJ6A 1M2OB 2XSZD 1CULC 5CM9C 421PA 5JJKA 3PUWA 3EZ6A 2IS1A 2NGRA 2OCAA 3CX6A 4LC1A 4JBXA 3KXIA 1G7SA 5DISB 1J90A 2KBEA 1I4TD 4PSKA 3LH5A 1W4AA 5TMPA 3CW2A 1NJGA 2VP5A 3T61A 621PA 1QHIA 2QSYA 4Y0AA 4B3DA 1F3OA 3GQBA 3OFND 4LBZA 5KPJA 5G3YA 3R9IA 4A8JC 2ZAMA 1H8HA 2CHGA 2OM2A 1W5SA 1JBKA 2FFBA 3E2IA 3TMKA 3TRFA 1TADA 4KSCA 5EQTA 1XTRA 4X8MA 5AK0A 3CRMA 5EUMA 4XWKA 1MV5A 2V54A 1Q1ZA 4A0RA 3SR0A 4F7WA 1E9DA 2C03A 4I99A 3JZMA 2YVUA 4D80A 5LPNA 4LYJA 4DXAA 3RS7A 3EA5A 5IT5A 4MGYR 3NC0C 2WAXA 4AYTA 2D62A 3WNCA 1UBFA 1ZIOA 2ZM5A 5KSOA 2ZTSA 4PZLA 2AK3A 1BYUA 1GNPA 1ZD8A 2IXFA 3C16C 3IQWA 1G20E 3LXXA 4R2IA 5KYKA 1FZQA 4MQBA 3PEYA 1DAFA 2JDIA 1Q3TA 3ASYA 4OK3A 3I92A 3NH9A 2GCNA 5DYIA 4BLRA 1XDBA 5K8TA 4UXHA 2OBLA 3KKOA 3OAAD 2HUPA 3PG5A 4UNQA 4LCBA 1Y3AA 2XSZA 4TL8A 2R6GA 3IPXA 1WE2A 4CDGA 2VO1A 3NC1C 2ZR0A 2BDTA 2BOVA 2C77A 3RLFA 1Z3IX 1OH7A 1S2MA 2A78A 2WWWA 4JLAA 3AVVA 1IJEA 4LV6A 1Q0UA 1AN0A 1DVRA 3QOFA 1QHGA 4B48A 2IYXA 3L2OB 3TNFA 2QPAA 5HE9A 4ABYA 2CE2X 1E9FA 4MYHA 2OBNA 3VMFA 2OE2A 2OESA 2ZE7A 2O8CA 3GPLA 2CCKA 5CM8B 4JKYA 3V9PA 3TJZA 1FX0A 1JEDA 3VR6A 4PX9A 4TSFD 5IRCD 1N5LA 4ACAA 1EFRD 4R2HA 3ZJYA 5G41A 3FKQA 4KLZA 3SJBA 3K70D 1DG1G 1NBME 2ZS8A 1S1CA 2OILA 3SJZA 1ZRHA 1NL3A 4WXRA 2QORA 3PJRA 1NY5A 4TMXA 5B2ZA 4HB0A 4M1TA 4D6PA 3C5HA 3OF5A 2ZJ8A 3CRQA 2JLYA 1NSFA 3HPRA 4WZBE 3X1DA 5AJZA 2ZANA 3MJRA 5KSZA 3RWMB 3BK7A 2O8BB 1NKSA 3B1ZA 3LW7A 3QXXA 4Q02A 2PMKA 1XTJA 4N0EA 1FQKA 1W4CA 4Q7MB 4KFUA 3T34A 2N1BA 1UADA 4ACBA 4TLDA 3CF2A 1TF5A 1UKVY 2ZSAA 2FX3A 5DYGA 3TSOA 3LVRE 4G5QA 1KDTA 5JFGA 2NPIA 3LDAA 1VMAA 3BB4A 2YC2C 3KL4A 4IKEA 5FOVA 3OAAA 4A36A 4QHSA 1F60A 2J7PD 3HJNA 4QBHA 3SE0A 2FGJA 2H5EA 4A6PA 2JAQA 2ZRDA 4Q66C 1KNXA 3RABA 3BH7A 2BBWA 3AH8A 2QPOA 2JLRA 3KQKA 4IDNA 2IL1A 4ILEA 4KCGA 2IWHA 3C8UA 1M7HA 1XMSA 2GAAA 4LJYA 5E7JA 1CEEA 2AX4A 1CTQA 1H65A 4G1UC 2QMHA 1AIPA 1ZUHA 2QU8A 4B44A 4IXNA 2H7VA 2B92A 2RGNA 4GDFA 3BB1A 2DWZB 2X1VA 5J40A 2V55B 2RH5A 5DN6A 5D3MB 3AVWA 4ZPXA 4JVLA 2IYQA 4TSFA 1ZP6A 2IT1A 4Q4HB 4DRZA 2X19A 3A1WA 3ZIAA 1EFRA 2YV5A 1RW4A 1X6VA 4Y0VA 4UNPA 2EFHB 1DEKA 1U9IA 3U7FB 1BKDR 2ZJ2A 1KKMA 4II7A 1AA9A 4JLBA 1GUAA 2AFIE 3GLGE 2D06A 1UEJA 3B78A 5KO2A 5BW8A 1SVLA 1T6NA 4HLUC 4HAZA 4JL8A 2GJ9A 2UKDA 3A1VA 4NMMA 3R9WA 2G6BA 4F4JA 4OQXA 4Q4JA 2RHDA 4X8HA 4MKGA 1Z0JA 4FCWA 1Z22A 1UFQA 8OHMA 3T1QA 1N5IA 1U90A 1KDPA 3KJIA 4C0AC 5J4LA 1PVOA 4XSGA 1MABA 3ZQ6A 4DJTA 2QRNA 3NHAA 5CITA 1FUKA 4YMWA 2P67A 4BLOA 3QEOA 4Z54A 5E3HA 3QI2A 1N6RA 4LBYA 4NYIR 1FOEB 4FI3C 3ZGXA 1G8GA 4QGHA 1KZ7B 3WBKA 4DIEA 4RFSA 4OYHA 1Q21A 3T1OA 2GCPA 3KKQA 2J7PA 3PUVA 3W6NA 5GJCA 1DE0A 4OKSA 3TSZA 4F91B 4DLYA 4QKQA 4CT5A 1EWRA 2IYLD 1DAMA 3CPEA 2VEDA 3UMRA 3EPLA 1J8YF 1V5WA 3T1TA 3RWOA 4B74A 2R2AA 3KJGA 1NG1A 4CEHB 1YVDA 1XXHA 3K0CA 2UVQA 4PHGA 3CO5A 4LUCA 2IS6A 5KSPA 1EFTA 1XWIA 2MSEB 1ZU5A 1XD2A 1Q20A 4UXIA 4LV5B 1JAHA 4TYWA 1OW3B 2QL6A 2ODWA 1LB1B 2RB4A 1W2HA 2OSBA 3HPQA 3NTUA 1E9AA 3QPVA 4D4JA 2RGBA 4I81A 3PVSA 1FFHA 1G8FA 3IO3A 2P5SA 3Q85A 4GBMA 4HZUA 1W0KD 3NIBA 4F4IA 3Q5EA 3B13B 4ZO4A 4P3YA 1SGWA 3DPUA 1ZBDA 4E5UA 4HATA 1AK2A 1F2UB 3C4JA 3R7WB 3E70C 3NG1A 1I4LD 1M34E 4Q7JB 5HCIA 5EJEA 4CIDA 4EJSB 3GFOA 4PHHA 5EXSA 3THXB 1QHYA 2J0UA 3ZD7A 1JJVA 3AVPA 5EP1A 5UKDA 2ZR7A 5JRZA 1QHNA 4KYIB 3NDPA 5IHPA 3R8FA 1Q22A 2XTZA 4LRTA 1AS0A 3X1YA 1KO7A 4JLVA 1KKLA 3BOSA 3OZXA 4LRSA 1E0SA 4ZDJA 4D81A 2EU8A 4I4LA 2FSFA 3PV0A 1OXXK 3FVQA 2PX0A 5EZ5A 3KDSE 5TDHA 2ZEJA 4MITA 4PC3A 2O8EB 3AVYA 2DFTA 3EIHA 1CLUA 2Z0MA 3A4NA 1IXSB 3ND8A 3TW8B 2EYQA 1Q12A 5J47A 4PHFA 1ZU4A 4KV9A 2CEAA 1VCMA 4LHYA 1X8LA 2FFQA 4A2PA 3THYA 1U0LA 3LO5A 3KZ1E 4Z1MA 1EK0A 1CR2A 4BLTA 1QF9A 2FOLA 1GM5A 2WMNB 4N1AA 4C0BA 5TY0A 2XGJA 5FTLA 5EXPA 2CJWB 2XZOA 4BLQA 2QRZA 1ZW6A 5J4YA 5KUTA 3DEFA 2F7SA 1NLZA 5C1BA 4EAQA 3CH5A 4TMWA 1X8KA 4DEXA 3EPKA 4C7OA 1U81A 1Z06A 1ZC3A 1IY2A 3HR7A 1O3YA 3DZDA 1QZXA 1SKQA 1W0KA 2VPPA 3MWKA 3I62A 4IDQA 2QBYB 4A15A 4BQSA 4BPBA 2OXCA 1EXMA 3PEWA 2OLKA 4PQFA 1N6PA 1P75A 1PJRA 4K46A 4M9SA 1UBCA 1OFHA 5FTNA 1NVMA 1XF9A 4O2LA 4HLQB 4RCZA 1E3MA 4K8OA 5E7IA 1C4OA 2GXUA 2AXPA 3F0TA 4AG6A 1KI9A 2WAYA 4TMTA 1CJMA 3BFKA 2ZUCA 5EE5B 2J41A 5ANRB 3QG5A 1XEWY 4TT3D 4QJ3A 3HDTA 2DVWB 2QAGC 2YZ2A 1CRQA 3CPJB 5KOYA 4NCNA 4A3VB 4RKEA 4D2IA 5CB8A 4HAUA 4MGZR 4F4CA 3TVTA 5EP4A 1X86B 3VR2A 3GLIB 2F1HA 3OEEA 1W36B 2IXGA 3KW6A 1JAIA 3N5CA 3A4LA 4B32A 4DSOA 2LCFA 1ZIPA 5FL3A 2RGXA 4G5RA 4E09A 5JECA 1ZM2A 4US1R 4A2QA 3MUFA 3BJIC 2WVJA 4NONA 2J3EA 3IIKA 4JIMA 3CUEF 3PITA 1H8EA 4Q1EA 4C4PA 2EWVA 1M6NA 5JHHB 3PQCA 3U4QA 5KDOA 4XTRA 2QQEA 3RSLA 1E4YA 4PAOA 4A4DA 3ZQJA 1KGDA 1G8HA 4U02A 1G5RA 5DE3A 3W6PA 3KKMA 2N46A 1KI8A 4AURA 3HU1A 2FU5C 4FCTA 4KBGA 2HDNB 2ORVA 4IXMA 1KSHA 3RRYA 4XJXA 3GMTA 4IOKA 3T06B 1A7JA 1EFHA 2O8CB 1K8RA 2V9PA 4Q4AA 1HV8A 3EZ9A 1U99A 2ZROA 5TB5A 3WYFA 4UKDA 5HZKA 1G3UA 3K09C 2CMKA 2WM9B 1QZMA 3ADDA 1L8QA 5FPKA 1ZNYA 2ZYUX 4W5JA 4NE2A 5BN4A 2VHJA 3SEAA 4MRPA 4B73A 3B60A 1AKEA 1E2JA 4D4KA 2RAPA 2CHQA 1Q1EA 2DCUA 1Z63A 1SVOA 3KJHA 1IBRA 1NVWQ 2IYVA 4LHVA 4BASA 5F3WB 4LJ4A 4C9BA 2EFDB 1DOAA 1G18A 2ODEA 3TH5A 5C4GB 2IHBA 4DDVA 4B35A 4GL2A 2WJHA 2C9YA 4RD1A 3KQLA 1OKKA 3M6AA 4I1SA 1KSGA 4KO8A 1A5TA 2XB2A 3K1JA 2GVDC 4ARZA 2CNWD 4MH0R 3SHFA 4EPRA 4JSYA 3SQXA 1XTSA 3WXMA 1CXZA 1A2BA 2D2EA 2HXSA 2JA1A 2OAP1 4XOIA 1GOTA 4NYMQ 5CLQA 5FPYA 1SXJC 4US2R 2JJ2A 3W90A 3W9YA 1OHHA 3PCRB 4MYUA 4BECA 3EZ7A
chains in the Genus database with same CATH superfamily
3VYWA 3AVQA 2IP1A 1GG9A 4ATNA 2EG9A 1N8TA 1EK5A 5EEGA 3TQCA 3GXOA 5CA1F 1TEZA 4YAOA 3KUUA 4MCIA 4Z4FA 4HBZA 3LA6A 1ULHA 2C5FA 2D2IA 2WU3A 4ZD6A 4ER3A 2W00A 3MTDA 5I7WA 3C3WA 4Z0NA 4JLMA 1J21A 4HGRA 3OKAA 1FDIA 4BNHA 1E3QA 4TXNA 2XE6A 4HPJB 4Z4HA 3K4PA 1C7QA 3LPAA 1FYFA 4L3VA 1LPOA 3R6WA 2VP0A 1K7SN 1JAXA 4IZ6A 3X1JA 2GEJA 4CGZA 3UBMA 1AUQA 5CNKA 1NVVR 3QOWA 1FFYA 5I01A 1PR5A 2IIPA 5K3FA 1KRWA 3NOOA 5KDDA 4QTZA 5LA6A 4LBWA 2CVFA 1GVHA 3IE1A 3PA6A 1TRHA 2O23A 2P78A 2PL9A 5ELMA 4BO4A 5CFOA 2BFCB 3SMVA 2DBVO 4WSOA 3DEZA 4MTLA 1O0CA 1SXIA 3IHLA 3QJYA 1VHLA 1TZJA 2ZIWB 2BCJQ 3TBFA 2EL9A 5DEOA 3PEFA 5LQMA 1FRQA 2Y1OA 1EKXA 1W6RA 2GESA 4GMQA 2UYHA 3K6KA 4ZAVA 1T15A 2DPXA 4DA7A 3GGJA 4GOMD 4AKHA 3ZWQA 3D6TB 1P5ZB 4R8SA 5D3QA 2F3RA 3WLEA 5C46F 5T4BA 4DPKA 1YB7A 4PXYA 3BREA 1XMJA 1G71A 1RAGA 4BJ5A 1Z38A 3AKYA 3E9RA 4X94A 4BGVA 1TC1A 2QLBA 4PF1A 3H3FA 3FI9A 1IMOA 3MOGA 4RFVA 4DPMA 4G8BA 1UZNA 2PZEA 3ZLUA 2B6NA 1V8ZA 1CUHA 4QBTA 3ZCUA 2P6UA 4CHTB 3GNLA 2O3RA 1T5LA 4ZRMA 4X65B 4NCBA 4OI0A 1S0UA 1U8UA 3BM5A 6PFKA 1F6DA 3EC1A 1KOGA 1PS0A 1N34M 1XP8A 1N2IA 3SMPA 3KQHA 1A1VA 5D1NA 3FWKA 3OIYA 1MOZA 4GSKA 1DBSA 2SICE 3PD7A 1P1BA 4B79A 1JJBA 2YWGA 4ZOQI 1IBKB 2WW8A 2JKYA 1OXVA 4H7HA 1YJAA 2P2DA 4XQ0A 1T2AA 1G0OA 1IHYA 3DTYA 4DE5A 4KIGA 2EKBA 2Q6IA 3RR2A 3NWLA 2OHFA 2ZIXB 2A4MA 3C9PA 1F2TB 4TZ0A 5GV7A 1XDZA 3ZDCA 2EO2A 3EFEA 3E4RA 4L85A 4RTMA 3CNQS 1W5FA 1XKXA 2ZDQA 1NF3A 5AJYA 1P1JA 5TARA 1T8RA 5EHGA 2FN9A 4DLSA 4HR7A 3GLFE 3G2HA 4P2GA 2DFPA 4HQNA 2UZAA 3E9MA 1OIVA 4C89A 3BWEA 1G38A 3L07A 4W8GA 1KIMA 4YV1A 1XHLA 3RIMA 1VMDA 1RYHA 2FN8A 3AVXA 3FVTA 1H1LB 1JZQA 2KWIA 4QOJA 4DR1M 3UATA 2QLTA 4QBFA 3U3KA 1TW2A 3QK7A 3HBFA 1ZYUA 4BIMA 5DGXA 3V7FA 2QMZA 4XYGA 3QM1A 1E6UA 1VIDA 3N8HA 4JUDX 4NTZA 3LDGA 3W6OA 1H8ED 5IMBA 1SUDA 4X8OA 1US8B 2PGNA 1ADJA 1GV1A 1SVMA 3V1KA 1NTRA 2Q5CA 2XMGA 4KIJA 1KTIA 4JV5M 1QQ7A 5BUQA 5EP2A 4V2UA 4GOJA 4Q3CA 1J2EA 4LHZA 3GCGA 5FJIA 5EE9A 1UMCB 4V3CA 3PBKA 1EXDA 3N76A 4ZJUA 2CD9A 2AYYA 4NCHA 4H0CA 2GEVA 2QT9A 3ET5A 4MGKR 4FOPA 1M1XB 2CLDX 3AFIA 3ZX5A 3E7FA 2QG6A 1II8B 2P3LA 4U1RA 4NKRA 3TW6A 4J3FA 5C4MA 5FBLB 2VXCA 4US0R 3FA2A 3O93A 5CBKA 1NSYA 4RY8A 2X2PA 4CTKA 5AVKA 4IDEA 1K6EA 1ZGHA 1PR2A 4QOFA 5HIAA 2CXQA 3JASB 5CXSA 4NZPA 1CYDA 3NKFA 1ZD3A 3OBIA 5CDGA 5B1YA 3DKVA 3HRIA 3PRKE 3LPDA 4FT2A 5JWOA 2B2XA 2AHOA 3LL4A 3CXRA 3IR5A 4AJNA 5KYTA 3UQYS 1T91A 4FBLA 1DAOA 4FEGA 4HWGA 4OJQA 1Y1TA 2P69A 8MHTA 3BQMB 5AI8A 5T64A 2I2XB 3SR3A 3EX7C 1V5EA 1KJWA 4ND3A 3VR4D 4XLZA 4CEIB 1H2WA 2QR5A 1P2SA 3BTUA 2Q8PA 4FI3F 2CVHA 2VAXA 2JIPA 5CLGA 3PU6A 1UWLA 4YI3A 2QT1A 3I9MA 3IPRA 3QF4A 4NV0A 3NHJA 2A57A 2DCMA 3I53A 3K9CA 1I0ZA 1ZS9A 4ZEMA 3B1XA 5EKDA 2YWJA 4RF3A 5LCXA 3Q8LA 4LC9A 3IDFA 2IYSA 3ZDEA 1ZM4A 4CMHA 3X1ZA 2OFOA 5G1PA 4NBNA 2QTZA 2VQEM 3S7ZA 4YP9A 4JJ7A 2I6XA 4P82A 4DTCA 4A8JB 4QEZA 4JXXA 2JK1A 2EVWX 3W9BA 4DBZA 4D0SA 1KQNA 4EG4A 3VX3A 3HFRA 3W4IA 2XF2A 2JHAA 2NZUG 2YQZA 1E0DA 5JEDA 3UICA 3ZVLA 2LP4Y 3GZ4A 2GPYA 4JYAM 3BEDA 1TA0A 3O83A 3FMIA 4JXKA 3VDQA 1P7PA 2RG7A 5FD8A 5KQ8A 1TAHA 1HEIA 2P75A 4KXLA 2KHHA 1CZUA 1O87A 3PDIB 3VPHA 1S3SA 4FZ3A 1K92A 3DFUA 4HWRA 4ZAWA 3RJMA 4EITA 2Z4SA 4AJ1A 3GP1A 1LK0A 2XOKA 4FYIA 3FTEA 3GLGA 1RZRA 1CJVC 2P9EA 4ZOBA 1GVNB 3V8MA 1UPXA 3B2EA 2RI1A 5FJJA 1DGFA 3DHYA 1CUAA 5JT1A 5ERGB 1DARA 4TTSA 3ITKA 5KNLA 2Q9BA 2CRUA 5I45A 4I4IA 2VQFM 4YPOA 2OO5C 5LVAA 1LPMA 1MOPA 3ESYA 1D2NA 3T5PA 3N2IA 4BO9A 4HB4A 4W5RA 4OLFA 1AGXA 1JAYA 5DW0A 2KNAA 1Z0KA 2Q0QA 3NHMA 1ML4A 1P7CA 3ADOA 4QSMA 1TH2A 2OAQ1 4MGKE 4OX9B 3DWEX 3FHLA 1U1CA 2W2KB 4LRQA 1G8YA 3D7KA 3Q1LA 3Q88A 2FLWA 1TTEA 4RCVA 5CFRA 2Y21A 1PNRA 4HL4A 5DNDA 3ZIUA 3GJ3A 5JNWA 1ZJ4A 4EIWA 8ATCA 1K2VN 1G8AA 2WYIA 2ZRAA 4BWYA 3SG0A 3MXOA 4GP9A 4FGJA 2B21A 1U0SY 4RJLA 5IKEA 1GSOA 4GIBA 1Z36A 3F49S 1IZ0A 2JLUA 2GM4A 3FE2A 5IM4A 3GCWA 3VRHA 3W68A 1RTKA 4DIKA 1EDZA 2V1CA 2DMRA 3JQFC 3WP1B 3W5BA 5GY7A 1GWNA 3GX1A 3ZJ5A 1J56A 3ROMA 5I8ZA 2O05A 2DQZA 4TMKA 3DOCA 3VBEA 4OGWA 5J2TB 3C87A 4BRZA 2H48A 3EW9A 1MEOA 2N9UA 4UAUA 1EE9A 1VHJA 4V1CI 4EDFA 3EYWA 3O94A 4LQ4A 2QAGB 3HY6A 1N5KA 2D7DA 2JFPA 2VTDA 1E2DA 1CUXA 4OBBA 4PG5A 1A5SB 1RWOA 1UMDA 5JSZB 4LVCA 4B6FA 2VKQA 2UUCB 2FSVC 1UP6A 1VJ5A 3NIDB 3BFJA 4P81A 4NJOA 2VQSA 4LHWA 1QF6A 4MZXA 3GOHA 4DDTA 2PZGA 2F9MA 1KEZA 4BO6A 2IPOA 2IBTA 1FP4A 3ROPA 3A9SA 1GLVA 1ZAYA 3GJ5A 4HVCA 5BSKA 3JQBC 2ZAGA 5CT5A 4LF4B 4DNOA 3H1BA 4X7PA 4A1FA 1C9JA 3IUMA 1HQCA 3P9NA 1ZGAA 2O8FB 1FB5A 2EFEB 9LDTA 3A0RB 4KWHA 4GGMX 2CN1A 3MSCA 2O7QA 5AOCA 4IUDS 3MB5A 4FR5A 4WK4B 3GUHA 3EPJA 5E38A 3QIAA 2VN8A 3PE6A 5B1EA 4JBIA 2KSQA 4O6VA 2FE1A 4YQZA 2Y9MB 3NORA 3QFHA 1P6XA 3ZV5A 4B7XA 1D4OA 1QK3A 2EJWA 1E8DA 2DETA 1FLNA 5HWSA 2WPNA 3JYNA 1NXXA 2F1KA 2ZTCA 1PV2A 3D3NA 2PSSA 1AK9A 1TJYA 1MT0A 1Y1PA 5HRCA 4QPJC 1T3TA 2QUAA 4GC5A 4ZDWA 1MQ8B 2XUFA 2B1RA 3ZDRA 3G5AA 3EGIA 3V46A 3LXUX 3A8TA 2VSXA 4O8CA 3HJSA 2B8EA 3SIPA 3B6ZA 1BA2A 2H4WA 4K0RA 5IJ9A 2AOUB 5BURA 1FYVA 1RD4A 1QQ5A 1KWGA 4MDFA 3USCS 1ZG3A 4NNOA 1Z7WA 2XB6A 4L4SA 1TAGA 4RYLA 4FGZA 1NAIA 4EB8A 5BSTA 1ISSA 4LXIA 1BTOA 2V7VA 3K8YA 1L5NA 1YACA 2XR1A 1CR6A 5K0EA 4UBJA 1L5SA 1M1YA 4C0WA 1L1ZA 2GCGA 1ESDA 2SECE 3HBAA 4X60A 2IV3A 2XTMA 1L5OA 4OMCA 1FJ2A 4BO2A 5JWRA 1MGPA 1DFGA 3MTEA 5JFTA 3UANA 4RQBA 4IHJF 5KC8A 2WLSA 2Q1SA 1ORVA 3OOWA 3WE7A 4XR9A 3FRIA 1PQPA 2SHKA 1HE8B 5C3MA 4PSDA 5C7OO 3AHEA 3M83A 1SD2A 2ZQYA 3BH6A 4MUGA 4XGKA 1EEHA 3AF0A 2QD3A 4C2BA 2A35A 5HQJA 3CB4A 3HYCA 1SUAA 2ZT8A 2AMFA 3RJ9A 1O9HA 4A3SA 3T5AA 2I4IA 5HS6A 4ZV4A 1Y5MA 1J1ZA 1QDTA 1PDWA 2IS1A 4EG8A 2IZ6A 3A9TA 3LH5A 1W4AA 1NOKA 2XUZA 3RK1A 1A5ZA 4ENSA 4Y0AA 2CLEB 5KYXB 3R9IA 2CBGA 3IUBA 4B6PA 1V8DA 3AF6A 5AK0A 1TK2A 4F7WA 2DT8A 1S2DA 3JZMA 4FC6A 4CTNA 3H7AA 3IEIA 3GT0A 4AYTA 3OMXA 5LMZA 4RV4A 3FTDA 4O08A 4OK3A 4BLRA 5K8TA 6ABPA 4F56A 3KKOA 1NOJA 1ZWLA 5ALZA 3EODA 4NU6A 4G8CA 5KYVA 4F1IA 1GU7A 1IJEA 2Q8QA 3BJEA 3COSA 2F5NA 1SELA 4RM3A 4TROA 3GA0A 4NAHA 2OE2A 3DZIA 2UU9B 4XWWA 4PX9A 5IRCD 2W2OA 1RKUA 4LISA 1X0VA 4JI6M 5G41A 2JNWA 4QQKA 1NBME 1TUGA 1WG8A 3NHYA 1NL3A 4WXRA 1TZCA 4TMXA 3A70A 1KVSA 1XC8A 3HPRA 3X1DA 3MGGA 2O8BB 1PG0A 1J25A 3RU2A 3L5OA 2PV0A 3G23A 4Y2YA 4C06A 4V39A 4JX8A 3KL4A 2I4MA 3D6JA 5BV1A 5HQTA 3GVPA 1MOSA 3UCFA 2J9GA 1RWXA 1W93A 4U9IS 2RGWA 1JDZA 2BMVA 5IVIA 4LI3X 1CEEA 3HJHA 2QU8A 1MIOB 1QK5A 3AI7A 2YHBA 5CBPB 4W63A 3O73A 4II7A 4JLBA 4KB5A 1OI2A 3KOMA 4BLVA 3IJPA 1DL5A 4UCXA 1Z0JA 1UFQA 3C97A 4XSGA 4JR0A 1FUKA 4Z54A 5BSUA 2ATEA 2E4YA 3W6NA 1H69A 4MJXA 3G9TA 4B17A 3X2EA 1EWRA 2IYLD 2EKQA 4KMMA 2V3VA 3RFFA 4IJFA 3JS5A 4YJ3A 4LUCA 1QH1A 1YFKA 4D9BA 1BW9B 2PVCA 1EGMB 3Q85A 4HZUA 3U6CA 2VT6A 4P3YA 3DPUA 3G0DA 3MHTA 3NG1A 2CT8A 1DP4A 4IMJB 3FJOA 5IMSA 3CVOA 5IYZA 1IEWA 5CB4B 4F97A 4WCVA 2RSLA 1FLDA 1L4HA 1F8XA 2ACVA 4CT0A 1A9RA 2R8ZA 1KDVA 2DH6A 3E3NA 4ZDJA 3IAS6 3GEDA 5EZ5A 1P0CA 1HM5A 5K4GA 5L45A 1EK6A 4HQFA 2OO5A 2EYQA 3KVOA 3NTQA 4F84A 2FOLA 4C0BA 1TK9A 4I0WB 5HKAA 2AMYA 2F7SA 3J80A 3NQ41 4E12A 2HU2A 1P3QQ 2PIDA 5BVGA 1OWPA 2BD0A 1X1AA 1NXWA 3T3OA 5IW8A 4N82A 4K8OA 1C9DB 1CJMA 3OTOB 3EB9A 1F7UA 1CRQA 3JD3A 4HY3A 2QD4A 3IPLA 3CT6A 1F38A 1Y9EA 4ZK6A 3EEFA 2QZZA 1BMQA 3G79A 4IGKA 2M32A 4HEA1 1MU0A 3GPPA 1SG9A 2H0QA 3PITA 4MRAA 1YONA 2DPMA 3ZU3A 1PSZA 2YXNA 1GYQA 1M73E 3MAGA 1PJ8A 1NI4B 3QJGA 2V9PA 1C9EA 3EZ9A 5ITTA 4S1OA 1X7GA 1TKAA 2NU9B 1L8QA 2CL5A 4CM5A 2ARKA 3SEAA 1WUHS 3BX1A 5GINE 3JQFA 5H80A 1SVOA 2NU7A 3ZWVA 1YLAA 2E6KA 3KQVA 4AROA 3H3JA 1ZIDA 2OHIA 2W2LA 4IZOA 5C4GB 2FZKA 1M2GA 4JVOA 4WEQA 3IEMA 2VK1A 4MVCA 2QZJA 4N0MA 4WEOA 5F76A 4QOGA 2AZTA 3QHQA 5K5EA 2ZU6A 4P83A 4O2AF 4HNUA 1ZUIA 1AGRA 3DMHA 5GADl 1VCNA 3UGTA 1CUCA 2FSVA 2GN1A 1YQEA 3OZTA 1LC0A 4F3KA 5J2UF 1V8BA 1MABB 2QG9A 2R7KA 3JQBA 5F7ZA 4F2PA 1W34A 2WICA 1I2DA 3NRCA 5TVKA 3OIFA 4X97A 3LUGA 2ZBDA 4CEHA 4HNAB 2QMYA 2F9FA 3J81k 2I2BA 2RD2A 4DW8A 1BXZA 1FW6A 2ZRHA 2CXPA 1KMCA 2BF4A 1N0WA 3P9XA 1IM2A 3JX9A 1NATA 4TZ6A 9ABPA 2QMOA 1LY1A 1ZOLA 3U2QA 1FNDA 5I7OA 5DRTA 1CVIA 4OBXA 4PRLA 4OO3A 2IEGA 2RI6A 2CWWA 1OIXA 1RZUA 5LBIA 4B8ZA 2KMLA 3KJXA 4N8EA 1T5TA 4RJKA 1Z12A 3ECCA 3DE0X 3PPYA 1BEEA 5DM2A 3VZCA 3WX0A 3W34A 2F1RA 3A1EA 1YFZA 3PFCA 2UXBB 2HSJA 4KG7A 3CUWA 3K1ZA 4R9SA 4WKGA 3GLIA 3UJNA 2HEIA 4JYZA 1BFUA 3SJCA 4NCIA 2P27A 3OQIA 4QELA 3I9JA 1DC4A 2NQ2C 1HNZM 2C3PA 3SXPA 2D74A 2Y05A 3T3MB 1FFXA 3E5RA 2WF9A 1P8AA 2QRHA 3S44A 3U4GA 1W29A 4COKA 4AQYB 3AEKA 4G0NA 3PKIA 4UEKA 1XVAA 5BR8B 2IXDA 2IGTA 2ZDGA 3Q3EA 3EN0A 3WSVA 4U2DA 4ZAGA 3D43A 2H4FA 1NBIA 4RK5A 2P2NA 1DRUA 4IBGA 2BZGA 3S1SA 4GOND 2R1VB 1R0BA 3L7AA 3W5AA 4QU5A 3HHWA 5BV8A 1XNRM 1V33A 3OIUA 1VE5A 2DWNA 3NGLA 4JKIA 2QPLA 1QYRA 3FYUC 4CKBA 3NNNA 4GU5A 1RQNA 1C1KA 2J7NA 3U37A 1MMFB 3Q7PA 3HH8A 3QEMB 1C30B 3FRHA 1V3TA 2RB5A 4J1QA 1EGHA 1W46A 2LHCA 2VLIA 1POWA 4GPAA 3FDZB 4BE4A 4IIGA 4ZEXA 1R66A 3QEBZ 3GLTA 3IDOA 1NZFA 2OQIA 4D9FA 2BFWA 4X6YA 1EZZA 4BBAA 1DAIA 3DS8A 1M74A 3TLJA 1TR8A 1LQTA 2WWIA 1MNQA 2OV3A 5BMOA 2OQVA 4EELA 2OOKA 1BDIA 3WNQA 3MK6A 3WL5A 4EECA 2BRUC 5LBUA 3GQVA 1FZTA 1QIGA 3QLUC 5EWLA 1B15A 1F8GA 3SZGA 1U4NA 1XU4A 2QM0A 2F64A 2C7QA 3HKDA 5L95A 5DFLA 4IXDA 1N0VC 2REOA 5EJ2A 4WZBB 5L3SB 3WGMA 5K8VA 2XCLA 2PBFA 2J09A 5HA5A 3I73A 3DJYA 5LYJF 1WHTB 1LPBB 2AVNA 2WSBA 3L6DA 1WPXA 4EP1A 5JS2A 1ZK2A 2JFVA 3AR8A 4TS4A 1BMFD 1FJGB 4CM1A 1Q3HA 4KKXB 1OVGA 1F14A 2R44A 1NDUA 5A4KA 5CJ2A 1WV1A 1YJ5A 2H8KA 2QE6A 1DO2A 4B5LA 2Q7XA 1SWVA 1YDHA 1JT9A 4FFPA 4D5EA 3DCJA 1RM3A 1E63A 4NHOA 1G8JA 3MFYA 4WJKB 5K3BA 4P4SA 5CVUA 3WMRA 2PWZA 1UDWA 1R0RE 2ZB3A 1VG9B 5GGYA 2Q6LA 1MT3A 3QUQA 2HA5A 2W6IA 3W8FA 1GPAA 5DI9A 1XG5A 2P9CA 4YROA 4W5WA 4S12A 4Q4LA 2HRCA 1DBVO 3ZW7A 3LCUA 2DZOB 4YX9A 3FPLA 3RSOA 2A33A 4QUAA 2J07A 3UMBA 2P2LA 1VIAA 1RWQA 3H05A 1JIQA 3PNQA 3O74A 2QYTA 5CNIA 4HDNB 3DP9A 3V76A 4XIFA 1SG0A 1RI1A 2C9MA 1NNJA 3B6JA 3AK4A 3GLHA 2JCXA 1V11B 4KQXA 3P2EA 1W36C 4N7JA 2BWBA 4FONA 3TZ6A 3BWBA 1W2GA 4BVGA 4G1MB 1E7QA 4ZJPA 5HYVA 1E1RA 2RGCA 1O0BA 4KVFA 4G5GA 3QU4A 4I8OA 1RAFA 2AG5A 4OLHA 2WNSA 2Z2YA 1XZKA 4Y6OA 2I7TA 1DB3A 4ZOLA 4E11A 4BVHA 1F0YA 1I2CA 3I23A 3GDFA 2FZWA 1DRKA 3O2QB 3NWJA 5THQA 4P7JA 2QT0A 3QXJA 1C7IA 4XX0B 3CM0A 4L6AA 3UC5A 4QLBA 5L3VA 1M1NB 2HK7A 1O1YA 1KDRA 1NFFA 3ZTYA 5ES4B 4HFMA 3CF4A 5JZMA 1ZRSA 4AP9A 1JEEA 5H5JA 2H1RA 3G82C 2GEFA 2WDZA 1MFZA 4TQGA 2B1JA 1XTKA 3OQVA 3VUEA 3ANYB 3GA5A 3K70C 4PV7A 2QW0X 3U4DA 2V8BA 5GONF 1VEGA 2FEPA 2GM9A 1TQDA 4X62B 2LCIA 3UK1A 3WSTA 5NULA 1ORHA 5FEMA 2DPHA 3CLSC 4CW7A 3IBSA 1E2GA 1PLKA 5A5GA 3BRQA 4L08A 1X39A 3U7JA 4CLOB 3HCNA 3KUDA 4O4IF 1N2HA 3E7DA 5EZSA 5LC1A 4Z86A 5SY6A 3AF2A 5LLSA 1YKFA 1XZGA 5J4KA 3PJGA 2P2ZA 4EY8A 3JWJA 4MJ3A 2B37A 3K20A 3DDNA 1V7CA 1DIOB 5DM0A 1JDUA 1XRJA 4YRBA 2Y20A 3HUDA 1JHXA 1GYPA 3RSSA 2UV8A 1IM8A 1DTEA 4MI3A 1YZYA 3R6TA 6ADHA 1SRRA 4YDSA 4IYJA 3KE9A 2ZBUA 5KJ6A 2BP7A 4Y98A 3U6EA 4BTLA 1XZFA 3UXMA 3NBXX 4AJKA 4DMGA 2DR2A 1NUAA 1AD2A 2M5ZA 1QS0B 2R8RA 3IKVA 1O94D 3PEVA 4BQPA 1Z2AA 3S4YA 4FUQA 2OFFA 4LXXA 2JAHA 2NADA 1UDXA 5BPHA 1E2FA 1CNEA 2NZVG 4N41A 1YRAA 3LYUA 3HU2A 4OD0A 2CMGA 2DKOA 4DYDA 3G9XA 5HUQA 2H2AA 4LF8M 3M6LA 3BGDA 2R86A 5D51S 2CHFA 1GTRA 4FGWA 2GK6A 2F1OA 3E9CA 5C2JB 2ZRLA 1OBFO 2VK8A 4Q3BA 4ZO6A 2BPOA 4IBKA 2HMVA 2IYPA 5TF0A 4ED9A 3THWB 3QKRB 5E6JA 2DSNA 1R12A 1R8YA 2R6R1 5EGSA 4OSPA 3BJZA 4ZALA 2ZRNA 1X74A 1H3EA 4F1WA 1J00A 3AR7A 2ZETA 1W4ZA 2I66A 1DFIA 3ZIDA 2AK2A 3STWA 4R9UC 2PU7A 1CQIB 2O1SA 1MB2A 3FM9A 4FJ1A 1QUTA 4K03A 4YT4A 3QRWA 3PFIA 1FFSA 3TAHA 5BW4A 4B4OA 1D4AA 1GPMA 1U1DA 4P84A 1QFJA 1Y5IA 1PFVA 4HI0E 4F71A 1IUKA 2ESRA 5F5NA 2AZ4A 4ARVA 2YR0A 4B08A 1FPMA 3IRUA 5C34B 3QI7A 4IH9A 1VFNA 3CGGA 2DY1A 5B3LA 3WNDA 4B6QA 4BIIA 4ZVNA 3VZDA 4M7OA 5KNBD 2F8LA 2F5SA 4V1CA 4FQ7A 3PFHA 4PZAA 3CUTA 5IJWA 1L7VC 2EAUA 2AFIB 4RLFA 3IMCA 2RC6A 3YASA 1VHDA 4M55A 1T2DA 4V0RA 1Z5CA 3UWDA 5HBGA 1N2BA 2CW5A 4R2JA 5C4IA 2Q27A 3K1AB 1IZYA 2IF0A 4FWIB 4UUQA 4HP8A 3FYUA 3MRVA 1ZXBA 1QLJA 2IPMA 3SZLA 2L7IA 2RHMA 5EJ7A 5KOHB 3EIXA 1KSFX 1XL0A 1G3IA 2ZKLA 1Z2EA 1XZQA 3RUIA 4B6EA 4P5DA 4CLDA 1R0ZA 3KCQA 1K8QA 1H9CA 1UJ4A 2PT5A 5HIIA 4JH0A 2EL7A 1PL0A 3EARA 2YRWA 1R3UA 4H3SA 2XE7A 3VH3A 1BCRB 2X6TA 4C1NA 2ODTX 4IDAA 2D0PB 2H3HA 1H4SA 3OC0A 2QE7A 1HG0A 1D6SA 1MO3A 5JEEA 3U4CA 3CV3A 1W94A 4WKOA 1LC3A 3IG5A 2BRUA 1MJGM 2CLFB 5K6AC 4LJ8A 2BFAA 1VL5A 5B6PA 3R7LA 4R1QA 2JFWA 3QLUA 4NSOB 1I9CA 2IC5A 1SHKA 3Q87B 5IZCC 1JLRA 4L4RA 2IKQA 3IP1A 3PNVA 1KH1A 2I03A 3WYAA 1I3OA 3MTAA 2OWDA 1ECCA 2BMJA 1V34A 2GPAA 3D7MA 3R0JA 2C4WA 1PFQA 3VDNB 2ZJZA 2G72A 4ER6A 5JH7A 1HDRA 1GU1A 4RGVA 1XZ8A 1H2AS 2CKDA 2CHUA 2XZFA 4AULA 5IKPA 2GRUA 2R97A 1L5RA 4I55F 3NAQA 4DCSA 3TG2A 1SQGA 4ND1A 4KI0A 2BM0A 1RKBA 4A6XA 1FFGA 4ZTUB 3RVQA 3LUAA 5JJCA 2ZRCA 4OF4A 3R3ZA 5KX5A 1MJHA 4KDEA 4B83A 4WVFA 5IWCA 3HYLA 5EUQB 2O1WA 2KRKA 4L28A 3ZHYA 3REQA 3A3KA 3IUSA 4GS5A 3ADPA 1RABA 5EL0A 5KYWB 3L8FA 3BIWA 4V0OA 2QN7A 5JATA 1QGYA 5L3RA 3TTSA 3TOSA 3P32A 4NOMA 4YJ2F 1Z4PX 1YR7A 5B2EA 4LZWA 5K0LA 4ZN6A 4IDDA 2H4XA 1EM6A 4ZV9A 1PW5A 4TM8A 5JJKA 4NJEB 3CX6A 2JH8A 3HUEA 2C57A 3NAZA 2CXRA 4CV0A 4HQ0A 2B5OA 3GDWA 4EMBA 1JBKA 3D8UA 4KSCA 4GWKA 1XTRA 3H5NA 4AW9A 4WCFC 3IBFA 1PW7A 2BKVA 4DXAA 4GI2A 5A02A 2IKSA 3N6RA 3ZCQA 1Y7HA 3CT4A 2IXFA 4Y28F 4J6EA 2RK3A 5EWMB 2J4FA 2GCNA 4K2AA 3SF8B 5BWBA 1AV7A 4HQLA 2JG3A 2GD0A 2OD7A 4CDGA 2R60A 3NC1C 2P35A 1JSZA 4JLAA 1H0RA 3O82A 4E3ZA 4HX2A 2P9YA 3FW1A 2DKNA 1Z4QA 1Y1LA 3RNOA 5CHEA 3VR6H 1DUIA 3OC6A 4IDBA 4K6HA 3RVLA 1HEUA 1R3DA 4KLZA 4RHFA 1S1CA 2LVAA 2H7XA 3BG5A 3GI1A 5CLHA 1O6GA 2CXNA 4F6RB 1ZIYA 3MA0A 4TKVA 1W4CA 2AEEA 1UADA 1T4DA 3ZE6A 4TLDA 5DYGA 2PGAA 5HIJA 3GD5A 3OAAA 3N0RA 1QTQA 3V2HA 3B70A 2JAQA 1Z82A 3BH7A 2BBWA 1BHO1 4IDNA 4ILEA 4CKZA 2ADFA 1VFPA 1NVEA 2X4IA 1A95A 4JOBA 3MS7A 2LXEA 4ENWA 5T3UA 3A1WA 3CN7A 4UMEA 1D2RA 2UKDA 5ALGA 5TRTA 1EUZA 4C6RA 1HEYA 1R0SA 4QWWA 1ODTC 4YMWA 4PHCA 1E1LA 4RKYA 1KU6A 4QGHA 5CAEB 1R6UA 4N6OA 1MG0A 2RGHA 4LVOA 4F91B 3UMRA 5DCWA 1F1JA 3KLNA 4CJ6A 1HKHA 4DARA 3SWWA 3L1JA 3WAGA 2APJA 1Q20A 4UXIA 3FTNA 2HA6A 3T4PA 2FQQA 1W2HA 2OSBA 3PVSA 1W0KD 5KAMA 4Q7JB 3FF1A 2Z2KA 1M10A 3GFOA 3DGFC 1BX3A 2GBPA 3OCWA 4ZZ1A 2ATCA 4LXHA 5EMHA 1Z73A 3IV7A 2WP0A 5IAJA 3VZSA 4L8YA 4R5MA 3AVYA 3EIHA 5TQ0A 4WLUA 3TW8B 3D9QX 4OH1A 4Z7QB 2CEAA 2G63A 5DU2A 1U0LA 1EK0A 3MVEA 3ZLBA 2P2SA 2XCRB 3IVAA 4A03A 4NOOB 1L7MA 1YBAA 2O19A 3FGPA 3HX3A 1U1FA 3GBPA 1UCFA 1Z6PA 2GAIA 1OAKA 5DZSA 2GYVA 2GTHA 3U4AA 3VPDA 1ZMWA 1N77A 4UULA 4HLQB 2J6CA 5E7IA 5EXEA 5I4CA 2WAYA 3BFKA 1GZVA 1DKMA 2BKAA 3C4QA 3S2EA 3FLMA 2PAFA 4BUZA 3HDTA 3HXQA 1YA8A 4KAFA 1Q0TA 4Q1VA 3D4NA 1JAIA 1YIOA 4MQ6A 2DWUA 3WTCA 3O1IC 4D41A 5JHHB 4Z3KA 1ODKA 4EBFA 2BFBB 3DHNA 4K8RB 3WL3A 4I9GA 2XT9A 1G8HA 5DE3A 3W6PA 4F45A 3WDSA 2ORVA 1HV8A 4AQDA 4S2UA 4HAOA 3RVOA 2L7HA 1GQ2A 3ADDA 2P4HX 3GGOA 4XRGA 3TEMA 4D4KA 1IBRA 4W5NA 3Q11A 5F3WB 1C1HA 1W52X 3Q12A 4PRKA 4KO8A 2NVUA 3ZUGA 3FPSA 3U40A 2ZSHA 3QYBA 4BB0A 1MRZA 1J0EA 3O1HB 1CXZA 1A2BA 4JGBA 1ZGCA 3BE5A 4NENA 2PKEA 3WYGA 1SCAA 4DCJA 3O1LA 1KK3A 1RWPA 4PU0A 2VF5X 3CJTA 3CZ4A 4V03A 1TYZA 2G07A 1C3OA 1RLIA 5DO9A 4LYFA 2A94A 4C22A 2VTBB 3I5UA 3EF0A 3DM9B 1UWKA 4B6OA 4KNVA 5A05A 3SYNA 1TIPA 3PENA 3TLXA 5C18A 1JV2B 3SEQA 1FLVA 4M37A 1XV5A 4L8RC 2Z3XA 5U9CA 1T8TA 3MOIA 1T9HA 5DHQA 2I22A 2NYAA 5I3ZA 4A9AA 1NHGC 1HZZC 3ULKA 4YIKA 2ZKIA 1R7RA 3HE3A 2GZ2A 2JIBA 4KK4A 3L6RA 4RXTA 3OT1A 3AERB 4EY3A 3SQLA 1OBCA 4ZI3A 3P19A 1GPBA 1HA3A 1MJFA 4Z3OA 1QHFA 5TSDA 3H19A 2Q29A 1XMQM 4P34A 4FSDA 2X8AA 3V32A 4QEKA 3GLHE 2FN3A 4A0GA 3ADCA 2QHXA 4ZI7A 2NU8B 5CDFA 1YKSA 5LYYA 3EJWA 4EHKA 5BP7A 2Y1EA 1C3VA 4LPSA 3HCPA 4INZA 4BLSA 1WUIS 1O03A 2Y0BA 4BFSA 2E6UX 3K71B 2HWUA 1T36B 3IEVA 3CZMA 4RNDB 3HYSA 2QK4A 3LWBA 1G21E 1Z5GA 2WT9A 1K75A 3DOIA 4NBUA 3UO8B 2WWHA 2ZAOA 1RQPA 1MH9A 4YGYA 5KAPA 3AHIA 3B1JA 5T4EA 1R6VA 4IP0A 2WZCA 1CRWG 1KETA 4B6SA 3RFUA 1A2KC 1DIGA 1FDSA 5K6AA 2ZYGA 3NIWA 4QUHA 3MJEA 1K9VF 4OGKA 5GQSA 5DSXA 1XLTC 5IZCA 3PGLA 3U60A 4IQ0A 1NMZA 1S5PA 2D1FA 1SXHA 1NXOA 5KI6A 2ZBQA 1CLEA 1USUA 1RPZA 3L01A 5KWIA 1QQWA 1KBOA 1FY2A 1DJQA 1IBMB 2BEJA 5DT2A 2QP9X 4MQLA 2EKLA 4M86A 4TQUS 3DWGA 3WGQA 2XCIA 1OI4A 2HK6A 1B73A 1Z5UA 2XH9A 4F2WA 4DNQA 2J9YB 3L6EA 4PGMA 5TQJA 3DBHA 4PLFA 1L4YA 1XZHA 3GJ6A 3V4RA 4R01A 3IPYA 10MHA 1KMQA 2OP0A 1REQB 1BKSB 3PQ7A 2XBMA 1MCZA 4Z4QA 4U7HA 1N1MA 2ZVQX 3WIVA 3OO0A 3MGKA 3DDHA 3AR2A 3MGBA 2ZUTA 4OGFA 2AEMA 3RTEA 4EPTA 2XUJA 4GOXA 3SFTA 5T4FA 2WM8A 4YJGB 4E6PA 5TX7A 1EEXB 2BM1A 3VPCA 4UQLA 1RU3A 2BH2A 3EOBI 2QPTA 4A82A 4LZNA 1PNOA 4RA6B 2EX4A 2WUVA 2Y1LA 3WNZA 2RC5A 4HWTA 1P39A 3ZCPA 3OICA 3W2FA 4H1WA 1JHMA 3D2AA 5F7JA 1C41A 4IJ5A 4XD7A 1P61B 4C5AA 1VL1A 3TIIA 3VH2A 3I3SR 2AN3A 2ANCA 2J3IA 5JCXA 2JFHA 1TE2A 3C1AA 4DZZA 3SAWA 1NQTA 4FC7A 4C7MA 4BB5A 5JWHA 4WCFA 1OWOA 3L7JA 5EMNA 1N0HA 4PQEA 4ESVA 5JVDA 3GEMA 1L7RA 4DADA 2CFRA 3LX5A 3K0AA 3CH6A 1G5QA 2XAUA 3QVTA 2Z3VA 4FYHA 3ZK8A 1TTPB 3OEED 3H2YA 5ESDA 4KK3A 3I32A 5ALHA 1XT6A 3CNEA 2C8KA 2WMDA 3CNNA 4J2TA 3DFKA 1LRLA 2IUSA 2O2XA 1XCMA 4MQEA 2QM3A 5PNTA 2Q4RA 3K0FB 1ZCZA 1PU2A 1P2BA 4DQUA 1XVLA 2FHSA 3G2MA 3P2JA 4DV6B 4CF5A 2R46A 4HLCA 5HMMA 2P91A 4PNZA 3L7DA 1Z37A 2Q28A 4F6CA 1UT8A 4J1SA 4E6EA 2Z9BA 5EYPA 3DBIA 3M9LA 4KYVA 2ZW9A 2NYVA 3WK7A 4FN5A 4AKGA 1U8EA 1R10A 1T6OA 1VP3A 1XTBA 4CG1A 1EUDA 1PWHA 3O8CA 2E18A 3GVHA 3VKGA 5A5DA 2VA8A 2RH8A 1O6FA 2QVZX 1J23A 1MJGA 4KO3S 1ECLA 1KEWA 1JE0A 1K6JA 3AZQA 1ZOPA 4BX8A 1MKYA 4DBLC 3UTDA 2RBGA 4YMLA 1UKZA 4PPGA 2FTKE 2VYQA 2QQ8A 3W3AH 4ARSA 1Y9DA 1ULAA 4PY2A 4O4LB 1I2BA 3D4IA 2D59A 4D0NA 3H99A 2ZULA 1BE8A 4MLZA 1CDOA 2AOVA 3FJ1A 3NWBA 5DMXA 2QQ5A 3EF1A