4L15A

Crystal structure of figl-1 aaa domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
298
Chain Sequence
RAEPTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSSHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fidgetin-like protein 1
publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 95
structure length 298
sequence length 303
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l15A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l15A01
4P4SB 1HTWA 2QA5A 3N2IA 1M7HA 4ZKDA 1D8TA 3IHLA 4Q4HB 2XZOA 4DSNA 4Q9HA 3NBYC 1Y63A 4RD0A 1MKYA 2P0EA 3AF1A 2NZJA 3EG5A 4Q4HA 1DTSA 2ODBA 4L4UA 1KSFX 2YWEA 5KNBA 4DLTA 2ZANA 2OESA 3KJHA 4PPFA 1R0WA 1A82A 2PCJA 4URXR 1HURA 1DOAA 2A3RA 3CZQA 1CJUC 3H86A 3SBDA 3UG6A 4US2R 3ADBA 5J4VA 3KKMA 3PG5A 4JLMA 3PJRA 1LY1A 2REBA 1CKEA 1WE2A 4CDGA 4ZDKA 1QHIA 5EQTA 3SR0A 3Q9LA 2AFHE 3KQHA 3B2EA 3VKGA 2QAJA 2O8DB 1Z08A 3DZDA 4FI3C 1RVDA 2ATXA 2ZRFA 3EZ7A 3GFTA 2AFIE 2ZRNA 4MKHA 4RCYA 3AVQA 4M9QA 3IQWA 1WB9A 1W47A 1P9RA 2HV8A 2RGXA 1FUUA 1EFTA 2WJIA 1E9EA 4JZKA 3GLGB 3FB4A 5J47A 2KWIA 3GLGE 1T5LA 5CB8A 5ELXA 4K81B 3TE6A 1B0UA 2H1LA 2GVZC 4TT3D 1D2MA 3FKQA 4FWHA 1EX6A 3CH4B 3QVVA 4C0LA 4ZDIA 2FZ4A 1IN4A 3GFOA 4JL6A 5C4GB 1RRPA 2GWHA 2JLXA 4Q1FA 5CK4A 1FP7A 3NG1A 2XZLA 4LJ9A 3UWKA 2VIIA 1LB1B 4BPBA 5KO2A 4N3NA 3OAAA 2WICA 4UQOA 3PVSA 4HLUC 5L3VA 4FCTA 3QEOA 1S9HA 3BERA 4DCNA 4XJXA 3ECCA 1UAAA 2W6ID 1YE8A 3JVUA 2FU5C 1UJ2A 1DEKA 1W0KD 1X3SA 2CL6X 4BECA 1Z2CA 3UIEA 2PL3A 5LBIA 2WJGA 2VSOA 2YVUA 2CVHA 4RD4A 1O3YA 2GZDA 5J5CA 2CJWB 3O8BA 5J40A 2QSYA 1P73A 1BMFA 1T3HA 1II0A 1VYVA 4A2QA 4M9ZA 2CJWA 2NOAA 1QZXA 5TY0A 1U94A 4ZCLA 4Q02A 3UMRA 1XMVA 1E79D 2AD1A 5JECA 2DWOA 3C14C 2A5DA 4RSGA 2WJYA 1E98A 2DFNA 5AK0A 2IF2A 2ZAOA 1F60A 4TN1A 5FTMA 1C1KA 4TMXA 3RSOA 1N3BA 1G3RA 4TTRA 3SQXA 4EPYA 1OB5A 3MD0A 4GPTA 3Q5DA 5HE8A 5EUMA 3ZS9A 3G0HA 1YVDA 3PEVA 1SHKA 2C04A 2WHXA 3TLXA 2B92A 1S2MA 1FMLA 3G5UA 1DAIA 1TQ6A 4GP6A 3MUFA 4N0DA 2IYTA 4ZI2A 3ZZTA 3W8NA 3LBNA 2HEIA 3D6TB 4LY6A 5C1BA 1JEDA 2QTHA 5JWHA 1AS0A 1GUAA 4M21A 3CWQA 2YNMA 1YRAA 3WHLA 2BV3A 5JJLA 4V02A 3B78A 2OEPA 3R9IA 1PLJA 3CW2A 4LK2A 1KTVA 3IIJA 5BQ5A 1UKZA 1IM2A 4EFLA 4Q5IA 1OYWA 1E69A 1Q1EA 2HXSA 3SDZA 3K0FB 1ZNZA 1EFRA 2WWWA 2ZSDA 4RY2A 1DAFA 3MJHA 3SYNA 2ZROA 1TQDA 5K8LA 3K0FA 5F98A 1JECA 3TK1A 5EXSA 1NN0A 1RRGA 1S4QA 4IFBA 1BOFA 4LYHA 4TLCA 2D7DA 4A4DA 1W48A 1M2OB 4UNSA 2A7QA 2ATVA 4LV5B 3U3OA 1G3UA 2GRJA 4A6XA 4FW9A 5BN4A 1OH8A 1NG9A 4Q18A 3FPAA 2UZ3A 3B60A 2D3WA 3OIWA 2D62A 4GRAA 4GI7A 5BYJA 1EESA 3AKEA 5FUWA 3TW8B 2QGNA 2FJUA 4HZUB 2AL7A 2CVFA 5FH9A 1A7JA 2O0JA 2WWGA 4FMDF 1GRNA 1XF9A 4C0QC 3PCRB 2CNWA 4HZUA 4JYBA 4BFTA 2ZR7A 1XXHB 4LPSA 4ESVA 1P2UA 1XXHE 4OQFA 621PA 2BEKA 3DO6A 5HPYB 1TU3A 1TTTA 3B1XA 1XXHA 3KW6A 2BDTA 1S1MA 3QXHA 1XPUA 5GJVC 1LNZA 2JDID 3T15A 3B82A 5HKKA 3LY5A 4WW0A 2R6CA 3SZRA 3AVVA 1OV4A 3CX8A 1L4UA 4B33A 1OSNA 2OZEA 4QM6A 4PANA 1ZM7A 1WXQA 3AUYA 4XVUA 3ICQB 3AF0A 3L8YA 1SKQA 1CR1A 2IXFA 4MYTA 2F1RA 2H18A 3QIAA 2FFAA 4MUAA 3ADCA 5E95A 1EWQA 3CB4A 3QUSA 1ETUA 1P7CA 3A36A 2YC4C 1CR0A 3CX6A 3TJZA 2VF7A 3UATA 1WP9A 3RDPA 4S35A 1XDBA 2O8CB 2DCUA 1Z06A 1ZD1A 2OFXA 2VPPA 5TXGA 2XGJA 2O8CA 3RC8A 2YYZA 2IYSA 2D74A 3IDQA 4G5OA 5AJVB 1Z3IX 3CM0A 4QOSA 1E32A 2DZOB 1U98A 1IAQA 3T1OA 5KNCA 4DDVA 3GLHB 3GLHE 1RKBA 3U3JA 1PVOA 1LS1A 1OH7A 1Q12A 2O8BB 3GLHA 1ZJ6A 4GFDA 4J0QA 4OI0A 2B7CA 4GSYA 4DVGA 1MR3F 5GJBA 2F9MA 2O8BA 3GCGA 2WZQA 3R20A 2BJVA 4QL3A 2PX0A 1SULA 2B21A 1GDDA 1TQ2A 2FFHA 5G53C 3U7EB 1N5LA 1W4AA 4AURA 3IEVA 2VP4A 2QRNA 1T6NA 4B3XA 4ABYA 2TMKA 1YKSA 2J3EA 3QQ5A 2N42A 5CYOA 3QKSB 3WNCA 3RANA 4EPXA 1G8PA 3QE0A 1QBKC 3QKSA 2JCSA 1KI1A 3QI2A 4WBSA 2ZS8A 4NYIR 3VMFA 1DG3A 1Z8FA 1G5PA 3SHFA 1Q20A 1VDZA 2EVWX 4MA4A 1IHUA 3OEED 3V4FA 2HUPA 4DSUA 3OIVA 2FDCA 1SXJC 3EIHA 5J4LA 4FWGA 3A4MA 4GITA 2J5XA 2IL1A 2IEZA 4KJZA 4WVFA 3T5GA 2ZM5A 1G6HA 1KJYA 5K8IA 1NI3A 1UKVY 4TL9A 5CM8B 3DM9B 5KSOA 4TQAA 1NJGA 1N6LA 4UXIA 5TVKA 3OFND 3C7KA 5G40A 4EFMA 1ZNXA 5AWFC 1NVVQ 2J1LA 1ZAKA 4DEXA 1XP8A 4EPRA 5EP2A 4TQUS 3AF3A 2GK6A 4QGGA 3TAHA 2J46A 3MFYA 4GP7A 1N6IA 3B13B 4FWTA 3TSWA 2VYFA 4JLOA 1VG8A 3U60B 4Q00A 2MMGA 3LBHA 4OHVA 4DXAA 4XD7A 3IILA 3R9XA 4TLBA 2BOVA 4X8OA 1R7RA 2W6JA 3GEEA 1N6KA 3W5IA 4TYQA 5JJIA 2PJZA 4XSHA 2BMFA 2UZIR 1BMFD 3F8TA 1COWA 1ZM3A 4O0MA 5P21A 5EJEA 3NDBB 2DWQA 1ZM2A 2Q3FA 2Z6VA 4K46A 4US1R 4BFXA 3OESA 1KO1A 4NPHA 4YMVA 4TYYA 2GXUA 1GL9B 2QORA 1IJEA 3OEHD 4IJMA 1ZD8A 4ZDJA 2KE5A 2ZETA 4MDFA 2BMEA 4NHOA 2WWYA 2J45A 4OQXA 5KYKA 2ZU0C 1G6OA 2AHOA 2XJ4A 2VL7A 1Z0IA 3ETLA 2O52A 2R6GA 1GRRA 2FG5A 3C4JA 1XEFA 1CP2A 4DB4A 2ZITA 1RJ9B 4DBLC 3LLMA 4N1AA 4MUBA 4F93B 1W4BA 2O8FB 4D2IA 1KDRA 5DISB 4HAVA 1OFUX 3GLIB 3GLIE 2OBNA 4KHZA 4NCKA 4KCGA 2MMCA 3GLIA 3NDPA 3TUZC 1P2TA 3QXSA 4Q9JA 3QXJA 2EU8A 4II7A 4K8OA 2ZJYA 4A8JA 5FTKA 3OF5A 4OJQA 2RH5A 3A1SA 1ZU4A 3AF2A 3BXZA 4IDHA 4Q7KA 5FOSA 4B3BA 5JCPA 5JWRA 3P32A 2OM2A 1T4GA 2NO0A 4OKSA 3AVTA 1ZBDA 1EFRD 4EKDA 1NVVR 1OKKD 1N0WA 2WIAA 1NVXQ 3BOSA 1IBRA 2B7BA 2GDJA 5LD2C 1Z07A 4Q4LA 1QG2A 4TSFA 2YKGA 3AV0B 3NHAA 1WMSA 1UPTA 3BD9A 3P4YA 2Q9AA 3LQQA 5JRZA 1MV5A 1C4OA 3H0KA 3AVOA 4FN5A 1SVOA 1SXJB 4MGYR 1SXJE 1ZINA 3T1TA 2K5UA 3WNDA 1SXJA 2CNWD 3K9GA 2ORIA 4KO8A 3K0EA 2GZHA 1DAHA 5AUOB 1LF0A 3OIYA 1Q44A 1QF9A 3DDCA 3L43A 5TDHA 4AYTA 4DSTA 5J4YA 1AZTA 4A15A 4U00A 4B35A 3D8BA 1ZYUA 5HKKD 3K0CA 1XMIA 2SHKA 1AN0A 3C16C 4GMXA 2L0XA 3LDAA 3R9WA 4TT3A 4Q19A 2ZUCA 3KQUA 3EPKA 4BQSA 1HY3A 4DLYA 1VCMA 1J2JA 4UNQA 2FV8A 4XH9B 4RFVA 2EFDB 5DO9A 1JEEA 2LKDA 3AKCA 5KPJA 3BFXA 5FPYA 4CT5A 3BFVA 4OQNA 3ZZUA 5DHFA 3CZPA 4GOXA 2F9LA 4XWOA 2ZSAA 5JZVA 4O2LA 4JLJA 2PEYA 3OHMA 2V6ZM 2A2ZA 3ICEA 1AKEA 1E9RA 4POAA 4YMWA 5KSZA 5EE3A 4MKGA 4GOJA 3W5JA 1W1WA 2XNSA 1KKLA 2X1VA 3LFUA 4TTPA 3O8CA 1AM4D 3Q7PA 3RWOA 4DCTA 1XCMA 1N6HA 5JBQA 1XTRA 2VQSA 4CEJB 1AS2A 1IY1A 4A9AA 2CCGA 1B23P 3JVVA 4URUR 1U90A 5LPNA 1G1MA 3LH5A 4CEJA 1IJFA 4O25A 1GITA 3FFBA 4BRWA 4URWR 2JIZD 4Q47A 1SVWA 4ESHA 1KSHA 3TAUA 2IBMA 3KXIA 2V7QD 2ZR0A 4HLDA 3SC3A 1E79A 4MRNA 721PA 1US8B 2ZRHA 1AS3A 2MSDB 2F43B 4FCWA 1FFHA 1P5ZB 2ZS7A 5DYGA 2C98A 1DARA 3RS5A 1US8A 2BCGY 2I1QA 2NIPA 821PA 5CM9C 1GL6A 1E2DA 1XCPA 5FL3A 1G5TA 1Z6XA 4B2PA 1ESNA 4R9UC 4TYNA 2CK3A 2XEXA 2OUKA 3QPUA 2CCKA 3KXLA 3ZJYA 4ILEA 3EWAA 4M2LA 1S3GA 4BWYA 1XRJA 2WV9A 1Z5ZA 1W2GA 5DHAA 1GRQA 3I5XA 4ZPXA 4I1UA 1ANKA 3TSZA 2QTFA 1ZNYA 3ADKA 5LD2B 1R0XA 1XJCA 1Z0FA 4GT1A 2GVDC 3PV0A 1OXXK 2GESA 4DCVA 2IHYA 1A4RA 2WPDA 2V9PA 1KAOA 1W4CA 1X8KA 2FGJA 1LS6A 1XPOA 2FSHA 3B9QA 3X1YA 3ZQ6A 2HT1A 3MJRA 1BH2A 5KPDA 5F3WB 4CW7A 1TPZA 4GOKA 2VTKA 3QBTA 5K8UA 5KTYA 3WBKA 4Q66C 1JXOA 4HUTA 2ZE8A 1OIXA 2X19A 3WMEA 1VCNA 1GNRA 5JFGA 2RMKA 1R0YA 4W9MC 3ZVLA 1CRQA 4ZI3A 1E1QA 3ZLJA 4PAQA 4TQ9A 2G0TA 3AGPA 4MYHA 3R8FA 2AN9A 3PFIA 4FWDA 4XD7D 3EZ6A 2Z83A 5KOYA 3B6EA 2J0SA 2W6JD 1XTKA 4YC7A 4A92A 4HB2A 2ZR9A 4ERNA 4BZXA 4WZ6A 1ZW6A 4PAOA 5FUVA 5DH9A 1EFCA 5EXXA 3IIMA 1JI0A 4TWZA 1E2EA 4RZ2A 4UKDA 1KJWA 1VPLA 2ZI5A 1E2KA 3L2OB 3JZMA 4OK6A 4AD8A 1N0UA 1PUJA 1FZQA 1NMXA 2QTVB 1WF3A 1E9CA 2FEMA 1JALA 4HAWA 4TMKA 3NKVA 4B48A 2DFLA 1E2IA 5KSYA 2P6NA 4PPGA 3RNLA 3TMKA 3UG7A 2G0NA 3MWYW 2RAPA 3K9NA 2CLCX 2BIFA 4D81A 1TF5A 2G6BA 5G3ZA 4RD6A 4F4CA 3L0IB 3LNCA 1XD8A 3MCAA 2IX3A 2IYUA 4LGMA 4H1UA 2HF9A 2A78A 5G41A 3AVPA 4WAUA 2CHQA 2AXPA 2DWPA 1IQPA 5HZKA 1GKYA 2BM1A 2Q3MA 4QNRA 1D2EA 5AR1A 1QRAA 1NVWQ 2W2VA 5FBQB 2QROA 2QU8A 1JQLB 4C9BA 1MOZA 1P9WA 1Z0JA 2NGRA 4LYAA 2O8EB 2WMNB 3D3QA 4A0RA 3FOZA 2ZREA 4CEIB 2C2HA 4YMUA 2VLIA 2O8EA 2C77A 5EXPA 2QP3A 1SVMA 3DKVA 4QKQA 3CX7A 4CEIA 5JEDA 4KYIB 5ANRB 3RAPR 4OHZA 1KI8A 3MWKA 4Z1MD 3RS3A 5KU1A 3O8RA 4IDQA 4P4SA 3SN6A 4DIDA 1ZCBA 1R8SA 2WSSA 1KDTA 3PUVA 1W0JA 1OFHA 4MQBA 4TSFD 3VTKA 5JS7A 1FUKA 1EGAA 1FTSA 2QNRA 1E1RD 3U4QB 3ZVNA 4OK3A 3HU1A 5AJWA 4RD3A 1KY2A 1VIYA 2VF8A 3CRRA 4M0LA 1YHNA 4BE7B 4DC9A 3U4QA 2YC2C 4GBMA 1RFLA 4B2IA 4TTQA 1E2LA 5SZIA 1SXJD 2BCJQ 3IIKA 1ZIOA 3DKPA 1XJ0A 1PLKA 2FPKA 2JLQA 3OEEA 5SZJA 1BYIA 4BFZA 3TQFA 2O8DA 3BE4A 2BHRA 4PPNA 4LHVA 2J0QA 2YHSA 3ND8A 4LJ4A 3EAQA 1R6BX 2D2EA 4IEIA 5FBLB 4Q9LA 3B1WA 1NP6A 2IYRA 3AVUA 1CR4A 3GLGA 4V0OA 1Q22A 3VHXA 3CNNA 4DCSA 1QHGA 3I8SA 4D4MA 3FMIA 5DN6D 3C15C 1RE0A 4TYWA 3A8TA 3PUXA 3OFNA 4JLKA 2QN6A 2WBLC 2F3RA 5L3SB 2WOOA 3CUEF 3PR1A 4V0KA 3W6NA 4BFUA 2Y8EA 4HZIA 1TQ4A 4A1FA 5L3SA 1T0JB 3KZ1E 1OXTA 2YWFA 5FPSA 1MO6A 4O3MA 1E96A 3QBVA 1H8EA 3DPUA 3LW8A 1Z0KA 3CONA 1E9FA 4HLCA 4DLZA 2GJKA 3GJXC 4QGAA 4Y0AA 1FQKA 4IDOA 1Z0AA 2PT5A 3F0TA 2GAAA 3QXCA 2HXYA 2E9SA 3RS2A 4DDWA 1P72A 4FMCB 5AUNB 1G19A 2J7PA 2IA5A 3NIBA 4KFUA 2N46A 2IEYA 1XJQA 5JHGB 4OHYA 1KIMA 4LUCA 1G64A 1X6VA 4C0JA 2VP9A 4BLQA 4Q21A 1CJMA 1E2PA 3HYRA 2NQ2C 3CKLA 1F2TB 2V4ZA 2NO1A 1RIFA 2CHGA 1TX4B 1X37A 1NSFA 1ZP6A 4BZQA 3B8HA 2V6JA 3T12A 3HPQA 3LX5A 3W6PA 1F2TA 1U9IC 3CPEA 2OAQ1 2RGNA 4I4LA 3IPYA 4PQRA 4UNNA 3K09C 3KQLA 2HCBA 3RLFA 1CJVC 1PLLA 3OEHA 2Q9CA 1FNMA 2ZJ5A 2ZJ8A 1KYIA 4Z54A 1YR7A 2R6FA 1NNEA 4AI6A 5TARA 2XITA 3UKDA 5DI3B 5FBRB 3VR1A 2WTUA 4YDHB 2YWHA 5E7JA 3P4XA 3BS4A 2CK3D 1E2GA 2DY1A 2GILA 3WP0A 4KBFA 1SZPA 5DI3A 2IC5A 5HCNA 1DPFA 1G20E 2GETA 1BKDR 3UANA 2EW1A 2FOLA 1Z6YA 4IKEA 3AVYA 3B1ZA 1Y3AA 3NEJA 5KHOC 3A6PC 1M8PA 1AGRA 1OF1A 2JA1A 4NONA 2X77A 1YZGA 2ZPTX 2XTNA 5EE5B 5AUPB 2P3SA 2QQEA 3U3RA 2GZAA 2GEVA 1G7RA 4L9SA 4M1MA 4Q1AA 2GA8A 3EC2A 4JS0A 1J8MF 4E03A 4PHTA 4FINA 1GILA 2R6AA 1YR8A 2WPDD 2QL6A 1XZPA 3Q5EA 3NWJA 3W3ZB 5DYIA 1EFHA 3J81k 2N1BA 4PQFA 2GBLC 1OKKA 5JI3E 3FMFA 1TNDA 1QVRA 3HU3A 4B76A 4EQ6B 2BWJA 4TL6A 4CYMA 5FOTA 1VYUA 2I1VB 4EQ6A 4CF7A 4MRPA 3ZH9B 5CYPA 3GLFB 2XZPA 5JRJA 2ZUBA 4H9GA 5H68A 3GLFE 1Q57A 2A5FA 2WJJA 2FA9A 4NL4H 4FWIB 3QKRB 3GLFA 1JQJC 2BMJA 4AKEA 3TR5A 3PIRA 4D26A 3VR2A 3QKRA 1WBBA 1E1QD 5HCIA 3THOA 3A1TA 2V54A 1QZMA 3DMDA 1GIAA 4KFRA 1N25A 4IFEA 1E9AA 3BC1A 3HP1A 5FI1B 5EE1A 2BJWA 1FX0B 4L16A 2DFTA 1U0JA 4QG7A 3ZGXA 3RABA 3VR5A 4B47A 2EFCB 4QHSA 4EIWA 5EZ5A 3CLVA 5M04A 1FX0A 1FPMA 2ODWA 2YINC 5H8WA 3ZVMA 3P26A 4XVRA 3KJGA 3A1WA 4GNKA 4NE2A 3W8RA 3IEUA 4X8HA 5C4MA 5CITA 4LJ6A 3K9HA 1CEEA 1MABB 3ASYA 2PZEA 2OT3B 1N6RA 4YDSA 2ZRBA 4MH0R 4Q4JB 1MABA 4QJ5A 4HLUA 1KO5A 2IUSA 2ZRMA 1IN8A 4RJLA 2AWOA 4Q4JA 2C9YA 3ZS8A 3A4NA 2LKCA 3NBXX 2IHBA 5FOUA 1U2RA 4DLWA 1NLFA 5EP4A 2IS4A 1Q3TA 3CF6R 2ZJOA 4IVQA 1VG9B 4LBWA 1RYFA 2IWHA 5L3QB 1GM5A 1CULC 4A3VB 2OE2A 2ZI4A 4IVPA 1OE0A 1P75A 2BKUA 5FL7A 4EPWA 5L3QA 4TZ0A 2WJHA 1YZLA 3U3KA 3FHCB 2ZI9A 3SU8A 2OLJA 3A1UA 5FTLA 1U9IA 1S9DA 4E5UA 3U5ZB 1TEXA 4JL5A 2JIZA 2EWVA 3NC0C 1A1VA 1MO5A 3GJ7A 4R7ZA 4MYCA 4RKFA 1AKYA 3LLUA 2V7QA 4JYCA 4KVGA 2GJAA 2W0MA 3T34A 4F38A 2WIBA 1P6XA 1G3QA 3BAFA 3THXA 4AYWA 2C99A 2ZSBA 1W36C 4ZDWA 4QJ3A 2QRZA 2C78A 5C2JB 4QXAA 1E0SA 4M9XA 2WSSD 3UK6A 1XEXB 1W0JD 1GNPA 2J0VA 3T5DA 2OCAA 1NJFA 4TMVA 2IYWA 1PJRA 1QHSA 1R0ZA 1XEXA 4IVRA 4R2HA 2WAYA 3W34A 1ZMXA 1D9XA 1S1CA 4F4IA 3N5CA 4MRSA 4M9SA 2GF9A 4ASUD 3GQBA 4PC3A 2V1UA 1D5CA 1KMHB 2FX3A 4BRUA 2XAUA 3PXGA 4JKIA 4LHZA 4PZYA 5D3QA 1UKEA 2D2FA 3RRZA 1NN3A 5JEEA 4HDQB 3CF0A 4D82A 1KMHA 2GJSA 5F9FA 3K53A 1CJKC 3D7MA 2V6IA 1QDEA 5DE3A 5FPKA 4KSCA 2QUZA 1KMQA 3ZDQA 1Z22A 1JJ7A 4US0R 1P3JA 3B85A 2IUUA 1XWIA 2PMDA 2VP5A 4RZUA 4Y0VA 4B6FA 4W5HA 3M1IA 1W5TA 2R2AA 1VG1A 2FEOA 5JWOA 4JLDA 3FMOB 2XX3A 1TADA 1VCIA 4LJAA 1UEIA 3JZAA 6Q21A 1KO7A 1FOEB 1MO4A 1ZD9A 2PT7A 4TL8A 2ZRLA 4OJKA 1HQCA 4LDJA 3IUYA 3QOFA 3FWYA 2RB4A 3VU9B 3THWB 4I1VA 3FKSA 2OAP1 2OCBA 3MG9A 3U6KA 4LZZA 2F7SA 3VU9A 3X2SA 3THWA 1NF3A 1ZC4A 4PSAA 1ONBA 4N0EA 3CRQA 1H8ED 4AC9A 1DO2A 3KX2A 5JSZB 1E2NA 2JJ8A 3ZZ0A 1GAJA 4QHTA 5JSZA 3UPUA 3TVDA 2NO6A 1P4SA 2W58A 4P4TA 2A5YB 1R2QA 4OHWA 2IWRA 2J7PD 2ZVQX 1DAGA 4TLAA 1DELA 3IBYA 3REFA 1Z6AA 1G9XA 4MGZR 4KLNA 5BW8A 1G7SA 4KLZA 1KK3A 2G1JA 3NBFA 2MSCB 2OLKA 5J4KA 4LC1A 4HAXA 4JVSB 2PLFA 4NU0A 2FSFA 2ZJBA 2DB3A 2P65A 5IF9A 1J90A 4AKHA 3A58B 4G5QA 2NPIA 1S0UA 5FOWA 2FPMA 4BGDA 2H92A 2IYQA 1GOTA 1TF2A 2RGGA 1KJZA 3GFPA 3ZVRA 2EWWA 2F1JA 1NSTA 1J8YF 4I1OA 1KK1A 3SJBA 4BEJA 3IO5A 4IHQA 1WCV1 1CRPA 4B73A 3GD7A 4LX0A 3KKPA 2ZI3A 4JLVA 1CBUA 3WYFA 1IXZA 3KKQA 2YV5A 4MGIR 4PSKA 3CRMA 1FL9A 2ZE7A 3THYB 2EFGA 2FSIA 3BFKA 3X1WA 1RJ9A 4HLQB 3THYA 4URVR 4RD2A 2WWFA 1G3IA 4Q1EA 3QENA 2LWIA 2REXB 2O8FA 3VHLB 2QZ4A 4YONB 3X1ZA 4A0HA 2AR7A 3K0SA 2A30A 1EK0A 1QHHB 2AKYA 4JT4A 4BLOA 2NO9A 1W2HA 4UXHA 3FE2A 4M1OA 3I8XA 1QHHA 2RGEA 3H4MA 3EA0A 1N6OA 3SJCA 4ACBA 3W3AA 5IK2D 2ORWA 3NTUA 2G88A 4LPKA 3CR8A 2IYZA 4Z1MA 3UMSA 5JJKA 1VKJA 2ZYTX 4LOAA 1KSGA 3V9PA 2GNOA 5E3HA 4X8LA 1C9KA 2H17A 1W49A 1FTNA 1NVMA 3OE7A 2H8KA 5KNDA 2DWZB 3PITA 2PEZA 1IY0A 4C3ZA 3GP8A 3TUJC 2ANCA 2W00A 3MWJA 4DKXA 4DZZA 3U44B 2QEQA 4RD1A 4P32A 5CK5A 3ZD7A 4ZIRB 4LI0A 1E1RA 1Q3HA 1UFQA 3U44A 3VKHA 1G4AE 2G9NA 4ZIRA 5CIWA 4B3FX 4D0NA 1P61B 2Z4SA 2R65A 4ZCMA 4WZBE 1RRCA 5FFMA 3PEYA 2FFBA 2BM0A 3Q85A 5FOVA 4QBFA 1HE8B 4Q1CA 2Q6TA 3EWSA 5LB2A 4JSYA 4Q03A 5FTJA 1U8ZA 1NY6A 2FZLA 4PO1A 1AQYA 1BS1A 2CLSA 3FYHA 4BFWA 4OL0A 4CGZA 1OXSC 4ON9A 2ERYA 4YXWA 4DIEA 2ECKA 2CCJA 3SYKA 1OXVA 4Q7JB 1FNNA 2ZI6A 3QY0A 1ZUHA 4IOKA 2R6DA 5DN6A 3MGCA 5DGXA 1XPRA 4IXNA 3AQ4A 1L2TA 3BH0A 2CEAA 3KXKA 4DDTA 1E0JA 1NIJA 3L82B 3B5JA 2AK2A 4S2EA 3HU2A 3X1XA 3X1DA 2YJTD 1NG1A 2PZGA 1KY3A 2ZJAA 2NPFA 3AB3A 4W7SA 3RS4A 1ZUNB 2R9VA 5CB6A 3H2YA 4JBYA 2ZYWX 5EZ6B 4HAYA 3GJ5A 1N5KA 1XEWX 4BLRA 2J41A 2ZI7A 3IKJA 1UBEA 2QM7A 5FL7D 4IOMA 1LW7A 4DDUA 221PA 3NHBA 3SQWA 2VRWA 1YR6A 2BBOA 2HJVA 4V0ME 2QG6A 4C30A 1HEIA 2A5GA 4C0BA 4DLRA 4V0MA 4Q7MB 2V8OA 1JR6A 1A5TA 4NCJA 2QP9X 3IGFA 3RRMA 3O8DA 3E70C 1P2SA 1OFTA 4Q01A 3CNOA 1W46A 4GDFA 2VEDA 1YZQA 3BB1A 2ZRDA 4XWAA 2XSZA 4JLPA 3TR0A 2W0SA 1KI2A 2WSMA 1XD2B 4NYMQ 2QPTA 4WA7A 1G8FA 2F43A 3CH5A 3KB2A 1DBSA 2A5JA 1E0KA 3C41J 1XD2A 4EAQA 1IONA 3NC1C 1II8B 3RYTC 3WMFA 1SKYB 3DZ8A 1UF9A 1NIPA 1SKYE 2KI5A 3HWSA 3TNFA 3EPJA 3GJ3A 1MH1A 4A36A 1II8A 1D9ZA 4C0AC 2YOFA 1N2CE 5KDOA 5KSPA 4JLNA 4KITB 1KI6B 4M1TA 3K70C 2GXAA 1HH4A 2GKSA 1LV7A 3BK7A 4XVQA 1KI6A 2YOGA 3UXMA 1VIAA 2OFWA 3NXSA 3QEJA 2FN4A 1EFUA 1VMAA 2WJVA 5JCZA 1OH5A 2RGBA 1Q0UA 3VR3A 1F5NA 1FW6A 3U3MA 1OH6A 1SHZA 2FE4A 1DG1G 4FMCF 2G1KA 2ZRIA 3GJ4A 3SYLA 2QE7D 4I81A 1HYQA 2MSEB 3KKNA 2OV2A 4CEHB 4ZKEA 3GPLA 3WY9A 2XOKD 4CEHA 1TAGA 3I3SR 1XMSA 4CVNA 2P6UA 1UBCA 3QSYA 1NMYA 3SFVA 3ZYCA 3HJNA 4IRUB 4TMWA 5FBVB 4ARZB 3PENA 3TH5A 4U7DA 1F3OA 3FKSD 2ZRAA 4EUNA 1GNQA 1D2NA 4ARZA 2D7CA 2QPAA 3SFZA 4PC1A 2C96A 4A0GA 3O47A 1LTQA 4A6PA 3FHOA 5IT5A 4NCNA 2P5TB 5KDLA 3EPLA 2RKOA 4B44A 3KL4A 4DLXA 4OQLA 2ZE5A 3QG1A 4MKIA 4A82A 1SVLA 1W4RA 3CRVA 4WXRA 1Z83A 3HR8A 1DVRA 4EDHA 1KZ7B 3AKDA 4XTRA 3W6OA 5IHPA 4LJ7A 2F1HA 3GJ0A 3PQCA 1P9NA 1XFAA 1XBTA 2IYVA 2RGCA 1G18A 1JJVA 3LW7A 4DLSA 3SOPA 4NKRA 4NYMR 3ASZA 4P3YA 4C2UA 2QPOA 3RVBA 2DFKB 2ODEA 2PMKA 1EWRA 4BLTA 3RS7A 3LVQE 4BFYA 1YU9A 1L8QA 1E99A 2CBZA 5HZHA 3CF2A 1AIPA 3E1SA 2JJ1A 3B7GA 1SVKA 3QJYA 1Q21A 2BBSA 4PXAA 2OXRA 4PC7A 1RW4A 2VP0A 3FMPB 5JMTA 1G7TA 1CF4A 2C5LA 1OB2A 4G0NA 4FD2A 1G5RA 2ZS9A 1YRBA 4O2RA 4LJ5A 3WYGA 2AKAB 1OIVA 1C1YA 1NBME 3L0OA 1KNXA 1RRFA 4OK5A 3SBEA 3MWLA 1XD9A 1HE1C 1NBMA 1KK2A 5DSZA 2VP6A 2VHJA 1A2BA 2QT0A 4KVAA 3SJAA 4PHGA 5B30A 3BRWD 1G17A 2DZNB 2FFQA 2GCOB 4KBGA 1R5BA 1AJEA 1DS6A 1IY2A 3TW4A 5GVRA 3M4YA 2O0KA 4LYFA 4UJ3A 2XTMA 2GEDA 5A0FA 3A37A 1W36D 4XOIA 2GCPA 3AEZA 3LX8A 5GADl 3QVUA 2BBWA 3EZ2A 3SE0A 1N5IA 1NKSA 1NRJB 2WKPA 3T06B 4U5XA 1KSJA 4E09A 2OCPA 2CXXA 1K6MA 1XTIA 3CRW1 1EXMA 3OE7D 3KKOA 3K70B 1BIFA 2QT1A 4BLPA 1RZ3A 4HB3A 2JLVA 1O87A 3LVRE 5FR2A 3IBGA 3VQTA 2P67A 3LA6A 4RZXA 5DI9A 2EQBA 1E9BA 3GEIA 1XNJA 2NTYC 3BWDD 2QAGC 4ASUA 3KB1A 4G01B 1T5IA 5FUYA 1G8YA 1ZVQA 5TV2A 3MHVC 4PSVA 1QHXA 3SNHA 1P62B 1RPZA 1KI3A 3G82C 1RC8A 2OSBA 4Q9KA 4DWJA 1K8RA 4LCBA 1DAEA 2J7KA 2GCNA 2IYYA 4KAXA 1OHHA 8OHMA 4JKYA 2DBYA 4U02A 1T3SA 1NN5A 121PA 2ZJ2A 3QG5A 1CR2A 5CJPA 2ANBA 4YXWD 5TB5A 1ZM4A 3EX7C 2ONJA 2QENA 2BEJA 4RVCA 3WXMA 5DIFA 3F5FA 2XNDA 4Q7LA 2H5EA 4PAMA 4KODA 3FFAA 2RHMA 3EC1A 3PEWA 1Z47A 4PQYA 3SEAA 2G83A 3T1VA 3WRYC 3REGA 1DO0A 4G5GA 4NCHA 5A4JA 3BB4A 1H8HA 3Q8XB 2ASEA 4ZO4A 4P31A 3AM1A 1NMZA 1NY5A 3E2IA 2QBYB 1XU4A 2VO1A 2A9KA 2WWIA 1IOZA 2LCFA 4PO8A 2QBYA 4LBZA 1WBDA 3VFDA 3VAAA 3BB3A 3QKUA 3I92A 2NMVA 3EW9A 1V43A 2FH5B 4DJTA 4YMTA 4D4JA 5SZKB 1CS4C 1T91A 4EPTA 5BWMA 2PJRA 4L8GA 3IO3A 5AJXA 1U0LA 3I32A 3Q72A 4KI0A 1UBFA 4CIDA 1Z2AA 2XSZD 1UM8A 1LF5A 1I2MA 3KJEA 4NH0A 1DE0A 1SQ5A 1Z6GA 3W9YA 3WP1B 1OXUA 2HJGA 3ZIAA 1G4UR 4GZMA 2ZRGA 3D31A 1RYHA 1NVUQ 1UKYA 3CPJB 3EZFA 4IEEA 3MMPA 1S96A 4QHYA 3M0EA 2GF0A 5DNYB 4HAUA 3VX4A 1S3SA 4QM7A 3IHWA 3AKYA 3SI7A 1PV4A 1W44A 2BC9A 3CIOA 4QFMA 1JR3E 3KUDA 2H57A 4Z8XA 1W5SA 5FTNA 1U0HC 1JR3A 2VA8A 1IXSB 1VYTA 4DUGA 1FP6A 5AUQA 2G77B 3VKWA 2OXCA 4NYJQ 3AGQA 3I4LA 1T8TA 2C03A 2WWHA 4HI0E 3R8CA 2WKRA 2HYDA 4AIIA 1R8QA 2GJ9A 3KFXA 4LV8B 4IDPA 4D80A 5LB4A 3I72A 4D6PA 4Z51A 4JVLA 5G3YA 4A0FA 1E9SA 5FR1A 4M1SA 5IK2A 3HYTA 1G7CA 3MLEA 4GZLA 1ESMA 4M8NE 1P2VA 3F3YA 3MSXA 2QAGB 1E4VA 4JJKA 5HE9A 2ZQ5A 3P27A 4DRZA 4ITRC 1OJLA 4LHYA 2BBTA 2QAGA 4LJ8A 3TKLA 4BFVA 1KDPA 1NL3A 5J4HA 4Q1BA 1QG4A 5F9HA 3KDSE 1UBGA 3LD9A 4KU4A 5CIQA 1JB1A 4FIDA 2QSZA 1YZUA 1VHLA 2CE2X 2YWGA 4B6EA 2X8AA 1ZC3A 4DLUA 5FBWB 1Z6TA 3CO5A 3OZXA 2OBLA 1R4AA 1TMKA 2JJ2A 1EX7A 2F6RA 2Z0MA 4QJ4A 1T9HA 1G291 1Z63A 2AK3A 3TUIC 2WVJA 4JN6A 1MRSA 3CNLA 2IXEA 4KYUA 4R71A 1M7GA 4AY2A 3VX3A 1ODFA 1G16A 2WWXA 1VCOA 2OFOA 4DSOA 1DAKA 5IRCD 1UADA 4ACAA 1D6JA 4OI1A 2IF0A 2QMHA 1XMJA 3CR7A 4I99A 1W7AA 5CLQA 1G41A 2IS1A 4JJZA 2D4HA 3A1VA 2I4IA 1TEVA 4OYHA 4HATA 2QMUA 4KFSA 4LYJA 2JJ1D 2ZRPA 3EPHA 5JI2E 1GKUB 4HDCA 2PH1A 4AG6A 4JLBA 521PA 2V55B 4G5SA 3S1AB 4CT4B 3VLFB 1GP2A 1G8GA 1Q1BA 4IXMA 2NG1A 4TZ6A 4MRRA 3ZD6A 2W83A 3S1AA 2PX3A 1UDXA 4NYIQ 4PTLA 1GG2A 1NLZA 1P60A 4LRSA 1K5GA 2X2EA 3IPXA 3AH8A 1ELOA 1ZU5A 3ND9A 1NBMD 1U8YA 2EFEB 4TLDA 2FNAA 2XXAB 5FUXA 3L8ZA 1MRNA 4B71A 4NYJR 1IXRC 2KRKA 5K8TA 4JBWA 2XXAA 3BH6A 4XSGA 4QGFA 1BO6A 1KI7A 5GJCA 2HYIC 1TUEA 3WMGA 4CZ2A 4D25A 2DPXA 2J87A 1NLYA 1XX6A 2G3YA 3QXXA 3TIFA 1YZTA 3K09A 2ORVA 3AF4A 4QRHA 2P5SA 3R7WB 4KXFB 1YZNA 4JBXA 3BH7A 4OI2A 1V5WA 4FXPA 4PZZA 3R7WA 2C9CA 2B6HA 1KO8A 2PZFA 2GK7A 3B1VA 4JVNA 4MYUA 2IYLD 3EZ9A 3K70D 3BBPA 1KI4A 3QKTA 4HDOB 3U2QA 1K5DA 1HQYE 3V00A 1ZCAA 3A4LA 2XJ9A 5B57C 3WNBA 4B75A 2QMEA 2DYKA 2ZSFA 4C2TA 3I5YA 4HYYA 3DM5A 5B64A 4YMSA 4KFTA 2GEUA 2B8WA 3PUWA 3QPVA 4IW3B 4A8JC 4QBIA 2Z5FA 3KTAB 4X8MA 2PBRA 4XWKA 1AA9A 1E2FA 2ODNA 1OHHD 2O5VA 4P4UA 2KB0A 3KTAA 1TL7C 5JLJA 2W2XA 3BORA 2GBLA 1XCGB 3K9LA 1JNYA 2QE7A 2JLSA 2ERXA 4F4JA 1M34E 3P20A 4XIGS 2XOKA 1Z29A 1NN1A 1XB2A 3WBJA 5UKDA 1QHNA 2ZVPX 1QHYA 1X1SA 2XNDD 3Q7QA 1M7BA 4NCIA 3RHFA 2P2LA 3RC3A 4HEJA 2Q9BA 3FDIA 3LXRA 4RKEA 3U61B 2KJQA 4EFNA 4PHFA 2ZRCA 1H8HD 4LC0A 2RHDA 4M4SA 4W5WA 1KAGA 4A2PA 1VECA 4YLGA 5EUQB 2FMXA 2IK8A 4LBYA 2VHCA 1CJTC 1MO3A 1I4LD 1WA5A 3EXAA 1OW3B 3HDTA 2HLDA 4XTCS 5LDDC 2AWNA 3WYAA 3H84A 1ZIPA 3KQNA 5EP1A 1ZNWA 3K0CC 2JLWA 4D4LA 5CDFE 2GXQA 2VBCA 3QPWA 4DEYA 1AZSC 1OFIA 3BJIC 4PC2A 5B2ZA 5CDFA 1ZUIA 2CHVA 2ZTSA 3LBIA 3OAAD 5JS8A 2P6RA 1FMJA 4MITA 2ZRKA 4OI4A 1E0AA 5IDVA 2J9RA 3N70A 2B8TA 4JMPA 4LRWA 4PO9A 421PA 2E87A 1LVGA 2ZE6A 1GFIA 2F3TA 5BYKA 2W2TA 2QY9A 3DMNA 1HUQA 2JLZA 3DVLA 4M53A 5BN5A 4PZLA 3EA5A 1CLUA 1YJ5A 2DHRA 2R44A 4MDEA 4LSGA 3ZIAD 1E3MA 2F55A 1IN6A 4IOLA 3C5CA 1OT3A 5FPHA 2WMOB 4NP6A 2ZUDA 1VG0B 3MRSA 1Z28A 2OBMA 4LJYA 3I62A 1U81A 5H1YA 1E2MA 3N2EA 4GMDA 4WIAA 1WDTA 3L0SA 2YOHA 1HT2E 3QF4B 1XZQA 4BFSA 1SGWA 3QF4A 4D4KA 1JR3D 3U7GA 3B9PA 4M1KA 4OHXA 5D3MB 4DUGD 1E4YA 1G3MA 2AD5A 2C95A 2HT6A 2JEOA 2KSQA 1W36B 2REOA 1VHTA 4AYXA 5D3MA 4NMMA 1I2DA 2JAQA 4WXPA 2GJ8A 4OQMA 1TUIA 4FMBB 1G21E 4HUQB 4URYR 1KK0A 4V0LA 1YZKA 2ONKA 1A2KC 3AJIB 1UDWA 4G3XA 3AVXA 1KOFA 4HUQA 1X1RA 4FMDB 4B3GA 4NBSA 4DT1B 4ZV4A 5EXTA 4LV6A 1J70A 1GSIA 3H1TA 4Q1DA 2CDNA 5GJWC 2QP4A 4DT1A 3VNVA 3BGWA 1JXMA 5KDDA 5GVSA 1HA3A 3LO5A 2OILA 4JVMA 2VH5R 3NBZC 2FWRA 3Q3JB 2JGNA 1E6CA 4IOJA 1E2JA 1E9DA 5DLQC 3SS8A 4A8JB 1GL7A 4ZCIA 1IN5A 3HPRA 3NH6A 2BKEA 4KV9A 5L3RA 3UWOA 5C18A 3CPHA 2Z43A 1BYUA 3BIFA 3VR4A 4C4PA 4AKIA 4C0HA 1N6NA 2IYXA 5BN3A 4DB2A 1N6PA 3ONWA 1ZRHA 4P33A 1E2HA 3DHWC 1G8HA 2OG2A 2JJ2D 3TQCA 4E22A 4TYPA 4Q9IA 1XTQA 1PUIA 1II9A 1LFDB 2FGKA 2WAXA 2HCJB 2H7VA 2J59A 5HR5A 1X86B 3M6AA 1J7KA 3AP1A 3DEFA 1OLOA 1PZNA 4W5JA 2CMKA 2Z4RA 2ZYUX 3P1JA 4L9WA 2JLRA 4JT2A 4UNRA 5HTKA 3C8UA 2UVQA 4HB0A 1GTVA 2IXGA 1KGDA 4MRVA 4TMTA 5B58C 3RRNA 2GHIA 2QQ0A 3I61A 1M74A 3KQKA 3LWNA 2CL7X 3GEHA 4AWXA 2HF8A 4AG5A 4Q4AB 2FSGA 1UEJA 4CRWB 4BEBA 3W90A 3U7HB 2JASA 2NO7A 1NKTA 2BMDA 4Q4AA 1AK2A 2C8VA 3MAAC 2JLYA 4G1UC 4PX9A 2IT1A 2VSXA 3U6BA 1M6NA 5H70A 5SZHB 5CJ2A 3UMFA 5KUTA 3GMTA 1IN7A 3T61A 5C46F 1KDOA 2GAOA 2H16A 1CU1A 4H1VA 4Z8YA 5L8VA 2VP2A 4I1SA 1R10A 4JLAA 3LV8A 1T0HB 5FI0B 1WQ1R 2V1XA 5BXQC 2OHFA 4F92B 2FF7A 3SHWA 3T35A 4MKFA 1EG7A 1JAIA 1SVIA 4LHWA 1JBKA 4C7OB 4B43A 3LAWA 1U8AA 3RS0A 1VTKA 3FTQA 2W6IA 1E2QA 1H65A 1KKMA 1KO4A 4NTZA 3FHTA 2QMOA 4C7OA 1OYYA 2WKQA 3K8YA 1W0KA 4JSTA 1MT0A 1DADA 4P0TA 4YQFA 4GL2A 4JL8A 4BLSA 3TVTA 4MGKR 1U99A 2NZ8A 3NH9A 1Q1QA 5JHHB 2Q0HA 1L4YA 2HDNB 2F1IA 4RCZA 4B34A 2I3BA 2CE7A 4QC2A 2PLRA 1KHTA 4DLVA 3RWMB 2DVWB 2KBFA 5CLLA 1DAMA 3KFVA 4EJSC 4WOPA 4KSBA 3I73A 2RGDA 3ZQJA 4TLEA 5EE9A 4C0KA 3AVWA 2VHQA 1WRBA 3GJ6A 4PFSA 1F48A 4G5RA 4B2LA 1X8JA 4LBVA 1L7VC 2ZRJA 4C0SA 3DOEA 1HT1E 4IDNA 3TGPA 2V3CC 4NDZA 1GVNB 4Q48A 4RZ3A 4QBGB 1GWNA 1JPJA 4PPQA 4PR0A 3RRYA 3E5HA 4R2IA 3LRPA 1TF7A 3EASA 1OIWA 2ZEJA 4L15A 2R8RA 4R98A 4V03A 3EIEA 1E94E 1GZSA 4HSEA 2AXNA 4OBEA 4EPVA 3CBQA 2CLDX 1FQJA 3VNUA 1N5JA 4M22A 3THXB 2OCYC 2JATA 4FCVA 3DOFA 3K0AB 4WZAE 3SJZA 3L0PA 5EP3A 4TL7A 1T8UA 1Z0DA 3I1FA 2EYUA 1TU4A 3GJ8A 3K0AA 4BZPA 1HV8A 5E4FA 1AQUA 1T3LA 5EE0A 2DR3A 4V0NA 5AJZA 1XTSA 3DL0A 2ZIAA 2HLDD 1CXZA 3FGNA 3HR7A 2VHUA 4QNMA 1I4DD 3C5HA 1YQTA 2VHTA 2ZAMA 2ZSEA 3AP3A 3ADDA 2Q3HA 2EYQA 1JPNA 1SVSA 3TBKA 3QNUA 3EIQA 1M1YE 1XEWY 4B74A 1GKIA 3TSOA 3T1QA 4M1WA 4QGHA 2XB4A 4L5BA 2R62A 2IW3A 1ZM9A 4BASA 2QM8A 3NVAA 2RGAA 2ZJZA 4BUJA 4URZR 1N0VC 3FVQA 1KNQA 3LXXA 2IS2A 3B1YA 2QGZA 1S8FA 3AP2A 4B32A 1COWD 4UNPA 1QVAA 3EARA 2JDIA 2Q21A 1CIPA 1F2UB 4LRTA 1F6BA 1X8LA 2RCNA 2WOJA 4LWZA 1AGPA 2YZ2A 4PC6A 4DCUA 2IS6A 3PUYA 1YR9A 2UKDA 5FOXA 1F2UA 4AK9A 2J0UB 3IQXA 4UXJA 3RSLA 2D06A 4TMZA 3K1JA 4AKGA 1CTQA 3WRXC 2J0UA 5AJYA 3PEUA 2ZXUA 2VSFA 3KUCA 3OIUA 2CL0X 2GCOA 2RGNC 4NZYA 2QI9C 1KZGB 5F2EA 5FPTA 1OPXA 4HB4A 1KI9A 2O0HA 4DHEA 1JAHA 2XB2A 2ZYVX 4D0GA 3QF7A 3WHKA 1J99A 4PHHA 4HAZA 3VR6A 2XTZA 2FPLA 4B3DA 4F7WA 3CWZA 5A5GA 2AX4A 2IUTA 3V4RA 4M1YA 4LHXA 2JLUA 4EJSB 1XTJA 1R5NA 3AUXA 4A2WA 1I4TD 2KBEA 1Q1ZA 4F91B 4UJ5A 4JIMA 4EJSA 3LQRA 3PUZA 2C9OA 5TMPA 2X2FA 2ZU6A 2E1RA 3KJIA 2WM9B 4RFSB 5E7MA 1R5OA 4QBHA 2BVNA 5E7IA 4B3CA 3TRFA 2OO7A 4RFSA 3U7FB 2GTPA 2EFHB 3NEYA 2GXSA 4D0LB 2PCLA 4E07A
chains in the Genus database with same CATH superfamily
2QW8A 1HTWA 2BLNA 2ON6A 1BC5A 1H2YA 4P35A 1DTSA 2YWEA 2AJDA 2OGSA 3E58A 1CJUC 2A8YA 5ALIA 3KQHA 3B2EA 2QAJA 3G13A 1Z08A 3ZUGA 5J47A 4PAWA 5ELXA 4K81B 1E61A 1D2MA 5HF9A 3D8NA 2GWHA 5I4BA 2OC4A 4LJ9A 2ZFUA 4BCBA 1Q0RA 3FCSB 4DCNA 3A9CA 4IDEA 4DA4A 3A04A 2F4VB 2A33A 2CL6X 1GZ6A 3ZHRA 3UIEA 2B9EA 3W0FA 4QU5A 5AM0A 1T3HA 3V2GA 3EFEA 4B7FA 2C58A 3VVLA 2X49A 1N3BA 2O05A 5HE8A 5EUMA 1CHNA 2JFHA 3KLPX 3LWZA 1FMTA 4QAQA 1KDYA 4N0DA 4HDSB 3AR9A 4I4TB 1ZZGA 1WPGA 3HM9A 1E1NA 4V02A 2NP7A 3CW2A 4I5FA 3CUKA 4MQEA 2BHNA 4UQPA 3K0FB 3A32A 2VNIA 1JECA 3R40A 1NC3A 1QCCA 1BOFA 2W6QA 1M2OB 3Q7TA 4ANRA 3CHYA 3DAOA 2QGNA 2YCLA 2XUOA 4HG2A 4AF6A 3C4QA 1N9ZA 4LPSA 1P0IA 3QXHA 5JAQA 1EBUA 1ABBA 3LY5A 4GOMD 3WWZA 5JSFA 4PANA 3L8YA 4TMFA 2H18A 3DA8A 3ADCA 4TM8A 5KYUA 1JIXA 1NQWA 3D6VA 1HLPA 1CR0A 2ZYAA 5A2QA 4DDKA 4R31A 1T5HX 4WK6A 3U3JA 3V4SA 3W78A 2B7CA 1ZKMA 1IZ7A 3DMRA 4R2LA 3K9FC 1TQ2A 4U3JA 1RKQA 2P62A 2XODA 1V33A 1QBKC 3QKSA 4H77A 4WBSA 3RKSA 3V4FA 4N01A 4DQKA 3VU1A 4CM9D 1RU3A 5L7YA 5IDWA 1LRJA 4I55F 1KJYA 4X1IB 4X71A 1PNTA 3IJRA 3C3MA 3OFND 4ZCPA 2C0CA 5ENVA 1OAAA 2FWAA 5FBHA 4E21A 4HTAA 1T1JA 1U28A 2FN3A 3G2MA 5FULA 2BKLA 1QFMA 4PGFA 4DR1M 2LIPA 4XSHA 2W98A 1TUBB 2VKTA 4L85A 4E5SA 1TAHA 1EGVB 1MOQA 1UZMA 3S1LA 4DV0B 1K92A 3V9AA 2HHLA 4HRYA 4MP8A 3HNOA 4D2IA 4WKGA 3KSDO 4OG2A 3HGMA 4KCGA 2PUHA 2VQEB 4OJQA 1NLMA 2NTNA 3L8MA 3SJUA 1PD1A 3PFFA 4RHXA 4OB8A 3L79A 1HZZA 3HP4A 2EX4A 2DR0A 2GPTA 3QWIA 4QXOA 2IHVA 4MGYR 2CNWD 1N7HA 1VEGA 3X1KA 1SD5A 4IDCA 4AYTA 4MJLA 4I3FA 3WK5A 3QWBA 3KQYA 1HY3A 4N9QA 5DVZA 4C08A 5IN4A 5FPYA 1H6DA 2WTAA 3D8TA 2XCIA 2Q41A 2V6ZM 3QVSA 3G8CA 5DK4A 1S89A 2ZUEA 3DDOA 3PNPA 1AM4D 1AXRA 4GOOD 5JISA 3DZBA 3P2KA 3Q1KA 4C7VA 4URWR 1NXOA 5I48A 1US8B 1QK5A 3D1JA 3CIFA 4UPDA 5A9RA 1E2DA 3KWJA 3IVXA 4R9UC 2Q6VA 2I22A 2YQ4A 3K5WA 4AZ3B 2OHHA 1I33A 5GKNA 5DOVA 5A06A 3WJ7A 1UT6A 4NABA 1ESCA 1SH7A 3A6DA 4HWSA 1YFLA 1KJNA 4G4NA 1QHEA 3OM1A 1PJZA 4PLZA 1HTTA 4OOFA 1P0MA 3EA4A 1IBLB 3RIGA 2FZKA 1AU9A 4HUTA 3F5DA 1ZJWA 1RWWA 3SF8A 5BMVB 4MYHA 4MVYA 1JLHA 1YJAA 3B6EA 1P4GA 1Q6YA 3KOYE 5DH9A 4F2GA 3LC7O 4IQ8A 1EFCA 3IIMA 3RF7A 2V7VA 1F1BA 2ZI5A 4Z0TA 2Y92A 2AGVA 2AEEA 4TROA 2I2WA 3RE8A 3A10A 3SGLA 4ZT2A 2BIFA 2G6BA 2VAWA 4LGMA 5AI5A 3OIDA 4WAUA 2CD7A 2Z2JA 3TXYA 4GMQA 5FBQB 2QU8A 3ZBQA 2FMKA 1Z0JA 4ZQCB 2YQ5A 4YMUA 1JDUA 1SIBE 5ANRB 1FRVA 1KI8A 3MWKA 4OHOA 4P0PB 1TF0B 2C2GA 5CBKA 2HU5A 2JY8A 3W2FA 1VJRA 3VOSA 5AI8A 2QNRA 1VIYA 4GBJA 1YHNA 1NPDA 4YRMA 3RYFB 1TZKA 1WV1A 1ZIOA 2D54A 5ALKA 2X22A 1PZGA 4ZP1A 3B20A 2E7ZA 1Z6QA 2XDAA 2AOXA 5CDSA 1BJRE 3W6NA 2DHCA 1RHKA 3JQ6A 1FK8A 1GGHA 3KHSA 1WHTB 1VRCA 2GJKA 4O59O 3IMEA 1Z0AA 3WL7A 2E9SA 3PSHA 1XVLA 3G8YA 4ZALA 4RKQA 3ZCSA 4JEUA 1Y82A 4P58A 4R3WA 2QVCA 3OQNA 2IDZA 1FE8A 2G3QA 2HZBA 3B36A 5FWYB 1U9IC 2JC3A 4JEMA 3IXMA 4Z54A 4MUXA 5C37A 2XITA 4C4XA 2YWHA 1JN0A 1C2TA 3IEIA 2P78A 2KHZA 3PRHA 3NEJA 1MB9A 2CYBA 2ZPTX 2P3SA 3COYA 1IWPB 1VXOA 4E1VA 3P0EA 4ITQA 2QL6A 1EFHA 2JVIA 5GAJA 3HGQA 3FCXA 5IZCA 4QGBA 1N4AA 2YCBA 1R0RE 1TVKB 4O3FA 4KKVA 5H68A 3G79A 5CCDA 2ZWVA 1DC3A 4JI3B 3G1TA 4I66A 3QVLA 4V2UA 4DY4A 3CLVA 5M04A 1FPMA 3DXZA 3WQSB 4QICA 2FQYA 2GMWA 3ENKA 3A6KA 5HDQA 4OATA 3VXKA 4LJ6A 3DEHA 3K9HA 4KPGA 2W8BB 4Q4JB 2C4WA 3SFTA 4QJ5A 3GL9A 1R12A 3QY9A 2ALJA 2IHBA 3ILXA 4DMHA 1EAMA 1YQGA 2WU8A 4WLUA 3UUEA 4KSYA 1ESEA 1YZLA 3EDRA 5TQJA 1EX9A 4YV1A 2VDLB 1XMQB 1KQGA 4BMSA 1P6XA 3BAFA 1KZ9A 1E0SA 3ZNPA 4D8YA 1QHSA 4M1ZA 4DC0A 1NI5A 2UZ4A 1QF6A 5D3QA 3PNOA 2XCLA 2HHHM 1SZCA 4X94A 2OOKA 4A2CA 1N77A 1GZHB 5CHYA 4FOSA 2JVKA 2Y0CA 3VYVA 4WESA 1FXUA 1TJYA 4X6YA 2XX3A 5ESRA 3TRDA 2DH5A 1GPUA 1HQCA 2O7VA 1NJ8A 2C7PA 3MG9A 1PRYA 3GRZA 2CUKA 2IUYA 4QUKA 2V6MA 4GKKB 4YIKA 4KACA 3A9UA 4YWHA 2ZKLA 5BW8A 4HR7A 4R0VA 2DKLA 3EDCA 3C4VA 3ZHYA 4QU9A 3M4XA 2P65A 3A58B 1GPKA 5JO9A 5JNVA 1ZAYA 1SFRA 2G4LA 1UKBA 3UAZA 1YUBA 1FNBA 3OIFA 4OCZA 2ZI3A 3SC4A 1LBEA 4PSKA 1VLJA 4DABA 1DT5A 4LZWA 3C1UA 3QYJA 2R1VB 2QZ4A 4DMRA 1JA1A 2NO9A 1GG5A 2UV8A 1LPBB 1JFVA 3GRPA 2G88A 2RG1A 1KSGA 5E8RA 3CURA 3AHGA 2YICA 1K7FB 3VR6H 4EI7A 3DOOA 4LQ4A 2B0JA 5GV7A 1L5YA 1IZ8A 1E5TA 3H8SA 1Q3HA 4LI0A 5J2UF 1X1TA 5CIWA 3EDYA 5LYJF 4WZBA 3I2GA 4QBFA 1X1AA 4DS3A 3FI0A 5EG5A 4CGZA 4IGFA 4ON9A 2O07A 3KKEA 1T2NA 3C6QA 1GYQA 3V34A 3AR2A 1FFEA 2RBKA 5T4EA 3K6SA 1WQ3A 4BLRA 3IKJA 4KAAA 3LXMA 1UINA 1I13A 3TQOA 4NESA 4MZDA 5B58T 3K7EA 1YZQA 3VNBA 4WA7A 1L3CA 1DBSA 3B7WA 3VK7A 4DUZB 1TK9A 4EAQA 4HEA1 3KQQA 2OFPA 3EPRA 4OP1A 4I14A 1FRNA 3T0IA 1N2CE 3OBIA 4HXYA 4NE9A 3QEJA 3EBPA 4DNFA 1F5NA 2HK8A 4DIKA 4RWEA 1M0TA 2XMSA 1S7GA 3CJRA 2R00C 4XWTA 3ZYCA 3HJNA 3I9KA 4J0IA 3KLMX 4BEWA 2ZE5A 2DPHA 1W4RA 3HR8A 3FROA 3KHUA 2EIXA 4AO7A 1U3TA 1G18A 2L7IA 4DLSA 2J3QA 1V39A 4LMPA 2WTNA 6LDHA 1EPUA 3GCDA 2QM3A 3CF2A 5B1IA 2E85A 5KVQA 2ZS9A 1V5GA 3IA7A 4KQ1A 1KIAA 2DWCA 2G9ZA 3JQ8A 4D99A 4JI1B 3DLCA 1GCIA 2NUTA 2FFQA 1DS6A 4U1RA 4RDXA 1V7CA 1N5IA 2YY7A 1NRJB 1GTMA 5K6AA 3R4VA 5B1HA 4C20A 1TM3E 1Y1KE 2WVGA 3PXBA 4IEFB 4X7PA 5G0SA 2MSNA 1QHXA 3EVTA 3FSGD 4R8SA 2I4MA 3FPKA 4LCBA 4QXRA 3W5HA 4BLUA 1KFJB 3CX4A 4MHSA 5DNUA 5K8CA 1AD2A 5TB5A 1VSTA 5KOIA 4N5HX 3GUUA 3HE3A 4GKBA 5TPWB 4G26A 4H7DA 3V76A 3EC1A 2A0YA 4PQYA 1H5NA 2X41A 3R2JA 5J9FA 1SQGA 1IOZA 1DKPA 1BCRB 3R0VA 5A9SA 3IV9A 2NMVA 3I92A 4YMTA 3ROEA 4MRMB 2Z3VA 3MJ4A 2I7XA 3Q72A 1E3DA 4QREA 4XE5A 2EHJA 2M6SA 1Y3CE 4W9RA 2QSUA 4PYKA 1DRJA 3W9YA 1Z6GA 2XH8A 2R1ZA 3SMSA 3TQIA 1NLUA 2ODPA 4HAUA 5C3UA 3DOAA 1S3SA 3HNPA 4LXHA 3MIIA 2PXCA 2HREA 1EDZA 5BW5A 3BMOA 3BIJA 4R2XA 2H57A 4LAFA 5F2OA 1UP7A 4V38A 16PKA 3HWRA 4NU5A 4ZVVA 2PGDA 4U7GA 4MNTA 2ZUSA 1H2WA 3SAWA 1HR0B 2ZQ5A 4X9XA 4ZOEA 2BBTA 3B3FA 3TKLA 4IIXA 1KDPA 3D81A 4QDUA 1WXWA 2WF9A 3WIUA 5EZQA 2YWGA 4D4HA 4QPZA 5BRNA 3QLUC 1Z63A 4JI8B 3IODA 3HJUA 4YP0A 4ACAA 3SLGA 5CX4A 3NAZA 2WSYB 4QTUB 2QYTA 3PQDA 1FFXB 2VDBB 2O9JA 1EFAA 2D4HA 4KFSA 4V0QA 1WB6A 4QQKA 4G5SA 2D0OB 3ZD6A 1Q0HA 2EXXA 4H18A 1D04A 3HG7A 4TLDA 3A9SA 3U6LA 5L6MB 4OM8A 5THKA 3DXFA 4RTKA 3K09A 4PN3A 3WICA 1JG1A 2M6RA 4V1CI 3BH7A 4YRNA 3BJZA 1KPHA 1KI4A 4R1MA 4B75A 4EHAA 3I5YA 2IGBA 3D4IA 1C2YA 3QPVA 3DH0A 3ID6C 5L6LB 2IDMA 2X6TA 4P4UA 4ZGGA 1UC8A 4M9RA 3M5CA 5IMSA 1YB4A 4N49A 1XB2A 3TYXA 1IH8A 1D8AA 2ZVPX 4LCEA 3G8DA 4BHTA 4KWHA 4RF5A 2HAKA 3U6PA 2RHDA 1YACA 1KAGA 4CFSA 5BSVA 4IHJA 3ZY2A 4FUQA 2HLDA 2ZUWA 5ED4A 1ZN2A 1OBVA 1NUPA 1FMJA 3OX1A 2E87A 5ESXA 2XGNA 1HUQA 3IV7A 1CLUA 3CZ9A 4BL5A 1Z25A 3PF9A 1BQ3A 3R7NA 3I6MA 3PU6A 1ESZA 3FD8A 4WFJA 5BW6B 2OCGA 1JEOA 2QUHA 5TGTA 3RUHA 2OMKA 3H1PA 1KOFA 2C57A 4PCLA 2WFLB 1RI4A 3L4BA 4E2XA 2XTJA 4TS9A 5DWQA 5GVSA 5IARA 2YVQA 2H2WA 5D1HA 1T9ZA 2FWRA 3Q3JB 5DLQC 3F6YA 2XXBA 4TXJA 1IN5A 1L4KA 4LJLA 5BN3B 1PDOA 4RDCA 1KEUA 5JR3A 2JLRA 3SHQA 2UVQA 1U7WA 3PXUA 4LXTA 1X14A 3I61A 4X64M 4N18A 3WAGA 1UEJA 1NHGA 1O5TA 5E26A 1Y3IA 4UEWA 5JAIA 3ZGYA 5KUTA 2W6OA 1QZUA 1WM1A 1KDOA 2O01F 3FF4A 4F92B 2JIBA 4S0ZA 3T35A 2ZTLA 4LFCB 4B43A 1U0NA 2CKDA 3CF4A 4B08A 3PDIB 3B9RA 4LFBM 5C8YA 4GL2A 1RZRD 4MGKR 4BBAA 4X1KB 5FWDA 5KIAA 2PLRA 1SXGA 3OZUA 2RGDA 4AXBA 1EIWA 3D2AA 4PFSA 4LBVA 3CLRD 2BDEA 5CU7A 3CTPA 1EUCB 3C85A 5LMNB 3AQIA 1J8QA 2H4XA 2GYVA 4FK8A 2AXNA 4TZKA 2CW5A 1TYCA 5DZSA 3IA2A 5IVHA 1A2OA 3DOFA 3JQAD 1YR3A 4Q3LA 5EP3A 2OD7A 4WECA 5F52A 1TU4A 3K0AA 1K97A 1KPIA 1Y4UA 1OBFO 5COBA 3KOUA 3BBZA 3NDJA 2H9YA 1YBVA 4GP9A 2IU0A 1VGQA 3R3HA 3NRCA 1JG3A 4M87A 5L4SA 4XGIA 1XKLA 5FUQA 3SBJA 1EUDB 3PI6A 2DG2A 5BNIA 2D1TA 4BNXA 3FOFC 2MHCA 2G7MC 2P4QA 4ALLA 4JJEA 4X62M 3C8MA 3EARA 5KCZA 3TOZA 4C6TB 1J4AA 4UXJA 2R3SA 4OFBA 5DM70 4Z49A 2EKDA 2FMIA 1YU6A 4BWVA 2XB2A 4TLLB 4FX2A 1T9GS 1A3CA 1TFUA 4BNHA 3L1UA 3R0JA 3CWZA 2QL7A 2JLUA 5DM1A 4F91B 4CETA 3M70A 4DCOA 3P2MA 4HDAA 3UJNA 1QIJA 3CYFA 3HBFA 2JBWA 3RSSA 4ZKDA 2DQZA 4Q9HA 5HIMA 3IDAA 4A16A 1ORWA 4PZAA 1R0WA 4UHKA 3AB7A 1L4LA 2HI0A 4UHJA 1VE5A 5EQTA 2AFHB 3SR0A 2NSHA 1QIFA 3SYTA 2R8EA 5CDGA 2FZ4A 4JL6A 5EZSA 1FP7A 1WVMA 3NG1A 1Z7YA 4XYEA 1L5NA 3RKUA 5EYPA 1X3SA 1DV1A 1YL6A 2FK7A 1RM3A 2CVHA 3OZSA 2HSWA 1LTMA 3GY0A 5IJ0B 5DHQA 1L5ZA 4OM7A 1LVHA 3RYIA 2X23A 2DWOA 2IF2A 5L8RF 2DCMA 4BXOB 3DMHA 3G0HA 2NLOA 1YVDA 2QRQA 3VH1A 1ZW1A 3GFVA 1KF0A 4ZI2A 5EJIA 4LY6A 4Y9RA 1GUAA 2PQ2A 1IZYA 1ZA1A 4KN9S 4NARA 3QE4A 3RG2A 3DNFA 2P11A 4LK2A 4TT8A 1P77A 3OZTA 4BNLA 2UXBB 5EJFA 5BUCA 4DYDA 3LYLA 1G3UA 4FW9A 1E4EA 1DC7A 3ISVA 2J09A 4EY8A 1Q0QA 2XUFA 2O0JA 1KEVA 3PCRB 1MB3A 2IFTA 3N5KA 3WRWA 3MQ2A 3KW6A 3ZLTA 5BUQA 1P5RA 3N8DA 4B33A 2ZT5A 2X8WA 1OSNA 2OZEA 4QM6A 4X92A 1WXQA 5DGCA 2I1WA 4F5YA 2IXFA 5FSWA 2F1RA 1WZEA 1Y5MA 5I7AA 3FUCA 2HSEA 3CX6A 4FFLA 1I8TA 5CA1F 4I19A 1N34M 1ZD1A 2DUJA 2FTKE 4HNHA 1I7SB 1KFCB 3EGOA 3ER9A 3DD1A 1U98A 3FBGA 4Q4DA 4J0QA 4OI0A 3L4KA 4LVNA 1URPA 2E4WA 3WGUA 2PX0A 4WK4B 1ZSVA 1T6NA 1L5MA 3LUHA 5BW4A 4L1KA 1CUIA 3WNCA 1TH2A 4KOAA 1KETA 2XKJE 3BSYA 1JQBA 4TXLA 3KD3A 3D3JA 2VYVA 2SKDA 5AJTA 1JL3A 1ZVMA 5EHQA 2J5XA 2IL1A 4INZA 3EVFA 4OXNA 3W5AA 3FOEC 1LD3A 3G9QA 2CXOA 2R8YA 3EFBA 3N8IA 3TAHA 3TQSA 1NJ5A 4MYRA 1AK1A 4OHVA 3D3NA 2WE7A 5KQDA 1CB0A 3KAPA 4QLBA 4NNJA 5DGHA 3NDBB 1YSYA 2XUZA 3TG8A 2Y77A 2E0IA 2C2MA 5GPBA 3RROA 3WV4A 3Q2KA 1GV1A 2GXUA 1HQKA 1QFJA 3I04A 2KE5A 3KM0A 5KYKA 3IT3A 1HDGO 1Z0IA 4KDEA 1LLDA 4J3FA 2ZITA 3LUAA 4F93B 4TVKA 4J7CA 4UTOA 3SSOA 3KVYA 3I2IA 5FWXB 4RNAA 4YJHA 4II7A 4FSXA 4B4UA 5HRUA 3A1SA 1U2GA 2H4FA 4PS1A 3H0EA 1SIWA 1NVXQ 2REQB 3ET5A 1Z5UA 4F86A 4C3OB 5J63A 1MV5A 2NZUG 3QYBA 3SY8A 1SXJA 4P16A 4KO8A 3ZK9A 5D8DA 4ZVMA 3ZHVA 3K9PA 1ZYUA 1B1AA 2L0XA 4LCJA 4Q19A 4QEZA 5CPBA 3GPBA 4HFJA 1HDIA 3U19A 4C4AA 1B2RA 1XA0A 1XV5A 3OMLA 1JFLA 1NBEA 4E5KA 3NMUF 2ZR0A 1AS3A 2Q2NA 2F43B 3F2IA 2FPGB 1VOTA 1NU6A 3HCRA 2ZS7A 2O2DA 3IPAA 4BMCA 3HL0A 4FYMA 1OROA 3USZA 3EWAA 3NYWA 1S3GA 2Q8QA 3QLEA 4ZPXA 1YB5A 2C7BA 3O0DA 4MM3B 4WZAA 1BWRA 1YVRA 2GYUA 4M0FA 4CF5A 2H63A 2V9PA 3RGWS 2PKXA 2KS6A 1XPOA 3ZQ6A 4M0WA 3RUAA 2X2OA 4REMA 3GJYA 3MXTA 4YAUA 2QMZA 3I52A 2OKGA 1W34A 4ZI3A 3AGPA 3F2VA 4QLAA 5LC1A 3EGIA 3DCJA 2V65A 5KOYA 4QE3A 3WLOA 3ILYA 2Z9CA 3JYHA 4RZ2A 4IBCA 4CL3A 1E2IA 2AZTA 5HUHA 3F96A 3K9NA 4DIFA 3DOUA 1XD8A 1QIIA 5G41A 2VDVE 4MKZA 2Z95A 4ZVRA 2O3RA 5LMUB 1RSZA 2VDPB 5CM2Z 5A05A 2QROA 2O2HA 3IHPA 3ZU3A 2O8EB 4CEIB 5YASA 4FHGA 1ZMVA 1P7VA 4N65A 3HA7A 3RS3A 2B4RO 1Z8NA 1NW6A 2PS1A 1I2CA 1B93A 2R4JA 2V6FA 3KAKA 4ZRDA 4ZI7F 1XJ0A 2QGFA 1DI0A 5A7GA 3ND8A 1R6BX 1CR4A 4OXXA 4V0OA 2GASA 3K35A 3HYLA 4TKUA 3EYAA 2BMVA 2JJYA 1EVZA 3OZCA 3EH2A 3GJSA 4IDOA 3F0TA 3QXCA 3BZUA 1V3QE 1CFJA 2N46A 1CEYA 2F5PA 3LOPA 5HF5A 2VP9A 5F78A 3EGXB 3WRXA 1X37A 1H9BA 1BN7A 3WZMA 3PPIA 4BWGA 2JFWA 1PSWA 2ZJ8A 4DHWA 3DULA 2EV9A 2CFSA 3A1EA 3UKDA 2DAKA 5E7JA 2WJZB 5EMHA 3WP0A 5DX8A 5HCNA 2AOUB 1CZLA 1BKDR 4C4OA 1Z6YA 1G20A 1SR8A 3L1IA 4Q82A 2HSZA 1H2HA 2X77A 4YCBA 4BLWA 2ZDQA 1EDEA 4L9SA 2QX9A 4QXMA 4E1AA 4PHTA 5CCEA 2I65A 3Q5EA 3BL6A 2EP7A 4P3PA 3JVEA 4ZVNA 3A4IA 4TL6A 4X7BA 4U9IS 2VTBB 2VPXA 4RQBA 4JD5A 4OBBA 2WJJA 4CWAA 4K2AA 3QTLA 4WNAB 3H9BA 3VR2A 3WA6A 3KUKA 4C3UA 4HQLA 4KFRA 1A50B 4F6RA 1XN4A 5EE1A 3ZGXA 2QTBA 4DR5M 2VPWA 2GHRA 3P26A 3OTHA 4V1CA 2H07A 1PEYA 4BU1A 4J76A 4MWTA 2I9PA 2PZEA 1RWBA 4YDSA 4F5WA 2ZYGA 4HLUA 2AWOA 2GEBA 3PIIA 4IJVA 3HB4X 4FU0A 1TJPB 2LKCA 1ZV1A 3BGVA 2IS4A 3CF6R 1FRQA 4EY4A 4J0KA 3RNOA 1VIVA 2WDZA 2ODAA 5L3QB 4REOA 2ZI4A 2GSWA 2WJHA 4K6OA 3PICA 4CGYA 2GCIA 5A4IS 1YB7A 4X20A 3UJHA 1G3QA 3THXA 3VGPA 1VBMA 2FPWA 3OZWA 4FJ1A 1W0JD 2J0VA 2QLTA 5FPPA 4QDOA 3O4JA 4RNCA 4EYQA 4E2ZA 1E60A 2D2FA 5H5JA 3RRZA 3CF0A 2GJSA 2JFPA 2Z4TA 4R1UA 5A3JA 3MTAA 2XGGA 3OCXA 3ANXA 4U7PB 3NB0A 4W5HA 1WL8A 4H4DA 2BZSA 1UPBA 2HBQA 2XMDA 5FWAA 1TADA 2O7RA 3JZAA 3HI6A 4OMFG 1VL0A 3UHFA 2K6GA 3NHFA 3GJZA 3R3YA 1JQDA 3ZV7A 3HBNA 4Z7JA 2W58A 1QYVA 2OGUA 1BW9B 1IFXA 1KK3A 3Q2OA 4HAXA 3DPIA 3NVMB 4ZU6X 4C07A 1NSTA 4YV0A 2W37A 5TEWA 5KOJA 4IBFA 2ENUA 3GFFA 1CBUA 3DEAA 1YS7A 4H0NA 3X1WA 4Q1EA 4YRQA 3T9AA 2AR7A 3F1LA 1ZJ5A 4BLOA 1QHHA 4U2CA 5CAEB 3H4MA 5IK2D 3NTUA 1U4SA 2ADOA 1K0FA 3PXXA 4OHCA 4KRGA 1PGOA 2VDJA 2XIJA 3U9SA 1DRUA 2ANCA 3DAHA 1HNXB 5KTKA 5B4TA 1GGMA 1HPLA 4PRKA 4O29A 4BZZA 4EP1A 1AXGA 4JHLA 2PXXA 4D0NA 3PEYA 3G7UA 3QRWA 5FOVA 3SQNA 1E5VA 1ODSA 4Q1CA 4JSYA 3SAUA 2H11A 3V8QA 3FYHA 2Q7OE 3HSSA 5IJ9B 4EL5A 5KNBH 2C0QA 4Q7JA 4AF8A 2YFQA 2ZWMA 3OQIB 3O2SB 1NG1A 3AB3A 4W7SA 4BFLA 2W6MA 3EXIB 5HA5A 2ZI7A 4CF6A 4DDHA 4PYLA 3CUUA 4UVGA 4RQAA 3P5SA 1L4FA 4KH1A 4B3MM 3IB3A 1Q16A 2PU5A 2XEDA 1Z12A 3ZJVA 1AQJA 3STYA 4EDFA 4RTMA 1KI2A 3PNMA 1AT1A 3CH5A 3TECE 1JMKC 3L7OA 1D7AA 4NZMA 3RYTC 1SKYB 2DAEA 3U7IA 3GRVA 5K0GA 4KITB 5K3OA 1NX9A 1U1GA 3N53A 2XMGA 4ARSA 3UXMA 5JCZA 2WJVA 4UVEA 5H82A 3MMSA 2C7GA 3AEQB 3H2SA 1D2AA 5L95A 1TAGA 2EW2A 2VK2A 4JYMA 2FRXA 3RE1A 3TWOA 4S12A 4ARZA 4Y30A 4PC1A 3OKAA 5K3BA 3CUTA 5HM8A 2P5TA 1STOA 3H17A 4J2TA 4EDHA 3VO9A 4XUGB 2ETXA 1PZHA 2PMKA 1VSQA 3M33A 2J3JA 2ADMA 3UWSA 3QJYA 1GGFA 1Q21A 4C7KA 1PSZA 4O1MA 3L0OA 1KK2A 4K1LA 3IR7A 1UT5A 5LYJA 4MIEA 3NYRA 3WDSA 3P0IA 1SELA 4P9NA 1MJGM 5GVRA 3JS5A 4XOIA 5AK5A 1UXIA 4Z6YA 2FWMX 4BC0A 3UJAA 5K8VA 2FH0A 1YQQA 2XWQA 1VMIA 1RZ3A 3NFRA 2KYRA 3LVRE 2QUKA 2F1OA 3IVCA 2NU6A 2QAGC 3KB1A 1G8YA 3MHVC 4AU1A 1Z4MA 1GRVA 1JSXA 1OFVA 1SQ0A 4XQ0A 1JQEA 4GAEA 1NI4A 2JFFA 4KR0A 3M6MD 3L6OO 3OPYI 2H1CA 5TJHA 3UAOA 3U0BA 5IU6A 1BU5A 4NCHA 3ZQ4A 1FNSA 2ASEA 3GYGA 3U7QA 1G4HA 2WE8A 2IZ6A 3TSCA 2G0AA 1TW2A 3COZA 3BSFA 1I3LA 4P2BA 2IKQA 1A5BB 4Z2AA 2W4IA 3PNBA 3DMTC 3U4IA 2VQFM 4DV4M 2FHPA 3MMPA 4LGCA 1XQ9A 3AG5A 3DG9A 5DNYA 4BO3A 2C7OA 4Z8XA 2BRUA 2UZ1B 4FGJA 3OHSX 4KTVE 4FT4A 2OXCA 3OQPA 5BQOA 1I2AA 2HYDA 5KVVA 4K2HA 2WTEA 4EFKA 4ZC8A 3IUMA 1K0UA 3N0XA 1QRUA 2QZ9A 2QAGB 3QYAA 1N3YA 3UKOA 3RGPA 3IAM1 3QWLA 5F35A 4CU2A 1V47A 2QSZA 1YZUA 1CW2B 1ZC3A 3EQ2A 1P91A 1T9HA 3PFCA 2WVJA 4X41A 1VKZA 1XHLA 3LOUA 4JN6A 3PTAA 2MWMA 1SQ6A 1VLVA 3EXG2 4R05A 3D3KA 3ABZA 5LQJA 4AMGA 1T26A 1GKUB 5CB0A 4IXMA 4B7HA 2XQVA 4MRRA 5A7HA 5C51B 4KVFA 1M2VA 4NQZA 1NNSA 3LRTA 1A9XA 2B4KA 4KN5A 3ZI4A 1QGUB 2HPAA 2DPXA 5EFZA 3QXXA 4H7KA 2FEPA 4U0JA 4MQUA 5KPZA 5AW0A 1B26A 1MBZA 3J80A 4E4YA 3DJYA 4QQFA 5K0FA 1RPNA 1LFAA 1GSAA 3Q12A 2WNIA 3HB9A 2GRAA 3T4XA 3A4LA 2MINB 4RVDA 3N05A 2WA2A 1KU6A 4BKOA 4BJ6A 4QBIA 1E20A 2ODNA 2YH2A 3AOEA 5GZ1A 4KPYA 1QGED 2ERXA 3HXPA 1M34E 3P20A 2XOKA 1Z29A 1KQPA 2GERA 3PPVA 2OSVA 1AXEA 4NCIA 3MTJA 3FDIA 3PFKA 2CXHA 5KU7A 4EEZA 1DQZA 4ZHQF 1WA5A 1DCTA 5LDDC 3W5VA 1GV0A 2HMAA 4PC2A 5CDFA 3DP7A 2I3DA 5KYGA 2CHVA 1C9EA 5M7EA 1PSDA 2MSLA 4L2IB 2SECE 2OBXA 3BXWA 3EA5A 1YJ5A 2D1RA 4MDEA 4NMLA 1DUIA 4OX9M 4UM9B 1Z8HA 2GZRA 3QF4B 2W6PA 2JPDA 2EL9A 4AYXA 4WXPA 1KAEA 4HUQB 5JCXA 1Q0LA 1JHOA 3G6WA 4W5RA 5A62A 2L09A 1UJ4A 4ZV4A 1TZJA 4Y1EA 4Q1DA 3VNVA 5KHAA 3RYHB 4DA0A 2BPOA 5EFOA 2H5LA 3GGGA 3ESBA 4AJPA 2OG2A 4JJIA 3QKIA 2Z4RA 4ZGBA 4UNRA 3HBJA 1ZMTA 4NRVA 3HHYA 2BKXA 5FLEX 1J39A 2AN1A 2ZZNA 4AZ0A 2NZWA 4Q4AB 3U7HB 1FVXA 3ZK7A 2G07A 5F4ZA 2D3TA 5H70A 5A3VA 1I2ZA 1HNWM 3LV8A 5ICCA 3A45A 1N36M 3ESDA 3E27A 1SVIA 1L7RA 3PX2A 5CMLA 1ECCA 4GPIB 3FHTA 1W0KA 2J3LA 3HKPA 4YJ2A 2NZ8A 5B1SA 4ZXFA 4DNPA 4BNJA 2CE7A 1LU9A 3AR3A 1FU4A 1K3WA 4EVQA 4OLHA 4B09A 4DUPA 3GLRA 4B2LA 3CE9A 4BX8A 4XYMA 3RRYA 5H37D 3RREA 4Z9FA 1NZDA 5AH0A 1Y3FE 3AI7A 1Z5GA 3LMKA 5I7EA 3STWA 1TJ5A 4ENTA 2VF4X 3FY4A 3HCOA 2PGJA 4MI6A 2PE5A 4D3SA 1HEYA 2IPLA 3AR7A 1V35A 2AT1A 2QN1A 5AJZA 4YRIA 3C98A 5AM2A 4R83A 2HPZA 6CHYA 2H1OA 2ZAMA 1GQ2A 3Q7RA 3AP3A 4EY5A 5AIAA 1M1YE 2ZBVA 5LQAA 3T1QA 3B89A 1PTJA 3WO0A 5I7HA 2YYSA 4ISBA 2WD7A 1SA0A 3QOWA 2QGZA 5EJ7A 1MO2A 3AP2A 2PH5A 1CIPA 2IS6A 1OLSA 1UIMA 4MDYA 1GQQA 4K6KA 4X1YA 2J0UA 3LYAA 2ZXUA 3PF8A 1F06A 1XLTC 2A59A 3H87A 4D0GA 1WD5A 4UBJA 4PHHA 1C7ZA 1WY5A 3T6PA 2Z7JA 1R5NA 2JA2A 5LQUA 3EFHA 3U6SA 2Q8PA 1S2GA 4L5YA 2Q1XA 3U7FB 3MZ0A 5CVCA 3NEYA 2P9GA 5CT5A 2V3WA 2PGIA 3INTA 4Z4HA 1GZ3A 4G4JA 3UENA 2WG2A 1JFTA 2F64A 2P0EA 3BILA 2ODBA 4L4UA 3HCAA 4D3XA 3GJQA 2VJAA 5LZ9A 2G7ZA 4AJNA 1NOIA 3PX7A 1KXZA 2RGXA 1FUUA 1QNLA 3A1FA 4YRZA 2GM9A 5KJEA 3IPLA 5H7XA 1EA5A 4FEEA 1JLMA 3CT4A 4HWTA 2JLXA 2XZLA 4C3VA 2CHUA 5DBFA 1UT8A 4ND8B 1ZR2A 3BERA 1DBRA 1XTVA 2AOVA 2HV9A 2ZIVB 1VC2A 3O8BA 1H2AS 3MCVA 4MGEA 3UZUA 2VZ8A 4OP3A 1BHQ1 2NOAA 4HGOA 2VS1A 4RIFA 2CVPA 1E98A 3U09A 4TN1A 1ZUD1 3FZQA 4L0MA 4L08A 3Q5DA 1VPDA 4ZA2A 2B92A 1A27A 4K9QA 2EZ4A 4B3RM 2FUNB 2IYTA 4XDGA 2A0UA 4PX2A 1EM8B 1FTGA 3JWGA 1YRAA 2WB2A 3ZBUA 3F73A 1JKJA 3RI3A 1IM2A 4ZCSA 1CIVA 5DYWA 2WUGA 2DFDA 1B0PA 2HJSA 1CUBA 3FFTA 3U6CA 1U3GA 3TLGA 4NPCA 1GADO 3LUDA 1KKUA 4OIMA 1TD1A 4U7FA 3BL5A 2AL7A 2CVFA 5FH9A 3TW8A 1WW8A 3JAWA 4Z0NA 3KWFA 2V0CA 1RHUA 4G0ZA 2EAUA 2DERA 3V8MA 4PW0A 3IAAA 3U31A 5F76A 3SDBA 3FWHA 1JTVA 1HI9A 4N6NA 2OFXA 1U9YA 1ZBQA 3TLCA 2G72A 4G5OA 3BBLA 4MJXA 5D86A 2L2DA 1GZVA 2XMCA 1OYVA 1OH7A 3GLHA 2ZIXA 2CV1A 1H93A 3LDUA 1C7YA 5CEFA 2YFKA 2FFHA 3U7EB 3GPUA 1R0KA 1LBTA 2FN9A 4QEKA 4FFBA 2C82A 1Y6QA 5KHLB 4TKVB 3QE0A 1YL5A 2VUTA 1KI1A 1DG3A 3SHFA 3STUA 3MTGA 1IHUA 2FPRA 4DG5A 4RPIA 1T1IA 4AKSA 1YF3A 4TL9A 2CNBA 3UT5A 4UXIA 2J4FA 3Q8GA 4QLOA 4YMLA 5E38A 5AOAA 3R9XB 4RTLA 1KZYC 5K01A 1VG8A 1VA4A 4YBRA 3EAFA 5JJIA 1ATZA 1BMFD 1AKNA 2I62A 4O0MA 3IPCA 4QYIA 4RE6A 3HX3A 1UOPA 4CG0A 1KE2A 4JNKA 4OU4A 1KBOA 4J1NA 4G9EA 2QORA 1W4LA 1JDPA 4UHHA 4PZUA 4NJOA 1UMBB 1NBHA 2AHOA 3ETLA 2VDRB 3RSGA 3AEKB 3L8CA 3BWCA 1D0IA 3PC6A 1E7QA 5HKLA 3OLVA 4AJLA 4UOZA 1XZIA 3WHIA 1JP7A 3DE0X 4JHXA 1BEEA 2EU8A 4MCIA 2QN9A 1CQJB 1CNMA 2NO0A 1N0WA 3IQGX 1DOZA 1NT4A 1Z07A 1Y42X 4CTOA 4HNTA 2YKGA 3AV0B 4OBXA 1E6EA 4CTMA 1RWKA 2I33A 2P2GA 1NXXA 1Q84A 4D96A 4IZ6A 2K5UA 4EUHA 2M1XA 5AUOB 2BFMA 3L43A 1A76A 1MFZA 4FVTA 3HBMA 2V5VA