4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Fidgetin-like protein 1
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
3ZYCA 1C1KA 2ZTSA 1NN1A 2ECKA 5FTKA 2QPOA 2SHKA 1NN5A 1Z2CA 4MYTA 2CXXA 2ZUDA 3NTUA 5CYPA 2ZROA 3H86A 3CWZA 2PCLA 4Q03A 4LYHA 4V0NA 5FPTA 3MSXA 2OEPA 3OAAA 3DL0A 4MYCA 3BJIC 2R6DA 4TMVA 1H8EA 4UXJA 1C9KA 4C30A 3IO3A 2REXB 1KK0A 1X1RA 5BN4A 4QNMA 3LRPA 2O8EB 1KAOA 2IS4A 2VPPA 1KJWA 1RJ9A 4HAUA 5DSZA 2RHMA 1S9DA 4BQSA 4FMBB 3UXMA 1KK3A 2ZE6A 3LO5A 1KO5A 2OCYC 2PX0A 4R9UC 3ZLJA 1U9IA 2VL7A 2PBRA 3K53A 4Q4JB 2OILA 4TT3D 1CP2A 5DIFA 3SYKA 4TT3A 1UKEA 1F2TA 1UDWA 2ZREA 3N5CA 2GJ9A 4RZUA 4PPFA 1E1RD 1RZ3A 4X8LA 2WJJA 2BKEA 4V02A 4G01B 2V4ZA 2Q9CA 2ZRMA 4A2QA 1P2TA 2IXFA 1AN0A 1EFUA 1W0JD 2XZPA 2ZRFA 2WJYA 3OE7A 1LV7A 4FWIB 3BBPA 1S3SA 2OBNA 1XWIA 2GILA 3L43A 1K5GA 2WWHA 4EAQA 1XTRA 4YLGA 2AX4A 2CK3D 2FH5B 1OSNA 2GBLC 2F1JA 2I3BA 3HP1A 3NHBA 4HUQB 3VMFA 3A4MA 4AG5A 2O8CA 2QL6A 1IHUA 4MDFA 1TL7C 1N25A 4WW0A 3LVRE 1OYWA 2A78A 2V6JA 4JJZA 3CKLA 1E2IA 1N3BA 3KTAA 1NY6A 1OW3B 1SZPA 1OJLA 1E2JA 3UPUA 1UM8A 4A0GA 2BBSA 4TLAA 4IRUB 3QVVA 4A2WA 4QGAA 1MRNA 3T61A 1UDXA 3IILA 2HJVA 3LY5A 1MO6A 2ZSEA 3GLGA 3SOPA 2REBA 3K0AA 4Q5IA 5ANRB 1M7HA 1JAIA 1RKBA 1GTVA 1G9XA 2P2LA 1YR7A 5KTYA 1P2SA 3UIEA 3HU1A 4LC0A 2O8BA 4RCZA 1KMQA 521PA 1JECA 4G5SA 3R9IA 1W0KD 1YHNA 5KUTA 4LBYA 2ATXA 1VHTA 3A6PC 4RKFA 4D81A 3O8BA 5SZHB 1KK2A 1H8HD 2ZUBA 2ZYVX 2QMUA 5H8WA 1KOFA 1U81A 1NN0A 4Q9KA 4G3XA 3MWLA 3K0FB 2ZS8A 2F6RA 4ZDWA 3W5JA 1UF9A 3RANA 3Q7PA 3B6EA 2QZ4A 1AS2A 3FDIA 4CYMA 1L7VC 3D7MA 4JBYA 4DIDA 3WYGA 2D7CA 3ETLA 1DEKA 2HF8A 3Q85A 1PUIA 4LJAA 1VCOA 4X8MA 4ESVA 2PLFA 4C2TA 2YV5A 3ZS8A 4LRTA 3W8RA 2C98A 1PVOA 4QJ5A 5BWMA 4IW3B 4JLKA 3TRFA 3QUSA 4IDPA 1OH8A 2VHTA 3H4MA 1NMXA 3N2IA 1GRRA 1R5NA 4TYQA 5CJPA 2NTYC 4C0KA 4EFNA 3MFYA 5GJCA 3TNFA 4HLUC 3AEZA 4A8JC 5AUOB 2ZYWX 3PITA 1T91A 1Z29A 2V6IA 4PR0A 5B57C 3THXB 3PEUA 3PR1A 4C7OA 1RRGA 1SXJE 3W9YA 3RWMB 3VQTA 5F9FA 5BQ5A 1NG1A 1FX0B 3K9HA 2FNAA 4LCBA 4IVPA 3GLIB 1ZM4A 2QGZA 4QKQA 1BKDR 3SYNA 5JEEA 4MDEA 4PHGA 3BFVA 1G5PA 1P3JA 3FHOA 3TAHA 3WYFA 1YZGA 3Q3JB 2G1KA 2X2EA 5EXPA 1FW6A 2F9MA 5DNYB 1Z47A 4EJSC 1Q1ZA 4CGZA 3KQUA 4A6PA 4ON9A 4OL0A 2W00A 2AD1A 3Q8XB 5LDDC 1ZCAA 3KQNA 3CZPA 3GLFB 5KDLA 3SQXA 4N3NA 3UMFA 1XRJA 3TH5A 1MT0A 3ICQB 1AA9A 1OIWA 5DE3A 3G0HA 1ZNZA 2WSSD 4BECA 5FTNA 4CEJB 3NIBA 2FOLA 1CRQA 4NCIA 1TQ2A 4Q4HB 3ZIAD 5KDDA 2QEQA 3A1VA 1IBRA 1YZTA 2OESA 3LNCA 3CH4B 1G8GA 1II0A 3U5ZB 1QG4A 2IUTA 4KSBA 4ARZB 1Z0KA 2FWRA 1UBCA 4HATA 4NDZA 4U02A 3QG1A 4C0JA 1EX7A 4WBSA 2CJWB 1KHTA 3B13B 1WP9A 4TQ9A 4BRUA 3MHVC 1KDRA 4PAQA 4NZYA 1GSIA 5EE9A 5FTMA 1KIMA 5CM8B 4F92B 2R65A 4YXWD 2BDTA 3HPRA 1U98A 1UJ2A 1X6VA 1AS0A 4P4SB 1G4UR 2JIZA 1M6NA 1IXRC 3HPQA 5JRZA 5FPYA 1GM5A 2F1IA 1Q1BA 5LD2B 1E2LA 4HLQB 4B74A 1K6MA 2ODNA 4P31A 3KX2A 1PUJA 2PT5A 1KZ7B 2ZJ2A 3REGA 2QROA 3UMRA 3I32A 3UANA 5HKKA 1VIAA 3C15C 3KKMA 4GMDA 5SZJA 3C5HA 3RSLA 2VP5A 5FOXA 3PV0A 4B6FA 2CBZA 3NHAA 3PUYA 2DFLA 2X1VA 4RJLA 4B33A 3M6AA 5JI2E 1OKKA 2O5VA 5FL7A 2NO7A 3RNLA 1VMAA 1L4UA 3DM5A 1NRJB 2DB3A 4HZUA 5G41A 5LB4A 1XTKA 2ZR0A 3LXXA 5FBLB 4KYIB 2G9NA 2PX3A 1N6OA 2H92A 3OIYA 4H1UA 2QE7D 3HR7A 5FUXA 5DHAA 3S1AA 1Z8FA 2WBLC 2ZSBA 3SEAA 2XXAA 4BLRA 1S2MA 2EWVA 3UWOA 3EG5A 2IYQA 3K8YA 4MGYR 4B48A 4EPVA 4GI7A 2W83A 3QKTA 1GNPA 3V9PA 2UKDA 4JS0A 3AKDA 4I81A 4E07A 5HPYB 2YZ2A 2ZSDA 3RAPR 2OCBA 2J7PA 5FBRB 1CIPA 3TVDA 1E2QA 4A92A 2Q3MA 4CEHA 4TMZA 1ZM9A 2JDID 1E98A 1W44A 3UWKA 4AI6A 5C4MA 4HI0E 4NHOA 1KO1A 2W6IA 2GJAA 4XIGS 4BZPA 4Q21A 3U3JA 2G1JA 4HSEA 5H70A 4KI0A 4POAA 2G83A 4BFVA 1D6JA 2IEZA 4I1SA 1NVVR 4LHXA 1VECA 1N6LA 3ZDQA 4GP7A 4B3DA 2P67A 5KNCA 4UNRA 1E79A 1X8LA 4QBFA 5BW8A 1BYUA 4NYIQ 4PPGA 1N5IA 1CTQA 3BORA 1IQPA 4FINA 1NBME 3I5YA 4HLDA 3UATA 4BLSA 1ZRHA 4C0AC 3NBZC 4HAWA 2Q0HA 2PCJA 4C3ZA 4OI1A 5JJLA 2JJ2D 5BYKA 5KSZA 2IYVA 3C7KA 4A6XA 2ZRJA 2O8DA 121PA 1X1SA 1T3HA 5H1YA 2GF0A 2W2TA 2GVDC 2OSBA 4A4DA 1LF0A 1NG9A 2ATVA 2YOGA 3AKEA 3AVWA 1FOEB 1NLZA 3PUXA 4PPQA 4OHYA 4WZ6A 2QG6A 3WNBA 1QF9A 2LKCA 3CONA 2FSIA 1UBEA 2REOA 5IF9A 1WDTA 1ZNYA 3CX7A 3H2YA 5FPKA 2F7SA 2GK6A 3WNCA 2QAJA 2BBOA 4EPWA 3RRYA 3NEYA 4X8OA 1EFTA 4W5HA 3NG1A 4HLCA 1XXHA 3SE0A 3THOA 3IHLA 1HT1E 3K0EA 3PUWA 2P6RA 1N0WA 5EE5B 2CE2X 4DXAA 4ZDJA 1DAMA 3G5UA 4XVUA 1P2VA 1XX6A 2X8AA 1G8YA 1SXJC 4V0KA 5JS8A 2RGDA 3KQHA 2XGJA 5F98A 4OYHA 1K8RA 2R2AA 3L8ZA 5B58C 1XP8A 1BH2A 4N0DA 1TPZA 3BS4A 2V1XA 4IOMA 4D0LB 2CVHA 3CX8A 3LV8A 3BAFA 3OAAD 4E5UA 3HR8A 3CWQA 1CEEA 3TUZC 4UNQA 4IXMA 2ZXUA 1SVLA 1S1MA 2E87A 4RFVA 3GJ3A 2CLDX 1U99A 4DSTA 3PEWA 1LW7A 5F3WB 5AK0A 1W2HA 2VHUA 4PSVA 2R62A 1G5TA 1XJCA 1XMVA 2V54A 4PAMA 3CW2A 4WIAA 2YWFA 3RC3A 1OB5A 1OXVA 1U0HC 1BYIA 1V5WA 5L3QB 1TU4A 3LLMA 2WVJA 3MAAC 5AUQA 3SZRA 5TMPA 2OZEA 2WM9B 1YRAA 3B7GA 3UMSA 1UEJA 2QBYA 1IN5A 1ZUNB 2F55A 2PMKA 3B2EA 1Z0IA 3I72A 4C2UA 4TSFD 2R9VA 3RHFA 3WMFA 1E2KA 2W58A 1XU4A 3E1SA 4Z1MD 5AWFC 1E2FA 1ZUIA 3WP1B 4ZPXA 1K5DA 4KO8A 3IIJA 2NO1A 2C8VA 1TEXA 2GK7A 4NPHA 2Q6TA 2RGNA 3A1UA 4TLCA 1G1MA 5L3VA 1VPLA 4LK2A 3KDSE 1FTSA 1SVMA 1G8PA 1KI3A 3GLHE 4QJ4A 2FFAA 5CLLA 6Q21A 1G3QA 3AQ4A 2BBWA 2KBEA 3THYA 4A36A 3AVTA 4WXPA 3EW9A 1SKQA 421PA 1XF9A 1M7BA 2C9CA 2FFHA 2JCSA 1SXJA 1N2CE 4D25A 3M4YA 4ACAA 2DY1A 2W2XA 3C41J 5DGXA 2A5GA 1T0HB 2VSOA 3LH5A 4NYJQ 3GLHA 1JI0A 2Z43A 4JBXA 4AYWA 4AKIA 1TUIA 4UKDA 1T8TA 1AGRA 2QPTA 4F38A 4Q01A 1CULC 2V7QD 3MUFA 2PZGA 3GFPA 2ZRNA 4LRSA 4BUJA 2WKQA 4NCKA 5CYOA 2JEOA 3AV0B 3U3KA 5J4HA 1AKEA 4G5RA 1YZQA 2FFQA 4V0LA 5BYJA 4IVQA 2QRZA 4FWHA 2JLYA 4M21A 1J8MF 4BFWA 4MGZR 5EXXA 1IM2A 4LWZA 1M7GA 2IBMA 1N5LA 3Q7QA 4D80A 4PTLA 3B1ZA 4JJKA 3AUYA 2XTMA 1ESMA 2PH1A 4S2EA 1IY2A 1QBKC 4ITRC 1LNZA 2Y8EA 3MG9A 4NH0A 2ZANA 5FPHA 1KI9A 4OQNA 3FKQA 1XMJA 1MO5A 2BMEA 4I99A 3OEHD 4MRSA 4TYPA 1NBMA 1HQCA 2NQ2C 1G16A 3IPYA 3GJ4A 1DE0A 3IGFA 3TJZA 2VHCA 4JLVA 1XMIA 4HUQA 1US8B 4LYAA 1D2EA 4Y0AA 1UBFA 2QP4A 1MRSA 3FFAA 3H1TA 3RSOA 4A0FA 4LSGA 1JJ7A 4D4MA 5G40A 2FA9A 1XXHB 2C96A 4IEEA 2FDCA 3PUVA 4C0HA 2EYQA 621PA 2HCJB 2J46A 4IVRA 4MUAA 4E03A 5JWRA 1ESNA 2MMGA 1E0SA 2DWZB 5KOYA 4Q7LA 4KJZA 1U8YA 3A58B 3EA5A 2HXSA 3I61A 2D4HA 5HE9A 4GP6A 3CIOA 4NTZA 5JHHB 2OV2A 2VP4A 4TL9A 4Q4AA 2GZHA 1J99A 1Y3AA 3QOFA 4B3CA 1WB9A 5JBQA 2KBFA 4LV5B 4Z51A 2DR3A 2WZQA 2W2VA 1OV4A 5C1BA 5FOTA 4DT1B 5L3SB 4V03A 1JEEA 2FV8A 2XJ4A 4QGGA 2B8TA 3ZVNA 4QOSA 1WBDA 5CIQA 3GCGA 1XNJA 4PANA 1SVIA 2VTKA 1E9FA 1VYUA 2ZVQX 3ASYA 1G7SA 4PC7A 3EC1A 4HB2A 1NI3A 5FTLA 4OQXA 5FPSA 3VTKA 1VKJA 2ZJ8A 2IWHA 1KDOA 4O2LA 5DN6A 1XB2A 1G17A 1W5SA 4NKRA 2QP9X 1HYQA 3U7GA 1U2RA 2IWRA 2DPXA 2V1UA 4B35A 4BFYA 3U44B 3A4LA 3IQXA 2UZIR 5CIWA 3C8UA 3AJIB 1E1RA 1QHNA 1NIJA 1P9RA 1BS1A 2IYSA 2WHXA 4S35A 1FNMA 1OXTA 5JZVA 1P6XA 2IC5A 5EXTA 2AK3A 4P4SA 3KXLA 2MSEB 2FPLA 1P7CA 3UG6A 3SYLA 2OAQ1 2YINC 2XTZA 3VKGA 5HZKA 5LD2C 4EKDA 5HR5A 1BOFA 3VX3A 5JWOA 4KFUA 2AXNA 1W7AA 4ZKDA 4TLDA 4MRPA 5DISB 4OQLA 3I62A 4ASUA 2O8FB 2I1QA 2DZOB 2HV8A 2IUUA 4M9SA 2IYLD 2AXPA 3E2IA 2YOFA 1F2UB 1MO4A 1Q3HA 3ZVRA 2J59A 2JJ1A 4JL8A 8OHMA 2AFHE 5FBVB 1XDBA 3NXSA 4PC3A 2C04A 4B75A 5FOWA 1DAIA 1AKYA 4QGHA 4GDFA 3J81k 2QRNA 4P4TA 4CEJA 1G5RA 2IX3A 3EPJA 4DHEA 2A30A 4RKEA 3LXRA 4TLBA 4FI3C 3GMTA 3CRRA 1IN4A 2OLJA 5TB5A 2WPDD 1HY3A 1Q57A 4E09A 2WPDA 2PZEA 4PZZA 2J41A 4L16A 1AIPA 5B64A 4JMPA 4NYIR 3AGPA 4B32A 1AS3A 3UKDA 2WSSA 3VU9B 4AC9A 4M1TA 1X8JA 2CL7X 2HF9A 2ZQ5A 4DLRA 4PHFA 1XCMA 3NVAA 1QVAA 1Z22A 1ZM7A 4IEIA 4AK9A 4PXAA 4Y0VA 3FWYA 4BZXA 1E1QA 2NOAA 3HJNA 4GOKA 2RGEA 3W5IA 4M9QA 4ABYA 1A4RA 2QT0A 1OT3A 3KZ1E 3AVQA 4YMUA 1LTQA 3R8FA 1X8KA 1X86B 1T8UA 4QHSA 1CS4C 3KJGA 4WZBE 4D0GA 1NVUQ 5JLJA 1N5JA 1EFRA 4AYXA 1ZC4A 5HE8A 1HV8A 4FCWA 3X1ZA 2RGXA 2A2ZA 3B1WA 2J7PD 1SKYE 1YQTA 4R2HA 1KAGA 1CLUA 2LCFA 3WRYC 5K8IA 2N1BA 3AKCA 4ZCMA 4G5GA 1TTTA 4A0HA 2G77B 4Z8YA 2ORWA 3KJHA 1GNRA 2GJKA 3TIFA 2IK8A 3AM1A 3KKQA 2QQ0A 2BVNA 2GXAA 5JCZA 3PCRB 2JDIA 4A8JA 2ERXA 4JL5A 4L15A 4KFRA 4MKGA 2Q9AA 5K8UA 3WMGA 5KSPA 2XEXA 2ODEA 2BWJA 4ZDIA 3L0IB 5KSYA 1TX4B 2JAQA 1UFQA 3NH6A 3ADDA 4B3FX 4KAXA 3KJIA 2QQEA 2V8OA 4O2RA 3U60B 1T0JB 3EASA 2IHBA 1JQLB 1SHZA 1ZC3A 1XCPA 4N0EA 4PQRA 2WWIA 3FKSD 5E95A 2FSGA 1LY1A 3OEEA 1DELA 3GPLA 4US1R 3TR5A 4R7ZA 4GZMA 5E7MA 4EPTA 2FEMA 1G7RA 3B1YA 4L5BA 4KSCA 1RVDA 1ZUHA 3ZD7A 2F9LA 1NF3A 5JMTA 1G19A 1RRCA 4IOJA 4JSYA 5E7IA 1KJYA 3ZD6A 3U6KA 1IN7A 3NC0C 1GKYA 1XTJA 2IYUA 1KNQA 1COWA 4XVQA 1P73A 1Z07A 2DWPA 4KVGA 3TQFA 3IO5A 3VR2A 3TUIC 1DS6A 1N6KA 4PAOA 4WVFA 3CF2A 1ZD8A 2G3YA 2WSMA 3P1JA 1KI2A 2XAUA 4HZUB 3A1SA 4DLUA 1Q0UA 5HCIA 5L3QA 1YR6A 2C78A 2DFTA 4URWR 2Z0MA 5C18A 5IK2D 2IS2A 1EFRD 1R0ZA 3OEHA 2IXEA 2OCAA 3H0KA 4I1OA 4JLDA 1E9RA 1TU3A 2ZSAA 4DZZA 2ASEA 3EA0A 4OBEA 1L4YA 4FWDA 1KZGB 2YNMA 4BFSA 4CRWB 2AKYA 4CDGA 3EPLA 1ZP6A 2ZU0C 3DVLA 1ETUA 1F3OA 1ZU5A 1EFHA 3CBQA 3CNLA 2K5UA 4MA4A 3FMIA 4RZ2A 1KK1A 3LBNA 3X1WA 4DSUA 5GJBA 1ZD9A 1Q22A 3FPAA 1RIFA 4F4CA 3EPKA 1KNXA 2JLUA 2ZI7A 1EXMA 3QI2A 2FJUA 3FMFA 4ZKEA 5AUNB 1N6HA 1Q20A 3EIHA 3HDTA 2D7DA 2H5EA 4URXR 1J8YF 4DCNA 1W4BA 3IUYA 4IHQA 3I8XA 3QXXA 1COWD 1IN8A 1XBTA 2WICA 1GITA 1OB2A 1FPMA 2R6CA 3KL4A 4M8NE 3OFNA 2VP9A 2A5DA 3MLEA 3F8TA 5FL7D 2AR7A 5JEDA 1W46A 5EE3A 2FEOA 3ZIAA 1ZNWA 3CLVA 4C9BA 3DO6A 3K70C 2RAPA 5FFMA 2NO0A 4DBLC 2CLSA 3BGWA 2P6NA 4Q1BA 2HDNB 3K0CC 4D4LA 2AK2A 3EZ9A 4RFSA 4B3BA 3C14C 1E3MA 3WP0A 2JASA 1SXJB 5CJ2A 3TQCA 1US8A 1KI8A 2GEUA 3DKPA 1W36B 1TF2A 3A1WA 5L8VA 2EFDB 4DB4A 3CH5A 1KY3A 3GJ7A 2OFXA 5AR1A 4BE7B 2NO9A 2ZUCA 1AQUA 1ELOA 1G20E 3AH8A 1H65A 1HTWA 2P5SA 3KXIA 2GZAA 4P0TA 4DSNA 3B82A 1CR1A 1GKIA 3WYAA 3RDPA 1VG1A 4JIMA 4W5WA 3LQRA 5LB2A 1FMJA 4Q7JB 1U90A 4K8OA 4RD2A 4IDHA 2F3TA 4JYBA 1WMSA 3GEHA 3QNUA 4ZI3A 5FUVA 2ODWA 1CKEA 2VSFA 4IOKA 2YOHA 2JJ1D 3SFZA 1MH1A 3GEIA 3EZ6A 2RCNA 4AKEA 3AVXA 4ACBA 1QHYA 3AVUA 2H18A 4OQMA 1GKUB 4Q7MB 2BV3A 3FHCB 2CVFA 3RRZA 1OH6A 3U6BA 3TUJC 1DAGA 1ZNXA 3CPEA 4TYYA 2Q3HA 3AKYA 4HAVA 4DLWA 5J4VA 2XOKD 3KUCA 2XOKA 3IDQA 2GCOB 1OFUX 1Z6TA 3MD0A 4IFEA 4MRVA 3EX7C 2OXRA 1KI6B 1YE8A 4LBWA 4P32A 2J1LA 1KDPA 2ZI3A 4DDWA 5G3YA 1SGWA 2ZS9A 2MSDB 2ODBA 1OHHA 3O8DA 4B71A 4LHVA 3R9XA 2NPFA 4Q4LA 1J7KA 1Z63A 3EARA 2DWOA 1KSHA 3SJCA 1IONA 2GVZC 4DC9A 1FFHA 2JLZA 2QM7A 3QF4B 2GBLA 3EXAA 3QJYA 2RGNC 3BXZA 5G53C 3U44A 4OHVA 1KKLA 1UKVY 1NVMA 3GJ6A 4PPNA 2WJVA 1P60A 2QMEA 2RHDA 3DZDA 1TQDA 4Q00A 1JJVA 3CRQA 2G6BA 3AVPA 4P4UA 1ZINA 721PA 4AY2A 5KYKA 2ZEJA 4ZCIA 2ZI4A 3IBYA 4D82A 4GFDA 3NWJA 1JAHA 1W48A 1YZUA 4DDUA 4FN5A 5J4YA 4W9MC 4ASUD 4YXWA 2VIIA 4K81B 1ZAKA 4UJ3A 3BFKA 3MCAA 4BFTA 4B3XA 4UJ5A 1M8PA 3BB3A 2WMOB 4F91B 4G1UC 1FX0A 1X3SA 2BEJA 4A2PA 3AP2A 2QMHA 2A5YB 3HWSA 2LWIA 4KV9A 4Q19A 3T35A 2R6FA 4FWTA 1W4CA 4M9ZA 3ADCA 2NZ8A 2VP2A 2DVWB 3TKLA 1KTVA 3EWSA 1E2GA 2P0EA 4PFSA 2EWWA 4RY2A 1MKYA 1WBBA 4A9AA 3QEJA 3WBJA 1VCNA 4F7WA 3FKSA 1EK0A 2XZOA 4PQYA 5JJKA 1N6PA 4OQFA 5J40A 2OBMA 4XWAA 1NVWQ 1HE8B 1YR9A 3QF4A 4EQ6A 4QC2A 1E9SA 4Q4AB 5FI1B 1E0JA 2VF8A 3ECCA 2PZFA 3NBXX 2KB0A 4LJ5A 1BMFA 1W4AA 3D8BA 2GF9A 3D3QA 2B21A 2YYZA 3RVBA 1VYVA 1TMKA 5TDHA 3NH9A 5GJVC 4QM7A 3OESA 2IF0A 1ANKA 1UKZA 4IDQA 4R2IA 1PLKA 4LRWA 5LBIA 3ZJYA 2HLDA 4DSOA 4HEJA 2BJVA 4HYYA 4TL6A 2ZJOA 4UNPA 4HDOB 1SHKA 2WOJA 3WHKA 3Q5EA 1Y63A 1O3YA 4KU4A 1SQ5A 2ZRPA 3L8YA 3RABA 3AVYA 1XD8A 1S96A 2BCGY 3IQWA 5EZ5A 1N5KA 1HEIA 3WRXC 1KO8A 2B8WA 2Z4SA 1VHLA 1KSFX 1S1CA 2GETA 2Q9BA 1XJQA 3QXCA 2WKRA 2GCOA 3K9LA 5A5GA 3TK1A 3FVQA 2BIFA 5JS7A 1QZMA 1YZKA 1F6BA 2ZRKA 1TQ4A 5SZIA 3CO5A 1FQKA 2NMVA 5IT5A 1CJVC 2OHFA 2JLWA 4PHTA 1J70A 3KQLA 3U61B 4WZAE 3IBGA 3QSYA 1GG2A 1L8QA 2IL1A 3PEVA 3K70D 5CDFE 1XZQA 4GOXA 4LYFA 2AWOA 1G7TA 1YR8A 4X8HA 2IHYA 4Q1EA 4B2PA 2HCBA 1ZCBA 3OHMA 4B2LA 2E9SA 1YU9A 4G5QA 3ZQJA 4AD8A 5TXGA 3VKWA 2YKGA 4DRZA 4EPRA 3S1AB 2WV9A 3CF0A 3B5JA 4XH9B 4A82A 5CM9C 3ADKA 4G5OA 3F0TA 1JALA 4JVSB 4OK5A 4C0SA 3KKNA 4M1KA 4DCVA 4DVGA 4P33A 3RLFA 1DG1G 2HLDD 3KKOA 2HT1A 1JQJC 4RZ3A 4LBZA 2IUSA 3LW7A 2QY9A 1XEWY 4BZQA 4OHWA 4E22A 5EUMA 1FUKA 5AJYA 3TR0A 1DBSA 1OF1A 2UZ3A 3SN6A 4KODA 1U0JA 2CK3A 1W49A 2V9PA 5JWHA 2KWIA 4OI2A 4OJKA 3RS5A 1XEXA 5E7JA 4QHTA 4R98A 5FBQB 4DDTA 2PMDA 1R0YA 2FZLA 2JLRA 2AHOA 5K8TA 2JLVA 2I4IA 4B34A 2RMKA 2RGGA 1TUEA 2UVQA 4IDOA 1Z0DA 3KB1A 3K0AB 3LBIA 2FMXA 2ZRHA 2HT6A 4H1VA 4B3GA 5JRJA 4URYR 3B85A 1QHXA 4JVLA 3MJRA 4H9GA 4PSKA 4KLNA 4WOPA 4ZIRA 2N46A 3PUZA 1TF7A 5EJEA 1Q3TA 4NYMQ 4M1MA 4QFMA 4QBHA 4CT4B 3CRMA 1AQYA 2HYDA 2V7QA 5L3SA 3PVSA 2L0XA 1W2GA 3VR1A 4DLTA 4DT1A 3VNUA 3X1XA 3RS7A 1FNNA 3Q5DA 4FMCB 1MABB 2QU8A 1VIYA 1ONBA 3DOFA 1ZIOA 2CJWA 5KNDA 1KSGA 3Q72A 4EFMA 1AJEA 1S3GA 1R0XA 2KSQA 3T5DA 4WXRA 1W5TA 4JLJA 4Q1CA 3IEVA 4L9SA 5TARA 3ZS9A 3TW4A 4F4JA 3VR3A 5BN5A 2OLKA 1JBKA 3OIUA 4TN1A 2OUKA 5EE1A 5BN3A 2X2FA 4EDHA 2FSHA 2OXCA 4XTRA 1N6RA 1PV4A 4II7A 1A7JA 3FMOB 4HB4A 2GCNA 5DH9A 4HZIA 3O8RA 1OFHA 4QHYA 1EWRA 2O52A 2Z6VA 3RC8A 3JVVA 2C95A 2C5LA 5TVKA 2VO1A 3IIKA 1Q1EA 3HYRA 4A8JB 1CJMA 4TMXA 4OHXA 3B1XA 3IKJA 4GRAA 1QHSA 3RS4A 3W8NA 1I4DD 1W0KA 1KSJA 2JIZD 1MR3F 5AJVB 1QHIA 4EJSA 2CHVA 2ZAMA 1E32A 3BOSA 3AB3A 2G0NA 4FCTA 3THXA 1SVWA 3KKPA 4UQOA 2ERYA 1YZLA 5HCNA 1NVVQ 1KO7A 4ZO4A 5AJWA 2J0QA 2WJIA 1RYHA 5HTKA 3EZFA 2DFKB 4GT1A 4HAYA 1TNDA 1G3MA 2ZE8A 4QXAA 4LPSA 2VF7A 1R5BA 2OO7A 1B23P 5AUPB 2P65A 3LDAA 1CJKC 4ARZA 2AD5A 5KPJA 1DARA 2WWWA 2B6HA 3K0SA 4BLTA 2QA5A 3W34A 3JVUA 4FCVA 1DO2A 2PJRA 3B1VA 4LX0A 2BM0A 4U5XA 3K0FA 1YRBA 4Q1AA 4JLBA 3QENA 4Q9LA 1SVOA 1OLOA 2XB4A 2FPMA 2GESA 5DI9A 4CZ2A 3GLGE 2BOVA 2GA8A 3QKSB 3QPUA 4HAXA 2J0UA 3A4NA 4Q47A 1Q1QA 1TEVA 3EZ7A 4KVAA 1XJ0A 1P4SA 1KY2A 1NKTA 4F93B 5JSZA 2DZNB 4DEXA 1OIVA 2ZSFA 4NU0A 4MYHA 4EPXA 3IPXA 4EFLA 2ZITA 3RS2A 3PG5A 2VEDA 5EZ6B 4PO8A 2O0JA 4UNSA 3SFVA 1W1WA 4UXIA 2WTUA 1CXZA 2XITA 2ZRCA 4RVCA 1OH7A 3G82C 3QEOA 1CBUA 1QHHB 2QP3A 3BH0A 5A0FA 1TF5A 2KI5A 4Q4JA 2WWYA 2OAP1 3QF7A 1NMZA 1I4TD 2DBYA 3VHLB 3MWKA 1DPFA 1E2NA 3ZGXA 1D9XA 3LFUA 2J7KA 4GSYA 2VP0A 4RZXA 1Z6YA 1OXSC 2ZS7A 3NBYC 4DUGA 5FR2A 5G3ZA 1T5LA 4KHZA 3EPHA 3LAWA 3T12A 1E9AA 5C4GB 3BFXA 2R44A 3E5HA 4DEYA 5JCPA 2ZM5A 2HYIC 4KCGA 4JLAA 4RFSB 4AWXA 2LKDA 4BFXA 2DCUA 1P72A 5EP3A 2HEIA 3VAAA 4KFTA 4B44A 1VG9B 4YONB 1PZNA 3OF5A 1T5IA 4Q4HA 3VR5A 2RH5A 1X37A 1U8ZA 3B9QA 1PLLA 4URUR 3QIAA 3KUDA 5GJWC 1E1QD 1Z06A 3U2QA 2RGCA 3HYTA 3AUXA 3B78A 3P20A 1VCMA 4JN6A 3VR6A 3MWYW 2NPIA 1W0JA 3OE7D 1OFIA 2WWFA 2DYKA 4WAUA 3RRMA 3KW6A 4D4JA 4YMVA 2CL6X 4AKHA 4CF7A 2GJSA 1QG2A 3K1JA 1R8QA 4LI0A 3UK6A 1NSTA 2J9RA 1JR6A 1XXHE 2C9YA 1T6NA 4RD0A 3T1VA 1KI4A 1XTSA 1FP6A 1GZSA 5E4FA 2IYZA 1JPNA 2Q3FA 4UXHA 1FMLA 5EUQB 4BFUA 1EX6A 5HZHA 3I8SA 1GILA 3GLIA 2D62A 2WIBA 3QKUA 4JLOA 4Q9HA 3KFXA 4PC2A 5CK4A 1SVKA 1JXOA 2OFOA 1OXXK 1NP6A 3FOZA 4A1FA 2IYWA 2FE4A 3TW8B 1F48A 4QGFA 4D6PA 2ZVPX 2YWEA 1NJFA 2D06A 5K8LA 2P5TB 1GUAA 1T3LA 2O8EA 1OKKD 1Z0JA 3UG7A 2VHJA 4DUGD 1V43A 3T34A 1AM4D 1M74A 3Q9LA 2FSFA 1SULA 3GJ8A 2XJ9A 3I73A 3P4XA 4AG6A 1A5TA 4YQFA 2JJ2A 1Z08A 4BWYA 1AZSC 3GFOA 1I2DA 1GP2A 1QZXA 2OFWA 3IHWA 4JVMA 4W5JA 4DLVA 3L0PA 4EUNA 3CUEF 1IJFA 1UKYA 5DI3B 1XZPA 1U9IC 2OG2A 3WBKA 1BMFD 3BERA 2ZRBA 4IDNA 4M1WA 4YMSA 5F2EA 3X1DA 3ND8A 3SR0A 1EG7A 1M2OB 2AWNA 5FTJA 3THWB 2IYRA 1HH4A 4FWGA 2CCKA 2FZ4A 3B8HA 5DI3A 1R0WA 4KLZA 4MH0R 5FH9A 2CNWA 4YDHB 3BB4A 4HUTA 4OI0A 2OE2A 4O3MA 1BO6A 1XEFA 4JYCA 1E2EA 3KB2A 4V0ME 3VKHA 1G21E 4L8GA 1G3UA 1A82A 3ND9A 1GFIA 2ONKA 1PLJA 4NCHA 5M04A 1ZMXA 3I92A 3L82B 1I4LD 4RD3A 3ZZUA 4U00A 5SZKB 4HB3A 4PZYA 1ZVQA 2O8BB 3U7EB 4LV6A 5FI0B 1W36C 1A1VA 2QPAA 2RGBA 2YHSA 5EE0A 5DYGA 1D2NA 1D9ZA 4FMDB 1YVDA 3CNNA 1J2JA 2AL7A 2F3RA 2CDNA 2BJWA 1IAQA 1GDDA 1XD9A 2ZYUX 1ZW6A 3K0CA 1XD2B 3P27A 5J5CA 1XPOA 2JLSA 2GXUA 1UEIA 2QAGB 4M2LA 2X19A 1NL3A 2GEVA 1OH5A 3GLFE 1GOTA 3LX5A 3ZH9B 1N0UA 1M1YE 2IS6A 1G8HA 5JI3E 1XCGB 2GJ8A 2ZYTX 3REFA 1GRQA 3QY0A 4XSHA 1P9WA 4PX9A 1KKMA 2QUZA 1E2PA 3GP8A 3RYTC 5GADl 4U7DA 2GNOA 1G291 2J45A 3DM9B 2A5FA 1QRAA 4LJ7A 2I1VB 3QXHA 3HU2A 3ADBA 1A2KC 4TSFA 1II9A 4OKSA 4BPBA 3GQBA 2GHIA 1CU1A 4BLOA 3SI7A 2IF2A 3BB1A 3AVOA 3DDCA 2IEYA 5AJXA 2EW1A 1DAFA 3D6TB 4C4PA 1Z83A 1IY0A 2CHQA 2ZE7A 2WOOA 3MGCA 2FG5A 5TV2A 4D0NA 3SBEA 3PENA 2CCGA 2ZRLA 3A1TA 1MOZA 3K9GA 5IK2A 4CIDA 2GAAA 4RD1A 4EQ6B 3DZ8A 1TQ6A 4M1SA 2ZAOA 1N6NA 3VFDA 4KYUA 2BM1A 4D2IA 4LZZA 4LHWA 1ODFA 3U3RA 3FYHA 1NKSA 1G6OA 4NE2A 1RC8A 5UKDA 4JT2A 4OJQA 1DTSA 4Q9JA 2H1LA 1GNQA 3DPUA 4LV8B 3T1OA 1E9BA 2VRWA 3FB4A 2ONJA 5IRCD 2ANCA 2FGKA 3EZ2A 1KYIA 3M0EA 1IOZA 1E6CA 5FUYA 2IXGA 2R6AA 4JT4A 1Z0AA 3R7WB 1WQ1R 2KRKA 3BD9A 1NJGA 3W3AA 3WY9A 1WRBA 1RE0A 3DHWC 3KJEA 2ZJZA 4OK3A 3TSZA 2ZPTX 3CNOA 1E2DA 1KDTA 2Z4RA 2D74A 2FU5C 1YZNA 2H8KA 3K09C 4JLMA 4JKIA 4LYJA 2X77A 4KBGA 1G18A 2J0SA 3ZZTA 1ZIPA 4MGIR 3BWDD 2ANBA 1P62B 1H8HA 1U0LA 2XNSA 2W0SA 3EAQA 3JZMA 3EIEA 1ZM3A 4GITA 2AN9A 3LVQE 1NSFA 2GTPA 5CB6A 4BEBA 1KMHB 2NO6A 3ZZ0A 2J0VA 2Q21A 4CVNA 3QKRB 1R8SA 4DLSA 2JGNA 1L2TA 2NG1A 3QPWA 3R20A 5DLQC 3AF2A 5FBWB 1RYFA 5FOSA 2EU8A 4BEJA 4PSAA 2CLCX 2O8DB 2XNDD 3LW8A 4KXFB 4LY6A 1NIPA 1OHHD 3NEJA 1Z6GA 1FTNA 4GBMA 1T3SA 1WCV1 4TMTA 3W6OA 5DN6D 3GLFA 4DCTA 3QE0A 3KTAB 3V00A 3AGQA 1EWQA 2WIAA 2GZDA 4M22A 2O8CB 4LJ9A 1Q12A 2HXYA 4CEIB 2CHGA 4IKEA 1IXSB 1SXJD 2EVWX 3VHXA 2JJ8A 5KO2A 4FW9A 1MO3A 3GFTA 2OCPA 4MKHA 1Z6AA 1QHHA 3SHFA 3IEUA 3KQKA 4MRRA 4DJTA 2XSZA 2WAYA 3NC1C 4QRHA 2XSZD 3F3YA 1II8B 5D3MB 3AVVA 1N6IA 2QENA 2D2FA 2QTVB 4OK6A 221PA 4C7OB 3RS0A 4UNNA 2ZRGA 4GMXA 1HT2E 1GWNA 1RRFA 4Q18A 4Q66C 3W90A 3OIWA 2D2EA 1JR3D 4JBWA 1TAGA 1XTIA 2DHRA 4MITA 2YC2C 4P3YA 3CZQA 1G64A 2ORVA 4JL6A 4C0QC 4US0R 2Z83A 3H84A 1T4GA 4M1YA 1S8FA 1GIAA 4KFSA 4QNRA 4J0QA 4XWOA 4FIDA 2VSXA 2QAGA 2ZU6A 4LJYA 1F60A 1OYYA 1GL6A 4ESHA 1FUUA 1E9CA 2CL0X 4TQUS 1KI1A 2FFBA 4BLPA 4LC1A 3X1YA 1E99A 1DAHA 1CR4A 5B2ZA 1C1YA 2C03A 2BHRA 3JZAA 3AF3A 2JLXA 3TSOA 1CRPA 4US2R 3GJ0A 2EQBA 4ZCLA 5J4KA 1KI6A 2XNDA 4MUBA 3CF6R 4XOIA 1P5ZB 3VLFB 1C4OA 3ZQ6A 2ZRIA 4B47A 2F43B 5E3HA 1PJRA 2BCJQ 4JSTA 3SC3A 1S0UA 5B30A 3PJRA 1MV5A 2H17A 2O0KA 1NY5A 1GAJA 3NKVA 4DLZA 1WA5A 3CR7A 4RD4A 4CW7A 3QPVA 821PA 3OZXA 2GEDA 1RRPA 2IA5A 1E9DA 2GKSA 1R2QA 3B60A 3DKVA 4Z54A 2CEAA 3DEFA 4TTPA 3CPJB 4XWKA 3A36A 3L0SA 1R6BX 3W3ZB 1XD2A 3I5XA 3HU3A 1OXUA 4RCYA 4D26A 2J87A 5IDVA 1W47A 3EIQA 3THWA 2XXAB 4FXPA 4G0NA 1NN3A 4TZ0A 2WWXA 3TBKA 2R8RA 3DMDA 2C77A 4PZLA 2C99A 4ZIRB 3I4LA 2P3SA 4EJSB 2QT1A 2VP6A 5DHFA 4LUCA 2BKUA 3QQ5A 3SU8A 1F2TB 2H16A 3DOEA 4GZLA 4GOJA 3O8CA 1G3RA 4M9XA 3K70B 2PT7A 3BH7A 4N1AA 1QVRA 3PIRA 3CX6A 3DMNA 1ZD1A 4B43A 1UPTA 2BMDA 2WKPA 4Q7KA 1XPUA 2IS1A 5CLQA 3SNHA 4HDQB 1D2MA 2GXQA 3MJHA 2ZR7A 3LLUA 3BC1A 5ELXA 2JA1A 1UBGA 4MGKR 1XMSA 3TE6A 2OT3B 3CRW1 3C16C 4ZI2A 1NMYA 3TSWA 3U4QA 1R7RA 3GEEA 4OI4A 2A5JA 4W7SA 2A7QA 4URZR 2CCJA 4XSGA 3C4JA 4QL3A 3CR8A 4TTRA 4IJMA 3GLIE 3W6NA 4B76A 2C2HA 4JLNA 5EP4A 1E4YA 2QORA 4PQFA 1EFCA 2V55B 4B2IA 1I2MA 4YMTA 1AZTA 3F5FA 1BIFA 4LPKA 3MRSA 3K9NA 3PQCA 3IIMA 2F43A 3MWJA 1E2MA 5FL3A 2ZI9A 3U7HB 4URVR 3BE4A 2H57A 4LJ6A 5FOVA 1D5CA 2ZIAA 1VDZA 4ILEA 3SDZA 5F9HA 3T06B 1WXQA 4XTCS 4Q9IA 4IFBA 3ZVMA 2CMKA 2AKAB 4PHHA 5C46F 4NCJA 1D8TA 1FQJA 4HLUA 4JZKA 4NYJR 5A4JA 1G41A 2OM2A 4JLPA 2QNRA 4BLQA 1NNEA 2WWGA 1Q21A 1VTKA 3U3OA 3L2OB 4DCUA 2RKOA 1KMHA 2DWQA 1GL9B 3T5GA 3FFBA 1H8ED 1FP7A 3BK7A 2V6ZM 4GL2A 4I4LA 1VG0B 1G7CA 3EWAA 4NONA 2N42A 1CJUC 4B6EA 1HE1C 4A15A 1JXMA 1CR0A 3NBFA 1HA3A 4M1OA 5P21A 2P6UA 1QHGA 4OHZA 4KITB 5EXSA 4I1VA 3AP1A 4L9WA 4FMDF 3I3SR 5FUWA 3KFVA 1IN6A 4MKFA 4MYUA 5IHPA 1B0UA 2J3EA 1FL9A 1EGAA 2NZJA 2VHQA 2YJTD 3RWOA 2B7BA 3CRVA 1UAAA 1IY1A 4Q1DA 2GAOA 3QG5A 4FD2A 4Q1FA 1RPZA 3E70C 3WXMA 1Z2AA 3LWNA 1W4RA 3FE2A 1WE2A 1G8FA 2BEKA 2ZJYA 4PO9A 2EYUA 5KU1A 1LS6A 1OPXA 4TLEA 2GWHA 3P4YA 2NIPA 3RS3A 1NBMD 2E1RA 5JSZB 5EP2A 1W36D 4TWZA 3VR4A 1CJTC 1M34E 1NLFA 2IYYA 2W6JA 3AF0A 4FMCF 2YC4C 2J0UB 3THYB 4NCNA 4CEIA 1LF5A 2ZRDA 1GL7A 4DB2A 1ZU4A 2RGAA 1UADA 4JKYA 3WNDA 3GLGB 1SKYB 5FOUA 1U94A 5KPDA 4TL8A 4LJ8A 5DO9A 2QSYA 1FZQA 3ASZA 4C0LA 1OE0A 1E2HA 2EFHB 2QAGC 3LQQA 4TZ6A 4WA7A 4IXNA 1DVRA 2PL3A 1E0KA 3GD7A 4LHZA 1AGPA 3SBDA 2B92A 3AP3A 4AURA 3O47A 2ZE5A 4V0OA 2ZI6A 4CEHB 3TAUA 2XTNA 2QBYB 4R71A 3I1FA 4RD6A 1JR3A 4KBFA 1U8AA 4M4SA 2A3RA 3BIFA 1KI7A 2HJGA 2G88A 4DKXA 4GNKA 2C9OA 2D3WA 2IT1A 1G4AE 2R6GA 2ZI5A 3A8TA 4IOLA 1WF3A 1E94E 5TY0A 3T1TA 2XB2A 1DOAA 5KDOA 4QBIA 4ERNA 4RSGA 3OFND 5J47A 2IYTA 2GRJA 2PLRA 3ONWA 5JHGB 2MSCB 3CM0A 4Z1MA 1XPRA 5EP1A 1XFAA 5GVSA 3GJXC 5KHOC 1Z5ZA 4A0RA 1JR3E 4M0LA 3WMEA 2KE5A 3W6PA 4LOAA 4JVNA 1DO0A 1AK2A 1P75A 3K09A 3GJ5A 4DCSA 2FF7A 1IXZA 2GXSA 3U4QB 5DYIA 4BFZA 5CB8A 2PEZA 4DDVA 2BMFA 4Z8XA 1YJ5A 1XEWX 1Z6XA 3T15A 1DADA 4AYTA 3NDBB 3QKRA 2VQSA 1R10A 3TVTA 2QM8A 4TYWA 4XD7D 1NLYA 2RB4A 4XJXA 3TMKA 4NBSA 2GCPA 5GVRA 2WMNB 3SJBA 2VLIA 2PEYA 1XEXB 4NL4H 1E96A 4F4IA 2W6JD 1KO4A 4TMKA 2XX3A 4PC1A 5J4LA 3SQWA 2ZJBA 3BRWD 2VA8A 2EFEB 3LBHA 1JB1A 1JPJA 1QDEA 1ZBDA 3ZVLA 3V4RA 3VNVA 2ZR9A 1J90A 2YWGA 2ZRAA 4QBGB 4QG7A 1E9EA 4A3VB 1F2UA 1LB1B 1RFLA 5AJZA 3QBVA 2YVUA 1II8A 5D3MA 3X2SA 2H7VA 5FR1A 4BRWA 2EFGA 2W6ID 1F5NA 3R7WA 2F1HA 1KJZA 4ZDKA 2VYFA 1LS1A 2ZETA 1DG3A 1VYTA 1LFDB 3KXKA 5HKKD 3VX4A 1Z28A 3CB4A 1JNYA 4TL7A 1HURA 2MMCA 2ORIA 1EESA 2BC9A 2CE7A 3P26A 1G6HA 1RW4A 2VBCA 1MABA 1R5OA 1LVGA 4AIIA 4AKGA 4D4KA 1GVNB 1CF4A 1RJ9B 4DIEA 3LA6A 3LD9A 4I1UA 2HUPA 4EIWA 2BBTA 4MRNA 4DWJA 1G3IA 3N70A 2QSZA 1P61B 2IYXA 1CR2A 1VCIA 3B9PA 4O0MA 4Q48A 2FN4A 2ZJAA 2NGRA 2BMJA 4TYNA 1JEDA 3N2EA 3AF4A 1ZM2A 5JJIA 5LPNA 4EPYA 2XZLA 1OFTA 1VG8A 1HQYE 2QE7A 3ICEA 5CK5A 2GDJA 4LBVA 2JLQA 2QGNA 2QMOA 1XTQA 4MKIA 4L4UA 1N0VC 1R4AA 2FGJA 2PJZA 4HDCA 5BXQC 4Q02A 1HUQA 4MQBA 3FMPB 4K46A 3SS8A 3RRNA 4YDSA 2G0TA 4XD7A 4XVRA 2J5XA 1ZYUA 4HB0A 5C2JB 3LX8A 2KJQA 4V0MA 5D3QA 2CNWD 3CPHA 2WJHA 2W0MA 5CITA 5L3RA 3L0OA 2VH5R 4QM6A 4PO1A 2DFNA 1A2BA 1DAEA 1P9NA 2ZJ5A 3EC2A 4M53A 2B7CA 4DLYA 4PC6A 3FTQA 4GPTA 4NMMA 1SVSA 1E0AA 4B73A 1O87A 4TTQA 2WJGA 4LHYA 4NYMR 3C5CA 3AF1A 4LDJA 2F1RA 1NVXQ 3U3MA 3SJZA 3QVUA 3FGNA 3QXSA 4TQAA 3VU9A 1E79D 5JFGA 2FPKA 3R8CA 3PFIA 1P2UA 4O25A 3MMPA 5EQTA 1TADA 2FX3A 3SHWA 3OEED 4C0BA 5KSOA 3NDPA 1E4VA 3T1QA 3TGPA 2QN6A 1KGDA 3QBTA 2JATA 2TMKA 5CDFA 3A37A 4NP6A 3QXJA 4LGMA 1S4QA 2OBLA 3SJAA 1Q44A 2AFIE 1ZJ6A 4LJ4A 3V4FA 1IJEA 4TMWA 3FHTA 3U7FB 3PXGA 3WHLA 1Z0FA 2Z5FA 3D31A 2O8FA 4DLXA 4BGDA 3PEYA 2WAXA 1Z3IX 2V3CC 2QI9C 1DAKA 2YWHA 5JECA 2QTFA 3R9WA 2EFCB 3M1IA 3P32A 3QKSA 1GRNA 2O0HA 1OIXA 3OIVA 5H68A 4CT5A 1S9HA 2QTHA 4ZV4A 4QJ3A 1E69A 2IW3A 2A9KA 4HAZA 5KNBA 1T9HA 1YKSA 4YC7A 3TLXA 3BH6A 3GLHB 4YMWA 4BASA
chains in the Genus database with same CATH superfamily
1C1KA 1DBPA 1WXIA 2DSTA 1V71A 4HQLA 4BB9A 5K6AC 1YONA 3IJPA 2PU5A 5BW6B 1U5AA 2EAUA 4WE3A 5FULA 1XRRA 3H1EA 2TMDA 1UBHS 3A42A 4Q03A 2PCLA 1UP7A 1RXUA 5BNWA 2OEPA 3OAAA 1IOVA 1B0AA 1FNBA 2FPXA 2P2DA 3AC0A 4MYCA 3ZDZB 3IE2A 5E0KB 1YZ3A 1SCUB 4F2GA 4CG1A 5EJ2A 1N9ZA 3C7CB 3CU5A 3GLSA 3KSZO 5I3ZA 4PZDA 1H2RS 3L28A 1PI3A 4G0PA 3LRPA 4GZ3A 5DFAA 2Z6AA 4BMVA 4XQCA 1G5IA 1KAOA 1PFUA 2VPPA 2IS4A 5DHQA 4HAUA 1MN6A 4ZZ1A 2RHMA 1S9DA 2O23A 1SZCA 3D4IA 2YWXA 4BQSA 1GTG1 2CBXA 2ZE6A 2ZJ0A 2OCYC 3M1YA 3OT5A 3T9AA 2H2AA 3TIXB 4RIIA 3K53A 2R68A 3K16A 5DIFA 3SYKA 4DHWA 3QU5A 1E1DA 1GFZA 3NBUA 1DC7A 2ZREA 1GG9A 5ENVA 2GJ9A 3BD8A 4RZUA 1Y0BA 1QG0A 4KO1S 4DLLA 4D0SA 2PKEA 1EFUB 3UJ8A 3IAUA 3HKBB 2V4ZA 4F2DA 1KFVA 1P2TA 3F5QA 3R3VA 4R1SA 1AN0A 1XC7A 2XZPA 4UEKA 2N47A 4GKBA 4WADA 3UT6A 4GPD1 3FE3A 3I23A 2G8LA 3OJWA 5E1BA 2A94A 1C2TA 2BI4A 2WHQA 3E18A 4YJ3A 4BRSA 1RYNA 4V1CB 1N4AA 2DI0A 2QJWA 1FVFA 3OUZA 3J2PB 1JPUA 1BCRB 3G02A 4EAQA 2NUTB 1EB8A 2VJBA 3R5HA 4YLGA 2XCRB 4WK2B 5LZ7A 4YRNA 2CK3D 2YJ4A 4YWJA 5HMLA 1CD5A 1CFZA 3UTCA 3RM3A 3UB4A 4ARCA 5K51A 2JH8A 5DF1A 4MDFA 3KZVA 2EC5A 3TGWA 3LVRE 3VUEA 2JFVA 2Q4EA 4TQGA 4C4SA 2DH6A 3DXXA 4J90A 1N3BA 4QU0A 5A7HA 1APBA 4X1IA 4ZCPA 1E4OA 1HE3A 1OJLA 3PXUA 4KP7A 4Y2TA 4Z9XA 1R18A 3KP1E 3O0DA 3DBOB 4IRUB 4TLAA 4NIMA 4YDQA 3T38A 4QGAA 1O58A 2OBXA 4PBTA 1I10A 3T61A 2QZPA 3F9IA 1GTJ1 4JQZA 3JQFA 4KQFA 4UE2A 1RS0A 2OMKA 5EMHA 1SD5A 3DUFB 3QVKA 1MU5A 1P7YA 2REBA 2V7XA 3WR5A 4C05A 1NWCA 4Q5IA 1ZVKA 1RM5A 2BH2A 4A5OA 3UWMA 1P2SA 2ZAGA 3DTVA 3UIEA 2RBEA 2JANA 3C1UA 4RCZA 4MUXA 1A71A 2PD6A 4GM4A 4G5SA 4LBYA 3O95A 5BSRA 3KB6A 4AVYA 4RKFA 4D81A 1W85B 3FNHA 3LPNA 3D3EA 5A6SA 5AVZA 3C7TA 2XLCA 5CB4A 1Y9AA 1CYDA 2PV7A 3QFCA 4MZXA 4PNZA 5C7IO 2X58A 2DAKA 1HFKA 2I2XB 3KSUA 2GWRA 5FLYA 4H4DA 2VK8A 1KJJA 2H2FA 3U4AA 3VYSB 3O1JC 1XA4A 3B6ZA 1SUBA 3CSDA 3WGKA 4D6XA 3KVOA 3REQA 1DFHA 2MR6A 5MHTA 1X7DA 2IEBA 2CF5A 4IBIA 2ZS8A 4ZDWA 9ATCA 3RANA 3A9CA 5CTJA 2EW8A 1RJEA 2WF6A 3M7IA 2WF5A 3FUXA 3PQ2A 3P4UA 1GABA 3GJQA 1QTRA 2D7CA 3ETLA 5C1OA 2HF8A 3Q7IA 3WICA 1PUIA 5KTKA 2O3UA 1JAYA 2PLFA 3ZS8A 5HF8A 4NAHA 4LRTA 3W8RA 2DBRA 2UZ1A 4X3PA 4ZPJA 1PVOA 4JLKA 5B1IA 1OH8A 5E6RB 2PWPA 4TT8A 2H5JA 1GRRA 2GRUA 3R9WA 3NHWA 2XMCA 3ER6A 3Q2IA 1WHCA 1IHXA 3AEZA 4HLUC 3RSCA 4TVOA 1Z8HA 5AUOB 3WSTA 2O2CA 2ZYWX 3OM1A 4LS3A 3S8EA 4Z4HA 5DCWA 2X9NA 3IP7A 3MLBA 4CHGA 2V6IA 4KQEA 4M36A 1W581 2XUQA 3NTRA 4DC0A 5B57C 3U6DA 1JKFA 3DL4A 3EEIA 3PR1A 4UAJA 4B9EA 2C0CA 3HMQA 4KN6A 5E3JA 3QEAZ 5BQ5A 1Z6ZA 5F9FA 5EEGA 4O3FA 3OA0A 2ZT5A 3CLTD 4IVPA 3GLIB 2VTBA 2QGZA 3CHYA 3CGWA 3ZXUB 4LCEA 4HDKA 3TRIA 1X9IA 4CM1A 4DR7M 4ZOLB 3ZDCA 3PFFA 1YZGA 4PG7A 2Q7DA 1PDVA 2ZJ6A 1FW6A 3AERA 5DNYB 1XUOA 2AMJA 3M7GA 2YHBA 4UEQA 4CGZA 4C0WA 3P9ZA 1YZHA 4RDHA 3KQUA 3ZOKA 5ALQA 3ANLA 5H7XA 1DPGA 5AO9A 2WZDA 4HF7A 1PT7A 2MSLA 3CLRC 1ZCAA 5KDLA 5JDIC 1VLHA 3T4EA 3HZRA 4JQSA 4N3NA 3FCUB 3WTCA 1WKBA 2JY7A 4IJ6A 5DU2A 5HQ3A 2Q3LA 4FYJA 3ICQB 1OIWA 3OPQA 4G1MB 1EVQA 4G9EA 4B8ZA 4GGOA 5AQ1A 5L6LB 4PG5A 4H18A 1A8HA 1V96A 3NIBA 5AI8A 5BN5B 2XZDA 2YQ4A 3DR5A 4FDAA 2YBDA 4NEGA 3DP7A 1ZJWA 3EHEA 5GM1A 1YBFA 2BM8A 2QEQA 2X41A 2EUCA 1KRWA 1PZXA 1H2BA 1QYIA 1Y7IA 4Q34A 4TKUA 3TBFA 3CH4B 3C9PA 1Y8QB 1G8GA 3ABZA 4ARIA 4QNNA 3GROA 3U5ZB 2AC4A 2IUTA 2E4WA 1Z0KA 3AYXB 1Y3FE 2FWRA 3I9NA 3O7WA 4NDZA 2QN9A 3L7LA 5GZ3A 1UDBA 1C3LA 3B13B 2O2DA 4I1RA 1V2GA 2X3UA 2VDJA 2ZIZA 5A5DA 3GVIA 4UUQA 2Q45A 4QXMA 3HJCA 3QNMA 1CQIB 2WFAA 1RBZA 4NENA 1KIMA 1FQOA 5CM8B 4D8YA 4F92B 1XNQB 4F8EA 1NASA 1C0PA 4NABA 4Z1OA 1X6VA 4P4SB 1G4UR 2JIZA 3HPQA 1IXRC 2WFMA 4WKPA 2X14A 5JRZA 3IG8A 4FOPA 2XDYA 3MWDB 3G7SA 3R0JA 2QTTA 3DW1X 4R8MA 5FPYA 5A5EA 3SHVA 3CLKA 1OX4A 3GFSA 4FYWA 1EA7A 4HGPA 4NENB 2ZJ2A 3L93A 4GQBA 5KYWA 2ZSUA 3GJRA 4V3CA 2D1QA 1NDQA 3HFJA 2QROA 3PR3A 4AM8A 4BQPA 2XGMA 5JROA 2LBCA 4LZAA 3AR4A 5A05A 3VMMA 3G8DA 3VPBA 2PBFA 2RD2A 1XAGA 2BTQB 1DJPA 4AY5A 3IR7A 2AOXA 2HPZA 3CUVA 3O93A 4K9SA 2KHZA 1J8QA 1E3WB 3MGKA 3M6AA 5JI2E 1X94A 2C61A 3BRSA 1L4HA 2JKYA 1DIHA 1B74A 3RT7A 5EIEA 3AFGA 2W90A 2NO7A 3L40A 3OTGA 5AHOA 2IFTA 2WTAA 3H1FA 4DBLE 4MJLA 1U65A 4QO7A 2DB3A 5THXA 1Y8RA 5LB4A 1I6KA 2ZG6A 1EUCA 1XTKA 3R6GA 4YJ3F 2G28A 3FNRA 2JI8A 4DR4B 4L7VA 4D43A 1JDTA 3KLMX 1I7DA 4NSRA 3LFTA 2WJ3A 2PX3A 1UPFA 1N6OA 2XYGA 5AW4A 1YZVA 4P7BA 4EW6A 3VGPA 3VI3B 2QE7D 3TL3A 3DA1A 1NQOA 2UXDM 4ZZ3A 2WBLC 2PSJA 4YRIA 1OWMA 3DAFA 4N3BA 2ADFA 4B48A 3MB5A 1X1DA 4R54A 3ZE7A 1I3LA 3Q8GA 1U7UA 2QJFA 4FFBA 3LUCA 1VPWA 1KY4A 1IIBA 5CVCA 3RAPR 2OCBA 4NZOA 3VH4A 2LZ0A 4WACA 1E2QA 1OTHA 4TTVA 4WUTA 1R4MB 3UW3A 2Q07A 2VJKA 2XQJA 2FPIA 1QX4A 1E98A 2JDID 5HIMA 4AI6A 2YWJA 4NHOA 1JA0A 2RKWA 1USUA 4TTSA 5J2UF 1KU6A 2GJAA 4XIGS 4BZPA 5B7QA 3GEBA 3U3JA 1AXGA 2P90A 5C31A 2NU7A 2C9DA 4HSEA 1HYHA 4POAA 3FPLA 3BEOA 3R0XA 4I1SA 2J9XB 4LHXA 2AQ8A 3UQZA 5H81A 2JH3A 2K87A 3PWZA 1M6EX 4UNRA 1X8LA 2W2OA 3JU3A 3DYBA 1BYUA 1XHFA 3LGAA 2YXNA 2L4EA 1HYGA 3HCFA 4GXTA 4NYIQ 4C29A 1N5IA 4GIPA 2CDAA 1CTQA 4FINA 3NIDB 2JAXA 2RHBA 4BLSA 3LCRA 3TDNA 3V2IA 5CDTA 3HYNA 3NNNA 2AN5A 4NBTA 4XVHA 1CF9A 4BB6A 4OI1A 2JJ2D 3TCXB 5HGJA 5BYKA 5CH3A 5LQUA 4C4TA 2IYVA 1RADA 3ANSA 1LLUA 4TV9A 1WDMA 121PA 2GF0A 3WVNA 4DJEC 1AGYA 2W2TA 3ENQA 1NI5A 3H9BA 2YHAA 3PHIA 2C00A 5SYNA 3T99A 3N2KB 3TLGB 4BNGA 2ATVA 2QVYX 4L8VA 5CW1A 4OM8A 2XWJI 1GA4A 2A0XA 2GPNA 1VYHA 4PIVA 3HKBA 1V0JA 3IBTA 3HCBA 4X00A 4QGSA 1QF9A 3CW9A 1V35A 4UFPA 4FFMA 2FSIA 1HE4A 3QVXA 4HLNA 4ZXFA 1Z8NA 3CCFA 2F7SA 4KWCA 3GCZA 3P9QA 1MQ8B 1NR5A 1Y4DE 2BBOA 3RRYA 3RF7A 3SC2A 5DHPA 1S5PA 3B1JA 4YPOA 4BPRA 5JQGB 1DIAA 1J1ZA 2LIPA 4ICIA 1Y4SA 5LWHA 1JFFA 1JKJB 3LCCA 1QPBA 2P6RA 3L9WA 3QFTA 4G86A 3WG9A 2XKKA 2LHGA 1XKTA 4IBDA 2CE2X 3G5UA 2IP4A 4XVUA 3LPDA 4MUNA 3R7DA 3V34A 1G8YA 1WXWA 3GAMA 4BO0A 3TRKA 3I12A 2AN3A 4WESB 4WASA 4I5SA 5JS8A 1G2OA 5GIPE 4HMPA 5DEOA 3E61A 1P1CA 4IQFA 1ZGHA 3RBAA 3LF1A 2XGJA 3L8ZA 2R8YA 4JGIA 1HDZA 1XP8A 2D00A 4EJ2A 2EIXA 3BFJA 3LSYA 3AOEC 4AN4A 1TIKA 3BS4A 4YP9A 2V1XA 1KERA 3HP4A 4YACA 1RLIA 3WDLA 2RHTA 1UMKA 2DWUA 1EGQA 3LV8A 4E5UA 2DX7A 3HR8A 5ALVA 3CWQA 3U5TA 1KQPA 2Q27A 3O5AA 4UNQA 4IXMA 4RADA 1WZIA 4HNTA 2E87A 4KTTE 3ICWA 4RWEA 1U99A 1OREA 4EO4A 3QHQA 5K03A 3PEWA 1LW7A 4NNJA 5F3WB 3IDSA 1W2HA 2H1CA 1OMOA 1G5TA 1XJCA 1H0RA 3CW2A 4JYPA 5GOTA 1N8SA 5ALFA 3R5FA 3KQTA 3X0DA 1CUWA 1V5WA 3ZY6A 1TU4A 2P7HA 1XZJA 1U8UA 2QUJA 2OPBA 2WA1A 3HJRA 3LLMA 2OGZA 3MAAC 5AUQA 3SZRA 3KAJA 4CIAA 5JT1A 5KYGA 2QBYA 1O6CA 4DVJA 1IN5A 1PL7A 1DT5A 2ZSIA 5IUNC 4TKZA 1Z0IA 2VATA 3I72A 4C2UA 3QZUA 3RHFA 3W6UA 1Y4AE 4CMHA 1XU4A 2BGGA 4ZYYA 2BMVA 2WR8A 5KHAA 3IIJA 4N9QA 4UDOA 5AW3A 2NO1A 2Y9PB 2D1FA 3QW2A 2AG0A 4TLCA 2L19A 2C1ZA 4F97A 4U7GA 4YROA 1SVMA 1XEAA 1UBNA 4FR5A 4D4HA 3DJFA 1M67A 2PNFA 1ORTA 4ZRDA 2VQFB 3OTWA 5K1ZA 4CFSA 2FOXA 3PNPA 1AGNA 4B6JA 1G3QA 1H2HA 4M7RA 3I2HA 4FFSA 1BJKA 3T5MA 4J4TA 2VSYA 4NJMA 1VRWA 4ZU3A 1FSZA 3EW9A 4KPYA 3U9TA 4L07A 3D1LA 3S5UA 9GPBA 2LBPA 1GDHA 4RPIA 2NU7B 4GYYA 1V8BA 2FR8C 2VAMA 3EZLA 2A3NA 2W2XA 5DGXA 4GQAA 1T0HB 2QF7A 3LH5A 2V7TA 1AKQA 4JBXA 4MEAA 4OXRA 1CQPA 3ZI0A 4DM4A 3SEQA 4DV4B 3NVMB 2NU6B 3PXBA 4HYEA 3ELYA 4Q3KA 1NQ5A 4ZHSA 1A9XA 1KYVA 1NAHA 1V11A 3G6KA 2PZGA 3MUFA 5ICGA 3HN7A 4MWBA 1NUUA 4P16A 2WKQA 4M0DA 1SQ0A 4O4LB 1AKEA 1L7EA 3D81A 5CA0B 3O82A 4RJJA 5BYJA 3SXUB 2Q3DA 1HGXA 1YD7A 3BWXA 4FGJA 1E59A 2QRZA 3ZCPA 4EGQA 2YTZA 1J8MF 3N6VA 1R8JA 3RD5A 1UBLS 3TG2A 2D5IA 2EL9A 2X5KO 2MJLA 4A03A 3D3NA 1SJ9A 1QLWA 1IRXA 1JDZA 2HB6A 1UIRA 2NW6A 3OECA 3OOWA 1BKSB 4ZMRA 4KXWA 5G0TA 2JZ0A 1DQRA 2FJ0A 3H05A 5AW9A 2H4HA 2JBAA 2HMWA 2XVXA 1CZKA 1NW5A 4FONA 3HV2A 3L7JA 3W2HA 3MLAA 2KRUA 2ILVA 1TEHA 1Q39A 2J0EA 2FUKA 2MYPA 3QVOA 3BPSA 1WNFA 1XMJA 3N7AA 3NHRA 3QKWA 4I99A 4WRRA 4OAQA 5E0OA 4RHCA 4RGYA 3KQPA 1IK4A 2O7QA 5HEKA 5KNCH 2JFWA 3LUAA 4TYPA 4DDMA 1DNPA 5KC8A 1JE0A 2NQ2C 3GPBA 4IG4A 2B4RO 4NOKA 3I04M 3A06A 4ARSA 1UFVA 3GY0A 5AM5A 1JEOA 2H6EA 2QTNA 3LI2A 1LVHA 4PRYA 5HQJA 5IW8A 1C50A 3TB6A 2HBYA 3WJ7A 4BGIA 5CVUA 5HQ3B 4HUQA 1US8B 4LWQA 1EZZA 5EMLA 3RGSA 1UBFA 4A0FA 1L4NA 2FW1A 4LSGA 1A4XA 4D4MA 5BMVB 2GJ4A 5DLEA 1UMCB 2VAWA 4EB8A 3Q7SA 4B6PA 4C0HA 2EYQA 2F3PA 4RLFA 2DECA 5CNIA 4O4HF 3L18A 1RQNA 5JWRA 5DRYA 1EEXB 2MMGA 1QR6A 2ZK7A 3CPSA 3DOHA 1SKMA 4M9RA 1KWKA 1VKRA 2V5VA 3AONB 4M76B 4Q7LA 4PYNA 5E2BA 1RAAA 1U8YA 5CCBA 2QW0X 2O06A 1J25A 3I61A 1MJ5A 4K8RB 3UJHA 3HZZA 2BMWA 3T4PA 4D8XA 3CIOA 2C8LA 5FLKA 5JHHB 3P0HA 3HA2A 4WNAA 3VH3A 2HFKA 2WSIA 4DV6M 5K9ZA 1CQIA 1X9GA 4U2DA 2GZHA 1NBOA 1J99A 2DENA 3QOFA 4OKNA 3Q40A 4LZPA 2KBFA 1TVKB 4G4GA 2DR3A 3STXA 2BGMA 1Q5PA 2FCRA 2W2VA 1TZBA 4HN2A 1UMDB 4CCAA 5KEIA 3WO0A 4PXSA 4U7JA 3UK0A 4IG9A 4ZT7A 3WYBA 1RMQA 5DM4A 1Y3CE 2B8TA 2F59A 2H48A 4QOSA 3LUJA 4Y1GA 4CM7A 3ZVNA 3GCGA 2R60A 2OO3A 3GDGA 1G8MA 2VYND 3DL2A 1SVIA 2ZVQX 1VYUA 2J9YB 2BRUA 1BU8A 2FZEA 4TSKA 4AJ4A 4ZYZA 3WK7A 1WVGA 2YDYA 1LC3A 4F2HA 2WB4A 4PC7A 2WTMA 5E1OA 3TZQA 5JAIA 4C6TB 5FTLA 3N28A 3OG9A 4U39A 4YBZA 1VKJA 3GBSA 5GAJA 1OVGA 1KDOA 1Q0TA 1DGHB 1JVNA 4FHGA 3DS8A 5EG5A 5ELLA 2IWRA 2DPXA 4B35A 3TLBA 1PWHA 2D2XA 1EDDA 1FB5A 2UZIR 1U8CB 3F5MA 3AJIB 4CV2A 4DWWA 3PGLA 1JZSA 1QHNA 4ENPA 4FVMA 4BJ6A 4J3JA 1BS1A 2IYSA 4AUMA 3A9TA 1EX1A 2OV1A 3HZOA 4AJ9A 4E2YA 3KT6A 5EXTA 4IO0A 3KXLA 2LCIA 2FPLA 1U28A 4FR0A 2QVLA 3H1AA 3RVPA 3TF5A 1QWSA 2OAQ1 2R47A 2R86A 3ICCA 4BVGA 1LDGA 1XQXA 1IM5A 1BX0A 1U1GA 1XHBA 3CLTC 4PXYA 3EOZA 3OZ7A 4JI6B 5LD2C 1RXWA 1LTMA 5HR5A 4JI0B 1E61A 1K0UA 1YJBA 3LQ2A 3V2HA 3LT2A 1VBNA 5T67A 1N7IA 3RJ5A 5TQJA 3RADC 1UJNA 4QTTB 3COZA 2IUUA 4TYMA 3WGYA 1NQTA 1JDUA 1Z56C 3O7MA 4BV3A 1Q3HA 4S1NA 4RTJA 2JJ1A 5NLLA 3OP1A 1TB4A 4QYXA 1I0LA 1UPXA 4UBOA 5FBVB 2BI7A 1LQUA 4JKOA 3WZMA 3FWZA 4FYIA 4PC3A 5KKAA 3O4FA 4IHKA 4H08A 4LIPD 2ZFUA 3E5NA 3ZJ5A 2J6CA 3J81k 4MV7A 2PKQO 2DU8A 1GPYA 1Y6FA 5FLEX 4Z86A 5IT9S 3OETA 2DSNA 3B3FA 2ZCVA 3CJRA 1OPRA 4ZEMA 4TLBA 1I1HA 2VI5A 4IFIA 1H9CA 1V9CA 3U61A 2ZUUA 1DC3A 4EGCB 2QW8A 4QVKA 4PZZA 1RYDA 4MWSA 4O8ZA 1JFTA 5IULC 2HWXA 5B64A 3C8DA 4WZAA 2G04A 4NYIR 4D9IA 4M89A 1AS3A 2C9BA 4RV4A 3SIPA 4PLZA 3FZQA 2HF9A 1I7PA 4M1TA 3TQIA 5L9AA 1ISPA 3QUCA 4MA5A 4MUEA 4Z4IA 1W75A 1SUWA 1LK5A 4IEIA 1F51E 1W8DA 2DRIA 3FWYA 1F2DA 3G68A 2NOAA 3HJNA 3MERA 4Y0VA 3RVDA 4B5LA 4ED9A 3ESCA 3KZ1E 2WINI 1ZOIA 2BEVA 4YEDA 1ZGJA 4PFKA 3R8FA 3RFXA 2HSGA 1X86B 3TLGA 1X80B 3BL6A 3SYRA 1V2HE 1CS4C 3BBZA 1A95A 3MJ5A 1H9AA 3BXGA 3PC7A 4D7AA 1DRKA 4YP0A 3F2VA 2XNKA 1YJXA 4W1SA 3X1ZA 4FCWA 3LC1O 2A9PA 3PNVA 2XAAA 3B1WA 4RLHA 4PNHA 1ORIA 1YQTA 2CXTA 2BNKA 1KAGA 1ZVJA 3C5VA 2VDPB 1VLQA 5EPEA 3FVVA 1TE2A 1RZVA 2R87A 3HDHA 3ES9A 3LUPA 1U3DA 3BZWA 3GZ4A 2G08A 2W2KA 2G77B 2JARA 2OKCA 3HO6A 4GUDA 4IF6A 3SAJA 2JD0A 1GNRA 1GA1A 1A2OA 3JQ9A 2O3RA 4XM2A 3TIFA 2IK8A 3WWDA 3FCOA 3SBOA 3KKQA 1T4BA 1WEHA 1QYVA 3PS9A 1QGED 3LUGA 4G4SP 4RA9A 1ND5A 4Y8VA 5EWLB 3U3XA 3DE6X 4N5HX 3MA0A 1VCHA 2J48A 4U2KA 4UPEA 5AI4A 2DUNA 2XEXA 2ODEA 1O8BA 4JLWA 2XUHA 1M1ZA 4CLRA 4QARA 1UFQA 4ALNA 3AJ9A 1WWKA 1L5FA 2C2MA 3UVEA 1UT6A 4B3FX 2QQEA 2V8OA 4O2RA 1PV1A 1XNQM 2Z08A 3MB8A 4IKOA 4HRXA 3ROTA 1C0IA 3ZWPA 2WWIA 1HMYA 3FTNA 4X1OA 4Y98A 4ZRMA 1BX1A 4DY4A 3DT6A 2BI8A 3TD2A 1SOWA 3E5MA 5E7MA 4I08A 4M49A 4O6VA 3B1YA 3AV0A 4LXIA 3LIIA 1J2YA 1Q1AA 3EVNA 3JASA 1RVDA 3UAOA 1UP6A 4YCMA 1SVUA 3SATA 1E6EA 2C4HA 5E7IA 2EKZA 1KJYA 1TA9A 1EIJA 3ZD6A 3C24A 3NC0C 1GKYA 1H0SA 3FI9A 3PFBA 1KNQA 5TQ0A 4XVQA 4HNHA 3TQFA 3IO5A 5BPVA 2EJCA 4JC0A 5LMCA 1M2JA 3BGIA 2R7KA 5CA1F 3O3OB 5J5AA 3KV3O 5LU8A 4WVFA 5DW0A 1GFSA 1ZD8A 4HZUB 2WSMA 2BPOA 4G1EB 5MGNA 3PNYA 2PQ2A 3PQFA 1JSRA 1VMDA 1ZOOA 1IVNA 2DPHA 1RWOA 2A7XA 7GPBA 5L3QA 2JAOA 2C78A 2R4EA 4QQNA 3LHSA 1IXSA 2B99A 4URWR 4XIIA 1NR1A 2ISCA 5A03A 5TX7A 4DYHA 5IK2D 1K7SN 1DQYA 3FZEA 4H31A 3NIWA 4JLDA 5I7HA 3K1TA 4W5RA 1ORYB 2ZSAA 3QELA 4PYKA 3ZPXA 2ZBGA 1B16A 4TV8F 2ASEA 2GCIA 4CXMA 3CVUA 3D9QX 3FXAA 2NXJA 5AM4A 1DQPA 2P68A 2QTLA 3OJLA 4GMFA 4YT4A 2AKYA 1BGWA 5CT4A 1WPRA 1W0CA 3EPLA 3L1VA 1YKFA 4ENSA 2NADA 2YXEA 2B37A 1VJRA 3DBVO 2JY8A 3LZDA 5EL0A 5LBTA 2K5UA 4RK7A 1LA2A 3FMIA 4ZA2A 3FJOA 3FOCA 3KO8A 4YLYA 5EJ6A 2Z9CA 1KK1A 3TKYA 4ZVRA 4IQGA 3G8AA 3DCJA 3X1WA 4AK9A 4DUYB 2HBQA 3HHPA 1QYRA 3KR0A 2VDOB 3RFFA 5CA1B 1KORA 5KX5F 1Z73A 5FHQA 3A31A 3BAZA 1RIFA 2LRHA 2X6QA 2XKAA 4IH9A 2UYOA 4N3AA 5DOZA 4JI4M 4ZU1X 3EPKA 5JJKA 4UTPA 2ZI7A 2OR3A 3IP9A 1EXMA 2FJUA 4H0CA 1JL3A 1X1AA 4NFYA 3IVMA 4LDAA 4QLAA 1C3OB 1L5ZA 1YB4A 1XDSA 2Y2VA 4URXR 4ER3A 1N2BA 1J8YF 2VQ3A 4NOMA 4RMGA 4F6RB 3PLAE 1GTZA 4RHUA 1IXKA 2JGFA 3QXXA 4R2XA 7YASA 3PNQA 3S70A 4EX7A 2YHIA 3C6QA 5C4IA 1IVSA 3WLKX 4JI8B 1FPMA 1NSYA 1WW8A 2JIMA 3ET5A 3EA4A 4WL0A 3ZHYA 3ZWDA 1K3UB 3H2BA 4PE5B 4B6OA 5LJIA 5CT9A 2VP9A 2PKWA 3GYGA 1MH9A 4IH1A 2MH8A 1W46A 3GEGA 5EE3A 3D4OA 3ZIAA 1I30A 4LFAB 1ZNWA 3KJFA 4C9BA 3DO6A 1CUVA 3Q10A 4E30A 2JEYA 3V5NA 1CF2O 3ISJA 1SC9A 4HWKA 2RI0A 4RFSA 1YQXA 5I9NA 4CIZA 1VL1A 1N2GA 5ICEA 5GZ1A 1BHQ1 2PFSA 3GPDG 1R5JA 4UBNA 1JH9A 1OX6A 4FFRA 1TF2A 3A1WA 4XIJA 3FWNA 5GP1A 4LXGA 2QXTA 4NXMB 4CF6A 4DB4A 2H52A 3CH5A 3GJ7A 4UHEA 1SIOA 2OFXA 3R7LA 2A0WA 2NO9A 1Z5VA 5AW7A 4BGUA 1C3XA 2LGJA 4I36A 1Y8ZA 2ZGVA 3NTVA 4DSNA 2GZAA 5DBGA 4KXMA 1K9VF 4RM2A 4R31A 1RJDA 5FFNA 4DQ0A 3EQ9A 5K0CA 1RCFA 3EEOA 3VV3A 1R00A 2FW0A 5BR8B 5LB2A 2W71A 4MHSA 4Q7JB 1RMYA 1U90A 4N6NA 4AL4A 2F3TA 2DVMA 2PX5A 2X7JA 3EDMA 1VLMA 3JR3A 3U48A 3LT5A 2ODWA 3VA7A 1G20B 2IODA 3EVFA 3TD6A 2GSDA 3SM3A 2WHEA 3DW3X 1T3ZA 4IBJA 1BA2A 3ZN2A 2O3QA 4CDRA 2CLHB 3L7OA 4D56A 1QHYA 1BTOA 2WNSA 2H18A 3LFHA 3PC3A 4OQMA 3FHCB 1Y8AA 1NX6A 2DLCX 5K3FB 3TUJC 1DAGA 1OILA 3MYRA 4HNQA 5CA0A 4B9AA 1MJGA 3B74A 1GG8A 2E48A 3DF9A 1M8KA 3OE4A 4U2EA 1SCNE 3UAGA 4TYYA 1TECE 3DMPA 5LC1A 3G17A 4ZEXA 2O7VA 2XOKA 3EEFA 2GCOB 1QRDA 1SNYA 1L7AA 4MIYA 4W7HA 4CL2A 4C4OA 2BFCB 2OXRA 4QQFA 1YE8A 4P32A 4OFXA 5P8WA 2AFIB 2ZI3A 1AKMA 4OIFA 4DDWA 5I9SA 2DLDA 3KAQA 1D5WA 5G3YA 2ZS9A 2LW7A 1KYWA 4EM6A 1I4WA 2DHDA 2HFJA 4QEZA 1PJCA 1N1EA 2C5GA 1MAAA 4K1LA 4KBYA 3HNPA 1Z63A 4GE0A 2Y4NA 1ZGBA 3SJCA 2GVZC 1EXNA 2JLZA 4R2LA 1PQUA 5T6BA 3Q3EA 1EA5A 2Q5FA 2XCSB 2UUCB 1X8XA 3GJ6A 1HZJA 1P60A 3N8GA 3EYAA 4PVDA 1FS4A 5LDHA 1TQDA 3AZOA 1TIBA 3SC4A 3CRQA 3OD5A 4HADA 3AVPA 4YIKA 1COZA 2YRWA 721PA 4FUQA 5KYKA 1KVTA 4JI5B 4HG2A 2ECQA 4MCIA 3WL6A 1KEEA 2ZI4A 2B5OA 3IBYA 1M10A 2PH5A 4YTEA 2X1MA 4X6LA 3V7YA 4GFDA 2G72A 3NAQA 3PGXA 3QMMA 1OTXA 4OB6A 1E60A 5ALPA 1MPXA 3SCZA 3LBAA 2P27A 1AZLA 3MCAA 4QLBA 1FJGM 4UM9D 2G63A 1EWYA 4B3XA 5JO9A 4RPHA 1AV6A 2PUWA 4B2YA 3UXEA 1X3SA 2I99A 3AP2A 2QMHA 4DCJA 3T35A 5ALDA 3HVJA 4EBFA 4L1KA 1KP2A 1Q2XA 1SUEA 2EKBA 2NZ8A 5EKDA 4C01A 4H15A 4WWHA 4E11A 4X45A 4D6YA 1NV9A 1N7JA 4WZBA 4YHBA 1PJ3A 2PA3A 4F85A 3HJTA 1UR5A 1Z62A 4GOLD 1E3TA 1BU5A 1GSHA 3EWSA 5FKJA 4Q7EA 4PFSA 2EWWA 1J0AA 2P5YA 3MTGA 5JMPA 5B55A 1T9BA 2Z58A 2O1SA 1MKYA 1NPDA 3DBLB 2YV3A 1WBBA 3T5BA 1VCNA 3GVPA 5JV5A 4F7WA 3D5EA 2ZJFA 3QLVC 4PQYA 5DBIA 3ZCVA 4M86A 4D8WA 4LY0A 4DIOA 5J40A 4F0JA 1YFJA 1O94D 1H23A 4XWAA 1NVWQ 5E6SA 4E2XA 2AJTA 3U4QB 2DUMA 1WKCA 2FETA 4CLRB 4IDFA 1C4WA 3GP1A 4HYQA 4QC2A 4ND5A 4Q4AB 1VG5A 2IEGA 1DLIA 2JBHA 2FDXA 2WHYA 1JLSA 2XB8A 3FDZA 4R81A 4Y9TA 5CCEA 1Y5IA 2I71A 1BRTA 5EKUA 4Z0NA 4LJ5A 1BMFA 1RAIA 3V1YA 2GF9A 1GEGA 4YRZA 3JZFA 4YY3M 1L6IA 2NTJA 3D3QA 2B21A 2YYZA 2BYTA 3ZIUA 5FWAA 3NH9A 2FR0A 4QM7A 2QTWB 2LVQD 1ANKA 3SMVA 3DZHA 3I1YA 2VVTA 2FH0A 4IDQA 4DV3B 3U7JA 3DT9A 5JE8A 2PT6A 3NASA 1NULA 2OHXA 2RGWA 3RYCB 5J23A 1AG9A 2QYOA 1ML4A 4FR2A 1K66A 3JAMA 5ICCA 4K3VA 4P4NA 4KH0A 2OL4A 4IR7A 4MQ6A 1C7YA 1V26A 3B2QA 3QE9Y 4ZTUB 2DAMA 1TFRA 1U1CA 4FFBB 1Z4KA 4ABTA 4KUHA 2Z7JA 4B7GA 1SQ5A 2ZT8A 3L8YA 4KK3A 4NNPA 1YT5A 4AZ0B 1HQDA 1KMNA 1RJWA 1S96A 1BD3A 3S2YA 1VKHA 3EFOB 2GB4A 4C6HA 1L5VA 4BGVA 2BCGY 2IIPA 2A67A 2UXCB 1TOAA 1HEIA 2G0AA 2GN8A 2C5HA 3FNQA 5H37D 2ZRQA 3UO8B 6GPBA 2C3PA 2Q9BA 2C1EA 2IIQA 1EZ4A 3PVZA 2NP6A 1T26A 2VZ8A 3G2JA 4CKYA 2WKRA 1OA1A 2EX0A 2WUWE 1WF6A 3TK1A 4WLEA 2BIFA 4KZPA 3VPCA 2JHGA 2J30A 2ZTVA 4MLPA 4MMZB 2PSFA 5SZIA 1FQKA 3NS7A 2OHFA 2FP4A 1UK8A 4XDZA 4YGXB 4AF7A 2JLWA 1UM9A 3GGOA 2VYNA 2ZBQA 3KQLA 5K0BA 2IGTA 3U61B 2Q49A 4UTOA 4WZBB 3S68A 5IF3A 1QYDA 3JPYA 4L73A 2IL1A 4BMDA 4M60A 1SXHA 2C4WA 2UVPB 2GFHA 1QJCA 1MC8A 3JYQA 4OQEA 3WK9A 1OBVA 4XYBA 1Z5UA 4DNFA 4OM7A 4B2PA 3H2GA 1SD2A 3KKEA 4I14A 2HCBA 1ZCBA 2QMQA 1LK0A 4G5QA 3GAFA 2PNJA 5JNSA 5LQAA 1UPCA 4A8PA 1I94B 1CT9A 4DRZA 3SVZA 3S1AB 2XQFA 3CF0A 4XH9B 3P5BA 5CLHA 3G79A 2UUPA 4FJ0A 3EXEB 4M1KA 3ZHVA 3EBPA 4QULA 3O8OB 4MEJA 3LUHA 1SWVA 4HGQA 4RZ3A 2PWYA 2IUSA 3BWCA 1NHWC 4ESOA 2QY9A 4KR3A 2FE1A 1UJCA 4OHWA 3AI1A 4X6YA 5KOHA 4DR6M 1FUKA 3CC8A 1M6VA 1UMCA 3TR0A 3G88A 2P6MA 1DBSA 3RBVA 2WYWA 4ZI5A 4KODA 2C5SA 1Z4LA 4R41A 4OJKA 1DXYA 1SHJA 2FRXA 4MS4B 5FBQB 3DVRX 1R0YA 3A9RA 2R46A 1P18A 3CE6A 3O4JA 4EL5A 5BUSA 1DBVO 4TMFA 4ZT6A 2JLVA 2DC1A 4B4KA 3MXOA 3PB3A 3KKLA 3HCNA 4R68A 1TUEA 4IDOA 4L9RA 2VT3A 3K0AB 3ISTA 3TQTA 4RULA 1TCVA 2IKSA 3DAPA 1GA6A 5DK6A 1P7PA 1EXWA 5A2QS 3DOIA 3JQEA 2FMXA 3RHZA 3VZCA 3ZDAA 1O8CA 2HT6A 3K4QA 3SIXA 4KOAA 4NR0A 1YL6A 2GZSA 2OSVA 2AI3A 1KU0A 2GT1A 2PGLA 5C5DA 4I2NA 1Q15A 2NVUA 3UK2A 5I7EA 3EVGA 1VP3A 3TPZA 2RH9B 4KLNA 3DNPA 1M34B 4PSKA 4ZEWA 4JH0A 1XELA 3VR6H 1CQZA 1KC3A 3GZNA 4DRYA 2IU3A 2BR4A 4R6WA 3G1WA 2C2XA 3BRCA 4TWAA 1ICIA 4F5EA 1VM6A 2CUKA 4RVDA 3T1YM 5BV8A 1N34M 4GAEA 5L3SA 1GHTA 2OHVA 3DLBA 2H59A 1Q0ZA 2BEUB 5TT0A 4NSNA 5HFAA 3DOFA 3E4DA 1ZIOA 5ICSA 2QLFA 2R8ZA 1HMPA 4E12A 1L5LA 3W78A 2XWPA 2Q1WA 1ZSYA 3GRFA 1Y8RB 3JQGA 2VFAA 5DK4A 2SBTA 2UZ4A 1AJEA 4EFMA 3BG5A 1LTKA 3T5DA 3UBMA 2LUOA 4NZMA 2J6HA 4EHNA 3QY9A 3W2IA 4HEOA 3GRCA 1BWQA 3OU2A 4J0IA 4L9SA 2OA0A 5E9WA 1UIMA 2XMZA 3IJ5A 4UTXA 4NARA 3TW4A 4L3VA 1N2ZA 3DDSA