4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Fidgetin-like protein 1
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
1F2TA 5EP3A 4TQ9A 3H2YA 3GJ8A 1ZYUA 5JECA 4CEHB 5AUNB 2AR7A 3GLHE 1R10A 2GXQA 1CR0A 4B48A 2J46A 2FNAA 3IBYA 4LSGA 1SKYE 3UMFA 1S9HA 1G18A 3WP0A 2WTUA 5EXSA 3IQWA 2PLFA 2V8OA 3CONA 2REOA 3N5CA 4G0NA 4NYIR 3L0SA 4LI0A 5EP1A 2O5VA 3QKTA 3QF7A 4DC9A 1Z0FA 3SYLA 1KI1A 3R20A 2N1BA 4DSUA 1DO2A 2FPMA 1ZM4A 4GOKA 1R0YA 2EFCB 4OQXA 4IEIA 3IIJA 1IBRA 1Z29A 1X37A 3ZH9B 1ZC3A 2UZIR 1E9AA 4IFBA 1GNPA 2OCBA 2QA5A 4UNRA 4JT4A 2IX3A 1E2DA 4DZZA 4L4UA 3X2SA 3HU3A 2IT1A 3F3YA 4JLNA 4XVUA 3PEUA 2RHMA 5DNYB 2XSZD 4ON9A 5DH9A 3TRFA 4R2IA 2WJIA 4GRAA 3R9IA 1GFIA 2OSBA 3RDPA 4LJ4A 3OF5A 4Z1MD 1W36C 3VU9B 4B3XA 4TQUS 2ZI6A 1G291 2AK3A 4O2RA 3RRZA 1Z08A 2WPDD 4MUBA 5D3MB 4ASUD 1JR6A 3THXA 4YONB 4B74A 2ZAMA 1OPXA 2DYKA 4YC7A 1A4RA 2GVZC 4NYJQ 4BE7B 2OFOA 1Z28A 2QBYA 2QUZA 4EAQA 1M8PA 5CYPA 4JKYA 3Q7PA 4B71A 2XITA 2A7QA 3AV0B 1KO5A 3IBGA 2JJ8A 1C1KA 4UJ5A 3VR6A 3MMPA 2H7VA 1JAHA 1K5GA 1W36B 5C18A 2IYUA 5LBIA 4M1YA 1VMAA 1SXJB 4XIGS 3CZPA 5DGXA 3CKLA 4QGGA 4IDHA 4AG6A 1OW3B 2O52A 1K5DA 2DFTA 2JLSA 2ZUDA 4MRSA 1U8AA 4IEEA 4Q9LA 5G53C 3W8NA 1R2QA 2WVJA 5JLJA 3X1YA 2VSOA 2PEZA 4PANA 4EKDA 3AB3A 3C16C 3OIWA 3E5HA 5CDFA 4LYAA 2JDIA 2QPAA 4LJ5A 3PV0A 4O2LA 2KE5A 1TQ4A 4HUQA 2CL0X 4FXPA 5CK5A 5L3QB 2VO1A 4A8JB 3ZGXA 4ZI2A 4BLOA 1CBUA 2WIBA 3IEUA 4I81A 1PV4A 2D2EA 2WSSA 2X8AA 1OB2A 1YR6A 2ZE5A 1TU4A 3F8TA 1MO6A 1XTIA 5JWOA 4A4DA 4JKIA 4I1OA 4M1KA 2P67A 3W6PA 2UVQA 4OQLA 1PZNA 3LVRE 5HZKA 2GEDA 4PTLA 2CCJA 1CP2A 3DOFA 2IXGA 5K8IA 4G5RA 4F4CA 2NTYC 5HE9A 1S9DA 1WMSA 4PSKA 1X8JA 2QTVB 5EE3A 2J0UB 3G0HA 5FL7A 1N6HA 4MDEA 2GEVA 1RYFA 3MWLA 1OKKD 1E3MA 2O8DA 3D8BA 5L3SB 1P9WA 4P0TA 3CM0A 3QQ5A 1Q0UA 4JLVA 1E2NA 5FR1A 1W0JD 2YC4C 5IDVA 4A0HA 5FUXA 1OHHA 4IKEA 1V5WA 4BRWA 3NDPA 1FP6A 2C9OA 1Q22A 3C7KA 3OE7A 3EARA 4QHTA 4ACBA 3QEOA 4GT1A 2KJQA 1G5TA 1X1RA 2OZEA 2W83A 1D2EA 2ZJAA 2XXAB 3KXLA 4HSEA 4HYYA 1VHTA 4Y0VA 1QVAA 2P2LA 2MSCB 4Q9KA 2WSMA 1P72A 2ZVPX 4LHWA 2OESA 3WMEA 3GP8A 1AS0A 4Q47A 2GEUA 4DDUA 2VHTA 1VG8A 2Z4RA 3ZVNA 1KSFX 2XNDA 1E9RA 3CH4B 4JBYA 3FMFA 1A1VA 3T5GA 1OYYA 5C2JB 1HA3A 2QN6A 3RS5A 2QAGA 3K70B 4C0KA 1GL7A 3DMNA 3HPRA 1DOAA 4TL6A 4XD7A 2G0TA 3BB4A 4IVPA 4OHYA 2XXAA 2ZRNA 1E0SA 3I1FA 3NH9A 1DAGA 4JBWA 4Q1AA 3FGNA 1OFIA 2YYZA 3NVAA 1E79D 3GJ7A 5F98A 2GTPA 1NBME 3W6OA 1US8A 1HYQA 3I92A 5TV2A 4RVCA 1HE1C 2PT7A 4MRRA 4RKFA 1MO3A 4A0GA 4NL4H 4V02A 5AUQA 5FR2A 4Q01A 2PJRA 1ETUA 1XDBA 5A4JA 1SVSA 4HZUB 3TR5A 4OHWA 4K8OA 2CHQA 4AURA 3KZ1E 2OG2A 1XJ0A 3SHWA 2JA1A 1S3GA 3WNCA 4QBIA 4RCZA 4GNKA 2WBLC 3GLFA 4EFLA 3DZ8A 2BMDA 1JJ7A 2OM2A 2HLDA 4GI7A 2BDTA 4DDWA 5KPJA 4A36A 2AD1A 5J40A 1XCGB 3KKPA 5CB6A 2GJ8A 1HT2E 3GLIA 3UMSA 1SULA 3QXCA 1KK3A 1U0JA 2WMNB 1NLZA 5AR1A 2TMKA 4LCBA 3PEVA 2QM8A 5LPNA 3WBJA 2ZVQX 3EZFA 3RS0A 4TYQA 2ORIA 4BLRA 1F60A 5AK0A 2G3YA 1CJVC 3A4LA 4MRNA 2RGEA 2NMVA 3SJBA 3CO5A 3VMFA 4RFSA 1CEEA 1NIPA 2PH1A 4ZDJA 1XTJA 2J87A 3FMIA 2QY9A 1NKSA 3IEVA 4Q7LA 3B8HA 4TL8A 4CEJB 1KI7A 1KDPA 3LO5A 4JBXA 3SYKA 3BFXA 2J1LA 1ZINA 3IIMA 1I2DA 4N0EA 1EFHA 4J0QA 1IXZA 1YZLA 4A9AA 4PFSA 4PXAA 2BEJA 3B78A 1XJQA 4LJ6A 4I4LA 1JBKA 2XZLA 3AVYA 2NO9A 5EZ5A 1FX0A 1DPFA 2FH5B 2GRJA 4BPBA 4FWTA 2UKDA 5HE8A 2YJTD 4A8JC 3A4NA 4B44A 2HDNB 4Q18A 2YZ2A 1FFHA 2FPKA 4KSBA 4YMTA 1GOTA 4W5HA 5FI1B 1DAKA 3IDQA 2W2VA 4EUNA 2GAOA 2H1LA 4DWJA 4BGDA 1ZU4A 3LNCA 1ZUNB 1CKEA 1II8A 1XRJA 2RGNA 1EK0A 4GBMA 4TMKA 4B2LA 1FMJA 1G7CA 3LQQA 3CPHA 3THOA 1XEXA 4JLOA 4LYJA 4C0BA 3CNOA 2B8TA 1ZBDA 4Z51A 1J70A 1TQ6A 2HEIA 2QZ4A 4LZZA 3WHKA 1QZMA 2ODEA 4Z8XA 1NMYA 3SI7A 1PLKA 1VYTA 3CBQA 4KVAA 1FNNA 2FGKA 4ERNA 4NPHA 1FTNA 1G3MA 2BBOA 2DWOA 5TDHA 4L9SA 1RRPA 1YQTA 2IBMA 5GJCA 3MWKA 1SVOA 2ZITA 1K6MA 3IHWA 1CXZA 1J7KA 4DT1A 4NDZA 2X2EA 3OHMA 3VR1A 2AX4A 2WV9A 5JI2E 1ZM7A 1UADA 1EGAA 3HYRA 4TLBA 4DCSA 2ZYTX 1FZQA 1XTKA 1MABB 3P27A 1GP2A 2DPXA 1U90A 1G8YA 1XFAA 2ZRFA 4KVGA 2J7KA 1B0UA 4X8LA 4RKEA 1ZMXA 3KKOA 3MGCA 2DZNB 3QSYA 2JLVA 2EWVA 4UXJA 2H5EA 5G40A 4ZV4A 1MRSA 1UBGA 3QXSA 1OJLA 5EXPA 2IXEA 3H0KA 4DCTA 2QG6A 1NJFA 4FMDB 1Q57A 2IUTA 3LXRA 3NDBB 4FWGA 1XEFA 3PENA 4V0NA 2HXYA 2RKOA 2HJVA 4MRVA 4QXAA 4KLNA 1E2MA 4MKFA 4M0LA 3FHTA 4TLCA 3EX7C 1NI3A 4BLPA 2DBYA 3QKUA 2ZI3A 2HJGA 1OT3A 4QGFA 5GADl 3A37A 2ZAOA 4LK2A 1NBMD 2NG1A 2EW1A 5DSZA 2CK3A 3AJIB 3LX8A 4A2QA 2ECKA 3AM1A 3QXXA 5DISB 4B47A 2NOAA 2J0SA 2G0NA 3K70C 3O8DA 3T1TA 2AXPA 1G9XA 5JHHB 2JIZD 2DFLA 3BH6A 3RVBA 2IS6A 1KOFA 1I4LD 2BOVA 2C03A 2ORWA 3KTAA 1L2TA 1JNYA 3FKQA 5FUWA 4GOJA 1NKTA 3NIBA 4QHSA 2ZEJA 4KU4A 1VCMA 1ZC4A 1TAGA 3KFXA 2V6JA 1E4YA 4IXMA 4QHYA 4E07A 1F2TB 1G6HA 2MSDB 1GG2A 2O0KA 4UNNA 4WXRA 5L3VA 4K46A 4BFSA 3ZVLA 4M9QA 1VKJA 2F1HA 1OE0A 2GVDC 1BKDR 2GILA 2FDCA 2WOOA 3BRWD 2G1KA 4LV5B 3DHWC 3CR7A 4X8MA 2OV2A 5JJLA 2X19A 3ZIAD 2ZR0A 3GJ0A 4PC2A 2JLUA 1J8MF 5HTKA 2WWYA 3ETLA 3MUFA 4XVQA 3A1WA 4Q7KA 4OHXA 1HQYE 2ZROA 1Q1ZA 2DVWB 4YQFA 4O3MA 4DEYA 5GVSA 2PL3A 3BORA 1P3JA 2A5YB 2O0HA 1E6CA 5H8WA 1Z22A 3OE7D 3T06B 1WBDA 4CEIB 3AF0A 3RC3A 2QQ0A 2ZYUX 4F4IA 1X1SA 2Q6TA 3BB3A 1GKUB 3TGPA 4GZLA 1BYUA 3N2IA 2ASEA 3LW7A 4FWIB 2UZ3A 1EX7A 2XAUA 3U44A 2EFEB 4XOIA 5FPKA 1YZQA 2F1JA 4A1FA 4AKHA 3E1SA 2ERYA 2RHDA 3TSZA 1NSFA 3QKRA 5CITA 4LYFA 1T8TA 1UEJA 4FI3C 5FOUA 1UKEA 2W0SA 4F91B 2ZJ5A 3F5FA 3H4MA 4WZBE 3R7WA 1KMHA 5HZHA 4V03A 3DVLA 5B58C 4HZIA 4ZPXA 4EJSA 2XTNA 3T34A 4TZ0A 3AVPA 3AP1A 3LBHA 2P0EA 4BFTA 1L8QA 4I1VA 4PZZA 5JHGB 4AY2A 5BW8A 4XTRA 4I99A 5JCZA 2VYFA 1E2LA 2AFHE 5FOVA 3T1OA 4LJ9A 2FFBA 1U9IC 2ZTSA 4L9WA 8OHMA 2DY1A 3TW8B 2XB2A 3VX4A 4M4SA 4Q1CA 2BCGY 3BC1A 1TF7A 4US2R 2O8FB 1KSJA 1N6NA 4HAWA 2R2AA 2EYQA 3QVVA 4DCNA 4TLDA 2OLJA 4FINA 1KKMA 3GD7A 2WPDA 2DR3A 3A8TA 3CWQA 3L2OB 4TZ6A 1QZXA 2J9RA 2KSQA 1LV7A 1SHKA 4PQRA 1U99A 1XP8A 4B3FX 3L0IB 2AXNA 4PSVA 4LJ8A 2ZI4A 3ZD7A 3GLHA 1AS3A 1E2FA 2QSZA 2I3BA 2EFHB 2I4IA 2IS4A 1JXOA 2ZI7A 5HPYB 2GDJA 4GMXA 1Q3TA 1V43A 3D31A 2GF0A 2GXUA 1UBEA 2VSFA 1OH8A 1W2GA 1ZVQA 1HURA 4ZO4A 3PVSA 5KPDA 2O8EB 1XU4A 1P61B 4LJAA 1SQ5A 4U00A 2OCYC 2OAQ1 3LD9A 2IHBA 1H65A 2YOFA 1TEVA 3Q5EA 2D06A 2JJ2D 4X8HA 5DI3B 2BJWA 1OV4A 3GMTA 1F6BA 2P5SA 2RMKA 5FTMA 3OZXA 5GJWC 1IXSB 3A36A 1XXHA 4ZDWA 1VCOA 4KSCA 5AUOB 4FCWA 1J2JA 1KSGA 4V0OA 1S0UA 4UXHA 3NHBA 1XD2A 2NO6A 4Z1MA 4KAXA 4Y0AA 4KLZA 2H92A 1YE8A 2Q9AA 3KFVA 1PJRA 4S35A 1VIAA 2ANBA 4B33A 3UK6A 4GITA 1P2SA 3IIKA 2KBFA 2IYYA 3TE6A 5JWRA 3P20A 1XD9A 1GITA 1ELOA 1QHSA 2OCAA 3RRNA 1OXTA 4PHTA 3I32A 4M1OA 1R5NA 1U81A 1UBCA 3EIEA 1ZCAA 1N6KA 2WJVA 2VRWA 4FMDF 5EE5B 4TT3D 1CLUA 1YU9A 3W9YA 2A5JA 1WF3A 4MYTA 4NTZA 3RHFA 1ZNXA 3L8YA 4EQ6B 3OIVA 3MCAA 4NH0A 1E0JA 1UKYA 2QMUA 1HEIA 4TMTA 4NYIQ 3FHCB 3MWJA 1Q21A 1CRPA 1CR2A 4B3GA 4Z8YA 5KTYA 3VQTA 4CW7A 2FA9A 5KNCA 2F1RA 4JSTA 2D62A 3WXMA 5EE1A 2IL1A 1XF9A 1E1RA 5B30A 3TUJC 4BFVA 1Q3HA 3BFKA 1ZNWA 2B7CA 1BYIA 5FI0B 4V0ME 2ZIAA 1Q44A 2ATVA 2BMJA 4D0LB 3I5YA 2HF8A 4JL8A 2FFAA 4ZDKA 3U6KA 3QF4A 1OH7A 1BS1A 4HI0E 3TSOA 3FOZA 2IK8A 4OBEA 3T1QA 2CLSA 4EFMA 5BN4A 1H8ED 3SBDA 1S96A 2ZSBA 2WWXA 2ODBA 4M53A 3THYB 4MGYR 4QJ3A 2IA5A 2REBA 5EP2A 3PJRA 4URXR 2JJ1D 3KQNA 4RCYA 1F48A 2OEPA 1DARA 2WAXA 1UDWA 1B23P 4IDOA 1KZ7B 1KDOA 3LVQE 1E94E 4PO1A 2YC2C 1ZCBA 5SZIA 4TMVA 1WCV1 1Z83A 2BMFA 2WZQA 5FUVA 1G17A 3SS8A 1E79A 1LW7A 4URZR 5A5GA 4TQAA 2J3EA 1Z6XA 3ZQ6A 1OHHD 1YZNA 4A82A 2P6RA 3RANA 5FBWB 1Z07A 2WMOB 1RRGA 4XD7D 5CJPA 3RRMA 4QKQA 2ZRHA 3ZZ0A 5UKDA 2ZS8A 5KNDA 4IRUB 3UG7A 4WXPA 4FWDA 2QROA 3JZAA 4C0HA 4JLKA 4AI6A 2A30A 4P4UA 1NG9A 2JLQA 3FHOA 3LAWA 3ND9A 1W1WA 4KFRA 5CJ2A 4IOLA 1E69A 1G41A 1H8HA 2ERXA 4LHVA 1UPTA 5FUYA 1JEEA 1KO4A 4JT2A 1G7TA 2IHYA 3MRSA 3I61A 1VDZA 3FFBA 4ZIRA 1I4DD 5JEDA 4BRUA 3EPLA 4B32A 2JEOA 4I1UA 2QEQA 2Z0MA 2D3WA 2Q3HA 3C41J 2J7PA 4NCJA 4Q48A 4UQOA 3K8YA 1E2GA 4Q02A 4ZKDA 1P7CA 1DE0A 2YNMA 3UPUA 1PLLA 3QJYA 4CZ2A 1XPRA 3PXGA 1NLYA 4GP7A 2YWGA 1J8YF 2X2FA 4KBGA 2P3SA 4A6PA 1FUKA 2EFDB 4QOSA 5FL3A 1NVXQ 1ZM2A 4WIAA 4D0NA 2QE7D 4RD3A 3AVUA 1Z6TA 2RH5A 4L5BA 1S1CA 1MT0A 3QXHA 4P32A 3GLFB 4PPGA 3CUEF 5M04A 3WNDA 1GRNA 2VTKA 2PX0A 5KSZA 5FBQB 2ZE7A 4DRZA 4JZKA 1W46A 2JGNA 4HDOB 1KNQA 4QG7A 5IK2D 2L0XA 5JSZA 5GJBA 1DAEA 2WKQA 5KSYA 1N5LA 2B7BA 4IDPA 1M74A 4DLUA 5EP4A 2C96A 1JEDA 3CH5A 4RY2A 2OBNA 1XMSA 5KYKA 3ADDA 3EIHA 2KBEA 4TTRA 5CK4A 1UEIA 1XTSA 3BIFA 5HKKA 3KXKA 4BECA 4EPXA 3W5JA 1NL3A 5FTJA 1G4UR 1ZNZA 4TYYA 2EFGA 3VLFB 4TL7A 3TR0A 4B35A 4PX9A 4II7A 3P4XA 121PA 1DELA 4DVGA 2F3TA 2IYVA 1F2UB 3B9PA 3NH6A 3DOEA 4XVRA 5K8LA 1RE0A 3GJ5A 3AGPA 4GDFA 3Q85A 4M1TA 1Z6GA 2A5GA 4LBVA 2ZSFA 5BN3A 3I5XA 1VYUA 3AF3A 1G1MA 1LNZA 5E7MA 2V55B 2WKRA 1NN1A 2WOJA 5KOYA 4JLMA 4AYTA 3KB1A 4B6FA 2PJZA 1XCMA 2NO7A 4B43A 1FNMA 3LBNA 1E9EA 1XXHE 1E0AA 4KYUA 4AG5A 4BLTA 3Q9LA 4H9GA 2J59A 2BHRA 3BD9A 4GMDA 5DN6D 1NJGA 4W5JA 2QMHA 4ARZB 4PR0A 1G64A 3FKSD 1Z2AA 2Z6VA 1QBKC 1KK0A 2XNSA 1KGDA 4NYMR 2F9LA 3TVDA 1FTSA 1NG1A 4NYMQ 2GHIA 4MRPA 3THWA 1YRBA 5JFGA 4XWKA 2VP4A 3LLUA 3A58B 3OEEA 3R7WB 4YMVA 2R6DA 4XWOA 4KBFA 2I1VB 1NN0A 2JCSA 2HF9A 4LC1A 1Z06A 3HU1A 4BASA 4DLZA 1ZD9A 4LHYA 1HQCA 3SBEA 3BE4A 4JVSB 1RFLA 3VHLB 3O8BA 5TB5A 2HYDA 3RAPR 3SU8A 4PO9A 1IN6A 1II9A 1LFDB 5TY0A 1F3OA 3GLIB 1IN4A 4NU0A 2OE2A 4RZUA 2O8BB 1JR3E 2JIZA 3SOPA 2YKGA 2WICA 1BIFA 2O8FA 4CEHA 3GJ3A 1QHYA 4HB2A 2FFQA 2ZJOA 1AN0A 4DDTA 2CNWA 2VPPA 1GNQA 3TJZA 4MA4A 5C4GB 2JLZA 2V6IA 4C7OB 1ESNA 5FOXA 1TTTA 1KI6A 1Z0KA 5L8VA 4MDFA 2V4ZA 4R9UC 1MO5A 5EQTA 1GVNB 2G6BA 2QP3A 4GPTA 3ZD6A 4GP6A 3G5UA 2RCNA 2GCOA 2HXSA 3AQ4A 4RSGA 3BK7A 3HYTA 4OQMA 3TIFA 3ND8A 3GFOA 3FYHA 3EA0A 1UJ2A 1G20E 5E3HA 4OI0A 3AUYA 4KFUA 5LB4A 3CF2A 4KJZA 2R9VA 3WBKA 4ITRC 4QBFA 1MR3F 1JQJC 2ZI9A 4TMWA 3ZIAA 4YMUA 2W2XA 3MLEA 1T3HA 4D4LA 1RC8A 4M21A 2VSXA 5AJZA 2FN4A 1SKQA 2BBWA 2HCJB 2RGXA 2WKPA 4PAQA 3TW4A 2CJWB 3D7MA 1U0HC 3U3KA 5H1YA 4D26A 4LGMA 1GKIA 2QENA 4KHZA 4BWYA 2YVUA 3NEJA 2NPFA 3X1WA 4HB0A 4LC0A 3EPKA 3TQFA 2PLRA 1CR1A 1OKKA 3LX5A 1KAGA 1XEWX 4DSOA 4BFUA 1W4AA 1XZQA 5SZHB 4G5OA 5SZKB 3KL4A 5L3QA 3Q5DA 4A8JA 4E22A 3K09C 4YXWA 4ZCMA 3CPEA 1QHNA 3RWMB 3QPUA 3B6EA 1NY5A 2W6JD 3OIUA 1LS6A 2C8VA 1IOZA 2W58A 3IPYA 1G5RA 2ZYWX 4NBSA 3CNLA 2QT1A 2EVWX 1G8FA 2LCFA 2JAQA 4P33A 1RJ9A 2A5FA 4FMBB 1AS2A 1E2IA 4XSGA 4Q4JA 5TVKA 2A5DA 5D3QA 3K0AB 4WW0A 1JQLB 2GK7A 2J0UA 2QBYB 2GF9A 3BH0A 4TLEA 1FOEB 2FE4A 3MHVC 3P4YA 4HATA 2AD5A 4HLCA 2Z5FA 3X1ZA 1F5NA 4LOAA 3Q72A 5DHAA 1A7JA 1N6RA 4HAXA 2B6HA 4LX0A 3BOSA 2YV5A 5FOSA 2Q0HA 1SVIA 3O47A 2F7SA 3GLGA 1U94A 4TTQA 2JLXA 4S2EA 2ANCA 3BH7A 1LF5A 4QM6A 2ZQ5A 1AGPA 4A2PA 2QP9X 2O8CB 3QEJA 1AGRA 2DWPA 3FFAA 2VP5A 1DAFA 4UKDA 3HJNA 3V9PA 4IXNA 4JLAA 1EXMA 1VPLA 4ZI3A 1T3SA 1Z47A 2V7QA 3GCGA 1VYVA 4HUTA 3DM5A 3L8ZA 1COWA 2GZAA 1KMQA 2E9SA 4JIMA 1RVDA 5EUMA 4X8OA 1P75A 4WAUA 2CEAA 2WJGA 4JYCA 3QKSA 3U3OA 2WWIA 3Q8XB 1E96A 3J81k 1EFUA 3S1AA 3IPXA 3TSWA 3OEHA 4R71A 1YZUA 2XSZA 3U3MA 1P2UA 3U3JA 2ZSDA 3LLMA 3LDAA 3EZ9A 4G01B 3RC8A 2ODNA 3SFVA 1GRRA 1LY1A 5F9FA 1EWQA 4M9SA 1CULC 1KO7A 5BYKA 2QP4A 1WP9A 4LYHA 4Q9JA 2CLCX 1KO8A 1Q1QA 3B1WA 3K9NA 4H1UA 4HLDA 3L43A 1VIYA 2ZR7A 2C77A 5KSPA 5J4KA 1P6XA 3SQWA 5ELXA 1FMLA 2J5XA 5DIFA 5JZVA 2R6GA 4BZPA 3ICEA 2F43A 1T0HB 3DKVA 4DHEA 5CLQA 2GCPA 3K9LA 2Z4SA 3NBXX 1JJVA 1ZJ6A 2A9KA 2ZJZA 1HE8B 3TH5A 3OESA 3TNFA 2GBLA 1N2CE 4P4SB 2FF7A 1SVMA 3LY5A 3V4RA 4Q4HB 5C4MA 1R0XA 4EPTA 3MD0A 3THWB 5FTLA 3HU2A 5HKKD 2WIAA 1P2VA 2QNRA 4KFTA 1LF0A 1E98A 1G3QA 2EQBA 4UNSA 4KXFB 3AVVA 3WNBA 2QPTA 1MKYA 4HB4A 1US8B 1GAJA 1IY2A 5AJXA 1HUQA 1SKYB 5JJIA 1YZGA 3K0FB 2OBMA 3GJ4A 4RZ3A 3FDIA 4DBLC 2Q3FA 3KKQA 1Z8FA 5DO9A 1JECA 3FMOB 1TU3A 2E1RA 1UBFA 3NEYA 1XTQA 3AVXA 3T15A 4PPFA 5A0FA 4Q21A 2PT5A 3FVQA 4B3BA 4EPYA 1GRQA 3CR8A 5J4VA 1OIVA 2XEXA 3B13B 3QPVA 1S4QA 4C0QC 1KK2A 2OILA 4JJZA 4Q1FA 1N6PA 1U8YA 1EFCA 5FOTA 1U2RA 4BFYA 4Q4AA 1RRCA 1IHUA 4JS0A 5JEEA 2CE7A 2A78A 4RD2A 4PPQA 5LD2B 1FP7A 4NYJR 2BMEA 3AUXA 3LRPA 1CJKC 1RZ3A 4EQ6A 3H86A 2OBLA 2W00A 4URYR 1IN5A 2WWFA 3VR5A 3IGFA 4D81A 1CJTC 1KTVA 2HUPA 3SN6A 1OH6A 2FEMA 3ECCA 4NHOA 1W47A 2V9PA 4A0FA 5BN5A 4C2UA 2RGNC 1IONA 1EG7A 1ODFA 1TQ2A 3RRYA 4EJSC 2H8KA 1JPNA 4BFXA 1D8TA 5FTNA 1E1QD 1Q12A 1X3SA 4PC3A 3QENA 1WQ1R 4PPNA 3HPQA 5FTKA 3CRQA 2VIIA 1P5ZB 2FSGA 4YDHB 3O8CA 3IO5A 4LUCA 2BEKA 2J45A 4NKRA 1S3SA 1XEWY 1WXQA 4PZLA 3UANA 4PQFA 2OHFA 3K0CC 2XTMA 4M1MA 2OUKA 1AJEA 4MKGA 2D7DA 5CDFE 2NQ2C 3QVUA 4HAYA 4OK6A 1XMJA 2ZXUA 2I1QA 3EA5A 1XPOA 4FMCB 1KSHA 2QAGC 1VCNA 1XCPA 2R8RA 3NBFA 4G5GA 1AZSC 4D0GA 4DKXA 1GL9B 1JB1A 2O8DB 1KDTA 4NP6A 1E9BA 3P1JA 3KX2A 3QPWA 3RYTC 2C5LA 3U44B 1ZUIA 2BM0A 2ZSEA 4LPSA 4IFEA 2ZRJA 2V54A 5FPTA 3JZMA 2AWNA 3KQKA 2XOKD 4HAZA 3G82C 3WMFA 3O8RA 2NZJA 3NC0C 2K5UA 3RWOA 4H1VA 4NCIA 1XXHB 2OXCA 3VKHA 4IDNA 4AYWA 3LFUA 2DHRA 3PUYA 4C0AC 2KWIA 5JMTA 2C95A 2C98A 1SZPA 3NG1A 4OHVA 1P9RA 5E4FA 2RGBA 3NBYC 5HR5A 2HYIC 2GKSA 3RABA 5EZ6B 3UIEA 1AZTA 1NY6A 4HB3A 1II0A 4B76A 1W44A 2IYQA 2B21A 2JDID 1VHLA 1GTVA 1N6LA 3PFIA 2QAGB 4FIDA 4G3XA 2KI5A 2XJ4A 3GEHA 4Q9HA 1H8HD 2CDNA 3AVTA 2F6RA 5DI9A 4US1R 3DL0A 3FTQA 3K1JA 4YMWA 5TARA 2CVFA 2ZJYA 1CIPA 3OAAA 1OFTA 4CIDA 2JLWA 4BLSA 3CNNA 3GEIA 1IQPA 1MV5A 1QHHA 3LH5A 4CRWB 1TQDA 2OLKA 3SFZA 1OIWA 4CDGA 3EG5A 3N70A 2ZRLA 2ZRIA 1XMIA 4EJSB 4GSYA 3GFTA 2FSFA 3PITA 5P21A 3EXAA 3IILA 2Q21A 3ZYCA 4MKHA 1I4TD 4XH9B 3DPUA 1TEXA 2FSIA 1C1YA 4QJ5A 2DCUA 5D3MA 4I1SA 4AIIA 5EUQB 1JALA 1E4VA 1TUIA 3CF6R 4US0R 4DIDA 4E03A 3GLGE 2YWEA 4B2PA 4C2TA 1E0KA 2GK6A 5FOWA 4B34A 1D5CA 2R6CA 5CM9C 6Q21A 4DEXA 1P4SA 1IY0A 2ZU0C 3T12A 1TX4B 3BWDD 4RD6A 4DB2A 1GDDA 4D4KA 2FJUA 2Q9CA 4D80A 3OFND 4O0MA 2FPLA 4B2IA 4UJ3A 4ACAA 1VECA 3PCRB 1KO1A 3QY0A 3RSOA 3UATA 3CLVA 1IJEA 1M7GA 2F9MA 4AD8A 4RFSB 3ZS8A 3CZQA 1HV8A 3ZVRA 2PZGA 1R0WA 3Q7QA 1BH2A 2ODWA 4OKSA 4URWR 1OYWA 1T3LA 1XB2A 1XNJA 4Q4HA 4ZCLA 3QBTA 3U6BA 3K53A 3OIYA 2CBZA 3GLIE 3TUIC 3F0TA 2QQEA 4DLXA 3BGWA 2RAPA 1GNRA 4FCVA 3U7HB 3VNVA 3A1TA 1RPZA 1CR4A 4QRHA 4JJKA 5IRCD 1KZGB 3B2EA 1KI6B 2GNOA 3AF2A 1IM2A 5GJVC 3SEAA 1I2MA 2AHOA 3MG9A 1NRJB 2XB4A 1Z6YA 1FW6A 1NVVR 2QPOA 3K0AA 5K8UA 1XD2B 3LA6A 2DWZB 4ZCIA 4D6PA 3L82B 5DLQC 4N0DA 3DM9B 2FV8A 3K0EA 1TF5A 3PR1A 5J47A 1XPUA 2ZUBA 4EPWA 1UKVY 2GJAA 3RS4A 2LWIA 1R5BA 3AF1A 2KB0A 3CX6A 2FFHA 2LKCA 1JAIA 3RLFA 3EPJA 5JS7A 2GAAA 2Z43A 3OEED 3WHLA 3BFVA 1LB1B 3H1TA 1KI3A 2VHUA 3CIOA 5AUPB 5H68A 2HLDD 1KJZA 2ZS7A 4MKIA 1R6BX 3NXSA 1JXMA 2ZS9A 4NMMA 4EPRA 4YDSA 4WOPA 2C9YA 2C04A 2WWHA 3L0PA 3VHXA 3WMGA 1S8FA 3FKSA 1Z63A 1AA9A 2ZPTX 4RD4A 5FBRB 3ZQJA 4P3YA 4PAOA 5GVRA 1A5TA 5KUTA 5DYIA 1O87A 3JVVA 3UXMA 1E9DA 1M7HA 1CRQA 1N0VC 1CF4A 3H84A 4V0KA 5IK2A 1W49A 1NBMA 1Y63A 2CNWD 2V1UA 1X8KA 5B64A 1GL6A 2P6UA 4TMXA 4DLYA 2QMOA 4IOJA 3U5ZB 3M1IA 4A2WA 4R7ZA 3EZ6A 3ZJYA 2IWHA 3I72A 3V00A 1HTWA 3U60B 1WB9A 1FX0B 2XZPA 2H18A 1S2MA 2ZJ2A 4HLUA 2IC5A 2P5TB 2R6AA 3KQLA 4BUJA 4EPVA 1YZTA 1EFRA 3A1VA 4F7WA 4ZKEA 4M1WA 4POAA 1FQKA 4B3DA 1N5KA 2R62A 3VAAA 3GJ6A 4ESVA 2QL6A 3K0SA 4C0SA 1E2HA 2X1VA 4AYXA 5L3SA 3THXB 5JJKA 1S1MA 3WYGA 1W36D 2ZRBA 3ZDQA 5LB2A 4LDJA 1GKYA 2QMEA 2EYUA 2BBTA 3CPJB 1KYIA 5F3WB 3WRXC 1W0KA 4QL3A 3PUZA 4OI2A 2IS2A 2O8CA 3AP2A 2IW3A 3WYAA 4BQSA 3VNUA 5JSZB 2C99A 1J99A 1MRNA 1ZM9A 2VQSA 3I8SA 4UXIA 3PEYA 4B3CA 2OCPA 4LJ7A 4NONA 3QG5A 4TYNA 2DFKB 3VKGA 3NBZC 3E70C 1GM5A 4D4MA 1DAHA 3VU9A 4DDVA 4DSNA 4UNQA 3U7FB 4DLVA 3SJZA 1VG1A 2JJ1A 2GCNA 2O0JA 3D3QA 3I3SR 3HR7A 1ONBA 5AJVB 2IEYA 4D4JA 2D7CA 2NGRA 3D6TB 2PZEA 4U5XA 2C2HA 1M1YE 1L7VC 4IJMA 3BERA 5JWHA 2CMKA 1ZD8A 3QBVA 3TQCA 3B82A 2IYRA 2FMXA 1D9ZA 2ZSAA 1OFUX 1OF1A 1RW4A 4NCNA 1BOFA 2HT1A 1VTKA 1T5IA 1YJ5A 3C14C 3ZZUA 4DUGA 1H8EA 3ZS9A 5C1BA 1AIPA 1D2MA 2IYSA 5JBQA 1E1RD 1R7RA 1G6OA 1DEKA 2P6NA 2W0MA 2QU8A 3U3RA 1KNXA 4BFZA 3GLHB 1AK2A 3WRYC 2VF7A 3K9GA 3CF0A 1T4GA 1P60A 5HCIA 3LV8A 2XOKA 4EFNA 1G19A 4RJLA 3IKJA 1EFTA 2PEYA 2W6IA 2X77A 2ZRGA 2G77B 1D6JA 3GFPA 2R44A 5AWFC 1R0ZA 1JPJA 2ZYVX 4M22A 5L3RA 4TL9A 2WJHA 3VTKA 1L4YA 3U61B 1Q1EA 4Q00A 3PUXA 3TMKA 2W2TA 1SXJC 1CU1A 1W4BA 4DUGD 1LVGA 3EZ7A 1E9CA 1QRAA 2AN9A 1KY2A 3I73A 2LKDA 2V7QD 4A3VB 1E99A 1SVWA 3P26A 3W3ZB 3KTAB 2QRZA 2F55A 4R2HA 1Z6AA 3BBPA 2NZ8A 1L4UA 1E2PA 3QE0A 4GZMA 1NVVQ 3EC2A 3LW8A 1CJMA 3SC3A 1NVUQ 1T5LA 3NTUA 1SVLA 3B7GA 1P9NA 1XWIA 3OEHD 3GJXC 2ZRMA 4KV9A 4HUQB 3EWAA 5KDDA 3THYA 2B8WA 3C4JA 1G8HA 4JYBA 2OT3B 2NO0A 1X86B 2NPIA 2ZRCA 3REGA 4ASUA 2ZM5A 3AF4A 4DLSA 2GA8A 3ADKA 4B6EA 4OK3A 4GL2A 1N25A 2VP2A 1M2OB 4A15A 2VHQA 2V3CC 4JMPA 2HCBA 2MMGA 4BFWA 4OQFA 3QIAA 4ZDIA 1NN3A 5EE0A 1N6OA 3QUSA 4JSYA 3KDSE 4C7OA 4FW9A 4F93B 1P62B 2VBCA 1NN5A 1TADA 5JRJA 4FWHA 4GOXA 1NP6A 4DCVA 5F9HA 3X1XA 3OFNA 1XMVA 1K8RA 1WA5A 4HEJA 2GXSA 2ZJBA 3KQUA 4DSTA 1ZM3A 1OSNA 1FL9A 3EAQA 2FEOA 1E32A 5FL7D 5BQ5A 3CRMA 1FUUA 4QJ4A 3RS2A 3BB1A 3EW9A 4MGZR 2ZRAA 5FBLB 1VCIA 2QGNA 3SYNA 4AKIA 1NVMA 3QI2A 1DAMA 2IS1A 2IYLD 1W0KD 2ZANA 4OI4A 1U9IA 2VP9A 2IEZA 1BMFD 2WWWA 4IDQA 2ZRDA 1Q1BA 4LPKA 3AKCA 1TPZA 3HDTA 1WBBA 1W0JA 4R98A 1ZNYA 3SNHA 3L0OA 2OAP1 3R8FA 4CT4B 1C4OA 1E9FA 1MOZA 3T61A 4YXWD 1KAOA 4LHZA 4P4TA 3B1ZA 4Q1BA 1P2TA 2D4HA 3B1VA 1ZIPA 1A2KC 2W6JA 1U8ZA 1DADA 3FPAA 2RGGA 3CRW1 1UF9A 2ORVA 5K8TA 2PX3A 5AJYA 5B2ZA 4MGKR 1ZD1A 1XZPA 3WY9A 2GZDA 3EASA 4PHGA 1IY1A 1N6IA 4FCTA 1GIAA 2VF8A 5FPYA 3RNLA 4NCKA 2IYWA 1COWD 3BS4A 3QXJA 3QNUA 3CX7A 2ATXA 5J4YA 1DS6A 3KB2A 3K0FA 4Q4JB 3I62A 4CVNA 1E2QA 4LRTA 5E7JA 1QHXA 2PZFA 4CYMA 4QBHA 2CK3D 1G7SA 5CYOA 4G5SA 1YRAA 2FU5C 1ZUHA 3A1UA 4L16A 2BM1A 1ZRHA 1T6NA 2WHXA 4AKEA 4AKGA 4M9XA 3A1SA 3QOFA 3UWKA 5FBVB 2XNDD 1UDXA 2CL7X 3PUVA 3W34A 1M34E 2AWOA 3TKLA 2PBRA 1II8B 1PUJA 2P65A 3DO6A 4HDCA 1OXVA 1KJWA 4LHXA 3FE2A 3DEFA 3AKEA 1QHHB 2ONJA 1N3BA 3R8CA 2GWHA 2N46A 4BEJA 3AVOA 3HR8A 3AVWA 1Y3AA 1MH1A 4V0MA 3NWJA 1Z0JA 1SXJA 1QG2A 2JJ2A 4N3NA 1NMXA 1Z5ZA 1Z0AA 2QT0A 4V0LA 2BVNA 2VHJA 1D9XA 2EWWA 2QGZA 3KKNA 3AH8A 5SZJA 2CE2X 2IF2A 3KXIA 4CGZA 1AKEA 5J4LA 2BV3A 4ESHA 1NNEA 1IJFA 2AK2A 4M2LA 5HCNA 4URUR 1IN8A 3KJEA 3SJCA 5KSOA 1R8SA 1CJUC 3BAFA 2AFIE 4TYPA 4BEBA 3U4QB 2ZR9A 1SGWA 2JATA 3B60A 2BKEA 4LRSA 3QKRB 2G1JA 4KFSA 4MYUA 4OQNA 4PZYA 1HT1E 5FH9A 2O8EA 4AWXA 2QSYA 1G21E 4QFMA 2ZUCA 3BJIC 1A82A 1D2NA 1EWRA 2QTFA 3KJGA 1AQYA 2VH5R 3QF4B 4KI0A 4FD2A 4WA7A 3LXXA 3PUWA 2GESA 5LD2C 1JI0A 3B1XA 5B57C 1EFRD 2REXB 4HLUC 2CCGA 4MQBA 1M7BA 2FOLA 2VP0A 821PA 1OH5A 4QNRA 221PA 4MYHA 4Q1EA 2A3RA 3U4QA 4HLQB 4QC2A 2VLIA 1CS4C 1QG4A 1DBSA 4MUAA 5AJWA 4DT1B 2WJJA 1ZP6A 2D74A 3TK1A 5BWMA 4PC1A 4IW3B 4DXAA 1TF2A 4NCHA 4PQYA 2A2ZA 4MH0R 3VFDA 1FPMA 1UKZA 3VX3A 4W5WA 4N1AA 4JLDA 1QHIA 2EU8A 3RS7A 4DB4A 4TSFD 5FFMA 2VEDA 2FGJA 4PAMA 2CL6X 2XGJA 2ZE6A 3ICQB 1E2KA 1W5TA 1M6NA 2ZREA 4B73A 1AM4D 1IAQA 2RGCA 3UMRA 1DVRA 3ZZTA 3Q3JB 3TUZC 3EPHA 3NKVA 1RKBA 3LQRA 1RIFA 2FSHA 4LV8B 2IYZA 3WP1B 2WWGA 3FB4A 2BBSA 4P31A 4KCGA 2J41A 3VR2A 1GUAA 1KI8A 3IHLA 4ILEA 1NSTA 2RGAA 4JLPA 2G83A 3C5HA 2GXAA 4ARZA 1N0UA 2JASA 2QM7A 3K0CA 2DZOB 1RYHA 5F2EA 1W5SA 4LV6A 2SHKA 4Q19A 5IF9A 3CWZA 4M8NE 2PCJA 1KHTA 4RZ2A 5G41A 2IYTA 3MFYA 4W7SA 1KKLA 1E1QA 1OLOA 3UG6A 1UAAA 3ASYA 2FX3A 5CIQA 3IQXA 2CJWA 3MJHA 1KK1A 1X8LA 3I8XA 3W6NA 3DMDA 2DB3A 4URVR 3DKPA 3B1YA 2FZ4A 3EIQA 3REFA 4BZXA 1TUEA 2OFWA 3KQHA 4OYHA 5G3ZA 4K81B 5G3YA 4AC9A 4F4JA 1T8UA 2IF0A 2XZOA 2CHGA 1PVOA 4ZIRB 1YHNA 1QHGA 5E95A 4EDHA 1N5IA 3CRVA 3CW2A 2ONKA 2GJ9A 1BO6A 5IHPA 2XJ9A 4AK9A 4D2IA 1SHZA 1N0WA 3A4MA 2ZE8A 2F3RA 4F92B 2KRKA 2QRNA 4IOKA 4M9ZA 4WBSA 2YWHA 2CVHA 4DJTA 621PA 1MABA 1NLFA 4O25A 2QTHA 4HAVA 4JL6A 5TXGA 4PSAA 4JLBA 3QG1A 2HV8A 4UNPA 4IHQA 4C3ZA 2V6ZM 3CX8A 4M1SA 3AKDA 4TMZA 1VG9B 1KI2A 1IN7A 1SVKA 1E2EA 1GZSA 1O3YA 2Q3MA 3W5IA 2BKUA 2MSEB 2RGDA 4JL5A 1X6VA 1XJCA 4QBGB 1WE2A 4XTCS 3GPLA 4RFVA 5JI3E 1NF3A 1Z0DA 2WM9B 3MJRA 1YKSA 2GJKA 4Q9IA 3ONWA 3SJAA 5KNBA 2CXXA 3JVUA 3W8RA 2BJVA 4YMSA 4OJQA 1KY3A 1E2JA 1OFHA 2ZETA 5KDOA 4MITA 2FG5A 4LBZA 1F2UA 2OFXA 5CLLA 4YLGA 3P32A 1YR9A 3TLXA 5J4HA 3R9WA 4XWAA 2QORA 1E9SA 4ABYA 4QGHA 1LTQA 3AVQA 1EESA 2YHSA 3PIRA 1KDRA 4MGIR 4LWZA 1NMZA 3SDZA 1ZU5A 2BIFA 2N42A 3GLFE 4IOMA 4JLJA 4FMCF 2GBLC 3SE0A 3CRRA 4CEIA 1XD8A 5TMPA 1HY3A 4LRWA 1PLJA 3OAAD 2IYXA 4D82A 3IUYA 2G9NA 3TVTA 721PA 3WYFA 3FMPB 3ADBA 1NVWQ 4A6XA 1G3UA 4HZUA 4TLAA 1T0JB 2VHCA 3AGQA 4JVMA 3RS3A 3U7EB 5J5CA 1R5OA 2FWRA 1OIXA 4NZYA 1RJ9B 5E7IA 3W3AA 4Q5IA 4C0LA 1KI4A 4Q4LA 2IWRA 3TBKA 2CHVA 1WRBA 2J0QA 1G3RA 3FWYA 3B5JA 2AKAB 3SR0A 4L8GA 2RB4A 1VG0B 1AQUA 1EX6A 1GILA 2PMKA 3EZ2A 1XBTA 521PA 2MMCA 3K09A 2PMDA 5EXTA 3B9QA 4QM7A 3IO3A 4JVLA 3GEEA 2WSSD 3VKWA 3ADCA 3EWSA 1QVRA 1KI9A 5IT5A 4B75A 3DDCA 1JR3A 1YR7A 3R9XA 3AP3A 4Q66C 4LBYA 5DE3A 2C9CA 2DWQA 1DAIA 1P73A 3TAUA 2O8BA 5DN6A 1G8PA 1CTQA 1KJYA 4KITB 1R8QA 2R6FA 4E09A 2E87A 4TN1A 2WAYA 5EJEA 3I4LA 4JN6A 1Z3IX 2H16A 5JS8A 5KDLA 3PG5A 1ZW6A 1QF9A 1LS1A 4CT5A 3BXZA 5FPHA 4RZXA 3T5DA 1YR8A 2WJYA 3RSLA 2Q9BA 1G7RA 2VA8A 4HAUA 1MO4A 2YINC 3MWYW 1XX6A 1G8GA 3MSXA 3M4YA 3PQCA 4TTPA 2BWJA 1DO0A 2OXRA 4C4PA 4G1UC 1JR3D 3KJHA 2IUSA 2ZU6A 2FZLA 1OXXK 5KHOC 4DCUA 5LDDC 3QKSB 4OI1A 4KYIB 2VP6A 1DTSA 5KU1A 4QGAA 4GFDA 1GSIA 5JRZA 3AEZA 2J7PD 5CB8A 1OXUA 2PCLA 2Z83A 5JCPA 1SXJD 2IXFA 4Z54A 4XJXA 4TWZA 5ANRB 2QI9C 3HP1A 4A92A 3M0EA 1GWNA 1W48A 5BYJA 3W90A 1U98A 2ZRKA 4IVQA 5DI3A 3UWOA 2CLDX 1T91A 2GJSA 3UKDA 3V4FA 5KO2A 2ZRPA 3KUDA 5DHFA 1XTRA 2QE7A 421PA 1IXRC 1C9KA 3E2IA 2W6ID 3SZRA 3ASZA 4CF7A 3N2EA 1Z0IA 2GCOB 4PC7A 4LJYA 3SQXA 4L15A 1YZKA 2D2FA 2BC9A 3GQBA 3U7GA 1G4AE 3U2QA 5H70A 3ZVMA 1RRFA 2IUUA 3K9HA 4D25A 4KO8A 3LWNA 3PEWA 4OJKA 4PHHA 1A2BA 1ANKA 2YOHA 2J0VA 1SXJE 1OB5A 3DZDA 1KIMA 2F1IA 4IVRA 4PHFA 4U02A 4CEJA 1T9HA 1QDEA 2JLRA 3A6PC 3AKYA 4U7DA 1NIJA 3T35A 2YWFA 1UFQA 4QNMA 1ZIOA 4C0JA 1HH4A 2B92A 2V1XA 3HWSA 4RD1A 1W2HA 3CB4A 2NIPA 4OL0A 1G3IA 4PC6A 3S1AB 4A0RA 4JVNA 1OXSC 3K70D 4Q03A 1TNDA 2VL7A 4Q1DA 3LBIA 1FQJA 5BXQC 4LBWA 1Q20A 4C30A 2H57A 1ZAKA 2Y8EA 2C78A 4WZAE 4NE2A 4TSFA 3C5CA 1KMHB 4XSHA 1AKYA 4WZ6A 5FPSA 3VR4A 3KKMA 2ZJ8A 3C8UA 5DYGA 4TT3A 2GZHA 1Z2CA 4OK5A 5EE9A 3VR3A 3SHFA 4C9BA 4MYCA 1R4AA 1J90A 2OO7A 3NHAA 4HDQB 1W4RA 3T1VA 4DIEA 4RD0A 4Q7JB 1UM8A 2XTZA 1BMFA 1YVDA 5EXXA 3GLGB 4Q4AB 2G88A 4DLWA 3KUCA 4PO8A 1W7AA 1N5JA 4KODA 4P4SA 2DFNA 4WVFA 1XEXB 3EC1A 3KW6A 2HT6A 1G16A 3KJIA 3M6AA 4BLQA 1DG3A 4E5UA 3NC1C 1ESMA 1DG1G 3X1DA 2XX3A 2R65A 3C15C 2ZI5A 4EIWA 2BCJQ 4Q7MB 4DLTA 2AKYA 1TMKA 3TAHA 1U0LA 4BZQA 2F43B 2H17A 1TL7C 2AL7A 3ZLJA 2YOGA 1WDTA 5CIWA 4LY6A 3MAAC 2NO1A 4TYWA 4W9MC 1PUIA 3B85A 4G5QA 4FN5A 5CM8B 4OHZA 5C46F 2CCKA 1G5PA 2JLYA 4DLRA 4F38A 1W4CA 2QAJA 2GETA
chains in the Genus database with same CATH superfamily
2GQFA 4TQ9A 3ND6A 3ORFA 2X0FA 3K5PA 2Q6VA 5K99A 4LA4A 5HBRA 2EZ8A 4FLEA 1B16A 4NENA 3IBYA 4YP9A 3OF3A 5B58T 3PNYA 1S9HA 3WP0A 2WABA 1EZ4A 3LPAA 2E4WA 3DBIA 3IDOA 2O59A 1XHLA 5EXSA 2PLFA 3PICA 1TH3A 4HEHA 3FWPA 4LI0A 4LC9A 5EP1A 1JJIA 1IOWA 4WKPA 3QKTA 1M72A 4ZEXA 5JCJA 1O95C 2J8ZA 3R20A 2FPMA 2QN1A 1G8SA 4OUDA 4C43A 3QH4A 3RVMA 4FYVA 2WIDA 2GT1A 3GVXA 3VPSA 2ATEA 1RAEA 2CWWA 2UZIR 4DWWA 1UK6A 1E9AA 3HO8A 1O5OA 1GNPA 4R1QA 3R3SA 4K6GA 3H13A 4F4HA 1EFDN 3IC5A 4DV6M 1P0QA 2PL5A 3X2SA 3SAJA 4NDNE 1LRKA 2IT1A 4GLOA 4UCFA 1U0TA 1ODSA 5IJAA 4INZA 3FCCA 2JBWA 4GVLA 2KRUA 3TZKA 2E82A 4ON9A 2RG7A 3TRFA 1JLLB 2Y0DA 3H9GA 3ZU4A 3PUJA 5M5BA 1ULAA 1XJ5A 3D2CA 2OSBA 2J9XB 4FDAA 3LIPA 3P9RA 4LJ4A 3OF5A 3Q11A 4Z1MD 3I6MA 3VU9B 2YFHA 3ADPA 2ZI6A 1GAXA 3HGMA 1IQ0A 1NW8A 1YRQA 4H59A 2AK3A 5BSTA 2OO5A 2I1WA 5DCUA 1PZGA 3L8MA 5TIIA 4B9EA 1VJ0A 2HGSA 3THXA 9ATCA 3VXKA 2JCXA 2OAGA 5E9JA 1XZHA 1OPXA 1X70A 2C2MA 2JJQA 3PPXA 4YC7A 5BSMA 1SBNE 3WQQA 3OX4A 1T34A 4NYJQ 1MAHA 4UM8B 5IAAA 3CEAA 1BEEA 1ZOPA 2ASVA 1Z28A 4UPVA 1B2RA 2QBYA 1FU4A 2QUZA 4EAQA 3EUFA 2JFPA 5CYPA 4MUEA 1YMQA 5CLHA 2A7QA 2PFSA 3L27A 2R7LA 3AV0B 3MWGA 5JT1A 1XMXA 2I2BA 1YDWA 2JJ8A 4J4BA 5FLKA 4RTMA 4WH0A 3VV3A 1HNZB 2M32A 2YCBA 3ZHOA 5J2TA 3K6SA 5C18A 1K2VN 5EMJA 4RTSA 2HFJA 1SXJB 2DZDA 2J5KA 1MJGM 2KX7A 1M8KA 2EDAA 2WTXA 4KIFA 3BXGA 3ZIDA 2DFTA 1K5DA 3GUHA 4MRSA 4IEEA 3KZKA 3UCXA 2XBMA 1SBIA 5TPWA 5TQ0A 2RB5A 2VSOA 1M2GA 1ODLA 2PEZA 4QATA 2I33A 3HEBA 4EKDA 4B83A 3ET5A 4OD0A 2XCUA 1PX2A 5A5VA 3SE7A 3FZNA 4ZOCA 3RTBA 3S2ZA 2JDIA 1CY6A 1FNSA 3PV0A 5M3BA 1CPYA 1DUIA 4WSOA 1TQ4A 1E4OA 2BN4A 1GDHA 1ENPA 2HIMA 5CK5A 1FDTA 5DWVA 1EFAA 1EE9A 3TO5A 4ZI2A 3AR3A 5AT1A 4FFDA 4HY3A 3MT0A 1PV4A 1TKAA 2BD0A 4LYEA 2PY6A 1NDQA 1NU8A 3BRSA 4ZU1X 3DGFC 1KIFA 1GAEO 1AU9A 3FPGA 1SCKA 3AHHA 2P67A 5KYYB 2UVQA 3S99A 4OQLA 4WECA 1ZVVA 3FOAA 3NP9A 1PP4A 3HVJA 2IXAA 2O0LA 1CP2A 2IXGA 4WGFA 4DA9A 5K8IA 4G5RA 2VQ3A 4B7ZA 3H42B 2YW9A 2R6HA 1S9DA 5HE9A 2AFHB 1X8JA 1HEYA 2HV9A 2PZJA 1RR6A 5EE3A 4I8OA 3C5EA 4MDEA 1OA0A 1QQ7A 3LKBA 4C87A 1JNXX 1E3MA 2O8DA 1KAMA 1S7GA 5EIBD 5H59A 3TW6A 4JLVA 3JQ9A 2PD6A 2PBLA 2AG5A 4C4YA 1V7QA 3AFOA 4HVTA 1KXZA 4PGGA 1XXLA 4MYRA 1A2QA 2OZLA 3CR3C 5GZ6A 4GWKA 1V5WA 1YB7A 3NDPA 1FP6A 4BJHB 2ZYSA 4EUSA 1H0SA 4UBIA 3QEAZ 4PG8A 1V4BA 4H7KA 4QHTA 4Q3CA 3QEOA 4ACBA 4GT1A 1JN0A 2QIPA 4WJZA 1G5TA 3UICA 2W90A 5IEJA 1U0EA 1YS4A 2PD3A 4HGOA 4XYBA 3HB0A 2YVKA 5SYMA 4OA8A 5HKLA 1XLUA 4NJOA 1JMKC 2FRDA 4DA0A 4AECA 4LRTB 3QHPA 3K3PA 2J6BA 4FVTA 4Y0VA 1QG0A 1WW2A 2P2LA 1H0KA 2H4YA 3B8EA 4Q9KA 1PFWA 2CXOA 4OCZA 4YPOA 4IAOA 3E9EA 2BR4A 2OESA 3D0QA 4Q47A 1N7GA 4DDKA 4LMPA 1USUA 2CF6A 3CH4B 1P4RA 1E9RA 2XNDA 4IBOA 4JBYA 3FMFA 4TXNA 4RL6A 2RI6A 3JZIA 3P2IA 3O91A 3T5GA 1EE1A 4OYRA 3SVTA 2Z7JA 2L42A 3H5WA 5C2JB 4BUZA 4OGWA 2GEBA 2HMYB 4MEAA 3TNDA 4TL6A 4XD7A 2WM2A 1DIRA 5G4KB 2M6LA 1SOMA 4WY8A 3KZOA 5I9SA 3GU3A 1QF7A 2M98A 4G86A 1E0SA 1RM5A 3NH9A 2JIPA 2HI0A 4BFCA 2HQRA 3CUUA 3FGNA 5F98A 4QEKA 2HHAA 1UM9B 4J76A 2NU6A 1NBME 3W6OA 1A9TA 1US8A 2X4LA 5LKAA 2R47A 1AXRA 1F8UA 5FB3A 3DBRA 1R00A 1F0PA 3G7UA 4MRRA 4RKFA 1Z7BA 4KO3S 4QXRA 1XDGA 2ZXEA 1QGAA 2XEDA 3KEGA 3C8HA 1DHRA 3IQGX 2GARA 3DS8A 3UT6A 5FR2A 4LFAM 1ETUA 4OX9Y 3VHRA 5C5DA 4DZTA 3L7AA 1P2GA 1OASA 4EG0A 4HZUB 5A4JA 1GTL1 4RX1A 4K8OA 4XEHA 4CLXA 5DKFA 4Z49A 1XJ0A 2QXUA 2BONA 3WNCA 4FUQA 4HH4A 3DDZX 4O2AF 4GNKA 3RSGA 3GLFA 3F9IA 3LL4A 4EFLA 1JJ7A 4GI7A 1HT3A 1P1HA 1RWNA 1F9EA 1X9GA 2IYFA 2ZCUA 3Q6NA 1GXSB 3OZGA 4DDWA 2G9ZA 4X97A 3KKPA 2V7TA 5CB6A 1JKXA 2GJ8A 1FXSA 1R5LA 1NYTA 4UEWA 2H00A 3ZBQA 4HEQA 1L1TA 4AJNA 5C7YA 1U0JA 2WMNB 3I28A 2EL9A 3V32A 1I7DA 1T0PA 1KMCA 3D6NB 3I3OA 5TMDA 1H5NA 2B36A 3L9XA 1X7ZB 1FF9A 2OB1A 2GPJA 1U1DA 2VDNB 2Q4OA 2ZVQX 3IYLW 1LX6A 3RS0A 3GRPA 4FPXA 5FJJA 3SHGB 2G3YA 3HY4A 2ZJ1A 4FIZA 4FU0A 5IMBA 1K08A 3ZY6A 5IZ7D 5IVKA 4TMFA 1CEEA 3F78A 2XNKA 4KQ1A 1NIPA 2IZ1A 2PH1A 4OUKX 2J87A 2WSIA 4HNHA 4NMXB 5CFZA 4RSRA 4CEJB 1P6UA 2RI1A 5ITUA 2AA3A 3FGZA 3O8NA 4G5FA 2Y4NA 1OLXA 2I54A 1ZINA 4HGZA 1J8DA 3RVKA 1T6XA 4FEAA 2NVOA 3EJ6A 3HKEA 2PIDA 5BSUA 4JI3B 3VR5D 5LZ2A 3RIXA 4RDXA 4YR9A 3ZCUA 4PXAA 5FYQA 2BEJA 3RC2A 3SC2A 2XH9A 2AQ8A 3B78A 4IBJA 1L1FA 2DLDA 1EE2A 1BQ3A 3DGEC 5EZ5A 4GG1A 3O9MA 1P5FA 5I4IA 2PQ2A 4YN3A 3TWOA 3QYBA 1S2GA 2VS1A 1NFRA 1UMDA 3ILVA 3PKJA 1XNQM 1U3WA 4BPBA 4FWTA 4GHLA 2XZTA 2GPBA 2UKDA 1C8LA 4XYGA 4GECA 5CBPB 3BRQA 3AWIA 4ED9A 1CYDA 3BEDA 3LLVA 3I9FA 2VXBA 3AEYA 4G9BA 4QYIA 4B44A 1BQEA 4Q18A 3VHQA 2JGEA 2FPKA 1GLGA 2YXLA 1Y6JA 4CU5A 3FE3A 3IDQA 4IXDA 3H1AA 3PR2B 1A98A 1F17A 1GR0A 1P80A 2H1LA 3BXXA 3EUWA 3LNCA 1ZUNB 4DWJA 3A0UA 2KHZA 4BGDA 4F3CA 3TX2A 3UOAB 3K72B 4GBMA 4FGKA 4TMKA 4B2LA 3LQQA 2F3SA 1W29A 3GRKA 2X8BA 5JSYA 2EA0A 1MB2A 1LDMA 3FWNA 3WG9A 1GCIA 2YFKA 2HEIA 3TI9A 1YL5A 2IH4A 3SI7A 1NMYA 2YVLA 4GHAA 3VH3A 2NQTA 3Q7RA 5EJAA 4DBZA 1R6UA 4KVAA 1XDUA 3HTXA 3HXPA 5CBPA 1XAHA 3IA7A 3OLWA 2VWPA 3PZBA 1G3MA 3V42A 1A7UA 2QRPA 4HXEB 3WL7A 2I22A 5EMHA 5JY6A 4KYTA 1SVOA 3BCHA 3VH1A 3AZQA 3U4CA 1QPZA 1J7KA 3EGCA 1DZ3A 1G2IA 4MARA 5EXDA 5A3SA 3DTTA 3SK0A 2G82A 2DAKA 3ZWCA 5JI2E 2QJFA 4TLBA 4RQBA 2ZYTX 3CWCA 4ZXFA 5B3LA 4UAJA 4RE6A 4PGFA 3ND5A 4UFPA 4BQRA 1WUJS 3EPRA 4N5MA 1G8YA 1XRPA 4TTSA 5IF3A 3H9JA 1BX3A 4DV2M 1BQ4A 3JRWA 3VYUB 4NRWA 3KKOA 4MHOA 3T3EA 1DP4A 1CY4A 1OI7A 4X7BA 3QSYA 4UXJA 3COYA 4XDYA 2H5EA 1H2HA 3P0HA 4GIBA 5G40A 3ANYB 3T0IA 3N8DA 1MRSA 3MJTA 4Z9AA 4C21A 2OLEA 1UXKA 2XXJA 5AVSA 5FWDA 5C35A 3LXRA 4PBRA 1QAQA 3IDFA 3JYHA 4RS3A 3DE0X 1PUXA 3B7QA 3PENA 2HXYA 3R7NA 3OU7A 2ZXUA 4KLNA 2C2YA 1UKAA 3LCRA 2O14A 2G71A 3FHTA 3E03A 3EX7C 3CGGA 1NI3A 1KYZA 2AVDA 2DBYA 4NZNA 2ZI3A 2JXNA 3LLCA 4N54A 3S2IA 5GADl 3AV3A 1Q0PA 4LK2A 4JYPA 1WLYA 4BCDA 2EW1A 2OXTA 3IPCA 3NYIA 2CK3A 4NBUA 2DR2A 3LX8A 2Q5JA 4A2QA 1HORA 3IQDB 4GKVA 5TQJA 2BGJA 2VHEA 2AOTB 2G0NA 2A9JA 1SHUX 1Z5PA 2H1FA 2PGXA 3IUPA 4QO8A 3K70C 2I8LA 1RMQA 1V41E 2D0IA 2JIZD 4GMKA 1QMPA 5F7JA 1FLDA 4YJDA 3G3EA 1Y9ZA 2DPLA 2Y0BA 3UHPA 1XKQA 3FVTA 2N75A 4MRAA 3KTAA 4KV7A 5DCWA 3B48A 3DMPA 2CDBA 1YASA 2P62A 3MXTA 3NIBA 4PGAA 2X15A 1WTAA 3FB1A 2CFTA 3A05A 4JBNA 2OY0A 3WZ2A 5CLGA 3GYBA 1WUYA 1LDYA 3RSSA 2V6JA 4WZZA 1RAIA 5K3DA 3VU3A 4OHYA 1E4YA 1CDZA 1DBIA 1L5RA 4IHAA 3SKVA 1GG2A 4YAKA 1R6AA 1PD0A 3HY5A 4K46A 4B84A 3ZVLA 3UBMA 3ERCA 1VKJA 1QWOA 2F1HA 4TSRA 4WNYA 4ND4A 3V7UA 3RSFA 3CEPB 3RAJA 2YMQA 3NHKA 2FHPA 1DLIA 3LQKA 2G1KA 4LV5B 3FYDA 3DE3X 1ZN7A 5ARDA 5TSDA 3QLUA 1ZJJA 5KTKA 2QRUA 1UBOS 4PZCA 4WESA 2V0GA 3CSSA 1RBYA 2VI5A 2ZR0A 3GJ0A 3KWFA 1VLVA 1ID1A 3INGA 2FHSA 2WWYA 3ETLA 3K20A 4G36A 1NJ6A 4I19A 3CQ9A 5I8ZA 4D1YA 1IQUA 2WB2A 2RGRA 4IIDA 4Z51A 4O3MA 2V9ZA 1OAKA 4MW6A 4UW9A 3GDOA 1THGA 4Z9YA 3SLRA 1KYQA 4GYYA 3FSGD 5H8WA 3T06B 1JYSA 4IXWA 1B0ZA 2XWPA 3R7LA 2AOWA 5JNVA 4LFCM 4FFMA 3ROPA 4A26A 3EYWA 3SXUA 3GLUA 4QASA 4GZLA 4MIOA 1I32A 1TCVA 1JHUA 1BYUA 1C0LA 1SUFA 2H06A 3LW7A 3OCJA 1B2LA 2OO9A 1WSBA 2UZ3A 4FKZA 4R3NA 5JBIA 1H1LB 4L8YA 4XOIA 1ACLA 4XXHA 3P52A 2VJCA 1N0IA 3AIMA 3K6KA 3E1SA 3SSOA 3DDWA 4EWLA 2RHDA 2ZRQA 1NSFA 4CIZA 3QKRA 3B6ZA 3FZEA 4ZVNA 3IKTA 3IG5A 4ENRA 1T8TA 1UEJA 3DC2A 3ENKA 2X8JA 2R8PA 3PQ2A 5JCJD 5B6PA 2XUIA 4YIHA 3W05A 4QEZA 4E4YA 3TLEA 4KQXA 4IIYA 4WZBE 2XKBA 2V4MA 3RJZA 2C29D 3HADA 3FH0A 3PGXA 3RVPA 3DVLA 4GEGA 3VU0A 4BMNA 4CIVA 4ZAYA 2XTNA 2XFTA 5GWXA 1VPDA 4E12A 5CDUA 5IANA 4HNSA 2M60A 4XEUA 3AVPA 1R6DA 4EZBA 4RKUF 1NVEA 1RWVA 2HRZA 2CV0A 4CODB 1L8QA 1YB5A 2BMVA 3RCBA 3U31A 4PZZA 4CDNA 4ZQFA 2BPOA 2COKA 1XALA 2XUPA 4J7XA 1C5KA 3AETB 2VYFA 3H2KA 4R9SA 3HVRA 4FNAA 2AFHE 2H2GA 3OC0A 3QHAA 5FOVA 4UZSA 5KIAA 4LJ9A 1BFKA 2ZTSA 3REQB 4IS2A 4B31A 4ZYLA 4KX5A 4RNDB 2CN1A 3BHIA 3BC1A 1TF7A 3ABOB 4BNZA 2QRLA 1MQ8B 2H31A 2Q1SA 2R2AA 4CGYA 3F8WA 2HEGA 3HZRA 4B8ZA 2OLJA 5KTTA 3VZRA 1T5BA 1F20A 3UHFA 3ZLUA 3R23A 3CWQA 4BMOB 1ABBA 4YYEA 2KSQA 4MIYA 4Z2YA 1L9XA 4L8VA 1LV7A 5NLLA 1P44A 2Z9DA 3U9TA 2PXHA 1HI9A 1U99A 4B3FX 4DCMA 4NXNM 3K5HA 1CETA 1VJ1A 2AXNA 1R0SA 3G68A 4GQIA 4UARA 5DHQA 5JSKA 2Q1UA 1E8MA 2B1RA 4E5YA 3HDQA 3FAZA 1U2PA 1EMDA 1XMPA 1E2FA 2CD7A 2QSZA 3HCBA 4YUWA 3IMGA 1K88A 1PBTA 4S1OA 1MDFA 2ZJ0A 1V3TA 4WLUA 3O3CA 4AG3A 5LOVA 2ZI7A 3UUGA 2A1TR 3M9WA 1E63A 1KF0A 4HN4B 4OFXA 4R9NA 1D4OA 3UT5A 2GXUA 5FWYA 2VSFA 2PDAA 3PXBA 3W7VA 1OH8A 1H85A 2H4FA 1HURA 3K16A 3NAZA 2WYVA 3KP1E 4DPLA 3TE7A 5F4ZA 3W68A 2PRZA 4DV0B 3G59A 3LD9A 4YV7A 1QR2A 1H65A 2YOFA 3VR4H 3LYUA 1IG0A 4MWGA 4Q3NA 2L4EA 2P5SA 3D54D 4N6GA 1OFGA 4EO4A 2ZWOA 3A36A 5JCXA 1VCOA 4DR2M 3D8UA 4KSCA 4G07A 4KO4S 1BE8A 5TS2A 4V0OA 4BVGA 1H0HA 3AT1A 2KNAA 4R2XA 1XD2A 4Z1MA 5LKRA 2WLTA 3W5SA 5ITVA 3PQ5A 3RFFA 2O5RA 2A4MA 4MK4A 1I0IA 2UXDB 3KFVA 4QQ8A 1D07A 4RVUA 3OFKA 1T1SA 5B2EA 3CRZA 5EERA 2AUTA 3AM3A 3G6KA 3ZV3A 5IN4A 4GITA 1HLFA 1F38A 2WEKA 1VKNA 1H6CA 5JWRA 3JSXA 1W94A 3FY4A 4JX8A 4TKLA 2INGX 1CJCA 3IMCA 1DEAA 2AEJA 1H3NA 3I9NA 3LOUA 1A8HA 4LXQA 5JFTA 2Z6UA 1R5NA 1U81A 1V47A 1RI2A 4WZBB 2CXPA 3V34A 1N8SA 1CLUA 3G1WA 3QPAA 3U6DA 4ZT5A 1QK4A 1Q7RA 2HA0A 2WZDA 4J0IA 1U1CA 3FMVA 4MYTA 3T5TA 3IQIX 4NTZA 2PO7A 1XQ1A 3GLKA 3CVWA 2NADA 3PNQA 1MAUA 3S44A 4QLBA 2X9VA 3OZFA 4ENSA 2QMUA 4KXXA 4PN3A 4X6YA 1XA3A 3R7DA 4ER7A 5JCOC 5LP6F 4NYIQ 4IH4A 4X0EA 5DLPA 2F00A 4O33A 4B3GA 4EITA 4K0RA 1U31A 3KOXA 5KNCA 1XLVA 4CV3A 3VVCA 2R7KA 4ENQA 3RJTA 1CC1S 4MW9A 3MS4A 1ZW1A 1EBUA 1PS8A 1OI2A 1XF9A 4LDRA 4RIIA 4XB1A 3TUJC 4BFVA 4EHLA 1U8XX 2B7CA 1QJ4A 1BYIA 2GBCA 2GZ3A 5KYVA 4V0ME 1WX1A 2UXBB 2ZIAA 2BWBA 1Q44A 2ATVA 2P1RA 4QXQA 2EG5A 3F98A 4RJJA 3WIBA 2SKEA 3PTAA 2VATA 3ESYA 1K68A 2P2NA 1E1KA 2H7XA 5IT9A 4EZIA 3MMZA 3UQYS 1IU9A 1BS1A 1TVKB 3GUVA 4HI0E 4XUDA 4NC6A 3GQBB 3MWDB 2IH2A 1KFKB 1H8ED 3BILA 4KL8S 4TROA 4BY9E 2JK1A 3ZE2B 2D13A 2GK4A 3AI7A 3L7NA 4M53A 3WISA 4KREA 3HJ8A 3ORSA 3THYB 3I6YA 3FJOA 4MGYR 1IHYA 4Z3KA 1Q7BA 2JNHA 1Z56C 2REBA 3PJRA 1C30B 1L3BA 1O4WA 1VZ3A 1DARA 1UDWA 4O3FA 5LXTB 3CG4A 1KZ7B 1Y1QA 2I4NA 4N01A 2V5UA 3LLSA 3LVQE 1GO2A 2XMBA 2YC2C 3LFTA 4FQ7A 1I1NA 4KGXA 3GMDA 2V5AA 3F7TA 3GJTA 4DAEA 1KRWA 2G4CA 8ADHA 2LE0A 1JDBB 3P7MA 3ESCA 2A1IA 4PVCA 3PCTA 2J3EA 4TQAA 4G63A 4WGGA 4AP5A 1OHHD 1YZNA 3L6EA 1OU4A 1ZOIA 1HZJA 3GDGA 4DGQA 1X2BA 4LNUB 1ZGBA 1DOHA 4V0SA 3B3FA 4XD7D 3Q9SA 5KCZA 5FLXA 5SY6A 4YAGA 2ZUEA 1BOOA 1H6AA 1ECLA 3ANTA 4DUYM 5UKDA 3ROKA 5KNDA 4IRUB 4WXPA 2Z8XA 2QROA 1NF2A 3A2KA 1QMGA 1GUYA 2PRIA 5EOVA 1HFEL 3LSTA 1W2WB 1L5NA 2W9XA 2XYVA 2FR8C 2DZLA 1V8OA 4J3FA 3LAWA 3VPHA 4E33A 1NG9A 3NCTA 4LMRA 1PFKA 4X45A 4OXYA 4JI4M 2OOKA 4QFDA 4IKPA 2YZKA 4Q39A 1QK5A 3U6LA 4CKBA 3MRSA 5DNDA 4ZEMA 4OVZA 1U0FA 3PGMA 4JGIA 1A0OA 4UDOA 4LZPA 1EHIA 1UMKA 2CB0A 1I24A 4FTWA 4G5YA 4KAFA 4C4OA 5JS6A 1IUKA 1KYTA 1T5HX 4BNGA 3MCZA 2GCIA 3A3OA 1TD9A 2PKQO 2JEOA 4I1UA 2PL1A 4ME6A 2Z0MA 1RAAA 4B32A 1NVDA 3J7BA 1RSZA 4NBNA 3C41J 4NCJA 3FZQA 4Q48A 2H85A 1IDOA 1T35A 3ILKA 4ZKDA 1P7CA 1DE0A 2YNMA 1XNGA 3CVJA 1PLLA 2WNHA 1CUUA 2BF7A 3HMQA 2FW0A 2HSGA 1XPRA 1NP3A 4ROSA 4L8FA 3X1MA 1FUKA 2EFDB 1BXKA 1E3DA 1FSZA 3LP5A 4I08A 4C5CA 1NVXQ 1J06A 3UBTA 2ZZMA 2LVOC 4RD3A 2QX8A 1WVGA 3HJCA 4M7PA 4L5BA 3RVQA 3QXHA 4BTVA 4D8VA 3NASA 5M04A 4MS1B 2ZTMA 4CR7A 2OD7A 4DV5M 3Q5GA 1BJTA 4BKQA 4JELA 4RELA 4JNCA 1W46A 3TCNA 1KNQA 4LGCA 3TDMA 5JSZA 3MK6A 1ISSA 5K0EA 4G9EA 3FPKA 2WKQA 1SUSA 3BSFA 3GH1A 1JKJA 1MJHA 5BRNA 2IP1A 4ND2A 5ICFA 3GG9A 1JH8A 5C1DA 4DRYA 3JAWA 1NFQA 3PA6A 5TQ2B 3ZE6A 5HILA 1RWBA 2QD3A 4RESA 4JB0A 5HUJA 4H27A 5CK4A 1XTSA 3BIFA 3KXKA 4JFAA 2H4XA 2P91A 4YMIA 4RTOA 5GOZA 3VDQA 3W5JA 1I94M 1GZUA 2JLBA 1Z4MA 3TZLA 3S81A 4NRVA 1ZNZA 1EX9A 3VLFB 2EFGA 3D7LA 4TL7A 3TR0A 4DWOA 1UT5A 4PX9A 3AEKA 5IW8A 2I2AA 1DELA 3QU5A 5F2KA 3MUOA 1VJGA 3LUDA 2J6CA 3RRJA 3V7WA 1XQ6A 2F3TA 2IYVA 1F2UB 2PV0A 2FPWA 2CUKA 4HLQA 3QITA 2CDAA 2X13A 4FOPA 3A14A 4XVRA 3TLGB 5B2FA 4FKMA 4AAYA 2RG1A 4UM9B 4QG3A 7REQA 4K9PA 2PVSA 4Q9DA 3FGOA 3Q85A 2RRUA 2ECPA 4M1TA 3FLEA 2FFRA 4NEQA 3WGNA 4LF9B 3L4SO 4B7CA 4DG9A 1Z88A 1Z5OA 3C3EA 1LNZA 2RI0A 4HSGA 4E0BA 1D1QA 4DUZM 2GFIA 2IBTA 4MXDA 1M6WA 4ITQA 4R7GA 5CA0B 3NNSA 1KQFA 1NT4A 1Q91A 4PIPA 5JSHA 4EGQA 1YV9A 2IKSA 3R24A 3LT0A 4NV3A 5BT9A 1ZXBA 4B43A 3JARA 4FFBB 5E38A 1T9GS 2Q41A 4V24A 4EG1A 4KYUA 4Z3OA 1QIDA 4QUBA 3Q9LA 3LC0A 3O92A 1MEEA 4JENA 4KMMA 4U2BA 2DHEA 4AZVA 4HNVA 2BHRA 2I87A 1FDSA 2ZIXA 4DR5M 3II6X 1GAQA 1BXRA 1K6XA 4KDFA 1U3FA 3CMMA 2RJ3A 1A7AA 4MKXA 3TPCA 3V48A 2QMHA 5K4HA 2C58A 3UYKA 4QQRA 3OKCA 4IIEA 3ZY2A 1RM0A 4RMGA 1QBKC 3GOQA 3SZMA 4UBNA 2EKQA 4AMZA 4YUXA 1ZN9A 3UXHA 2F9LA 1JG2A 4YQEA 4QODA 1QH1B 1MOSA 1WQ4A 2IIVA 2VK4A 1YRBA 4IIVA 1U8FO 4S1VA 2BGMA 1U2DA 1FDUA 1NJSA 2CNNA 2CXTA 1W25A 3OM9A 3PF8A 4J9UE 3AUFA 4UBKA 5K3FA 1D5WA 1IHPA 3AK4A 3HYLA 3L7IA 1CUXA 4NPCA 4MVXA 2Y71A 3A3PA 4R1MA 5DGCA 1QG6A 4BASA 4F06A 2JHPA 1FU8A 2G9UA 1A4UA 2VG8A 4Z5XA 1TZMA 3RV3A 1HQCA 1PV1A 2R97A 2YHBA 2I6TA 4Y1GA 3SF8A 3O8BA 1ODTC 2I62A 1NBAA 3SU8A 4PO9A 3KOMA 5BQFA 2B9EA 2OG1A 2HD4A 1GFSA 3GLIB 4JV5B 4RZUA 3ZR4B 5IYZF 1JR3E 2JIZA 4MB7A 2RBGA 3SOPA 1DGBA 1ORDA 1U3UA 5JH7F 3ZW9A 3PQEA 1BIFA 2EEPA 1SJ9A 2V7VA 4FK8A 4MW2A 1N5RA 3JV7A 4DDTA 2CNWA 1PJIA 4DR3M 4Y28F 3AI2A 3PFGA 2BLNA 3TJZA 4CI0B 3KYCB 4UUNA 1AF4A 2OOSA 2PSHA 2ZJ4A 2JI6A 1B00A 1FFBA 5BPVA 5G02A 1Q0LA 1A27A 1KI6A 1JWAB 3I30X 5HF5A 3GPDG 3W4KA 3OZWA 1ZJZA 1PF7E 1ADJA 2GCOA 3PHLA 4RSGA 3HLYA 3HYTA 1CZOA 1DBVO 5AXAA 2H07A 5K1ZA 2BUBA 1DTWB 1S2IA 1EHCA 3FUCA 1Z4OA 1TO2E 4JQZA 2YJ4A 4KWEA 1G20E 4OHMA 5E3HA 1MEOA 1WZNA 1CEYA 2B4RO 4DKJA 4KJZA 2R9VA 3WBKA 4C3UA 4Q4CA 3CU5A 3NWOA 2C31A 4ITRC 4ADSG 4D9IA 1MR3F 2ACEA 4Z7QB 4YMUA 1V35A 5JDCA 4D4LA 4UREA 2C2XA 4PV7A 4HRVA 4LF7B 1M6VB 2FN4A 3V7YA 2NP7A 5LMUB 2C0QA 1N9GB 1ZV1A 4MW5A 5H1YA 4LGMA 2REQB 1GKIA 4IF6A 2QENA 2XT0A 3JWIA 1XQ9A 4GM1A 2OMEA 5M2QA 2YJ5A 3S0JA 5ENVA 3D6AA 2O2SA 4CF5A 3K9CA 3TQOA 1X8XA 3LTNC 5B3AA 2ARKA 1NW5A 1CR1A 1OKKA 4D96A 1NBHA 4ZREA 5D2CA 3A3KA 4R5HA 1VJ5A 2AOUB 3MEQA 5L3QA 1PNQA 3V9AA 4WDRA 3PC6A 5CGQB 3L49A 1B6SA 4YXWA 3CPEA 1PGYA 2IW1A 1KE1A 1J0CA 3C48A 6CHYA 3B3AA 1JI3A 4JI8M 3MLBA 1LS6A 3OIUA 1IOZA 4MZDA 2W58A 3AO0B 5K6TA 5IASA 3FX2A 2Z04A 5K4AA 1OGJA 2QT1A 2EVWX 2LCFA 1PHPA 1X7ZA 3PRKE 4QNNA 1RJ9A 4K0KM 3G2PA 2LW7A 4OOFA 3DP7A 4XSGA 1CUIA 4HYEA 1A9SA 2Q07A 1SUCA 4WW0A 5FFNA 4HDNB 2HSDA 5K0TA 2HA7A 1JQLB 3C1OA 1IVNA 2J0UA 5EZYF 2WYWA 3WOVA 1LU9A 2QRJA 3GFVA 2AFIA 1YI0A 4PEVA 4F56A 2EBFX 3GNQA 4HLCA 3MHVC 2X5KO 3B1KA 2AD5A 3P4YA 2Z5FA 4O2BB 3SFTA 3SSAA 1D04A 1KEUA 3ENNA 2FS1A 1YVEI 4V0RA 3Q72A 4ASUA 3QPDA 4J75A 4JJAA 4X20B 1DAPA 5L7WA 3K1AA 1Z9BA 1E7YA 2DX7A 3IBTA 4H4EA 3ZEAA 4I14A 2ZQ5A 1YS9A 5GONA 2EQ5A 3KWJA 4DQXA 4A2PA 4Z4HA 4C5BA 3LK6A 4WY5A 1JPVA 2EG9A 2ODQA 1RCFA 1T2EA 1W5BA 2JGDA 2YW2A 1K0UA 3GZTB 3OZIA 3QEJA 2NTVA 1T36B 2TYSB 5LMUM 4L8GA 3FFAA 1NULA 2VP5A 3H4TA 4U39A 4UKDA 3HJNA 3T1HB 3KOZA 4DYVA 2R751 3JY6A 4XAQA 1VPLA 4EHAA 1EB8A 3T5BA 3ESRA 3E35A 4HUTA 1GEGA 2PUWA 3BUSA 4JVOA 5ES4B 2J85A 1COWA 3L8ZA 4H1HA 1KMQA 1PR9A 2E9SA 5HIJA 1YZYA 1XMQM 4F3KA 1N1EA 2CHEA 4J2TA 3RUHA 2HPAA 5EUMA 4AZ3B 3EC7A 4X8OA 5C8YA 4F9GA 2CEAA 2AYZA 1IAVA 2PZKA 5ALEA 4F11A 4JYCA 4RORA 3QKSA 3U9LA 4AZFA 4WDQA 3U3OA 3NI2A 1U5BA 4JLWA 4LJSA 5K3OA 3Q8XB 5T6BA 3J81k 4MPPA 1PDWA 3OEHA 4KKXB 1X74A 3BMQA 4YHHB 1YOBA 1VE1A 1P2UA 2ZT6A 2R84A 3LLMA 4G01B 4CMIB 1MFPA 4MQEA 1XZLA 4CKCA 3D7NA 4HGYA 1EWQA 2FZCA 2ID4A 4EX6A 4R8MA 3UJDA 4B81A 5BYKA 1JB9A 1U6JA 2EWMA 5TPWB 5TQ0B 1KO8A 3HB7A 1PGQA 2VYNA 3G9XA 5BWCA 1VIYA 2AHRA 1DXYA 4CV2A 4KLCA 2J5XA 3C6MA 3EMVA 3PDIA 5DIFA 4WJLA 4CQNA 2A33A 2F43A 1RADA 4L5YA 1YSYA 3G49A 3WK5A 4OV6B 4OKIA 1M6EX 2O7VA 2W8BA 1QK3A 3H1FA 1PJSA 4AQYB 1K3XA 2E5LB 3PPVA 3OESA 5THQA 2LHCA 3EXFB 3TH5A 3GJYA 3C6XA 4P4SB 2B8EA 2OQ2A 1V1MB 2FF7A 2ZM6M 3PFWO 3Q6IA 1YAJA 4NJEB 2ZIEA 1L5HA 4CMIA 3S1SA 4EPTA 4F21A 1KP9A 4RF2A 5F35A 4BX0A 3MD0A 4DSAA 5FTLA 3BSSA 4BNNA 2QNRA 2H08A 4EF5A 2QSFX 1IJKA 2EQBA 2Q5QA 4J6EA 4PCVA 1T3GA 2DAPA 5BNFA 4PNEA 4HB4A 1N3LA 1T2UA 4F4FA 2P2ZA 1RC0A 2JD2A 1IY2A 2F5NA 1ARZA 1SKYB 2B7LA 2GSDA 3K0FB 2OBMA 4RZ3A 4TV9A 4DBLC 2PJDA 2JFQA 2Q3FA 1SCUA 1B43A 1LLQA 1Z7YA 3FMOB 3LC7O 4PG4A 2DTXA 1Q83A 1VL1A 3QLTA 3NB0A 4E51A 1HQDA 3NEYA 1XTQA 2HW8A 3T15A 2UXCM 1ML4A 2HCFA 1YFKA 5LLSA 1P6QA 4Q21A 4IIXA 4OXIA 5A04A 3FVQA 5JG7A 4B3RB 1JDVA 3RTAA 2EGUA 3KQPA 1QO7A 3VSEA 4OMFG 4DDHA 3WC4A 3OICA 1V37A 3IXMA 1Z7EA 2O2ZA 2GAFA 4IO1A 5D5HA 1EFCA 1PR5A 2ST1A 2FQQA 3BJZA 4N3AA 3U4MA 1QOPB 2O5EA 4RD2A 2R1TA 3NC4A 1FP7A 3PTZA 5FAXA 1DJLA 1XPJA 3LRPA 1M3SA 1FQWA 3LGXA 4L4SA 4KH1A 1FDRA 4EQ6A 2W00A 4WPGA 2VLBA 4URYR 2H0RA 1IN5A 3RIEA 3BIWA 1VI6A 3RVDA 1E64A 4MW4A 4D81A 4CIXA 1KTVA 1UJMA 3VTFA 2FEMA 1ZUD1 1SMKA 3LHSA 3NFYA 1NYQA 2QLNA 5IBQA 1DHTA 2V9PA 5BN5A 1P4AA 5KTRA 1IB0A 1OZFA 1XR3A 3PDUA 5J2TF 2Z95A 3WL3A 1Z5GA 3O4VA 4Q12A 2B61A 1JLKA 5G0VA 1V6AA 3K4PA 1E1QD 1Q12A 2PBFA 3FTCA 3VDMA 1YO6A 3QENA 4KQMA 1D0IA 3FA2A 4PG6A 3BL5A 4S3MA 1ZGJA 2PA3A 4MIEA 1JG6A 1I3OA 2DOKA 4KQCA 3BYZA 2FSGA 2LGJA 4WOCA 5DGIA 3X1JA 3MA0A 4YO8A 4Z6KA 2D5IA 2F8MA 3F6BX 3PHBE 1AC5A 2P90A 3GC6A 4H0FA 4JCOA 1C29B 4P93A 4MGEA 1W5EA 3LI2A 2ZBVA 3HJHA 4OJNA 4AUKA 4UBJA 1ZUWA 3K0CC 1Q39A 1L4BA 3Q0IA 4Q6BA 1B0AA 4J91A 5L45A 1QU2A 1P5HA 4ZU6X 1AJEA 3MPUA 4P22A 4XRGA 5CDFE 4O4IF 4A0QA 1FY2A 2NQ2C 3D6MA 1L8LA 2YMLA 2JY6B 1XMJA 1R88A 1NHWC 3FSEA 4HPJB 2X0JA 3V5NA 1KSHA 2QAGC 1RWQA 4D0GA 2PZAA 2R8RA 2XQGA 3I51A 4MV5A 2R1ZA 3OTHA 1JKFA 1SXHA 3KR9A 3VAYA 4DLAA 1VA4A 3KX2A 3NRCA 2Z3VA 4K5QA 4PNZA 2ZP1A 5EJ5A 2L7IA 2A1UA 4LPSA 3UK0A 4N39A 5FI5A 3RBXA 3NBUA 3CLRD 2ZRJA 2WVGA 1A50B 1BFUA 3JZMA 1O8BA 2FOXA 4FHZA 2XOKD 4GRDA 2OK7A 3DBHA 3KEFA 3NC0C 3RWOA 1J1ZA 4NCIA 5E8RA 2CXHA 5A7FA 4DVJA 1LDBA 2QY6A 3DDSA 1LDNA 3PZRA 2ZJFA 3BQ9A 4AYWA 1LTKA 2KWIA