4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Fidgetin-like protein 1
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
4B2PA 1JQJC 4GP6A 3LRPA 1DAEA 3KJEA 1TL7C 1G5TA 5F98A 2BEKA 2ZR9A 4OL0A 4RKFA 4Q00A 1S4QA 5JJLA 3CZPA 4KBGA 5IT5A 1ZRHA 2GJ9A 2NO0A 2GAAA 3QNUA 5CIWA 2QU8A 2FGKA 3PEWA 4TTPA 2FSFA 3CZQA 1J70A 2IYLD 4E03A 2V54A 4NYIR 5B58C 1M74A 2OCYC 5DO9A 2Q3FA 4NE2A 3A37A 3SNHA 1E2MA 1N3BA 4PZYA 4URYR 3TSWA 3WMEA 4D26A 3A4NA 2J0SA 1JPJA 3CX6A 4BFXA 2ERXA 4DLYA 2WV9A 3FKQA 3T1TA 3GLGB 4R9UC 4JLKA 2ZE7A 5JHHB 1TQ2A 5CB8A 4NYJQ 1Z07A 4MRNA 2YVUA 1OIXA 5EE1A 5TMPA 5J5CA 5LB4A 2JGNA 2C9CA 4HI0E 4LWZA 2WJJA 4P31A 4OHZA 3GJ7A 3OIUA 4KFSA 4EQ6B 2GHIA 5JSZB 4IVPA 4JT4A 5FI1B 2ZRPA 1S1CA 2G77B 1N6RA 3HU2A 2KI5A 3EIQA 2VHQA 3BFXA 1FTSA 5J4KA 2BMJA 3SHWA 1HQCA 1GDDA 4NTZA 4IDOA 1XTIA 4URUR 5BW8A 5DI3B 1PV4A 1AQYA 4LJAA 1FOEB 2ZRIA 1HT2E 1N5KA 2FFAA 2XNDA 3C14C 3PG5A 5CM8B 5JI3E 2QPTA 4DCNA 3LBHA 3ZD6A 1W5SA 1TQ6A 2RGDA 2IA5A 4GOKA 1L4UA 4JVSB 1S0UA 3G0HA 4LX0A 1F2UA 1BMFA 1Z0IA 3QVVA 2PMKA 4Q18A 3D7MA 1TUIA 1XCMA 4BFVA 1KJZA 2OLJA 4OI0A 1HYQA 2H7VA 2QTFA 4NCNA 4IFEA 3GJ5A 5BYKA 3W8NA 4KYIB 4H9GA 2QMHA 1BKDR 1E1RD 2B8WA 5FUVA 1II8B 1S3GA 1SVSA 3GLFA 2FFHA 1DAGA 1KY3A 1NMZA 3AF1A 4IDNA 4LSGA 4LGMA 3KB2A 1Z28A 2Z4RA 1E2GA 2ATVA 3U2QA 6Q21A 3VQTA 1KK3A 1FX0A 1XEWY 1YE8A 2BJVA 4AKHA 2QPAA 2MMGA 2GEDA 2WIBA 1XCGB 3P1JA 1NN5A 2Y8EA 621PA 1KMQA 3CX7A 4ZDWA 3EZ7A 2IYXA 4KLZA 4B3BA 1XD2B 2OAP1 2ZJ5A 4GI7A 2IYUA 4PPGA 1U99A 2REXB 4CRWB 2Q9AA 2F1JA 3IQWA 4MKGA 1DAFA 1NN0A 3CR7A 3ASZA 3QKRB 1GG2A 4TMTA 3VMFA 5C4MA 3LLUA 4I1UA 3VU9A 1M8PA 5EE9A 1VKJA 4D0LB 4U00A 4A2WA 3WP0A 2O8BA 1NI3A 4B3FX 4I1OA 3GD7A 1KO7A 1Z0KA 2ORWA 3ZS9A 2ZI9A 1PLJA 4GDFA 2OUKA 4DUGD 1WB9A 2OZEA 1GRQA 4X8MA 4DCUA 2GDJA 4JLJA 3GJ0A 5C46F 3HU1A 4M1MA 3GLHB 2BMFA 2IT1A 4E09A 1IJFA 1XF9A 1T4GA 4G0NA 1N6OA 4HDOB 4HATA 5LD2B 721PA 1PUJA 3BS4A 2OBMA 3LX8A 1I4TD 4HDQB 2HF8A 4IOKA 1E0JA 4E07A 2G83A 1W0KD 3QXHA 1PVOA 4JLVA 4IEIA 4ZCMA 4QKQA 1GOTA 3B7GA 4NCKA 5D3MB 2ZRLA 1HY3A 4L9SA 4Q03A 4LJ5A 1AKEA 1KTVA 1NNEA 3A1VA 2EFDB 2PCLA 2HXYA 4QGAA 4DXAA 3GLGA 1II0A 4ZV4A 2JLUA 1P60A 4BE7B 3P4YA 4DDUA 1BYUA 4LV6A 4QGFA 2QP9X 2ZYVX 5ANRB 4DT1B 3GJ6A 1ZBDA 5HZHA 5D3MA 3EA5A 4LYJA 2F43A 1DBSA 2FMXA 1IBRA 4O0MA 3SU8A 2BBTA 3OEHA 5E95A 3F0TA 4LBVA 2D3WA 1RKBA 1KO4A 2NGRA 3GCGA 4GZMA 4TYWA 4ZO4A 1DADA 3ONWA 1E4VA 2AKYA 1G4UR 2ZVPX 1VYVA 1SXJE 3BB3A 2WTUA 4HLCA 1D2MA 3WBJA 4DDVA 1IJEA 1SGWA 3ICEA 1MO5A 1E0SA 4P4UA 5SZIA 1OXXK 2AN9A 1YZKA 2OILA 4JVNA 4LBZA 5H70A 3VX3A 4JVMA 1UPTA 1KAOA 3GLIA 5C1BA 2AXPA 2IF0A 3I32A 5DN6A 3PJRA 3AVTA 1E3MA 2CJWA 1G5RA 3THWB 1OH8A 3TUZC 1X8LA 4JSYA 2JA1A 2GKSA 1B0UA 1KI4A 2FWRA 1JR3D 2FN4A 1J7KA 2QAGA 1JJVA 4XWKA 5KSZA 4C0SA 1NP6A 2J41A 2VSOA 4LJ8A 1DPFA 3MAAC 1XD2A 3N5CA 2JATA 3ASYA 4Q47A 3LQQA 1HTWA 5F3WB 2ZR7A 4AWXA 1G8PA 3B82A 3WYAA 2ZSFA 3OZXA 1CR0A 4Q5IA 1RVDA 1GL7A 4OI1A 1VHTA 4IEEA 3T1QA 3Q7QA 3RYTC 5L3SA 4JBWA 4F92B 1KSFX 1T0HB 4B34A 1ZU5A 3WNBA 2ZYUX 1RC8A 2VRWA 4QBFA 1W4AA 2QROA 4NBSA 3OEHD 4P4SB 2HUPA 3CO5A 3F8TA 4FMCF 1CJVC 4U02A 1Z83A 5TB5A 2JLRA 3CRQA 2REOA 2ZI7A 4KV9A 4DSTA 3VFDA 3QEOA 5FOUA 1ODFA 2FSHA 1A2BA 2ZRAA 3NTUA 5G3ZA 2R6FA 4CDGA 4DLTA 1T9HA 2Z43A 3TVDA 1NKTA 2IYRA 4RY2A 2F1HA 2JJ2A 3IPYA 1IAQA 1TMKA 1DO2A 4WBSA 4QHTA 3AF0A 5FTJA 2QE7A 2JLZA 4RD3A 4W7SA 3W3ZB 3AVPA 3W90A 3I5YA 2IUSA 4HAVA 1JEEA 4LBYA 2O8DA 2CL7X 3GEHA 5IHPA 1Z2CA 4TMKA 1NMXA 4UNSA 2A5GA 5JZVA 5DHFA 5KHOC 3U44A 4L5BA 1G41A 2ORVA 5AJXA 1E9RA 4GFDA 3OIWA 5B64A 4EPTA 1YZNA 1J90A 4OJQA 1UAAA 2AK2A 2GZAA 3B1XA 4QXAA 1M7GA 2AK3A 2X1VA 2BWJA 1E2JA 2B8TA 1VDZA 4QNRA 4M9SA 4C2TA 2A5JA 4R71A 2JAQA 5G41A 2IHBA 2R44A 1P62B 3T5GA 2AKAB 3ZVNA 2V4ZA 4XD7D 4PC7A 4A0GA 3VR3A 2JLVA 5AJYA 1DEKA 3DOFA 2WJIA 4B32A 2ZAMA 4LJYA 2AHOA 3LBNA 1UF9A 2TMKA 4QJ5A 4RVCA 4ILEA 2ZSDA 3MFYA 4UXHA 4HUQB 3D31A 1SXJC 2HT6A 2OXCA 4B6FA 4XSHA 3ZVMA 5EQTA 1R4AA 2P0EA 3FFAA 1NJGA 5C2JB 4MYHA 3H0KA 1JJ7A 4W5JA 4TMZA 4MGIR 3W6NA 5BN5A 3C7KA 4L15A 2G3YA 4XVRA 5LB2A 5P21A 2F55A 2IW3A 4HB0A 4TTRA 4B73A 3I1FA 4A0RA 1FX0B 3GJ3A 1E94E 1GZSA 4MH0R 4MYCA 1SVOA 1Q21A 2GCNA 4QFMA 2C77A 1UBFA 2O8CA 1S3SA 5G3YA 1EX7A 3C8UA 4NONA 2J9RA 1OW3B 4HB2A 2G0TA 2RGGA 5UKDA 3F3YA 1E1RA 1XXHB 1MO3A 2VHTA 5HCNA 4DJTA 1M34E 3V4FA 1C1KA 2EFEB 1S9HA 2SHKA 3GFOA 2A30A 3SR0A 2Z6VA 4BLQA 4D4JA 1KI2A 4UNQA 3TE6A 2J1LA 4UNPA 1N2CE 3HJNA 5FPSA 1WP9A 2IUUA 2ZS9A 3AVYA 3KJHA 4ACAA 1XPOA 4A8JA 1CP2A 2B6HA 4QGGA 5K8IA 4CEJB 3LV8A 3S1AA 2HEIA 1NVVR 4ZDJA 1IXSB 5JCZA 1DAKA 4BFTA 4QM7A 4JJKA 4HAUA 4R98A 2GTPA 4NZYA 4PHFA 1KZGB 2MSCB 4ZIRA 3DKVA 2R8RA 1NBME 4B47A 5IDVA 2QTVB 4MYTA 3BFKA 1UEIA 3SQXA 1CXZA 3L0OA 3TW4A 1S2MA 1P9NA 4D0NA 2ZVQX 1SVMA 3VKGA 2GRJA 2YWGA 2WKRA 3DHWC 5G53C 4PC2A 1G3IA 4CEHA 4CW7A 1VG9B 3LH5A 1TQDA 3RDPA 3SI7A 1U2RA 3JZAA 2P5SA 2GJSA 3HR8A 4QBGB 4WA7A 1Z6GA 1Q57A 2N42A 1E69A 3C5HA 4XWOA 3E2IA 4G5QA 4JYBA 1NVUQ 4PFSA 2X2FA 4Q4AB 4TT3A 4FMDF 3X1WA 5LDDC 4RJLA 4Q7MB 3P20A 3OEED 2CK3A 2O0JA 1YZTA 2RGCA 4V0ME 5EE5B 1VCMA 4Y0AA 3OFND 1X1RA 1IXRC 3MLEA 4KVGA 4WXRA 4JT2A 1NSFA 2KBFA 1XNJA 3K9GA 2FSGA 3D3QA 3N2EA 2F1IA 4HSEA 3LNCA 2B7CA 3BB4A 2W2VA 5A5GA 2CCJA 3QBVA 1GNRA 2J7KA 4CEHB 4XH9B 3Q3JB 4HZIA 4MKFA 3K0FB 3LVRE 2OO7A 3MMPA 1R0ZA 1GITA 1KDTA 2VTKA 3DL0A 2AXNA 2BIFA 5LBIA 4KSCA 4QM6A 2JJ1D 2RGNA 3MUFA 4D4LA 3AVWA 3MWKA 3OIVA 3ZS8A 4EKDA 4Y0VA 2QMUA 2WSSD 1GKUB 2O0KA 3CM0A 3VNUA 1GVNB 1XTSA 1MR3F 5CLLA 1WBBA 3K9NA 2B21A 2V7QD 3UK6A 1GKYA 1G8YA 2CK3D 1W0KA 4BASA 1T3LA 2QSYA 3OESA 4JJZA 2IWRA 4D6PA 1FNNA 4A4DA 1X6VA 5B30A 3ICQB 1GRNA 1E32A 1COWA 3LFUA 1ZM2A 2I4IA 3RAPR 1FW6A 2BCGY 2HXSA 3ND9A 1ZNXA 2ZRHA 3TRFA 4B2LA 4B44A 1Z0AA 2XNSA 1E9AA 3TBKA 3J81k 2CCKA 4FMDB 5K8TA 2ZPTX 3HPQA 1ZD8A 5HKKD 3QKTA 1BS1A 3PEUA 3QF4A 5FOXA 1P2TA 3AVQA 4I1VA 2GBLA 4Q7JB 1XP8A 2XZPA 2ZUDA 4A6PA 1T91A 2J59A 1E99A 4IRUB 3CW2A 2LWIA 2FFBA 4FD2A 1N5JA 4PZLA 1XEFA 3DM5A 2XZLA 3AF3A 2NOAA 2JLYA 2O8FA 2CXXA 3BH7A 1XDBA 1JXOA 4HB3A 3CRMA 5JS7A 2D7DA 1D2NA 1GSIA 1M7BA 2XJ4A 4BWYA 3TAUA 4M1KA 5EP1A 2VIIA 1J2JA 2GVDC 3IHWA 3CIOA 3ZZUA 1MRNA 1PZNA 2J46A 3FMPB 3P26A 1VMAA 1G18A 2ZRNA 1VTKA 1MABB 3KJIA 1R7RA 2GXSA 2YZ2A 1I4LD 4PO8A 1J8MF 1Q3HA 1OH6A 5CIQA 2XTZA 4M1WA 1KO8A 3QKUA 2YINC 1IY0A 1KSJA 2XB2A 3SN6A 1W4RA 3EIHA 3KQNA 3AH8A 3EAQA 1T6NA 2AD5A 3K09C 2QP3A 1DE0A 2W6JD 4C0KA 4MRPA 1GAJA 3DEFA 5FTNA 1W0JD 3WRYC 3QOFA 2V55B 5HPYB 1K6MA 2GVZC 3HWSA 1TADA 1RJ9B 4P0TA 2XSZD 4PHHA 2Z83A 1BMFD 4GOJA 2QL6A 1E1QA 2E1RA 4RD1A 1OE0A 4B75A 3NH9A 4PPQA 2WPDD 4BZQA 1TQ4A 1XJCA 2O8EB 3KFXA 3UXMA 1X37A 3IGFA 1BH2A 2BDTA 1VIYA 1H8ED 3KB1A 4AY2A 3CRW1 4OBEA 4Q4AA 3CLVA 3SHFA 4FN5A 3QSYA 1UM8A 2NG1A 4UJ3A 1E9BA 2H1LA 1UEJA 1XMIA 5FOSA 3QXJA 4LCBA 1N0VC 1K5GA 2NO7A 4NYMQ 2OHFA 2ANBA 2OV2A 3BC1A 3NEYA 2ZSEA 1RJ9A 2QM8A 1DARA 2OAQ1 1NG1A 1X8JA 4B3DA 2BKEA 1MRSA 2ZQ5A 2RKOA 4PR0A 2ZR0A 3NEJA 1ZC3A 3CRRA 2PLRA 3B9PA 4FWDA 1LFDB 4ZPXA 1AM4D 2MSEB 3I4LA 4RZ3A 3GLHA 4EPRA 4KLNA 2AFHE 4TLEA 4V02A 2ZJ2A 1KK2A 4P32A 3WYFA 3QVUA 1LF0A 2C5LA 2DYKA 3SQWA 1OSNA 1A82A 2EW1A 3QG5A 2IHYA 3CNLA 3ADDA 4F93B 4HAXA 1XPRA 1UKYA 2QAGB 3Q72A 4Q4JB 4A8JB 1MOZA 4B35A 4FMBB 1O87A 2WMNB 1HA3A 1JALA 1OPXA 4QBHA 2VF8A 1M2OB 5FUYA 3PUXA 2W6IA 1OFHA 521PA 1JI0A 2CJWB 1F2TB 3SJBA 2O52A 4ZKEA 2QQEA 2NO6A 2WSMA 1KSGA 1W47A 3FPAA 2IC5A 4YLGA 2JLSA 2KBEA 5EXXA 3CNNA 4N0DA 3DZ8A 3QIAA 1DOAA 2EFGA 3AUXA 3W6OA 1ESMA 3UG7A 4B3XA 5KU1A 3PIRA 4WAUA 1ZJ6A 2QGZA 2IF2A 4US1R 2ZRBA 3BAFA 2PZFA 4YDHB 5BXQC 1VG8A 2HLDD 2ATXA 4GITA 1EWRA 5DLQC 4YONB 1NVXQ 3CB4A 3CH4B 4S2EA 4Q9KA 2OCBA 5JWHA 3RRMA 2WWYA 4BFUA 3D8BA 3U4QA 1ZU4A 4Q1BA 5HCIA 1G291 2Q0HA 1E2IA 1OFTA 3X1YA 4IHQA 5J4YA 1GP2A 4NKRA 5K8UA 2IS4A 4ACBA 1L4YA 4JSTA 1XCPA 3LW7A 2KB0A 3RC8A 2BHRA 1G17A 4DEYA 4ERNA 1N6PA 2RB4A 4PAOA 4URWR 2OFXA 4D25A 4IOMA 1CR4A 3C4JA 4X8LA 4CVNA 3K0AB 1TU3A 5JBQA 4IDQA 4M8NE 4FWHA 1F48A 4F4IA 4C7OA 5E7MA 1OHHA 3W5JA 1T8TA 4RCYA 1VYTA 4JKIA 3RANA 2IS6A 1OJLA 2W2TA 4LRSA 3A1UA 3P4XA 1E0AA 4RFSB 4TLDA 3Q85A 1Z6YA 5EP3A 4EFMA 5FI0B 4DSUA 4NP6A 1N6LA 4XSGA 1WXQA 1E2KA 1ZIOA 1OFIA 2DZNB 2GJKA 1JPNA 3ZIAD 2NO9A 4UKDA 3K9HA 1LTQA 1T5LA 4MRSA 2O8DB 2R6CA 3JVUA 2DWZB 4OQXA 1CS4C 4DDWA 4R7ZA 5SZHB 2ZU0C 2W58A 4I4LA 1FUKA 2OT3B 4MA4A 3PV0A 3U3OA 3GEEA 2JCSA 3V9PA 3GLGE 1FP7A 5L3VA 2LKCA 1J8YF 2XSZA 3I3SR 1NLFA 2FG5A 3V00A 3CKLA 4JL5A 2FGJA 4Q4HA 1EFRD 3KX2A 1KMHA 4AKEA 5K8LA 3U4QB 2GA8A 1ZCBA 3MJHA 1GWNA 3DKPA 3BH6A 1AJEA 1AGRA 1EWQA 2NIPA 2YHSA 4XWAA 4C0LA 5B2ZA 2X8AA 4D2IA 1R6BX 2R6AA 3BJIC 5BWMA 4QNMA 4M1SA 1Q0UA 3CWZA 2OBNA 1CU1A 4XJXA 2GCPA 1ZD1A 2NO1A 3OF5A 3KTAA 5EUQB 1A1VA 2V6IA 3VR4A 3VNVA 4BFYA 2F43B 2XITA 4URZR 1E2NA 2QAGC 2RGNC 4JVLA 4G5SA 3EZ9A 3WMGA 4PHGA 4D0GA 2MMCA 3A4LA 3H4MA 1J99A 2ODBA 3T34A 4IW3B 2O0HA 3TQFA 1AQUA 3RHFA 5KOYA 4J0QA 2R9VA 3FGNA 4EFNA 1Z0JA 3VU9B 1SVWA 2I3BA 1OV4A 1E9DA 3R9WA 5FH9A 4HAWA 4MYUA 1NSTA 1LF5A 1G9XA 1FTNA 2EVWX 5H68A 3RS2A 1M6NA 3VHXA 3B5JA 4DSNA 2VHUA 3UANA 4TYPA 1ZYUA 4LJ4A 1U0JA 1Z2AA 5JFGA 3ADCA 4HLQB 3QXXA 4DHEA 3DOEA 3OHMA 3TR0A 3EG5A 1NKSA 5AR1A 3ZQ6A 3U7FB 2DHRA 1W46A 3O8RA 4KCGA 2F9MA 2EYUA 3FB4A 4K46A 3ZH9B 4XD7A 1GNQA 1LV7A 2ZRJA 1FUUA 1ZD9A 4C7OB 4MITA 5HKKA 1UKVY 4QL3A 2RGXA 3SJCA 1Z06A 1OKKA 1G3RA 3VAAA 2PH1A 3DVLA 3S1AB 5L8VA 2EQBA 1ANKA 1KIMA 2CNWA 5AUNB 4W5WA 3OAAA 4PAQA 1XX6A 2GAOA 4ZCLA 4WZBE 2ZU6A 2V7QA 3GQBA 3PFIA 2DWPA 2G88A 3R8CA 2G6BA 2XOKD 2VF7A 4CGZA 2P6RA 1G3QA 4PC3A 1TF5A 1Q20A 4BLSA 2FH5B 1KDOA 3KFVA 4LC1A 3EASA 3IPXA 2A5DA 3QJYA 1TUEA 1OXTA 2QORA 4A0HA 5J47A 4XTRA 4HB4A 5CB6A 2XNDD 5BN3A 3QQ5A 1P61B 2CCGA 2NZJA 5JWRA 3ZDQA 4PZZA 3SYLA 1YR7A 1AZTA 4CT4B 4EJSA 2CL0X 1DG3A 1DAIA 2J7PD 3CWQA 2W6ID 2A5FA 4PQFA 1G5PA 3UMSA 5AK0A 1ETUA 3NBXX 4Q7LA 4DSOA 4L4UA 5TV2A 1KI8A 3D6TB 4ABYA 3AB3A 3AM1A 5JHGB 4OYHA 1FZQA 4MKIA 2OM2A 5JEEA 4TQAA 5KNCA 2GBLC 1W48A 1XWIA 2CLCX 4FINA 3IDQA 4HUQA 2O8BB 5J4VA 2BBWA 2AX4A 1AA9A 1MABA 2P65A 3EZ6A 1Y63A 1UKEA 5DYIA 1ZIPA 1AIPA 3TUJC 5FR2A 5FPYA 5JLJA 4TT3D 3CNOA 4OQMA 4QBIA 4C2UA 1UBCA 2YV5A 4HLUA 1VECA 2C03A 2DWQA 3Q8XB 2VLIA 1Z0DA 5EJEA 2GXUA 2I1QA 1A4RA 5HTKA 5KPJA 5E4FA 3P27A 3VX4A 3ZD7A 2YC2C 1E9EA 5JJKA 2ZSBA 5DGXA 2W2XA 4RFSA 1EFCA 3X1XA 3KTAB 4LHXA 3Q7PA 5TDHA 3WY9A 4Q1EA 2DCUA 2GXAA 4EPVA 5DN6D 2F1RA 2ERYA 1H8EA 3RS7A 3X2SA 4FIDA 4FMCB 4U5XA 3O8CA 2KRKA 1XB2A 2D62A 3NBZC 3PUVA 3LLMA 4HAYA 4PC1A 4ZDIA 3GLIE 3X1ZA 3WHLA 1NVWQ 3FDIA 2J45A 2ONKA 3RS0A 3WBKA 1MO4A 4N1AA 3RNLA 5TXGA 3UKDA 2ZS8A 1OYYA 1SKYB 3LWNA 4DCTA 2VSFA 4YMTA 5JEDA 4AYTA 3U60B 5CLQA 4TL9A 4EPWA 5DSZA 1V43A 2W0MA 3NVAA 4QGHA 1G7SA 3M4YA 4A36A 5KUTA 2GK7A 4C0BA 4B43A 1HUQA 1WA5A 3ZGXA 1SKQA 2ZAOA 2J0UA 3I8XA 1E2PA 4G5GA 4XVUA 4NYJR 2WZQA 3IUYA 4OQFA 4LOAA 1ZVQA 3GLIB 3TQCA 3VR5A 1QHYA 4RD2A 1JBKA 3NHAA 1GKIA 4AYWA 3WNCA 3CR8A 3SBEA 2ZJZA 5TY0A 2IYVA 1WF3A 2VO1A 2FE4A 4WZAE 4DDTA 4CEIB 1TU4A 2OEPA 1CRPA 1WQ1R 3F5FA 1RRGA 3TJZA 2AD1A 2Z0MA 3FKSD 4LYHA 3IILA 4AC9A 3RC3A 1LY1A 1YR9A 4DKXA 3SBDA 1U81A 5L3QB 2GF0A 2XEXA 2EFHB 2WIAA 3FMOB 5HE9A 2KWIA 4US0R 3ZLJA 4D82A 3GMTA 5HZKA 4D80A 1G20E 3WYGA 2JIZD 3THYA 1IN8A 5GVSA 2CL6X 3PQCA 4N0EA 3R9IA 3NKVA 4DUGA 4MDFA 4Q1FA 4JYCA 4FCTA 1IM2A 2C04A 1TTTA 1ZNYA 1AS0A 2ZITA 4DZZA 3FMIA 1FQJA 1U0LA 1Z6TA 2YKGA 2DFLA 2G1JA 1H8HA 4M53A 1I2DA 1VPLA 2RHDA 3B9QA 1Z22A 1E2FA 1R5OA 1G21E 4EJSC 4IDHA 4N3NA 1OH5A 2EYQA 2H5EA 3T06B 1KAGA 3FHTA 2ZI6A 2BM0A 4TMXA 4DLWA 5AJVB 3EC1A 3U6KA 1T5IA 4MGKR 4WIAA 1MV5A 3A4MA 1F3OA 4X8OA 4M0LA 1KMHB 2GETA 2ODNA 1O3YA 3P32A 1DS6A 2WSSA 1VHLA 1ZUIA 4TQUS 4DC9A 2C99A 1Z0FA 4JZKA 2C9YA 3CRVA 4D81A 4GPTA 4Q1CA 1GILA 1PLKA 3ZZ0A 3VR6A 3K0CC 2BOVA 4Z54A 121PA 4ON9A 4IDPA 2A5YB 4TN1A 4OK6A 4TMVA 3MD0A 5FUWA 1W36D 2PT5A 3THWA 2BBOA 5E7IA 3CPJB 3ZJYA 4IFBA 2IXEA 2PBRA 3GPLA 1OB5A 1XEXA 1KNQA 4LZZA 2WVJA 3DM9B 1CULC 4MKHA 4PHTA 3EPKA 3VR2A 3B1VA 3EW9A 1E2QA 3B8HA 2O8CB 4S35A 5DYGA 4V0MA 1P75A 5EZ6B 1EX6A 3IO3A 5FBWB 4Q66C 5FL7A 4IVQA 2FZ4A 2XAUA 2ECKA 1X1SA 3AKDA 1GNPA 1XBTA 4HZUA 2FPLA 8OHMA 4YC7A 2DFTA 4PSVA 5FPHA 4EFLA 2VP5A 1XJQA 2GNOA 5FL3A 5C4GB 1E98A 3TH5A 2QSZA 3K1JA 5G40A 2I1VB 1IN6A 4IKEA 3TSOA 3BD9A 5DIFA 1FQKA 5GJVC 2HCJB 2CNWD 1R8QA 2P6UA 3IEVA 4WXPA 2VPPA 3BBPA 1ZM9A 2PL3A 1D9XA 2RGAA 5ELXA 2QEQA 1Q1QA 4R2IA 1P3JA 4MUAA 4FWGA 2ZTSA 3FMFA 1AS2A 4LHYA 3NBFA 5JRJA 2QMEA 4QJ4A 2DPXA 2GJAA 3UWOA 1RRPA 3RS3A 4DLVA 3VKHA 3SC3A 3L0IB 1G16A 3IBGA 5FOWA 4A0FA 1W44A 3L0PA 3AP2A 1NVMA 2XB4A 3GJXC 1IONA 3O47A 3PCRB 4NCHA 4QJ3A 1NMYA 4NYIQ 1CEEA 1W49A 2QT1A 2VP0A 1NRJB 4TMWA 5JCPA 2BM1A 5JRZA 1G6HA 2C78A 4A1FA 4ARZA 1XD8A 1G8FA 2UZIR 4OKSA 1D2EA 4KODA 5BN4A 1NN1A 1QHHB 3UWKA 1KKMA 4BFSA 4KYUA 4QC2A 2PEZA 1GUAA 1CJKC 4LRWA 2FEOA 2ONJA 4V0NA 1RIFA 1N6HA 4POAA 3RRYA 4YDSA 5HE8A 3IIMA 4TTQA 1XMJA 2QP4A 1NF3A 2W83A 3SDZA 2UVQA 5B57C 1ZNZA 3DZDA 5JMTA 4GMDA 2ZJYA 3C16C 1GRRA 4BUJA 4BGDA 4Q02A 5JJIA 3IIKA 1EFRA 2FNAA 5FPKA 4H1UA 4II7A 2ZJAA 3QPVA 4OK3A 4NL4H 4URVR 2VYFA 5DE3A 1YU9A 1SVLA 1R5NA 1KOFA 3KKNA 2XGJA 4F91B 3CPEA 2QTHA 2WJYA 4IXMA 4Z8XA 5CJPA 1KK0A 2X77A 3BH0A 1XEXB 3KXKA 5BQ5A 4B76A 3LXXA 3OE7D 4KSBA 1A5TA 1P73A 2ZRKA 2YWEA 2XXAA 1A2KC 1N25A 3M0EA 1AGPA 3UG6A 3ZIAA 3A1TA 2OXRA 5FUXA 4B33A 3SFZA 1DO0A 2OFOA 4H1VA 1W36C 1F5NA 4HDCA 1WRBA 2JIZA 2J0QA 4EIWA 3AKEA 3KQKA 4LPSA 3VKWA 1W1WA 3I92A 4G5OA 4KI0A 3THXA 2XXAB 1OXSC 3ZVLA 1P6XA 4A9AA 2DBYA 4L16A 4YMSA 3RSOA 3EPJA 2VP4A 2HJVA 1KO5A 3MCAA 2PZGA 2ZUCA 2CHQA 3H2YA 1G4AE 1OIVA 3I73A 2O5VA 4NCIA 4HZUB 2AFIE 1HV8A 2PJZA 4LHVA 3Q9LA 1EG7A 5AUOB 2V6JA 2QM7A 3RWMB 1R0WA 1WMSA 1U8AA 2ZJOA 2XJ9A 4XIGS 4AD8A 3BWDD 4PTLA 3DMNA 3K53A 2VEDA 1W7AA 1IY1A 2IEYA 3FYHA 2CDNA 2GEVA 2LCFA 4CZ2A 3NHBA 4CT5A 4PC6A 4AIIA 2MSDB 4MGZR 5IF9A 1YKSA 3LQRA 3EPHA 2VH5R 3MHVC 2GZHA 2W0SA 3RSLA 4AI6A 3WHKA 3SE0A 4CIDA 1X3SA 4DLXA 3T61A 3GFTA 4DT1A 3QY0A 2QRNA 5KNDA 2H92A 4V03A 3RLFA 4D4KA 4P3YA 3TIFA 4QOSA 1AK2A 5KO2A 2GCOA 3EA0A 2J87A 4YMUA 3ZQJA 2CE7A 4GOXA 1YJ5A 1M7HA 2BMEA 2FPMA 1YRBA 1P2VA 2GJ8A 1E2EA 4C3ZA 1DAHA 2P6NA 4OK5A 4AYXA 4PXAA 2IYZA 4RKEA 1N0UA 5FTLA 4KU4A 1P2UA 2G0NA 2PZEA 2UKDA 4V0KA 1QZMA 4TL8A 3W9YA 1SVIA 1UBGA 2IXGA 3OFNA 3PUZA 4Z1MD 4BPBA 1P7CA 2XX3A 3VR1A 4GRAA 2BVNA 1SXJB 2ZSAA 3QENA 4ASUD 1K8RA 1OHHD 4JLPA 2DB3A 2OLKA 2WOOA 1S96A 4BZXA 3THYB 4TQ9A 3FHOA 5L3RA 1OIWA 4ESHA 3REGA 1N6KA 4M2LA 4NDZA 821PA 5F2EA 2P67A 3KKOA 3FTQA 3U3JA 4TL6A 1ZW6A 2WJVA 5FBRB 1B23P 1RRFA 1W2HA 1SULA 3HU3A 4JLNA 5EXSA 1QHSA 4BLTA 1NLZA 2QQ0A 3W6PA 3QXSA 3BK7A 1QHHA 4YXWA 2DFNA 4P4TA 3C41J 3L2OB 2QN6A 4KXFB 3T1OA 4B2IA 2EWWA 2IXFA 3RRZA 3C15C 1JEDA 3ADKA 1NN3A 3AVOA 1OH7A 3I62A 1Z29A 1QZXA 2NMVA 1QF9A 4ZIRB 1NBMA 4GMXA 4KFRA 3EARA 3EPLA 2VP2A 1G6OA 2NPFA 3QG1A 4EJSB 3TR5A 4DRZA 1UDWA 1IN4A 1JAHA 3QKSB 3KDSE 5FBQB 1W0JA 3E70C 1MT0A 5KDOA 1ZCAA 1EFTA 4QG7A 3SEAA 1LW7A 1YVDA 5DISB 2W6JA 1II8A 5JWOA 2R6DA 2Q9CA 3AGPA 4MDEA 4WW0A 3GLHE 3BRWD 3A1SA 1IY2A 1CBUA 1WE2A 3T12A 1NBMD 2GXQA 2ZIAA 1F6BA 3E1SA 4BLPA 5FOVA 3RRNA 3KQHA 4WZ6A 3EX7C 1HE8B 1Q1ZA 1D9ZA 1XU4A 2ZI3A 4PSKA 4GBMA 5IK2A 3KQUA 3IHLA 3MWJA 5LPNA 1GL9B 3KJGA 2Q3HA 2QY9A 2H57A 3KXLA 4LYFA 2WMOB 4F7WA 3UMFA 4I99A 2R2AA 2BJWA 4KFTA 1ZUNB 2KSQA 2HT1A 4HYYA 4UNNA 1XXHE 3L8ZA 1T3SA 2G9NA 1CJUC 5AUQA 4JL8A 2LKDA 1NY6A 2DR3A 1MO6A 3GLFB 2OG2A 3B60A 4OHVA 4F4CA 2FPKA 4OHYA 3ND8A 2VA8A 1E6CA 3LAWA 4ASUA 2E9SA 1RRCA 2IYSA 2V8OA 5SZKB 3TAHA 1L8QA 4I1SA 3W5IA 1XEWX 2DWOA 4L8GA 4U7DA 1DAMA 2OFWA 4BQSA 1EFUA 2VP9A 2ZYTX 4G1UC 3LY5A 4AG6A 1KDPA 5JECA 3K0EA 4P33A 1PLLA 1YQTA 3K09A 4HEJA 4MQBA 2RHMA 4LC0A 3AVUA 2QT0A 3A1WA 3UATA 3NWJA 1N6IA 3BIFA 3UPUA 1C9KA 4NCJA 2XZOA 3U7GA 5GVRA 1XPUA 1EXMA 3GLFE 1RPZA 4EUNA 2PLFA 2Z4SA 2IUTA 4LV8B 2QUZA 5FL7D 4URXR 4TWZA 5KDLA 2D2EA 3RABA 4JS0A 4UXJA 1KYIA 4PPNA 1CF4A 4M1OA 3NBYC 4TLCA 3U44B 5L3SB 3K70D 3GEIA 4ZDKA 4M9XA 4OQLA 1Q3TA 4Q21A 4MRRA 2ZRCA 3LDAA 3A8TA 4XOIA 4GP7A 2ZRGA 1TNDA 1VCIA 2QE7D 4C4PA 2ORIA 1JECA 4WVFA 3U5ZB 1W2GA 2A9KA 4GT1A 1KJYA 3TW8B 5A4JA 2P5TB 4LJ6A 1G1MA 1U94A 3AGQA 1YR8A 3HP1A 4A15A 4IOLA 2DFKB 1IQPA 1RW4A 1T8UA 2EWVA 4M9ZA 1TEXA 1ZC4A 4PX9A 4DWJA 4X8HA 2Q9BA 4KITB 3QEJA 3V4RA 2Z5FA 1S9DA 3QF7A 3HDTA 2C96A 3CH5A 2CEAA 2ANCA 3QXCA 1GL6A 2VQSA 4AKGA 1D6JA 3IKJA 3IQXA 4M4SA 3PEYA 1SHZA 1F60A 1YZGA 1P4SA 3L43A 2AWOA 2F6RA 1L7VC 1BIFA 1E79D 3UMRA 2WBLC 1QBKC 1Z8FA 1ZM7A 2BEJA 4F4JA 5LD2C 2CVFA 3H86A 1Q1EA 1U8ZA 1E4YA 2GILA 2VP6A 3PR1A 3OEEA 4PSAA 4YMVA 2ZXUA 1H8HD 3MRSA 1GIAA 3I72A 3KQLA 3TGPA 1KKLA 5GJCA 2WWXA 3AEZA 4KO8A 1OT3A 3B85A 4LHWA 1P9RA 1YR6A 1QRAA 3EZ2A 3KXIA 1QHXA 2GZDA 2NZ8A 1P2SA 1QHGA 4Z1MA 1BOFA 1QDEA 2V9PA 2IYYA 3U6BA 3EZFA 2YJTD 4Q7KA 4GSYA 2JLWA 2X2EA 2PT7A 2J0UB 2A78A 2D2FA 2JDID 3Q5EA 2HYIC 4Q1DA 1C4OA 3T5DA 4F38A 1COWD 3M1IA 2R65A 3NC1C 1ESNA 4PAMA 4Q19A 4BEBA 2ZI4A 3B1WA 1Z63A 1Z6AA 3R7WA 2R62A 4JLBA 3PITA 4K8OA 4Q48A 1QHNA 1R2QA 1X86B 3FOZA 2H16A 3RS4A 1WBDA 3LVQE 3PUWA 4G01B 1ZUHA 4M1YA 4P4SA 1XTJA 1ELOA 4NYMR 2WWHA 5FPTA 4JIMA 4FCVA 4FW9A 3BERA 2YOFA 2X19A 1Z3IX 4B48A 5H8WA 1FFHA 4JLDA 1Q44A 4HUTA 4ZCIA 4G5RA 2YWFA 2JLXA 4O3MA 1T0JB 4BRWA 1MH1A 1G64A 4RD6A 1UKZA 5FTKA 3B6EA 3K0CA 5A0FA 4BLRA 3WMFA 3TSZA 2HYDA 2ZJBA 2VL7A 3O8BA 1AN0A 4DLRA 3BORA 1NIJA 1U90A 2FJUA 2GEUA 1KI6B 1D5CA 2B92A 4TYQA 4TZ0A 4RFVA 4DIEA 3L0SA 3K9LA 2ZM5A 2NTYC 4R2HA 3SYKA 1FP6A 1US8B 1XJ0A 2QG6A 3BGWA 3PEVA 2QENA 1JNYA 4IXNA 3QKRA 4KFUA 4UNRA 4PO9A 4TYNA 2ZREA 3AVXA 3TNFA 1EFHA 1XRJA 2IYTA 4FI3C 1JR6A 2A3RA 2V6ZM 2OCAA 1E0KA 2J5XA 1E2DA 3CPHA 2PCJA 1OF1A 5KSPA 5DNYB 4QRHA 1P5ZB 5AJZA 3PVSA 1CJMA 4PQYA 3K8YA 1R0YA 3SJAA 1XTKA 1VCNA 2JEOA 1Z6XA 1FMJA 1GFIA 3IBYA 1Q12A 2H18A 1JXMA 2QMOA 4CEIA 4LRTA 5FFMA 1NG9A 2A7QA 1HQYE 4DLZA 2Q6TA 4GZLA 2H17A 1TPZA 1SXJD 5TARA 3B13B 3MJRA 2ZUBA 2C98A 1CTQA 3WRXC 1E9FA 4M1TA 5TVKA 1IHUA 1W4CA 4GNKA 1KI1A 1NJFA 2WJGA 1UDXA 3FVQA 3NDBB 2R6GA 1D8TA 4NHOA 3EWSA 2YNMA 3THOA 4JN6A 1PJRA 1RFLA 4TSFD 1KI7A 3B1ZA 2RMKA 3K0SA 4CYMA 2CHGA 1VIAA 1N5IA 3O8DA 4B74A 2BCJQ 1M1YE 1JR3E 2ZEJA 1L2TA 4KHZA 2QPOA 3QKSA 3BOSA 3T1VA 1KSHA 3NC0C 1LVGA 4LI0A 3CF6R 4A82A 2F7SA 5CDFA 2D06A 2D7CA 4RD0A 2J7PA 1LS6A 2JLQA 1TAGA 1RYFA 2W00A 1EGAA 3A6PC 4Q4LA 1G3UA 1OXVA 1QVAA 3MG9A 2JJ1A 1P9WA 5CM9C 1Q1BA 2DY1A 4O2LA 3RVBA 1DVRA 2EFCB 3LW8A 1YHNA 2OCPA 1JQLB 4IVRA 3TK1A 1ZP6A 3QE0A 4AKIA 1YZUA 3WXMA 3QPUA 4IJMA 1BO6A 1FPMA 2UZ3A 2VHJA 1IOZA 3LO5A 1YRAA 2XOKA 3ADBA 2WKPA 1SHKA 3GJ8A 1FMLA 4CEJA 1HT1E 1NLYA 1HURA 1SVKA 1ZINA 1KY2A 3HPRA 2O8EA 5EXPA 4Q01A 4E22A 1IN7A 1GM5A 3AUYA 1ZMXA 2WICA 3IIJA 2BBSA 3TUIC 1K5DA 2KE5A 3H1TA 4Q9LA 4JKYA 4EPYA 1DTSA 2E87A 2ZJ8A 3KKMA 4QHYA 4I81A 1CR1A 1PUIA 2K5UA 5DI3A 4TZ6A 1TX4B 2JASA 3AP3A 4B3GA 1IN5A 2JDIA 2OESA 2HCBA 3DPUA 2JJ8A 4M9QA 2DVWB 1VCOA 4ARZB 4DLSA 2CMKA 1CRQA 2L0XA 421PA 3PUYA 4HLDA 5EE3A 5CDFE 4OI2A 2N1BA 3AP1A 4OJKA 1C1YA 2XTNA 3K0FA 2WWFA 2OBLA 4HLUC 2WM9B 2VBCA 1QG2A 2CHVA 4AK9A 1JR3A 3EWAA 3AKCA 3K0AA 1AZSC 1W4BA 2RAPA 1NVVQ 4JLAA 5DH9A 2WJHA 3AV0B 3BFVA 5J40A 3U61B 3R20A 1CKEA 4V0LA 1KJWA 1ZM4A 3GJ4A 1US8A 5GADl 4LJ7A 4Z51A 2GCOB 1U98A 4LPKA 4Q1AA 3DDCA 4FWTA 2YYZA 4PO1A 3I61A 2FEMA 1MKYA 1RZ3A 2BC9A 4DLUA 1N6NA 5E3HA 2GWHA 3FKSA 5CJ2A 2FA9A 1KZ7B 2IWHA 1G3MA 3GP8A 5H1YA 3AKYA 1II9A 2QI9C 3LBIA 2ZETA 4A8JC 4EPXA 4ZI3A 2BKUA 4ZKDA 3KKPA 2HV8A 1G7RA 2QA5A 3U3RA 3B78A 4FWIB 4B71A 4M22A 4LY6A 4JBXA 1I2MA 2QRZA 5HR5A 1CJTC 4FXPA 2JJ2D 4CF7A 3WNDA 5D3QA 4B6EA 4C0JA 5F9FA 2ZE8A 4AG5A 2QBYA 4UJ5A 2KJQA 3HYRA 1LNZA 4Q9HA 2FF7A 1LS1A 4MGYR 3FE2A 4UXIA 1HEIA 2ZE6A 2IEZA 2RGBA 3ECCA 3NIBA 1Z47A 4EQ6A 1G19A 1SQ5A 4XTCS 3K70C 3CBQA 4XVQA 4TSFA 3U3MA 5KPDA 1GTVA 2ASEA 3SFVA 3Q5DA 1RE0A 4O2RA 3DO6A 3QPWA 3H84A 3CF2A 3NDPA 2VHCA 3ZZTA 1OLOA 2IL1A 1TEVA 2FX3A 2IYQA 3E5HA 1Q22A 2V3CC 2IS1A 5JI2E 4M21A 5L3QA 4DB4A 1EESA 3C5CA 1SXJA 5EZ5A 5EP4A 3SYNA 1XXHA 2ZYWX 3N2IA 3LD9A 4C30A 1W36B 4RCZA 2QBYB 4W9MC 3PENA 5AWFC 1IXZA 3OE7A 2NPIA 4Q9JA 5KNBA 2IK8A 2HDNB 2OSBA 1A7JA 2QGNA 2WWWA 4RSGA 4EDHA 2YC4C 4BECA 1N5LA 4G3XA 2F9LA 3ETLA 4A2QA 3KW6A 3THXB 2CLDX 2WWIA 2XTMA 3ZVRA 2FDCA 1KK1A 4GL2A 1JAIA 2FV8A 1OXUA 1XMVA 4Q4HB 5JS8A 1R5BA 3PXGA 4MRVA 3R7WB 4PQRA 4BZPA 1R8SA 3W34A 3AJIB 3QI2A 1VG0B 3TMKA 3G82C 2Q3MA 4EAQA 5F9HA 4KBFA 4C0QC 5FTMA 2V1UA 3MGCA 3NXSA 1E2LA 5EXTA 4TLBA 2YOHA 4FCWA 1U8YA 2EU8A 4D4MA 1I4DD 1DG1G 4PPFA 4LUCA 5CITA 2ZANA 2C95A 3JZMA 2WAXA 3AF4A 3SZRA 2PMDA 3TKLA 2PX3A 1KHTA 2FFQA 2QZ4A 3VHLB 2NQ2C 2YWHA 3KUDA 2RH5A 4NH0A 2ZRFA 4NU0A 1Z08A 4US2R 4KAXA 4C9BA 4YQFA 4RZUA 2GESA 3B2EA 5EE0A 1FNMA 1AKYA 2QNRA 2N46A 2C8VA 1XZQA 2PX0A 4Z8YA 3K70B 5JSZA 4BRUA 1S8FA 2AL7A 4HAZA 4A6XA 1EK0A 4TYYA 3KUCA 5CK4A 1E9SA 3L82B 2QAJA 5KSOA 3R9XA 3U7EB 3I8SA 1UADA 5AUPB 2C2HA 2FZLA 3QUSA 1QVRA 1ONBA 3FFBA 4RD4A 3SOPA 2WKQA 3A36A 3U3KA 4YXWD 3HR7A 3CX8A 1ZAKA 5FBLB 2CBZA 1KI6A 5BYJA 1SKYE 1VG1A 4Q9IA 1H65A 2GF9A 1QG4A 3UIEA 4LK2A 4C0AC 4JLMA 5J4LA 1WCV1 3GFPA 3LA6A 3TVTA 3BE4A 1VYUA 2IS2A 3CONA 4OQNA 3T15A 4WOPA 3KZ1E 4DCVA 1AS3A 3M6AA 2WWGA 1R10A 1G8GA 1N0WA 2FOLA 1E79A 4JBYA 1OB2A 3RWOA 4BFWA 2DZOB 5KSYA 5GJBA 1CR2A 1CLUA 3NH6A 2ODEA 3IEUA 4V0OA 3ZYCA 2FU5C 2ZROA 3DMDA 4IOJA 5M04A 3BXZA 2C9OA 2HJGA 5GJWC 2P2LA 4OHXA 3KL4A 1CIPA 1HH4A 2D74A 1DELA 1WDTA 3LXRA 4O25A 3CF0A 2F3TA 1F2TA 2P3SA 3EXAA 5SZJA 4KVAA 3R8FA 1OYWA 1Y3AA 3QBTA 4C0HA 1KI3A 4ITRC 3RS5A 4DB2A 1F2UB 3WP1B 3U7HB 5KTYA 4NPHA 4PANA 5FR1A 1P72A 4A92A 4LJ9A 1RYHA 1OFUX 1E1QD 1Z5ZA 2ODWA 1XD9A 4YMWA 2A2ZA 4DBLC 3MWYW 2VSXA 1KI9A 2HLDA 4A2PA 2O8FB 2AR7A 4LV5B 4L9WA 5CYPA 2ZI5A 2OE2A 3FWYA 2WOJA 1UFQA 1XFAA 1JB1A 4LBWA 1U9IA 5EUMA 3KKQA 4W5HA 3AVVA 1KGDA 3OAAD 5E7JA 2CLSA 2J0VA 3X1DA 3IO5A 5FOTA 1G7CA 1KO1A 1V5WA 1NL3A 2BMDA 1OKKD 1XZPA 2PJRA 1E96A 3QF4B 2D4HA 2IYWA 4MUBA 2ZRDA 3B1YA 4ZI2A 2ZE5A 4TL7A 3G5UA 3VLFB 2ZS7A 3SJZA 1U0HC 2IBMA 4BLOA 4DIDA 4RZXA 1R0XA 1S1MA 4JL6A 1YZQA 4ESVA 1ZNWA 2AWNA 4DEXA 1HE1C 1UJ2A 3N70A 3NG1A 2G1KA 3EC2A 1X8KA 5KDDA 4LHZA 5AJWA 4B3CA 1G8HA 1T3HA 3AQ4A 4LYAA 5CK5A 4DCSA 5C18A 3JVVA 2F3RA 4RZ2A 5IRCD 2H8KA 1NIPA 1G7TA 2HF9A 2Q21A 1E9CA 2RCNA 1W5TA 1XTQA 3AF2A 4A3VB 2BV3A 1KDRA 4TLAA 3LX5A 5CYOA 3T35A 3BB1A 1UBEA 1XTRA 1SZPA 5EP2A 1KNXA 3L8YA 3MSXA 3W3AA 2B7BA 4LDJA 2CVHA 3HYTA 2ZRMA 3SS8A 4E5UA 221PA 1NY5A 1ZM3A 1TF7A 5FBVB 1LB1B 1FL9A 2J3EA 4JMPA 1XMSA 4UQOA 1E2HA 2YOGA 1YZLA 4K81B 1U9IC 3A58B 2GK6A 3OIYA 5IK2D 3W8RA 4AURA 3I5XA 4DVGA 4KJZA 3MWLA 5DI9A 2PEYA 2RGEA 1TF2A 2IX3A 4BFZA 4JLOA 4BEJA 3EIEA 5KYKA 1BYIA 2WHXA 3CUEF 4OHWA 2FSIA 3FHCB 3TLXA 1QHIA 2CE2X 4Q4JA 4NMMA 2WPDA 5DHAA 5J4HA 2REBA 3VTKA 4OI4A 4QHSA 2V1XA 3REFA 2WAYA
chains in the Genus database with same CATH superfamily
4UULA 4B2PA 2V58A 4ZVVA 3ST7A 1MG0A 1QOQB 5BUSA 3LRPA 2X4AA 1JHOA 3GUZA 4JP8A 1CQIB 1FBTA 4E15A 2C07A 4AZ3B 4RKRA 4RCVA 1E92A 5IF3A 3RADC 2ZTDA 1EFDN 3Q0TA 4S0XA 1TUGA 3PC4A 1EYZA 4ZYVA 3UJCA 4UPVA 3KR9A 1LDNA 3PKJA 2NO0A 4GQIA 5FPQA 2QU8A 4P92A 2FGKA 2FSFA 4WXHA 2XT6A 3GPIA 2G5TA 3MYRA 1Q91A 3HJGA 4F45A 5B58C 5TQJA 3DHEA 2A9PA 5AI4A 2RGUA 3L92A 1M74A 4FLEA 4M37A 1BQEA 4MQ4A 2WIFA 4NOKA 2FEWB 2FFRA 4MUGA 3BFJA 1N32B 4EB0A 2F48A 2X7JA 5EHNA 3SNHA 1MFZA 2OYRA 5I9LA 1JEOA 2OPFA 3ZTYA 1ZR4A 1UODA 3HC7A 1SKUA 5I7HA 3L1IA 5AT1A 4MW5A 4MVJG 3GQ4A 2I7VA 3H17A 3V42A 3CX6A 2ERXA 3TRKA 4DLYA 2QZ9A 4O33A 4CR7A 3FKQA 3OZEA 4O5OA 4ND6A 2OSVA 3UMCA 4R9UC 1Y1QA 3HCPA 2P4UA 3LGXA 1DKQA 4QTZA 1MX0A 4KO1S 4YTEA 3WGUA 4BO6A 3KTOA 3VR0A 3EHEA 4DTIA 3BIOA 2D8AA 2L42A 1TQ2A 3TRDA 5CB8A 3TYXA 3WZMA 1Z07A 4LAFA 4MRNA 2PU7A 1OFUA 3MINA 5E3JA 5K3CA 1GU7A 3RUHA 4X41A 1FRVA 1HYBA 3M3DA 1DWUA 2II6A 1IBLB 4P31A 1E7QA 4J7UA 3H9EO 3F96A 2I7XA 4KFSA 3SZ3A 3UJBA 1T1JA 2NV0A 4OXRA 1L7RA 3EIQA 3PICA 4JI3B 1AIPC 3DOAA 2RBGA 3CTMA 3WKBA 5ICSA 2YMQA 4GGOA 3KJQA 5A03A 4LVUA 1GDDA 4Q93A 5JDCA 1JU4A 2FH0A 1TCCA 3A6LA 3IP9A 3WL5A 2YWRA 1O95A 4IDOA 3V97A 4OKNA 4MNTA 4QDZA 5DI3B 1IBKM 2WVHA 2XF8A 4MUJA 4A26A 2ZRIA 3TZQA 2YWJA 2C88A 3PG5A 2FWBA 3KEGA 3DOJA 3CZAA 5JI3E 1MA3A 2QPTA 2KPOA 1BNCA 1TVKB 2IOFK 3UCXA 3E22A 1PGQA 4C89A 4N5LA 1L4UA 2WTAA 3F67A 1TTPB 1M2VA 1S0UA 4K9KA 3FCOA 1Z0IA 3KSDO 5F1PA 3I64A 5DFAA 1PW5A 1ZEJA 5I9SA 1XCMA 4BFVA 1KJZA 4OI0A 4NCNA 3QAUA 1Z37A 1U8UA 3K2IA 4H9GA 1A88A 4QECA 5IVKA 4P98A 2Q45A 1PEAA 2EBFX 1C9JA 1VL6A 4KYTA 1T4MA 2FFHA 4Z9XA 2LNDA 3ACDA 5KNDH 1TFRA 5EKDA 1JEJA 1XQVA 4QREA 2ASVA 5A4IS 5CFZA 5GV8A 5JJBA 4P0QB 4IDNA 2QUKA 4LGMA 1RU3A 4NMLA 2XUJA 2PR7A 1PKEA 1DMRA 3JD3A 2OFFA 3ZV5A 1T8WA 2WINI 2LNHC 3VQTA 1KK3A 1FX0A 4UE2A 1YE8A 2Y20A 4WGFA 4DLAA 1Z3CA 5BSHA 2X4GA 2ZTMA 5AVXA 3LSTA 5F9FA 1NN5A 4FX2A 4J1SA 4CTOA 1BG6A 5KEIA 2P35A 4RJTA 621PA 1NOKA 1GLGA 1YJ8A 3QE9Y 2BKAA 4B3BA 5IZ4A 4QDTA 2OAP1 3EYAA 1IOVA 2ZJ5A 4AJ4A 3L8EA 3H6KA 1E62A 3KTFA 4JLUA 2G07A 3GUVA 3E9YA 4PPGA 5E6JA 1I6WA 3IUBA 3H5RA 3UGQA 4ER6A 1NN0A 3RF7A 2P2CA 4Z9AA 4YAUA 3CR7A 1C3VA 1L4MA 1X14A 4P3PA 2OQVA 4D7AA 4G4SP 1GABA 1W5EA 3VU9A 1G8SA 1VPDA 2AF3C 3WLMA 4U00A 3UHPA 3L6OO 4B3FX 1GG5A 3NT2A 5HF5A 2A6PA 2ZI9A 4JOQA 4QGBA 5G4LA 1YRQA 3PDHA 5A3SA 3HE3A 1SPBS 3RWBA 4DUGD 4B0PA 3CBGA 3GFQA 3GJ0A 5C1OA 3KSXA 1EWVA 2QRPA 3QVLA 5JW6A 4QRDA 2P9JA 1PBNA 5H68A 3KOWE 1G9SA 2G0AA 3JYHA 1PS9A 3ZK8A 5M7EA 2GM3A 2X9NA 1H4SA 4ENWA 4FX5A 2VK8A 2IIQA 5CEJA 4FBLA 3HKBB 1JR4A 5DLEA 4E3WA 1MB4A 1J2YA 3C1UA 1H0SA 3EF0A 1L9KA 4H0NA 3QI7A 3QXHA 4R6WA 1VEGA 2YXEA 4U2BA 3G8DA 3NWBA 1CDEA 1UM9A 2VXYA 4JLVA 5U1PA 4IEIA 3D3WA 4ZCMA 1P0FA 1OLUA 2VYNA 3DKRA 4Y9RA 5D3MB 4ZVSA 3T9BA 3TFOA 1HY3A 4O0LA 2AI1A 1KTVA 1CSEE 2A67A 2EFDB 2C92A 2HJRA 4QOIA 2PCLA 3GLGA 1II0A 3Q4GA 2OO5A 3ZH2A 3OJEA 1SR8A 4LV6A 4HEHA 4UVDA 5EXEA 3PWSA 2GEKA 2OCKA 1U11A 2V6BA 1LSSA 1ZBDA 2P2ZA 2QL9A 4PFJA 5HZHA 1KQNA 4G89A 4DADA 3K6KA 5D3MA 5LOVF 4FB4A 3CVOA 1ADYA 1DBSA 3UY4A 1IBRA 3LY9A 2Y93A 4LBVA 3BGOS 2GPBA 1RKBA 5F5LA 1KO4A 1F14A 4ZO4A 1E4VA 3WNQA 1D4FA 2AKYA 1HWYA 1R8XA 4CTMA 4QZVA 2ZVPX 5I6DA 3TB4A 1SXJE 4BOYA 1QO7A 4HLCA 5KPZA 2IUYA 4TV8B 1AV6A 3ROXA 1D6SA 5A9SB 1MO5A 4B7FA 3A3OA 4Q1VA 4TTAA 2JGMA 4XLLA 2OILA 5DMXA 1DV2A 1YA4A 4FYMA 5HM8A 4GKKB 3WV4A 4JVMA 1UPTA 1KAOA 3GLIA 3I32A 2B0CA 4UASA 5DN6A 4UREA 3PJRA 1E3MA 1KP2A 3THWB 1OH8A 3KVNA 4NSNA 1V16A 1PDWA 2ON6A 1XLWA 5IDYA 5TC4A 3TUZC 1PHPA 4RENA 2FK8A 2XDQB 5KAPA 3Q87B 2O3QA 1HDOA 3UN1A 4MPDA 1KI4A 2WF5A 1GQOA 2EBWA 2FN4A 1JLKA 2P11A 3RGWS 2JGLA 1TKAA 2ZJ7A 1JE0A 3GZ4A 3L1HA 3UO8B 4ME6A 3J7TA 2GKOA 2Y1CA 4UE3S 4TZKA 3W6ZA 3QWIA 2D7JA 3ROMA 3N5CA 2JATA 3ASYA 1S2LA 2WTEA 3Q8WA 1FRZA 3PQDA 3QFSA 1T3TA 2GEJA 4Q47A 5I45A 5KZMB 4QOHA 1A50B 1CUVA 2GCIA 4MW0A 3K6SB 1TU0A 4Q5IA 3RUIA 2D13A 1CVRA 1EDEA 3B9RA 1GL7A 3W79A 1U3FA 1YR2A 4U9HS 2FSVA 5K51A 1UINA 1J2RA 2Z2JA 1Z7YA 3T1QA 1VXOA 4BTVA 4YBRA 5COAA 5KNDD 3WNBA 1VOTA 1NM5C 2POCA 1EUDB 1XRPA 4B7AA 1GAXA 3LCVB 4RTNA 1F06A 1L6RA 3OEHD 3H5TA 4U02A 3W5HA 4NEGA 5TB5A 1CZNA 2AJDA 1IHPA 1L5FA 3H9GA 2REOA 2BGMA 2ZI7A 3F1LA 4KV9A 3RD5A 3LYHA 4DSTA 4RTLA 1OTXA 1A2BA 1RYDA 3AEUA 4NJEB 1QWSA 3NTUA 1NBHA 3RBVA 1UBTS 1QR6A 2PWBA 3DP7A 1RXUA 3RIXA 4G8JA 4BVJA 1SWWA 2F1HA 1JHZA 4EYOA 1ADGA 2C82A 3UWPA 4XA8A 3UPTA 4JJEA 2XBUA 3KOMA 3MNFA 1TMKA 1R5JA 2JAPA 1KDYA 4B5KA 4JB3A 3CQ9A 3SJ7A 2EJSA 4YP0A 5FTJA 1H2BA 3IAM1 2JLZA 4F84A 3T52A 2IHJA 2AF4C 3KQWA 3W90A 4DR7M 2IUSA 3I5YA 1QNLA 4HJRA 2CL7X 5DCUA 4L4ZA 4Y6RA 5IHPA 4KZPA 5IYZA 1WULS 1NMXA 2ZIEA 4UNSA 1CIJA 1R8YA 1PSWA 5KYNA 3BMOB 2BFWA 2AE1A 2PD6A 1T34A 4OQQA 4RA6B 3TAXA 3UCFA 4CLEA 2AFHA 1VPVA 5IMSA 3C1AA 3DF7A 2C9MA 4F4FA 3MJEA 2IZ7A 3NEAA 2GZAA 1NFQA 3B1XA 4FZVA 2QW1A 4HRVA 4JWKA 4QXAA 3T5CA 3LIPA 4HLQA 4LWPA 2JS7A 5ITTA 2B8TA 1W59A 4QNRA 4O1IA 1RT9A 2A5JA 4YUVA 2Z6UA 1JHUA 4WBNF 2IHBA 4MB7A 1P7VA 1P62B 3QTLA 3T5GA 4WFKA 4DAEA 3ZVNA 4XD7D 1IMJA 2A9VA 3WKEA 4X5OA 3VR3A 5JYEA 3T1YB 2PJUA 1C3OB 4YPOA 4JR1A 2JLVA 1QLJA 1SG6A 1SC1A 1XOIA 1R18A 2WJIA 2XADA 3E03A 1JXAA 1R6VA 4ZCSA 4FDLA 1ODIA 1CNEA 5IU6A 1QP8A 5DNAA 2PGLA 4RVCA 4DAOA 2ZSDA 3MFYA 1KA9H 1M6YA 5ICCA 2OXCA 4WOCA 2VUUA 3AR9A 1DDIA 3ILSA 4FHGA 5EQTA 5BRJA 2L7IA 3HXTA 3ZU6A 2DQKA 4EUSA 5EINA 2P0EA 3CNQS 1OX6A 3E58A 5DEIA 1IPHA 1KPHA 4DC1A 4RAOA 1W87A 4OGFA 2IUFA 2YIJA 4MGIR 3C7KA 1ULTA 1GR0A 1TYBE 1ZD2P 1A77A 3HHWA 4QWWA 5LB2A 5DMHA 4TTRA 1LK5A 5P21A 4ALLA 2BGUA 4A0RA 4DG5A 1FX0B 3W5AA 3GJ3A 1E94E 4OJNA 5AVWA 1EAYA 4YUXA 2DPGA 1JVBA 1D4AA 1WO8A 2FS1A 4MH0R 5J43A 1SVOA 4LYYA 3VJRA 1U6IA 5KVSA 1I7PA 1Q21A 3JQ6A 2ZJ6A 3DT9A 1HMPA 1UH5A 1F0KA 2H06A 5EPEA 1P31A 1W88B 1UBFA 2C77A 2HU7A 2UUOA 1S3SA 3EMBA 1DIHA 3MTBA 4HD8A 3C8UA 1NF2A 1OW3B 4UTRA 5JAPA 3F3YA 1E1RA 4BBAA 3GRAA 1XXHB 2VHTA 1K0FA 1BGVA 3L4EA 3V4FA 1C1KA 1E64A 2H4WA 1JKFA 1Y37A 3MINB 3OKCA 2BFDB 4PX5A 1N2CE 3HJNA 5FPSA 2ET6A 2ZS9A 3QMWA 3KJHA 2IUUA 3DOCA 2GNAA 5E9QA 2B6HA 1JG3A 2FUG6 3S1AA 4OJYA 1YI8A 4J4BA 4EW1A 1ZSYA 3V3TA 1EXVA 2AC2A 2P4SA 2QD3A 4JI4M 2WMDA 2VFAA 1INLA 3K4PA 4P36A 4N5MA 3AR7A 2P3OA 5I9MA 2WSYB 1ISRA 5NULA 3ZHRA 4CI0B 1JDNA 4B79A 1DMSA 4D3ZA 1FXUA 2FTKE 2XUPA 4MYTA 5IDVA 4CMAA 1NNJA 3ELYA 2VZEA 4NAHA 1M6VA 3H7IA 3GW8A 2ZVQX 5LKAA 1YRWA 4K9LA 3DHWC 2CZGA 4FNOA 1S4MA 3DBRB 1VG9B 4CQMB 1RI2A 3UOWA 2JKYA 3G9UA 1DC3A 1SUSA 3D0KA 3JYQA 3OJOA 1KFKB 4GR4A 3BK2A 3IECA 1RQ2A 1VHWA 3H6GA 3U4AA 1UQTA 1BGXT 2QZSA 1XROA 1DZ3A 1YQUA 4NOOB 1TIBA 3ASUA 3GFBA 4B46A 6AT1A 8GPBA 3ANTA 4XWOA 4E2FA 5B5SA 3C6KA 2RHJA 4MQEB 3K5PA 2FMFA 3DYBA 1G0OA 4GLLA 3I9V1 2YQZA 1EU1A 1LQ2A 5DK4A 1SOVA 4WCFA 2WUVA 5LDDC 3ZGZA 4K9PA 4LQLA 4QTTB 1VCMA 4L7QA 3CUKA 5DNWA 2HKIA 2W6NA 3BKWA 4WXRA 1JI3A 1NSFA 2VOJA 3I23A 1XNJA 3HMQA 2Y0QA 3TRHA 5F21A 5B3AA 1QC5B 3WKCA 4R3WA 1L7OA 2B7CA 5JCJA 2W2VA 5A5GA 1GNRA 2LVPC 4UMDA 3E27A 4HZIA 4MKFA 4QFDA 3QM1A 4JK3A 2EUCA 4X6YA 3MMPA 2G7ZA 2ID9A 1GJSA 1WD7A 4ZK6A 4GXRA 1GITA 1QXSA 1YA6A 3I6YA 3CGWA 5DV9A 3JWHA 4KSCA 4QM6A 1CT9A 2CRUA 1PL7A 2GD0A 3EQ7A 3SK0A 1K82A 3ZOKA 4CG1A 1H6AA 1ISPA 3MUFA 5FUBA 1QFSA 3AVWA 4MV1A 2Q5JA 3CB2A 4QUJA 1NHWA 4EKDA 1X1EA 3U3DA 3IC5A 1KDVA 3RREA 1C7RA 2O0KA 5JCJD 3GZJA 3HWRA 2POQX 2QHOB 4DW8A 3UW1A 1GVNB 1PZFA 1XTSA 4H4EA 5BNWA 1J2UA 1MR3F 1EXDA 1GCUA 2ZWOA 4FUTA 2Y6VA 4ZOEA 3KR2A 1D0MA 1WBBA 4P17A 3EQZA 1JT9A 1XTZA 5A06A 2V7QD 3P9KA 5K0JA 3N2LA 2A57A 3ZD8A 4E13A 2IWRA 4S1OA 5KQ8A 4J29A 1QP0A 4FQ5A 3R7AA 4GUAA 1HG0A 4M7OA 2D2XA 5LMUM 2CLLB 4B9EA 3S81A 2PUFA 1VP9A 1ECBA 4ZRMA 5JYDA 3DNPA 4J16A 1NV8A 1T0PA 3C4VA 1K5PA 4GBED 3UK1A 1IG3A 5EWJB 1RXYA 4CKEA 2HXSA 4YCNA 4KN6A 1IBMB 2ZRHA 2OM6A 2B4AA 4FFVA 4B2LA 1PG2A 4F9FA 1VBKA 3CVVA 4YT2A 4KK3A 2CCKA 2OCDA 4FMDB 3SC2B 3OP1A 3MEQA 3E7WA 4GKJM 1W2WB 4HN2A 4QPDA 1F0YA 5FWNA 5HKKD 1RC1A 3OCXA 3AVQA 3BE5A 2GBLA 1W0CA 3HZRA 3QWHA 4Q7JB 3SQMA 1T2DA 1XP8A 3FX2A 4A6PA 4IRUB 2FB9A 1I51A 1LTMA 4MRMB 2DAPA 4W1RA 1Q16A 4YQZA 1RVV1 2H3EA 1N5JA 3S2YA 4QARA 1HNXM 4QAJA 3J7AS 5GONA 2HQBA 1K3XA 2NOAA 3UJAA 2O8FA 3BH7A 4XRGA 2PKQP 3BSWA 2F8LA 1XQ6A 2Z57A 5LQRA 4DOMA 3RGPA 2A1UA 2R79A 2CXNA 5EQDA 1M7BA 1VE9A 2ZDGA 3FOAA 3AUUA 4YGXB 5AICA 3TAUA 1JTFA 1XNQM 2GN1A 3IS3A 5CX1A 1WMEA 2CW5A 1J2JA 1O1YA 3IHWA 4YI5A 3CIOA 4GPBA 1MRNA 3U6DA 3FMPB 2AQ8A 4OOEA 1VMAA 2ZRNA 4MVYA 1MABB 1T5OA 4MRAA 4EGCB 1QHFA 3KJIA 4M46A 2UYCA 1I4LD 2B9EA 1T6YA 1WX1A 1VP3A 1ETHA 2J3DA 1KO8A 1MA0A 1R0BA 5EI5A 1QZUA 4CL0A 4DDHA 4ZGWA 1IFYA 2YINC 3CUSA 3C1OA 1MENA 4AJEA 5A3VA 3EIHA 1IZ7A 4AM8A 3ETCA 2CNOA 3KJNA 2QP3A 4R2JA 2BGLA 3GH3A 3QU5A 5CPFA 5HUJA 2F4VB 3TINA 4C0XA 1L8OA 4PRLA 4H3KB 2V55B 4ZAXA 2HMYB 4LOHA 1K6MA 4OHFA 1KR2A 4R84A 5HMLA 3WQBA 4CTNA 3HY5A 1USVA 3G5MA 3HFGA 4CMEA 2QL6A 4UBMA 3S2SA 3L1KA 2C0QA 3A1CA 2WPDD 4BZQA 1WOYA 1QLWA 1K08A 1TQ4A 1W6UA 3ANXA 3B3JA 4NXMM 5EAIA 3GPYA 4AICA 4E4RA 1Q11A 1IEXA 1NLUA 1FUEA 4X7BA 2O20A 4J0JA 1ZSVA 2R7AA 3JTEA 1M67A 1YI1A 3K5WA 2O57A 1U1GA 3CLVA 4OBEA 4Q4AA 3O1LA 2E4XA 1UM8A 1D0IA 2GQ0A 4UJ3A 3VU3A 4ENVA 3QSYA 3ZCXA 1V96A 2H1LA 3Q5GA 1G5QA 4EARA 5K0CA 4H7IA 5FOSA 3QXJA 3Q1LA 2XB6A 4LCBA 1N0VC 3IEIA 3LSYA 1K5GA 3AV0A 3NP7A 1XF1A 4IUYA 4MVXA 4H7FA 4NYMQ 3X2FA 3QYBA 3OZGA 5IK2D 3DMYA 1XPJA 2OHFA 3BC1A 2NVOA 3TTYA 3PC6A 3C3JA 4REZA 4OYRA 4X00A 1RHRA 5K4GA 1VSBA 3UKOA 1MRSA 2ZR0A 3NEJA 1P2DA 4LE2A 5DYNA 5JRDS 2HHAA 2PLRA 4XAQA 2R97A 3LI2A 1NONA 3OFJA 2AFHE 4GWKA 4JDUA 3TDMA 1TLTA 3AJ9A 4KDEA 2WA1A 4M1QA 1L4EA 4O2BB 4PZAA 2LXEA 3WYFA 3ZW7A 2CN1A 2BGJA 2V0GA 1OSNA 1F4IA 1A82A 1ZA2A 5BY2A 3Q3CA 2A4KA 2J3HA 4JY7A 4UUQA 2W11A 1MX1A 3OQ1A 4KXWA 2NLOA 2V6FA 3B5EA 3AIKA 4YCDA 3SVTA 1XPRA 4JYAB 1JPVA 5CA1A 2W8BA 5K09A 4REQA 4A8JB 5KPRA 2JRCA 5ALMA 1O87A 1DBRA 1HA3A 1SCJA 4QBHA 1M2OB 3WLSA 1OPRA 2YUIA 1CYEA 3FG9A 4OBBA 4NU6A 3T4XA 521PA 4R9SA 4LDAA 3N2ZB 3RROA 3A9VA 5JFOA 3D1VA 4X6LA 4KR2A 1FDRA 3TLGA 5FRDA 4FK8A 3RSQA 4BXOA 4JJ4A 1MAUA 3GB9A 2UUCB 1UC4B 1ECFA 3DAFA 2ZT6A 2IC5A 5I4KA 1WLYA 5EXXA 1VHDA 3CNNA 5EHXA 3QIAA 1RJFA 2EFGA 3AUXA 3ZC7B 3KQVA 3W6OA 1ESMA 4NBWA 4B3XA 5HS4A 5JJCA 3P2MA 1XMQB 4NABA 1ZJ6A 2E21A 3BULA 1U1CA 4NS1A 2I7NA 1ZK4A 2K4MA 3WYBA 1QRRA 2F5PA 3DVRX 2FMHA 1FY2A 2YWBA 4OHRA 2ATXA 3VK7A 4UTNA 1PQYA 4GC5A 1RZVA 2FN9A 3OI7A 1I4EB 3A4IA 3TOSA 2IE8A 2H1WA 1NUSA 3O4VA 1J2EA 2L6OA 4DV1M 2F17A 2ZM6B 4D45A 1WG8A 3PXUA 1QYVA 1E2IA 3JQDA 4WFJA 1Y6ZA 3IT1A 3X1YA 1HYEA 4NKRA 5J4YA 2WQ7A 3G5AA 2IS4A 3IKMB 2HSEA 4JSTA 1O6FA 3LW7A 1N1MA 1SHTX 4J0DA 5E9JA 5IBRA 3WO0A 5C81A 1XNRB 3PGKA 4INZA 3WZLA 3T9EA 5TGZA 4DEYA 3C1TA 2I62A 1AGNA 4LYGA 3S7ZA 4N76A 1XL1A 1HDGO 1NXSA 1H94A 4IOMA 4X8LA 2X7HA 4FGLA 3NUGA 5JZSA 3K0AB 2QTLA 4JP1A 4OYLA 3LX4A 4MH0E 2DAIA 4M8NE 3UK0A 4FWHA 1BMTA 1Y89A 3GBPA 5E6RB 5E7MA 4A2CA 1JAZA 3W5JA 4M49A 4JKIA 3RANA 4JX8A 2WYVA 5IC6A 2IS6A 1EHYA 3HWX1 1JHYA 2W2TA 1JPUA 1JQAA 1WQ3A 1Z5WA 4RFSB 4RQUA 4TLDA 4U7TB 3HN6A 1YS6A 4ZT5A 3TRJA 3GARA 1WEHA 3MTEA 3IEVA 5FI0B 1HFEL 1VI5A 2CWDA 4MGEA 5I8WA 3IHTA 2GPYA 1JQDA 3OIDA 2XMPA 4P3KA 4YREA 1MOQA 2YWDA 3LOUA 1O2DA 5HIMA 2CXQA 4BMSA 3KZMA 1TC2A 2YHBA 3JY6A 1BDJA 1U0TA 3K9HA 1T5LA 3O91A 1DIRA 4JITA 4YBZA 3A70A 2DWZB 1NX9A 1CS4C 1KAMA 2I87A 2H7YA 1JNXX 4F72A 2G36A 3UGTA 5WRFA 4LOIA 3MMNA 1FFXB 4EA6A 3O9MA 4RK0A 2HPVA 2PGIA 4IDEA 3IUPA 4J76A 3KOOA 3T0GA 3HP7A 1NLFA 1TQHA 4L4SA 2Q2QA 3GRYA 2R60A 2WW8A 3TVYA 1V33A 4G2NA 3SVZA 2FPSA 2I7TA 1EP1B 1E7SA 1FS6A 2EDCA 3MD9A 1L6IA 4MQLA 1HSOA 3OO1A 2HY7A 2E89A 3T5BA 3BH6A 3V2HA 3WIUA 4Z7QB 5JMWA 2PZLA 2RC5A 2Q62A 3DAYA 3VOTA 2NIPA 1EWQA 4XWAA 4EF6A 3GX1A 2X8AA 4B7GA 2UVDA 2R6AA 2X5KO 3LU1A 3PDWA 1H3EA 1D0VA 1J8QA 2F3PA 3CWZA 4HGOA 4K9DA 1UZAA 4KQJA 5JSYA 2K87A 1QQWA 3ACCA 1Y4ZA 4YAOA 2XB8A 3OJCA 5LP6C 4MI9A 3GEBA 4ITUA 4QEKA 4OJMX 4RPHA 3JWGA 5D5PA 3RUFA 3U48A 4EKIA 3VNVA 4BFYA 2F43B 5IREB 4URZR 3UJ3X 1YONA 3KOXE 3CEHA 3COYA 2BSXA 2FWMX 5K1ZA 4BV9A 4WUVA 2VAXA 2RGNC 4RHCA 4P22A 3OOSA 3NNDA 3O84A 1IN1A 5DM2A 1H66A 3A4LA 1JMKC 3O2QB 4HO1X 3H4MA 1WB6A 3A04A 3X1KA 1PR4A 4IXWA 3KBOA 4QSHA 2H11A 2ZBFA 5KOYA 2R9VA 3FGNA 1WDLA 3VU9B 9GPBA 3PC8A 1OV4A 4G0UA 1PBTA 1AKMA 3L9XA 4KEAA 4Y2GA 3TLCA 4TKUB 1NSTA 1ECJA 3OX1A 2WZJA 4BX9A 1G9XA 3EEQA 4YAEA 3SLKA 1EI9A 2JAUA 1AG9A 3PRJA 3VHXA 1R4NB 2JVJA 1UT5A 4IMIB 4M8SA 3URMA 4LXUA 1FP4B 1ZYUA 2CB9A 4LJ4A 5G02A 1IMOA 4Q3OA 5JFGA 4JI6M 4E6PA 2OOBA 1M76A 3QXXA 4NRDA 4BMOB 3OPQA 3RQSA 5AR1A 4TTVA 3FOBA 3RQIA 2DHRA 2WHRA 3O8RA 2RGYA 2FQWA 3F6EX 2O2IA 2ZYAA 1CZLA 1GNQA 2HUNA 5DNYA 3D81A 2ZRJA 1ULUA 1DX9A 1OT5A 1MJHA 2I71A 2J67A 3O8OA 3K6JA 3QKWA 4L27A 5K6AA 4QL3A 4RHYA 2WSIA 2V7PA 3P19A 2XMBA 2PMEA 3VZSA 2HSJA 3BRQA 2NZUG 4BDTA 5L4SA 4RV4A 3PQ7A 2PH1A 1NHGC 5L8VA 1U28C 2WG0A 3AWIA 1LI4A 1FU7A 1MC4A 2XVAA 4WCDA 3S8YA 4B87A 7REQA 3OAAA 4ZCLA 4N3AA 4WZBE 1U63A 1J9GA 3PFIA 4K0RA 2G88A 5D6NA 3IULA 2C84A 2G6BA 5BWOA 1O08A 3JW8A 1NVAA 3ND6A 2P6RA 3DTNA 1NVFA 2Q4TA 3EXHC 1B16A 2C3OA 3ORFA 3QU7A 2X6QA 1ZKMA 2WILA 4ETMA 3KFVA 3O5AA 1XRRA 3EASA 5LBUA 1XC7A 4CPDA 1CP3A 1RHQA 1ISIA 1OXTA 2QORA 1J00A 5FV7A 5KOIA 1T6XA 4XTRA 2RH8A 1XZMA 1TO1E 1D6MA 1P61B 3QQ5A 4MQFA 1PWXA 4PZZA 1UFZA 2JWSA 4DR7B 1NVMB 4ZJUA 1T5SA 5BNZA 1NPTO 5I4CA 4XYGA 2G5GX 1BN6A 2WM2A 3PT9A 5JS2A 4L4UA 3STHA 3BK1A 3D6TB 2CFCA 3O9ZA 2VDWB 1NRIA 3AM1A 4I46A 1T4CA 2LCQA 4R68A 1GNVA 1PP4A 1W48A 3G0BA 4B08A 1TE2A 1JKJA 4O2BF 1F8FA 2Z2KA 5T57A 5IZCA 3DBIA 1QGAA 1NFRA 4P4NA 4CG3A 5ADWA 4MV0A 4HBGA 4Z5XA 1UKEA 2P6OA 3CVJA 1G38A 4RL4A 4N8EA 2H0QA 3IALA 5KX5A 1SIWA 1ZIPA 3LUFA 4EMBA 4EZEA 4IBBA 3TUJC 4OXIA 4CI9A 5KJFA 2RE8A 2FPIA 1TMOA 3IERA 4DR5M 1ZPDA 3IJPA 2H85A 2QLBA 4QBIA 3CU5A 4HLUA 1U2GC 2O14A 1DKRA 1XAGA 3HUUA 3DS8A 4G1CA 2X0EA 3WIEA 5IWAB 3BD8A 1C3JA 5ALYA 1J9ZA 4WFIA 1AD2A 1A8PA 1L5OA 1X7GA 2ZWPA 3VH3A 3VDRA 3P2IA 5HTKA 4C07A 4QDKA 1BKYA 4PSUA 5DHUA 5I7FA 4OB8A 1FFYA 3I04M 2YC2C 4O4JB 5C9ZA 5M34A 3DO8A 1EFCA 3KTAB 2VQEM 1U8XX 3CG4A 4Q1EA 4ZXPA 5TDHA 4ZYYA 4PZPA 4XWWA 1QG6A 2GXAA 2AJTA 2G6TA 2V45A 4P7KA 3EH2A 3U7QB 4PQGA 2GPJA 3N2GB 1R6TA 2F1RA 1H8EA 4INAA 2O5RA 3PEEA 2JCXA 4FIDA 4MVJI 1QORA 1YA8A 3GLIE 1XB2A 2Y1OA 3JQAD 4HAYA 4MVJD 4WI1A 4LE0A 2G8NA 5NLLA 3T41A 3WHLA 4ZDIA 3FDIA 2ONKA 3DDNA 4DBVO 1XRLA 3TECE 1C2TA 1MO4A 1P5RA 4EY8A 1QTQA 4M7RA 1CHDA 1E4OA 4WN3A 3S2ZA 4PSCA 3L8GA 3ZK7A 1E4EB 2ZS8A 3LWNA 3WZ2A 1CRWG 1VHJA 1JHRA 4E2YA 4L51A 2FJPA 4TL9A 1V43A 3H99A 4I55B 3SBJA 2A3NA 2J08A 1G7SA 3M4YA 4AU1A 2X8JB 2L19A 1FBNA 1HUQA 3P52A 1UPAA 4HWRA 4L5IA 5ITVA 3VPDA 4G81A 2PRZA 1CERA 4I2NA 2BT4A 4XGIA 1CUXA 2VSQA 5E4YA 4JC4A 5EJ2A 3T3MB 1D4OA 2WZQA 3IUYA 5I4IA 4KQHA 4LOAA 3ZWCA 1EUDA 4AXXA 1ZVQA 4QE3A 5K0SA 3VR5A 2KLHA 1M2FA 3ZNNA 4RD2A 3TB6A 3QE3A 4CUZA 2J9ZB 5ITUA 3QPAA 3WNCA 3CR8A 4HMPA 2FPXA 1IVYA 4X85A 1OLSA 2IYVA 1Z4JA 3QBJA 1BHJA 3QEMB 1CRPA 4OVZA 1WQ1R 2G04A 4L8WB 1HFJA 3MELA 1TTHA 1MB0A 4J9VA 1NBEA 3F49S 5IJWA 5HA5A 3G8YA 1V7CA 3RJ9A 2XYQA 1VLZA 5CB4A 4LXHA 1NFFA 4AC9A 4NE9A 3RARA 3RC3A 5KYYA 2HREA 3SBOA 2JGRA 3ETGA 4GMGA 4EUFA 3ZCSA 1U81A 2XEXA 4OHUA 3PHBE 1M33A 2EFHB 1QH9A 1QGZA 3LS2A 4OTZA 1T5BA 1GAQA 2Y6UA 3QMMA 1QP7A 3MFQA 1PEYA 4K1LA 4Q05A 3X1JA 3THYA 1PKXA 2P1ZA 4QDUA 4B2YA 3Q8GA 3JQPA 4W9NA 2J07A 4XKJA 3NKVA 2XUZA 2PJDA 3K2QA 2WA2A 3ZE9A 5ICEA 2CVOA 4MDFA 1JSLA 5J2UA 1IM2A 3DAGA 1RRMA 2P5TA 2AV6A 1N2ZA 1YJCA 4ZJYA 1O4WA 4C5AA 2JH8A 1JU3A 2GUGA 4YAJA 4AULA 4X6UA 3HL4A 1VPLA 2RHDA 3B9QA 4MV6A 3DR5A 4NMWA 2EW8A 3VJLA 4E1AA 4EVIA 5JS6A 3EEOA 1PV1A 3DQQA 1PNRA 4FLFA 1OILA 4N3NA 1RWVA 1XVLA 2VJPA 4IDCA 1HTTA 4YJKA 2OGZA 2VZ0A 3Q40A 3CF4A 3T06B 1RTKA 3FHTA 2BM0A 1N7HA 1DX4A 1TK9A 2WM3A 3E23A 4ONEA 1X1AA 1NMQA 4IF6A 4MGKR 4ML3A 3ROKA 4AJKA 1MV5A 4DUYB 2G76A 4RHFA 3N05A 3FGPA 1KMHB 5B7NA 3G0CA 4AJ9A 4CMBA 4IY1A 4TKVB 1AUPA 1BA3A 2FXIA 4EGAA 1UMKA 1Q2UA 2VVTA 3W7AA 1RXVA 1EE1A 1VHLA 2IEDA 5CHYA 2SKDA 3SSOA 1Z0FA 1X7YA 4JZKA 5L9AA 2C7GA 3ZW9A 1SZJG 2J9FA 3FPEA 1PL6A 3ZZ0A 3P2OA 3VR6A 3OLXA 121PA 2B20A 2HWKA 4ON9A 2VATA 2VNSA 4OU4A 1ACJA 3AJAA 4EHFA 4OK6A 3SF8A 1PQUA 1FP2A 1K9SA 1W36D 2EBUA 3DLAA 2BBOA 1T4BA 1QYRA 2PT6A 2QYSA 2ZWAA 3EIXA 2IXEA 4I6GA 5DNDA 3SXUB 3PX2A 3ZJYA 1KNQA 4HKTA 4EB6A 1JFSA 2G71A 3W5UA 3DBHA 3LP6A 1BHQ1 4DJDC 2DX7A 4YT5A 2O8CB 1P1RA 4S35A 2IDMA 1HDEA 1K68A 3I6IA 1JBEA 2IKSA 4JNKA 2CJYA 3O6VA 2GLTA 1B0ZA 1EX6A 3EODA 3HSYA 3MF4A 1X1SA 4HZUA 1KYZA 2EIXA 3CSDA 5FPHA 4TTIA 1LZKA 1XJQA 1T5TA 1IEQA 3K1JA 3KD3A 5A0VA 3WLEA 2M2IA 1I7QB 3TSOA 1IHDA 3JYLA 1YQEA 1FQKA 1UJ6A 1ZGGA 1JFFA 3F6BX 2CT8A 1DL5A 1LLUA 2P6UA 4PHCA 3VO1A 2JIDA 3VJKA 4GBGA 4X1IA 4BIIA 2VPPA 3BBPA 2FSSA 3PPVA 3OTWA 2CFIA 3L7LA 3KRTA 4HTFB 4ENUA 1JYEA 5DIZA 3EXEA 3GV0A 1GU0A 1Q1QA 2PQ0A 1P3JA 2Q6VA 1O97D 4FWGA 1GTMA 1RPNA 1FLVA 3PNYA 4FEAA 3UK7A 2NT3A 2WSEF 4I8OA 2WU3A 4KWIA 4RMGA 4X20A 1TVMA 4ZALA 3RT7A 3UBMA 1UAYA 1YBHA 2PUCA 3PLAE 5JRJA 4I36A 4U2GA 4P5DA 2DPXA 1SUWA 5HJ7A 4CUJA 4NAVA 3D3WB 4ZVOA 5EN4A 5KVQA 4ES6A 1XNQB 4Y9DA 2PMWB 1D5WA 3HEAA 3L3BA 1X87A 5F73A 1W44A 3L0PA 3PFHA 4RF3A 4CQMA 5CFLA 4BN5A 4E2XA 3E7PA 5HFJA 3CHYA 1NVMA 1KY4A 2XB4A 3DNMA 3CLUD 2NNLD 3U31A 4QJ3A 3HK2A 2P5UA 1NRJB 5JCPA 4KL8S 1N2GA 3GPXA 4D96A 5JRZA 1G6HA 2W48A 3KNZA 3UFXA 1A5BB 1E7WA 3JWIA 1WHSB 3KE9A 3P9IA 1A1SA 2CGEA 2WU1A 1FF9A 1VBFA 3JQ8A 1BD3A 4YRRA 3BZBA 1HM5A 2WAOA 1C3XA 3OZAA 4HDAA 1R2ZA 1NN1A 5CYFA 1Y5IA 1YVPA 4P58A 5DCWA 2V96A 2PEZA 1GUAA 1CJKC 1YQQA 2ATIA 2Q4RA 5DM70 4JYZA 3A9UA 4ND1A 4KPYA 5CT4A 4V0NA 4IO1A 3V48A 4FM9A 2N35A 3IIMA 2QP4A 1GO5A 3GBVA 2UVQA 2XQFA 1A5ZA 1T9CA 4Z1OA 1H3FA 5AK5A 4MMZB 4BGDA 2ZFUA 2YFYA 4Q02A 2IPNA 3N86A 4N40A 5AHWA 1WNTA 2P27A 2PGJA 2FNAA 3AOGA 5CCXA 3FHLA 4BLVA 1KZYC 1ZWLA 4IIYA 3TW8A 4H1UA 5A05A 4YO7A 3PC3A 2O1SA 3GCDA 4HQLA 3IOYA