4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
b'PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fidgetin-like protein 1
publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
1QHHB 1ZCAA 2ZIAA 3S1AB 3VMFA 4B33A 3K0CC 4EFNA 1Z08A 2Q9BA 4PPFA 5DI3A 3THXB 2RH5A 2QAGA 1XPOA 1CJTC 1L7VC 2JA1A 2V9PA 3B9QA 4PC3A 1XMVA 3WMEA 2WM9B 5AJZA 3BK7A 3LFUA 3RNLA 4D0GA 3LH5A 3O8RA 5EP2A 1C4OA 1NBMD 2CK3A 3ASYA 2HT1A 1YRAA 4YDSA 2BKUA 1Q0UA 3CRMA 1O3YA 2VP5A 5AJYA 1SXJB 4TQUS 5E3HA 2JLQA 3ZVLA 3Q9LA 4PHTA 2IA5A 2YYZA 3AVXA 3AM1A 1Q12A 4P4SA 1EWRA 2WWWA 3NWJA 3N2IA 1AQYA 4Q19A 2N46A 2EQBA 3VR1A 1RVDA 4FW9A 2G1JA 3VKHA 4TL7A 4BLTA 4WOPA 3PITA 4MUAA 4HI0E 5HZHA 4FCVA 2FZ4A 3O47A 3NBYC 1F2UB 3CRRA 4H1UA 4PX9A 1G1MA 4TL8A 3GLFA 4L9WA 2REOA 5FUWA 3C8UA 2W83A 3P26A 3SFZA 3Q72A 3RRNA 3DEFA 3LQRA 1KI3A 2YWFA 4AD8A 2AFHE 2MMGA 4YQFA 5EXTA 4DT1B 2B7BA 2ZRHA 1OIXA 4MH0R 4Q1BA 4QBIA 1R8SA 3EPLA 4XTCS 3A1UA 3KB1A 5CYOA 3H86A 4GZLA 4R9UC 3AVVA 1U8YA 5D3QA 4DLRA 4B47A 2PLRA 5CB6A 3QXXA 3KFXA 3LBHA 2GNOA 5DHAA 4UJ3A 5AJWA 2W6JA 4L9SA 1Z2AA 4W9MC 1N0WA 4OHXA 3T34A 3K0AB 1UAAA 4ASUA 5JMTA 2CHGA 1QVAA 2OCYC 1F2TA 1HURA 2H7VA 2Q3HA 3AQ4A 3FMIA 3OEED 3R7WA 4YC7A 1SVSA 3REFA 1RKBA 2B21A 5EE5B 2YKGA 4HLDA 1NKSA 4Y0VA 1PUIA 2EWVA 4K8OA 4TLEA 3C14C 2Q21A 2CVHA 3EX7C 4ESHA 5F9FA 2GJSA 5JS8A 3NDBB 4DUGD 1DELA 2AXNA 3QKUA 1I4DD 4S35A 2OUKA 4ILEA 3RHFA 3VLFB 1AA9A 2WPDA 4WW0A 1XFAA 2R62A 2QBYB 3O8DA 4AWXA 3QF7A 3FE2A 1KOFA 5J4KA 4N0EA 3RSOA 5GVSA 1NY6A 1E2PA 2GVDC 4B2PA 4TWZA 3WXMA 3GLGB 2EYQA 2R6CA 3QI2A 4JT2A 4QGFA 2AKAB 1R0YA 3K9GA 1T9HA 3DKPA 3V9PA 1EX6A 4YLGA 1Z28A 4DSOA 2VP2A 3LO5A 1B0UA 3X1ZA 2IYLD 1II0A 1R0XA 2QE7A 3LA6A 1E2JA 4Q01A 2QP3A 4C2TA 2IYRA 2AHOA 2P3SA 3C16C 2NO1A 4M1SA 4UKDA 4CT4B 2QN6A 4PXAA 3WBJA 2ANBA 5GVRA 4Z8XA 3UG7A 3I61A 3BH7A 4G5QA 4JLBA 3I4LA 1XMJA 3WBKA 3GJXC 3TAUA 1CULC 5JFGA 2PZFA 3UMSA 2OLKA 4MDFA 4QNMA 3EXAA 2V6JA 3K9NA 3WHLA 4LJ4A 1VDZA 2W0MA 3PEWA 4B6EA 1G3MA 1AKEA 1CR4A 1UDXA 4JL8A 4CEJB 2OAQ1 4C0HA 3QKRB 4NCHA 4NYJQ 3U7FB 1W4BA 3P27A 1ZD1A 1KK2A 3EARA 4AYXA 3LY5A 4RKEA 1FTSA 1G7TA 3R9IA 4I81A 1Z6AA 2DFLA 2IYSA 1OHHA 1E79D 3K70B 3AVWA 1W0JA 3ZQJA 5DN6D 2ZU6A 1P4SA 5TB5A 2VP0A 4EFMA 5J5CA 1IHUA 2WKPA 4JVLA 1IN5A 4L8GA 1XEWX 1KAGA 4BUJA 4E07A 1Q20A 4FCTA 4YMWA 1JJ7A 2JIZA 2ZR9A 3LQQA 3MWKA 1E4YA 2AWOA 1Q44A 2F43B 2YJTD 4G0NA 3T1QA 4XVUA 4FCWA 2ZJ5A 1IY2A 2ZSEA 4CRWB 1BIFA 3WYAA 4Z51A 2NO6A 4QGGA 2ZYWX 1E69A 1WE2A 3EPKA 4A36A 4DEXA 5HE9A 4NCIA 1V43A 4C3ZA 2V6ZM 2A5FA 1IN4A 1KK0A 1FUKA 1SVOA 4FWIB 3QENA 4JLMA 4G5SA 4TYPA 4BLRA 3CF0A 3FGNA 2GAOA 3GLHE 3ZIAD 1R2QA 2EFEB 2GJAA 2HLDA 2XOKD 3ADBA 3W5IA 4IVPA 2J5XA 1YZTA 2ZRPA 1CJVC 2JASA 1BYIA 1L2TA 2BEKA 2IUTA 3ZDQA 5KNDA 4LOAA 1Q57A 4NYIR 1T3SA 3W8NA 2RHMA 5FUVA 5LB4A 4DSUA 4HB0A 1CRPA 4KITB 4FI3C 3U61B 4KI0A 3UWKA 3EZFA 3FFBA 1CKEA 1COWD 2P6NA 2F1JA 1SVIA 1A1VA 1WRBA 1S3SA 4HYYA 4Q4AB 1E6CA 3KL4A 3K09A 4QL3A 2GZHA 2QG6A 3FPAA 5LB2A 3TAHA 2IYZA 1ZC4A 1XEXA 2ASEA 1U2RA 4TT3D 2IWRA 3Q7QA 4BFUA 2O0KA 4D0NA 2ZRBA 4OHWA 4NONA 2FDCA 1K8RA 3BOSA 1XD2A 5TMPA 3GFTA 4HLUA 1OXUA 1OFHA 1E96A 2GEVA 4HAUA 5BN3A 1W5SA 2WHXA 3RC3A 1N5JA 1XPRA 2E1RA 2DZNB 4DCUA 2O8EB 1VHLA 1W4AA 2VQSA 3MFYA 4Q1DA 4UJ5A 4W5HA 4EPXA 4IOLA 3ICQB 2ZVQX 4ARZA 2HXSA 1PLLA 4HSEA 5C46F 1P75A 1QHHA 2NMVA 3PEVA 2GCOB 3BERA 1LS1A 4ZCIA 3BWDD 3S1AA 1P2TA 2R6AA 1YRBA 4F93B 4KODA 1Z0DA 2BM0A 3THXA 1SULA 4XVQA 4DLWA 3SBDA 2ZI5A 1Z6TA 3T35A 1GKIA 2J9RA 1KSGA 2AR7A 2F9MA 3NBZC 4AKHA 3TGPA 3IPXA 4FINA 4C0LA 1VG9B 5H68A 1WDTA 1G3IA 1NNEA 4MRVA 1UBFA 2OESA 1LVGA 2YC4C 1NRJB 3UKDA 5LPNA 3W9YA 1PUJA 2G1KA 1SXJA 1JALA 4M0LA 1DAHA 1ZNWA 4PR0A 3TRFA 3H1TA 3DL0A 2PBRA 3SR0A 4IDPA 5BQ5A 5GJBA 1SZPA 2MMCA 721PA 2EFCB 1G19A 2AFIE 1UM8A 5BWMA 2BBOA 3RWOA 3FFAA 4F91B 1GRQA 2KBFA 2KRKA 4QFMA 5DHFA 3Q5DA 3AP2A 3K0SA 2ZEJA 1KI9A 1KDRA 2JJ1D 4PAMA 3DOFA 1G6HA 2QM8A 3OEHD 1GAJA 2EWWA 3TUJC 4JLJA 3C41J 4RD0A 2ZRGA 4Q9HA 4JLPA 3U7EB 3THYB 2HLDD 1IONA 3B1VA 3RS0A 5BXQC 2EFDB 2XITA 4CEIB 2WWFA 5E7IA 5EXSA 1EFUA 5BN5A 3G0HA 1XTQA 4R7ZA 1HT2E 4LYAA 4HAWA 1N2CE 3SYNA 5EQTA 3KQHA 2CNWA 2VYFA 1FX0B 4UXHA 2W2XA 3PENA 1TNDA 3ECCA 1RYFA 2IWHA 3Q3JB 3DOEA 2J87A 4JLDA 2V55B 4D4KA 3IBGA 1OFTA 1GITA 1TQDA 4PQRA 5JJKA 1W47A 5AUNB 3U4QA 5EP3A 3K0AA 1OH5A 2QSZA 4P33A 2I3BA 4GOXA 1DTSA 1WBBA 3PUZA 3GLHB 2IYYA 2J41A 1S1MA 3CF2A 3UXMA 4BFSA 2HJVA 4WZBE 4OYHA 3QIAA 2QROA 3LRPA 1GWNA 1ZYUA 4NCKA 3CZQA 3B8HA 4NMMA 5IRCD 1G9XA 2GCNA 1GM5A 1NLZA 1WCV1 3AF4A 1DAIA 4YMSA 5JRZA 2VP4A 1VCMA 4CYMA 5SZIA 1G7RA 1W5TA 4QHYA 2QBYA 2WICA 3VTKA 1P72A 3MUFA 4EDHA 2ZSDA 2OBLA 2I1QA 4MKHA 1NMYA 1KZGB 3MWLA 4IVQA 2X2EA 5FOWA 3VU9A 1E0AA 4LYFA 2O8FB 221PA 4M4SA 1J8YF 1JEDA 3GLGA 1F6BA 2GRJA 3HP1A 4LX0A 1G7CA 2QSYA 2AD5A 4TYQA 2PL3A 4WIAA 4MYTA 1XJCA 2QQ0A 2ZRLA 3RRZA 1VCIA 3ZGXA 2XAUA 4WZ6A 4BLQA 3SI7A 3KJEA 5FTLA 3WNBA 1VG8A 1KAOA 3EIEA 1TQ6A 1P61B 3CW2A 3GLFB 4K46A 3L0PA 3FB4A 1YVDA 4KFTA 4DLUA 1HT1E 2NIPA 2F3RA 3DM9B 4URUR 4II7A 1TAGA 5KPJA 1CBUA 3ADCA 3RRYA 4JL6A 2ZRMA 4HAVA 3NTUA 3LVRE 3K0CA 2H17A 1FQJA 1DAGA 5CITA 2X77A 4QRHA 1ZJ6A 4BECA 1IBRA 3PEUA 4PHHA 3TSZA 3B6EA 4J0QA 2YOGA 1GRNA 1JPNA 2CCKA 5AWFC 1E2DA 4G1UC 2DYKA 3L2OB 3SN6A 1XZPA 2FF7A 2XZPA 1RIFA 4BLOA 1WF3A 3QKRA 3R8CA 3U6KA 3EZ6A 2XB2A 5FBWB 4CGZA 1TL7C 2A5JA 5AUQA 3EA5A 1NMZA 3QPVA 4TMXA 2Z5FA 3KQNA 2GEDA 1C1KA 3AUYA 3QF4B 4C4PA 2GK6A 5HTKA 5B2ZA 2L0XA 1E32A 5LBIA 1OFUX 5DLQC 4YDHB 4WXPA 3BH6A 4GFDA 4Q1FA 1C9KA 3UANA 4RZ3A 3L8YA 1YZKA 2XB4A 3EZ7A 1E9SA 1DO2A 2F43A 4LI0A 1X6VA 1NN1A 1K6MA 4G5OA 1T0HB 2ZI6A 3BD9A 2PH1A 3BGWA 3AP3A 2H18A 5K8IA 2GVZC 2JLRA 2XSZD 1HEIA 3E5HA 4OK6A 1DO0A 3CX8A 4DLYA 4MYUA 2ZE7A 2BCGY 4NU0A 1P9WA 1E9CA 3V00A 1KIMA 4PFSA 3VR6A 5J4LA 2ZITA 2GEUA 4TLDA 1D5CA 3B1WA 3KUDA 3P20A 5E95A 2JLYA 1MV5A 1ZM7A 5JZVA 3CWZA 4O2RA 4H1VA 1J2JA 1K5DA 3GQBA 4P4UA 3U3OA 5TY0A 4V0OA 3TKLA 3CONA 3OIVA 4RFSB 1NSTA 4RSGA 5HKKA 3DZ8A 3CB4A 2JJ2A 3SEAA 1AM4D 1D6JA 2WWIA 2AD1A 3CNOA 4FXPA 4X8MA 5HCNA 2PEZA 1FTNA 2C8VA 1T91A 1OIWA 4Q4AA 4NE2A 2OFWA 2HXYA 1N0VC 2ZREA 2NTYC 1X8LA 3FMOB 2D3WA 2GF0A 4AC9A 4ZI2A 5L3QA 4QXAA 1EFCA 2FEMA 2P5SA 4D2IA 1Q1QA 3KKMA 3I1FA 1XX6A 4M1WA 2YINC 2ZPTX 5HCIA 1DG1G 3QBVA 3AKDA 4NYMQ 1FW6A 4JYCA 3DZDA 1H65A 2H1LA 2V4ZA 4IVRA 4PPGA 4RD1A 3K8YA 3A6PC 4HZUB 3FTQA 4IDHA 1HQCA 3C5HA 4JN6A 5TVKA 3TSOA 2BV3A 4TL6A 5KOYA 3A1VA 2QP9X 3FKSD 4DB2A 1MKYA 3CX6A 2O8EA 2QZ4A 3RS2A 1JAIA 3VAAA 4URXR 1A7JA 4PAOA 4Z8YA 5JEDA 5KNCA 4PC6A 2VHCA 2GCOA 1R5OA 3UMFA 1KK1A 1CJKC 2ZI3A 2MSDB 2QRZA 2IS4A 3ZVMA 3MAAC 2BBSA 2MSCB 3OAAA 1NN3A 2C99A 4RFVA 1J7KA 1SKYE 2D4HA 4MRRA 4JYBA 2Q9CA 2B8TA 1IAQA 1I2DA 2WMOB 3NH6A 3EZ9A 5JCPA 4B44A 1GNQA 4Q21A 1RPZA 2DB3A 4MRSA 1XXHE 2HYDA 2MSEB 4OK5A 2JEOA 3ND9A 4EPVA 2AKYA 5CDFE 1ZUNB 4BWYA 4V0ME 5G3ZA 2GBLC 1E2NA 1YE8A 2DCUA 3SS8A 1ZNZA 2ZETA 3LVQE 4DWJA 3IIKA 1JQLB 1KMQA 2ECKA 5FTKA 3IGFA 4IEEA 4Q9IA 4ZKEA 2VRWA 1DEKA 1U8ZA 4KJZA 1KI6A 3THYA 4JVSB 1AQUA 2DFKB 1JXOA 3LWNA 4ZO4A 3AVUA 1XEXB 4TMWA 1TU3A 1ZM4A 2ZR7A 4LHZA 4CEIA 1KHTA 4JLOA 2ZS7A 3NVAA 1E99A 2WMNB 3QY0A 5SZJA 1UBEA 5E7JA 2ORWA 2J1LA 5EP1A 1HH4A 1OW3B 1EWQA 3DHWC 1FX0A 2GTPA 3B9PA 4LJ8A 1AS3A 1HA3A 1A5TA 1GG2A 4UNPA 1JEEA 5IDVA 4HB3A 2B8WA 1IN8A 1XD8A 1II8A 1Z2CA 3I92A 1KZ7B 4Z54A 4RD6A 5KTYA 4WBSA 4TSFA 5KDOA 4C9BA 3AB3A 2XZLA 4JL5A 2WJIA 2ZRKA 2RMKA 4AKEA 1W2HA 2WV9A 3GLHA 3SZRA 3EIHA 4P0TA 2WIBA 3TVTA 1IXZA 3K1JA 1OKKA 2OLJA 2PEYA 1JR3E 1NL3A 3PUYA 4MA4A 4CIDA 3NC1C 3BS4A 2ODBA 1E1QD 5SZHB 2NO7A 2V7QD 4W5JA 3QQ5A 2GA8A 3BIFA 1J70A 4O2LA 4AG5A 2DWZB 2LCFA 3WMGA 4XOIA 3FKQA 1HE1C 1LS6A 3NDPA 2HCJB 3AH8A 3E2IA 4UXIA 4BFTA 3ADKA 4QNRA 3FHCB 5CM8B 5ELXA 1Z22A 1P2UA 3NKVA 3VQTA 2O8FA 1KO5A 2QMEA 4D82A 2GZAA 4NPHA 2XNDD 1W44A 1RYHA 1ZNYA 2HCBA 1HQYE 1QRAA 3LDAA 1G18A 1OIVA 3IEVA 1A82A 1N5KA 3CH5A 3EASA 1Z3IX 2CL7X 2VH5R 2VHTA 3DPUA 3HYTA 3B2EA 3OFNA 3PCRB 1OH6A 3QEJA 2B7CA 2WAXA 1W49A 1EFRA 4M1OA 3R9WA 2VF7A 3I73A 2QRNA 2WJJA 1CU1A 1CJUC 4M1MA 1J8MF 3ADDA 1VIAA 1KMHB 1AN0A 3W90A 2NPIA 1OXTA 2YC2C 4IFBA 4KBFA 2O52A 5JRJA 5K8LA 4LJ7A 3Q7PA 3IHLA 2PLFA 4US1R 3NEJA 4HDCA 3UIEA 4GL2A 5DI9A 2PCJA 4B48A 2R44A 4PZZA 1ZUHA 1YZUA 4JJKA 4MGYR 3C7KA 2H8KA 4A4DA 1SKYB 2JJ8A 4OQLA 2CHVA 4M8NE 2IS6A 1VYTA 1NP6A 2RGXA 3U4QB 3HU2A 4U7DA 4QC2A 4ZDJA 1CR1A 2YVUA 3T61A 2BJWA 1HV8A 1NVUQ 4PANA 4Z1MD 4AK9A 4F38A 1WBDA 5HR5A 1EESA 1II9A 3QF4A 4C30A 2RKOA 3D31A 2WJVA 1XD9A 4ABYA 1YU9A 1XXHB 2B92A 2IYVA 4NZYA 1OSNA 1TF7A 1TQ2A 3CKLA 4CF7A 1G64A 2IHYA 3DM5A 3K53A 4BFWA 2Y8EA 2OBNA 4GNKA 1Z63A 4KAXA 1N3BA 1U0HC 5C2JB 4FWTA 1N6HA 1M8PA 2AL7A 4X8LA 4D4MA 1RC8A 1GKYA 1OXSC 2BMEA 1Q1BA 5CK4A 2IYUA 5D3MA 3VU9B 4QG7A 3U3RA 2FJUA 4HB2A 4NH0A 2ZXUA 2CCGA 1Q3HA 4NKRA 4CZ2A 2QT0A 4N3NA 4JMPA 3AVQA 1N0UA 4HAYA 3LLMA 4BRUA 2VLIA 3C15C 1KDPA 2IS2A 1JNYA 2CK3D 1AIPA 1XDBA 2F9LA 4RFSA 1H8HA 1NBME 2FFQA 1AS2A 3SJBA 1AZTA 2PZEA 3WRYC 3PVSA 1J90A 1SVKA 3U7HB 1UBGA 5JEEA 2NO9A 4M9SA 4MKIA 1FMLA 1S9DA 1R0ZA 5J40A 2PX0A 4DB4A 4EJSC 1TTTA 5CB8A 2OCAA 3AKEA 3ZD6A 2FN4A 3AUXA 4V0NA 2D2FA 3SOPA 1VYVA 3Q85A 1SVWA 4X8OA 4R71A 2OFOA 2A78A 4GZMA 3T15A 1ZM2A 4UNNA 2R6DA 4E03A 4IOKA 4EQ6A 2JATA 3B60A 3ZH9B 1Q3TA 2BOVA 4HZUA 4Q7JB 2D2EA 3EWAA 1YR7A 3OF5A 3QG5A 4WA7A 3TNFA 3WY9A 1SVLA 2ZJOA 2JLXA 4NTZA 2FX3A 1NF3A 2QMUA 1E2FA 4MGZR 4RZXA 1TQ4A 3NG1A 2WJYA 2RGAA 1E9BA 1QVRA 2XXAB 3VKGA 2A7QA 1M34E 4TTQA 1XCMA 4KU4A 4FWHA 2CVFA 2QAJA 1Q21A 5H1YA 1FNNA 2W6JD 4IXMA 2ZM5A 1VPLA 4C0SA 5EZ6B 4ASUD 4GMDA 2RGDA 5FFMA 1NIJA 1NJGA 4EPWA 1NVWQ 4YMTA 3W6PA 1X37A 1ZCBA 1W48A 5JJLA 1C1YA 5DIFA 5GADl 1Z0JA 5JSZA 1KY2A 5EUQB 5IK2A 4ZKDA 2RHDA 3LD9A 1KI7A 3KQKA 2C5LA 4XD7A 4RCZA 4W5WA 5HPYB 2IS1A 3GJ3A 3O8CA 3BAFA 1OB2A 4A2QA 421PA 4EPRA 1JJVA 2GHIA 4RD4A 2CJWB 3RWMB 4D26A 1XNJA 1IXSB 2WPDD 4LBVA 4QBHA 4XTRA 1YZNA 4ACAA 2OCBA 1P2VA 2CBZA 3TQFA 1SHKA 5JHHB 2FV8A 2ZE5A 1OH7A 2NOAA 2ORVA 1XWIA 3QPWA 2ZROA 4XWAA 4RCYA 4EFLA 2D74A 5DE3A 2VPPA 2FPLA 1LV7A 4JKYA 3B78A 4NDZA 1JPJA 5FTMA 4M21A 4PO9A 5L3QB 4ZI3A 2CLCX 2AX4A 5TDHA 8OHMA 1GRRA 1BS1A 2ZI7A 1KJZA 2QE7D 4G3XA 4A2WA 5AJXA 1Z06A 4DDVA 2J0SA 2A3RA 3MLEA 4F92B 4QM7A 2R8RA 1KKLA 4R2HA 3W3ZB 4DBLC 1G291 1V5WA 2PCLA 3R9XA 1WXQA 5AUPB 1PLKA 5J4VA 4BRWA 2QY9A 5E7MA 4E09A 4Q18A 2Z4RA 3KTAA 3SE0A 3DDCA 4IJMA 2V54A 2ZRDA 2CL0X 3CIOA 2DVWB 3GFOA 2KBEA 3IO3A 4FN5A 2J0VA 5IF9A 2O8DB 1QHYA 1JB1A 4A8JC 2C2HA 3LBIA 4KBGA 1I4LD 4CW7A 1OHHD 2JDIA 1S4QA 2OEPA 5J4YA 1W0JD 3KQUA 1W36D 2UVQA 5L3SB 2A2ZA 3CLVA 5B58C 2GJ9A 4EJSB 4F7WA 4IDOA 4JLAA 2ZE6A 2W00A 4MDEA 1XZQA 4B3CA 1G8GA 4IOMA 1ZU5A 3QXHA 5EZ5A 2OG2A 3T12A 3M6AA 2GWHA 2JIZD 2BIFA 4QM6A 2GETA 4F4IA 3PFIA 3GJ4A 3EA0A 2ZUBA 4QJ4A 3TQCA 1P9RA 1VIYA 2ONKA 1YJ5A 3BE4A 2ZRIA 5C4MA 3F5FA 3MSXA 3CX7A 2C9OA 1N6NA 1CJMA 2N1BA 1KGDA 4TMVA 4Q5IA 1TPZA 1WQ1R 2GCPA 3H2YA 4FD2A 2ODWA 1T3HA 1VTKA 1EGAA 2GJKA 3MJHA 3VNVA 2XTZA 3REGA 1UADA 4EIWA 4BQSA 5F9HA 2FWRA 1KI6B 3JZAA 2V8OA 2QI9C 4MUBA 4US2R 1FQKA 3DO6A 4U00A 4TL9A 3T5GA 1GOTA 4PO1A 4R2IA 4A1FA 1E9DA 1H8EA 4YMUA 1E3MA 4LC1A 1KMHA 2YHSA 2XX3A 2NQ2C 3AF1A 5G53C 2G77B 1ZD9A 5P21A 2X19A 1D8TA 3QVUA 2LKCA 1LNZA 3MMPA 4IDNA 5JWOA 4TMZA 4NYIQ 3QJYA 2YWGA 4YONB 1CLUA 1II8B 2IBMA 2ORIA 3VR2A 3T1TA 3KKQA 1TADA 4C0BA 2JAQA 3D3QA 4BASA 3MGCA 4OHZA 4L15A 5AR1A 2GXUA 1BMFA 4AURA 4XWOA 4GDFA 4XIGS 2Q0HA 2HF8A 2IC5A 1F5NA 2J0UB 3FVQA 4HLQB 4JLKA 3RYTC 2ZUDA 3QG1A 3U3MA 1P60A 2AK2A 1GVNB 1TUEA 2GBLA 1XXHA 1X86B 4WAUA 3N2EA 4ESVA 1EK0A 4PQYA 2ZS8A 5FOTA 1TF2A 1IY0A 5CDFA 4FWDA 1JBKA 5H8WA 1I4TD 4V0MA 1NI3A 1D2NA 5EJEA 3SHWA 2F1IA 4N0DA 3RDPA 5KNBA 1NVVQ 2YOFA 3MRSA 1Z0FA 4B2IA 5JWRA 4DSTA 3QPUA 5TV2A 3TLXA 5B64A 3TBKA 2OSBA 1R5BA 4WXRA 4I1OA 4JVMA 3EC1A 1VCNA 5FTNA 4A2PA 4JBYA 1R6BX 1S8FA 2BHRA 5FUYA 4AIIA 4KSBA 1WB9A 1W0KA 2Q3FA 4IRUB 4ERNA 4E5UA 1GDDA 2BVNA 1ZUIA 3B82A 1ZRHA 1DAFA 4OQMA 3OIUA 3QXSA 521PA 1DPFA 3P32A 1TMKA 3CR8A 4RZ2A 2UKDA 5KDDA 5HZKA 2PX3A 4BLPA 3W6OA 1P3JA 3FMFA 1MOZA 2IYQA 5FPHA 1CR2A 2G6BA 1EFHA 1G3QA 2J59A 4TYNA 3OIYA 1R8QA 2AN9A 3QNUA 4JLVA 1LB1B 4TLAA 3CNNA 4OI2A 3TR5A 3SYLA 3M0EA 1SXJD 4DCNA 1ODFA 1VECA 5FTJA 1RJ9B 2IYXA 2WSMA 2G9NA 3SU8A 4TZ6A 1HTWA 4Q4HB 4AKGA 3SQWA 1G6OA 4GOJA 4B3BA 4TLBA 4M9QA 1JR3A 2Q3MA 1E2LA 4QBGB 4DSNA 1KO7A 2IHBA 2W6IA 1KY3A 2Z83A 3EG5A 1OXXK 4C0AC 2C77A 3GFPA 2KB0A 2X1VA 1QZXA 3GJ0A 2FA9A 3QE0A 4YXWA 4BZXA 4LDJA 1NIPA 2PJRA 4PSAA 2ZJ2A 3R20A 1EX7A 4A0GA 4DRZA 4QJ3A 4A0FA 2TMKA 4MRNA 4XJXA 4M53A 1AZSC 1TU4A 5FPKA 4FWGA 2AK3A 1RFLA 4BFXA 5FOUA 3IQXA 3P4YA 5EE9A 4DDWA 2W58A 4K81B 3A1TA 5A5GA 3OIWA 5JJIA 2LWIA 4G01B 1X8JA 4OKSA 1GZSA 4GP7A 5J4HA 3LV8A 1DARA 3TH5A 2CNWD 1Z8FA 2YNMA 621PA 2XXAA 2VHUA 1G5PA 1NMXA 1KI8A 2EYUA 2FH5B 4IKEA 1JXMA 4ZDIA 2DHRA 2CHQA 2HDNB 3FOZA 2IEYA 1G21E 1MR3F 2KWIA 4NCNA 4TMKA 3A4NA 1QHSA 2Q6TA 4TLCA 5JS7A 2OXRA 1S9HA 1KI2A 4OJKA 1GILA 5D3MB 4RZUA 2FU5C 4C0KA 1JECA 2R65A 2HT6A 3G82C 1WP9A 4V0KA 3ZZUA 5KSOA 1G3RA 2FE4A 1Z6XA 3NXSA 4P32A 4IFEA 5EE1A 4Q00A 4DIEA 3H0KA 3U6BA 2KE5A 3HR7A 4I1VA 2JGNA 3HJNA 4G5GA 4Q7LA 3LW7A 1I2MA 2CJWA 4URWR 4I1UA 1P73A 1MH1A 1U8AA 5G41A 3BB1A 3LBNA 5AK0A 3I5XA 3TW4A 3UK6A 4MITA 4Q03A 1T5IA 2NZJA 4V02A 1RE0A 4CVNA 3QEOA 1ZP6A 4PPNA 3WNDA 3I3SR 2PMDA 4QKQA 2W0SA 5FI0B 2FMXA 1D2EA 3OE7A 2J7PA 4POAA 1RW4A 1XJ0A 3PXGA 4Q4JA 2C04A 2P67A 2WWGA 2WSSA 1HYQA 4DLXA 1R7RA 2G83A 3CRVA 4QGHA 1E94E 2ZJYA 4QHTA 5FPTA 1E2GA 3I72A 3N70A 4Q1EA 4LY6A 2FZLA 5GJCA 1XEFA 4EQ6B 4NHOA 1HE8B 1UEIA 2PMKA 3CUEF 4TQ9A 4OQFA 2ODEA 3HU3A 2HJGA 4URVR 2QNRA 1GNPA 1X8KA 1NG1A 4DDTA 4Q1CA 3D7MA 2QL6A 3SFVA 3SHFA 4AYTA 1LF0A 3PQCA 3LXXA 1WMSA 5IHPA 3IKJA 2HEIA 4E22A 3I62A 1IOZA 3K0EA 1CIPA 1SXJC 2GESA 1G8PA 4JVNA 4EUNA 1UBCA 2QMOA 2QU8A 2REXB 3P1JA 2Q9AA 2O8DA 4YXWD 3KDSE 3WHKA 3QXCA 2P2LA 3NEYA 1YZLA 3C4JA 2RGNC 3UG6A 2BEJA 3ZS9A 3GP8A 4B6FA 4KFSA 1ZM9A 3A37A 1YR6A 1XTIA 3DMNA 4R98A 5KDLA 5KSPA 3K70D 2HUPA 1RZ3A 2FSGA 5L3SA 4KVAA 1FPMA 3A8TA 4O0MA 2A5YB 4Q9LA 1ETUA 1NBMA 4EJSA 4ZPXA 3IBYA 2RB4A 2ZE8A 3EPHA 1DG3A 3NH9A 3PUXA 3AF2A 5EE0A 5BW8A 5JSZB 1G3UA 2WIAA 3QVVA 4HAXA 1NVXQ 1TEXA 3PUWA 2ZAOA 4LJAA 2VTKA 2OO7A 1GSIA 4AKIA 3I8SA 5JHGB 2JLZA 4UNRA 1X3SA 3LX5A 4B71A 3BBPA 1NKTA 4TTRA 5AJVB 3RS7A 3UPUA 1U9IC 1FUUA 1KSJA 2GZDA 5K8UA 2XEXA 2ZRAA 5EE3A 2O8CB 1S3GA 1MRSA 4HDOB 2XJ9A 3AEZA 4LYHA 2OHFA 3SNHA 1G16A 2HYIC 3OESA 1Z83A 1Z6YA 4QOSA 4D81A 1ELOA 2ZSFA 2WWYA 1VHTA 4HAZA 3VNUA 2CLSA 2IK8A 2W2VA 3E1SA 1CF4A 4AG6A 1L4YA 5GJVC 5C18A 3JZMA 4C7OA 1KO4A 3QBTA 4ZV4A 4A15A 2O5VA 2ZRFA 1E2KA 3DKVA 4DJTA 4A9AA 3W3AA 1W4CA 2ZJ8A 4LSGA 3IQWA 4U02A 3B13B 1ZIPA 1VKJA 5HKKD 2D7DA 2GK7A 2JJ2D 3E70C 3AV0B 2R9VA 5FBLB 4NBSA 4ACBA 4EPYA 4ZCMA 3RLFA 5KSYA 4PSVA 1NLFA 2O0HA 4A92A 4Q47A 4B3FX 4TYWA 4JJZA 4MRPA 4L4UA 3AGPA 1XMSA 3KTAB 3OEEA 4AYWA 4PHFA 2X8AA 2J0UA 3D8BA 2A30A 5EUMA 3OZXA 3U7GA 4LV6A 1T0JB 2X2FA 3NBXX 4IXNA 3RS5A 3TUIC 2ZSBA 2FFHA 4ON9A 4OHVA 3TVDA 1NY5A 2IX3A 1PVOA 3R8FA 2G3YA 1UDWA 2GDJA 3BFKA 4DUGA 3ZLJA 1LF5A 4FMBB 2A5GA 1N5LA 2YWHA 3PJRA 1E2EA 2XJ4A 4D4LA 2YOHA 2C9YA 3BFVA 2RCNA 4DEYA 2B6HA 5FI1B 4FIDA 1TF5A 5DYGA 3KXLA 5CLQA 3CPEA 4LJ5A 1A2BA 1XB2A 4M9XA 4B76A 4Q9JA 3ASZA 1G4AE 3L0SA 3O8BA 3CPHA 3RVBA 121PA 1RRCA 2IXEA 4HEJA 2ZUCA 1DAMA 5CJPA 4XSGA 4HZIA 3BJIC 3OAAD 2DWOA 3ZZ0A 1KSHA 1N25A 2QUZA 1E2QA 5F2EA 5JI2E 3PG5A 2RGGA 5M04A 2KI5A 2A5DA 2XGJA 4D0LB 3EPJA 3CBQA 2FSFA 5L8VA 2QPTA 3PEYA 5FR1A 3K70C 3GJ5A 1GTVA 1U0LA 3GEIA 3GJ7A 4LHVA 1RJ9A 3A4LA 2VHQA 3L82B 4LRWA 2EVWX 5C1BA 3QOFA 1U99A 4V03A 1T8UA 2QPAA 4Q4HA 4A8JA 1GFIA 4Q4LA 3MJRA 5TARA 4DLVA 1DBSA 2G88A 2V6IA 3B7GA 3GPLA 1N6PA 4NYJR 5DH9A 3FHTA 3IIJA 1XTRA 1DVRA 1M7GA 1QHNA 4XVRA 1OJLA 1E9AA 2QENA 3F3YA 3RABA 3KJGA 1Q22A 1IM2A 4PO8A 1QG4A 3C5CA 3DMDA 1TUIA 3TUZC 3ICEA 1E79A 2N42A 4TTPA 5B57C 4PSKA 5KHOC 2ZAMA 4LPKA 4OJQA 1M2OB 2ZYUX 5DN6A 2OT3B 2WZQA 1NG9A 4Q9KA 5LD2C 1D9ZA 4KO8A 2JCSA 3CF6R 4BE7B 4DHEA 4LV5B 4PZLA 2GILA 1OB5A 3W34A 3G5UA 5FR2A 1Q1EA 5ANRB 4EAQA 5JECA 2GXAA 1G5TA 1U98A 3QKSB 3MD0A 1MABB 3KKNA 3K9LA 2ZRJA 4BPBA 1DAKA 4M1KA 4TSFD 1UKYA 1AKYA 4GITA 4LRTA 3VR3A 4MGIR 4HUTA 1A2KC 1VCOA 3CM0A 4XSHA 4Q48A 3WNCA 4URYR 1OKKD 2ZVPX 2BCJQ 2P0EA 4FMDF 4MGKR 1CRQA 1MO5A 1AS0A 5CYPA 3ZIAA 4N1AA 4CDGA 2FG5A 3W5JA 3SJAA 1BH2A 2XOKA 4HLCA 4M9ZA 1W46A 1UJ2A 3LXRA 4DCVA 3KQLA 4DZZA 4DC9A 2UZ3A 5DGXA 1GIAA 2VEDA 2C96A 4KXFB 4P31A 3W8RA 4DKXA 4B34A 3P4XA 2E9SA 3RS4A 1YR8A 4AI6A 2CMKA 3KZ1E 1NSFA 1S2MA 3RANA 3ZZTA 3K9HA 3LNCA 3MWJA 3BORA 1FZQA 3TSWA 2VSOA 4FMCB 4BLSA 1COWA 4H9GA 4ZIRA 3Q8XB 3THWB 3FHOA 4B3GA 3TR0A 3CH4B 3B5JA 1OV4A 3LAWA 2F3TA 1NLYA 3WRXC 4BGDA 1ZBDA 2VIIA 4TT3A 5JBQA 5DYIA 4DIDA 2ZJZA 5A4JA 2D06A 2EW1A 4XWKA 3GLIE 4GI7A 3EZ2A 1Z5ZA 2QQEA 4LUCA 2WKQA 5JCZA 3L8ZA 4W7SA 1T8TA 4I99A 3HU1A 5UKDA 2WOJA 2RGBA 1QDEA 5L3RA 2D7CA 4DLZA 4MKGA 3VX3A 4JSYA 3NC0C 1TEVA 2GF9A 3OFND 2VBCA 3AGQA 3RS3A 1EFRD 2I4IA 3WMFA 2ZANA 1XBTA 5BYJA 1EG7A 4IW3B 1KJYA 5H70A 4LK2A 3A58B 4LC0A 4LWZA 4O25A 5GJWC 5FH9A 3BRWD 4KHZA 1LFDB 2REBA 4P3YA 2ONJA 3KX2A 2DBYA 4JLNA 1T5LA 2QEQA 3QSYA 1N6LA 2R6FA 3K0FA 5A0FA 4GPTA 4Q02A 2FEOA 1KO1A 2YWEA 3B85A 4PZYA 2P65A 4MYCA 1KI4A 1RRPA 3ZYCA 4DCSA 4BFVA 1X1RA 1OFIA 3F8TA 1UKEA 1HUQA 1LW7A 1XTSA 4MQBA 4RJLA 1G4UR 4IOJA 3AKYA 1EFTA 2IYTA 3U44B 3HDTA 1G8FA 3KJIA 2FFBA 5SZKB 1BKDR 3X1XA 5FL7A 3IUYA 3A4MA 4LHXA 5DO9A 1CXZA 3ZQ6A 3KKPA 1ZD8A 2IL1A 2OFXA 1E9FA 4DLTA 1SQ5A 5CIQA 2ZR0A 3UMRA 5BYKA 1QF9A 4IHQA 3SYKA 5JWHA 4U5XA 3RSLA 2PT5A 2NGRA 3A1WA 4LBYA 4DCTA 4DVGA 4RKFA 3B1XA 2NO0A 5KO2A 1E98A 2QP4A 2O8CA 2GJ8A 3T06B 5AUOB 1DS6A 2R6GA 5LD2B 2GAAA 2VSFA 3VX4A 4A3VB 2JJ1A 1OXVA 3ZVNA 2ZSAA 3H4MA 1ZW6A 3OEHA 4QJ5A 2F6RA 2WJHA 4HATA 4LJ6A 1KTVA 1N6IA 1KSFX 2FSIA 1WA5A 1P62B 2JLWA 3AVTA 4A82A 2QA5A 3AKCA 2H16A 3GEEA 1EXMA 2O8BB 1ZU4A 5JLJA 4Q4JB 4X8HA 2BWJA 2DR3A 4RD2A 4LBZA 2OM2A 5K8TA 5CM9C 5FPYA 1GKUB 5J47A 4MYHA 4JT4A 4O3MA 1H8HD 1UFQA 1QHGA 5DNYB 2QAGC 2OZEA 4HUQB 1ESMA 4LHYA 3W6NA 4B3DA 5KPDA 2H92A 3KB2A 4B73A 1UKZA 3A36A 2VA8A 2CL6X 2F1HA 1XP8A 4B75A 1SHZA 3X1DA 2DPXA 4D4JA 2ATXA 3HWSA 2F55A 1E1RA 3U60B 4LRSA 1G5RA 3N5CA 2C03A 3X1YA 3EAQA 2RAPA 2CLDX 3ETLA 1ESNA 3PV0A 1NVMA 4B2LA 1K5GA 2E87A 1NVVR 5FBRB 3V4FA 5DISB 3GLFE 4JBXA 2ZU0C 1M1YE 1US8B 1ZMXA 4CT5A 3SJZA 1N6KA 2DY1A 3I32A 3FMPB 4TZ0A 4ARZB 3AF3A 4TN1A 3X2SA 2CDNA 1SVMA 5CIWA 3U3JA 3SQXA 2DWPA 1XF9A 4QGAA 3FYHA 4Y0AA 3X1WA 4BFYA 1CTQA 3TK1A 4Q1AA 5F98A 4NCJA 1B23P 3TIFA 1IY1A 2VP6A 5FPSA 1KDTA 5L3VA 1E9EA 3GLIB 4PAQA 4LGMA 5C4GB 4KFUA 2ERXA 4URZR 2IF2A 1MO6A 2ZYTX 4P4TA 1CP2A 1MRNA 3WP0A 1YR9A 3BC1A 3U2QA 3VR4A 5CLLA 3A1SA 2I1VB 2R2AA 3CZPA 1IXRC 4ZDWA 2ZYVX 4GMXA 1E0KA 5IK2D 4PC2A 3SBEA 2FPMA 4KCGA 5FL7D 4F4JA 4XD7D 3L0IB 5KYKA 2IF0A 1IN6A 3HPRA 1U81A 4KLNA 4TYYA 5E4FA 1KI1A 2DWQA 1J99A 4C7OB 2VL7A 1Z6GA 1U90A 4BEBA 2RGNA 3T1VA 4B32A 1FMJA 5FL3A 4IEIA 4WZAE 3VHXA 1BYUA 3GJ6A 1P2SA 1F2UA 2ZI4A 4PQFA 3M1IA 2DZOB 3I5YA 2J45A 1XCGB 5DSZA 2WWXA 3CWQA 1P9NA 1ZVQA 3M4YA 2G0NA 3TMKA 1R10A 4LPSA 4OI1A 1W4RA 4M22A 1D9XA 2ZJAA 1G41A 4DT1A 3L0OA 4UNSA 3HYRA 2JLUA 2QMHA 3U5ZB 1KK3A 1VG0B 3MG9A 3U3KA 2K5UA 5G3YA 1XCPA 2FPKA 3CRQA 1U9IA 4ZCLA 4D80A 2HV8A 1NN0A 1YHNA 4PTLA 1BO6A 3L43A 2WWHA 3QKSA 4CEHB 3VR5A 1U0JA 1ZC3A 2WBLC 4QHSA 1MABA 2EFHB 5EXPA 4UXJA 3LX8A 3LLUA 2W2TA 4FMCF 1N6OA 1T6NA 1KYIA 1E1RD 2ERYA 1UF9A 3TE6A 2XSZA 3KW6A 1IJFA 1AGPA 1MO3A 3CNLA 5FBQB 4D6PA 1ONBA 4KYUA 2VSXA 1FP7A 1M7HA 1JAHA 2DFTA 3EC2A 4US0R 1E2MA 4XH9B 5DI3B 1ZINA 2A9KA 1AK2A 2QAGB 3OHMA 4GP6A 4IDQA 4D25A 2JDID 1ANKA 2QORA 1W1WA 2BKEA 4BFZA 2CE2X 4OHYA 1GP2A 2GXSA 1QBKC 1YQTA 3PIRA 3PUVA 3AVOA 4B35A 4TQAA 1YZGA 1ZIOA 2ATVA 4PC1A 4Q66C 2V3CC 1OF1A 4HB4A 2C9CA 1W36C 2CCJA 3THOA 3THWA 3BFXA 3AVYA 2EU8A 4C0QC 1P5ZB 1FOEB 2J7KA 4JS0A 3BB3A 4P4SB 5FBVB 4A8JB 4B3XA 1E9RA 2FFAA 1F3OA 3IDQA 3AVPA 3CO5A 4JIMA 2OILA 1LY1A 3UWOA 5LDDC 3TJZA 4NYMR 1QHXA 2FNAA 2NPFA 4OI0A 1G7SA 1YZQA 1O87A 2BBWA 3IPYA 4RD3A 4TMTA 2XZOA 1L4UA 3MWYW 1G8HA 1KJWA 2AWNA 2WAYA 2ZS9A 3ZVRA 4GOKA 2F1RA 2QPOA 2SHKA 5F3WB 1P6XA 1F60A 3CRW1 1PLJA 3JVUA 2ZJBA 1HY3A 4A6PA 1W2GA 5HE8A 5KU1A 1JI0A 1P7CA 1S0UA 1Z0IA 2JLSA 2FGJA 2WTUA 2Z4SA 1OPXA 4LJYA 3FKSA 1D2MA 1H8ED 1OE0A 1Q1ZA 2AXPA 3SJCA 1SGWA 5B30A 1X1SA 1Y3AA 4YMVA 2LKDA 3GD7A 2BMJA 2IT1A 2XNSA 4CEJA 2P6UA 3IIMA 3JVVA 3MHVC 1AGRA 1TX4B 1KNXA 1OH8A 4LBWA 1R4AA 2PT7A 1Z0AA 4JBWA 1E2IA 1S1CA 1BMFD 1QG2A 3Q5EA 1F2TB 4OI4A 3R7WB 2GKSA 1VG1A 4GRAA 4V0LA 4BZQA 1XRJA 1Z0KA 1OT3A 2FSHA 1Z47A 4L5BA 2ZRCA 3U44A 1XPUA 2C95A 4A0RA 3K09C 3EIQA 2IEZA 1S96A 5KUTA 3LW8A 2QTHA 3NIBA 3FDIA 2BJVA 2BMDA 2WOOA 2BC9A 4AY2A 1DAEA 4OQXA 4JSTA 1RRFA 2VP9A 2QGZA 2ZI9A 4OK3A 4QBFA 3ND8A 2P5TB 5FUXA 2BMFA 2O0JA 2V1UA 3B1ZA 1OYWA 4HLUC 1CEEA 3ZS8A 3HPQA 2OXCA 4UNQA 1R0WA 2CE7A 4L16A 4UQOA 1F48A 1W0KD 3WYFA 4ZIRB 1M74A 2IYWA 2ANCA 2VF8A 1G17A 3PR1A 3F0TA 5FOXA 4ITRC 4BEJA 2IXGA 2JLVA 4DDUA 5CK5A 2RGCA 2VO1A 1GL6A 2J3EA 4KLZA 4FMDB 3T5DA 4KVGA 2O8BA 4GBMA 4DLSA 2J0QA 3IEUA 2P6RA 3RC8A 3MCAA 1E0JA 4LHWA 3ONWA 1LTQA 1N6RA 2BBTA 1FP6A 2OV2A 3VKWA 1VMAA 1Z29A 2Z6VA 3QKTA 4C0JA 3NHBA 3QXJA 2UZIR 4S2EA 4HUQA 821PA 5KSZA 1UPTA 2KSQA 3WP1B 2ODNA 2CXXA 2Z0MA 1XTKA 3B1YA 4I4LA 4HDQB 1IN7A 1SXJE 2PJZA 4LCBA 1T3LA 1JR6A 6Q21A 1GUAA 3WYGA 1A4RA 4OBEA 4F4CA 2DFNA 1JR3D 3RAPR 3QUSA 1T4GA 2VHJA 2W6ID 4M1TA 5G40A 2FGKA 3CR7A 2H57A 1XEWY 3K0FB 3AJIB 5EP4A 1VYUA 2YZ2A 4LJ9A 1N5IA 2ZQ5A 1XMIA 3EW9A 3KXIA 1E1QA 4ZDKA 2V7QA 4A6XA 2G0TA 1W36B 4EPTA 1US8A 1Z07A 4JZKA 4PC7A 1QHIA 2V1XA 3DVLA 5FOVA 1PV4A 2QTFA 1E2HA 4KYIB 1SKQA 2BDTA 2IUSA 2IW3A 3NHAA 1IQPA 3AF0A 3I8XA 4C2UA 1AJEA 2FOLA 4LZZA 5CJ2A 1OYYA 3J81k 2XNDA 3EWSA 1R5NA 3GLIA 1RRGA 3KXKA 2WKRA 1PJRA 3UATA 5IT5A 1QZMA 1PZNA 3HR8A 1W7AA 1XU4A 1FFHA 2WVJA 2ZTSA 4I1SA 4JKIA 4BZPA 1GL9B 1DADA 2QM7A 4GT1A 4LV8B 4WVFA 1NJFA 3FWYA 2F7SA 1GL7A 1UKVY 2EFGA 4NP6A 2OE2A 1XTJA 1IJEA 2H5EA 3BH0A 1MO4A 3BXZA 2WJGA 3IO5A 4M1YA 3ZD7A 1G8YA 2OBMA 1KNQA 3IHWA 4KSCA 3GJ8A 1ZNXA 4RY2A 2HF9A 2YV5A 3GCGA 1DOAA 1MT0A 2C98A 2BM1A 2QT1A 3KUCA 4OQNA 4KFRA 2GXQA 5TXGA 2PZGA 1GNRA 2D62A 1OLOA 2XTMA 1XJQA 1BOFA 1KDOA 1E4VA 1NN5A 3GMTA 3KKOA 1YKSA 1JQJC 3TW8B 4LYJA 2NZ8A 5FOSA 4B43A 3V4RA 4Q7KA 3KFVA 2Z43A 3H84A 4A0HA 3GLGE 3GEHA 3OE7D 2J7PD 1Y63A 4Z1MA 4NL4H 2IXFA 1L8QA 2ZRNA 4DXAA 4RVCA 2WSSD 4MKFA 1ZM3A 4B74A 2CEAA 1M6NA 2C78A 2RGEA 3VFDA 1G20E 3D6TB 1CR0A 1XD2B 2OAP1 2QGNA 5EXXA 1FNMA 1KO8A 2XTNA 4GSYA 2KJQA 1DE0A 3T1OA 2J46A 3CPJB 3NBFA 4M2LA 4CEHA 2QTVB 3ZJYA 2OCPA 1M7BA 2NG1A 3IILA 2IUUA 4EKDA 1KKMA 1UEJA 1FL9A 4G5RA 3SC3A 1ZAKA 3KJHA 4PPQA 4Q7MB 3SDZA 3VHLB 1CS4C 1U94A 4OL0A 3BB4A 3RRMA 5BN4A 4PHGA 3AP1A 1E0SA 5JI3E 4KV9A
chains in the Genus database with same CATH superfamily
1NX6A 2VK4A 4J16C 1SVNA 3CWCA 3IUEA 1XC7A 3ADPA 1M33A 1NOIA 4Z4FA 1P29A 3N1UA 4PHTA 1W73A 2UDPA 3CSUA 3U7JA 3F71A 4ALNA 1L5QA 3VR1A 4J0GA 1Y48E 2PGDA 4BLTA 4Q3LA 1F2UB 1ZAEA 2OO5C 3ZX4A 5EFZA 1KQGA 3EXHA 1ORVA 4O02B 4AZ0A 4BU0A 2FOIA 2ZWIA 4EA8A 3A1UA 3DNPA 2CJPA 3HFGA 4G97A 4RMJA 2ENWA 1ST2A 5AM0A 2VBFA 4Z7OB 1JRLA 4O4JB 2YKGA 4HXEB 3BMCA 2AOTB 5ICSA 4A8TA 2C5BA 5DHQA 1DELA 4NE7A 2JWSA 1BW9A 1LWOA 3RSOA 3AY0A 4LTMA 4B2PA 2CLFB 2Q7DA 1SOVA 3UW3A 3JQFC 2VJBA 1R0XA 3LA6A 2IYRA 5EZQA 5JROA 1IEVA 3CVUA 1R5LA 1IQRA 3O82A 4KLCA 3ZQUA 3Q1KA 5D2CA 3LHDA 3GJXC 3BQMB 2BFFB 4CQJA 4DBZA 2DWMA 3DO8A 4KQWA 4PE5B 4RFLA 4JL8A 4YRKA 4OGKA 4U6QA 2C2GA 4DGSA 5JAQA 3D4PA 3UPDA 2QF7A 4O5OA 1I6LA 2PSFA 1KRWA 5K6TA 4LA4A 3DW3X 4ZO6A 3O90A 1ZZEA 1BIFA 3WYAA 4UFOA 4Z51A 4NI5A 3MMNA 4A36A 4ND7A 2JUJA 1QO9A 3A9WA 1EGQA 4CM8B 5D1HA 4COOA 2VHYA 1C9YA 2B1QA 1HI9A 2WZJA 5KNDA 1J5PA 1E3QA 3EZFA 2F1JA 1Y8RA 1Z2DA 2JI7A 5G2OA 4U6NA 3FPAA 1VFPA 4GEKA 4TT3D 1M2JA 1OI3A 4RPGA 1WTAA 1E96A 3SOZA 3OMWA 1G8JA 2E1RA 1OY1A 1YXMA 5I8ZA 4N3BA 3TWKA 1PLLA 1MO2A 4KR2A 3BERA 4JU9A 2QTZA 4ENRA 1Z0DA 4E2YA 2V3VA 2F9MA 3IPXA 2W2NA 4P3KA 3OFVA 1G3IA 5EVCA 4MRVA 1NRJB 2BGIA 4KWTA 4TMFA 4YRBA 4HAOA 5IFLA 4OATA 3H1TA 2PBRA 4BNWA 1Z17A 2QVZX 3C3YA 3FFAA 1GRQA 1N78A 5E3JA 1A9QA 2RGRA 4C0WA 3P0IA 4KXMA 3R5FA 5BN5A 3A0RB 2CBGA 3DGFC 3LYUA 4KN9S 4IJKA 5DT2A 5AHOA 4WNIA 2QSZA 5I7WA 5FI5A 3IECA 2A4MA 3CBGA 1U31A 2HL7A 2ISCA 2WE7A 5LL6P 4GI1A 1P72A 4F6RB 3TWMA 3KWJA 2O8FB 1RQ2A 5FLEX 1B6TA 4MYTA 2QQ0A 5JLAA 3RUDA 2DR2A 1IZYA 3D7SA 2NM0A 1RJGA 4Z7NB 4U4AA 2EW2A 3GLFB 4BCBA 2L2QA 4KFTA 1P1RA 4YBRA 1QRDA 1WZNA 2J5BA 1GRNA 2CCKA 4RGBA 3M5CA 2EJBA 5LU8A 3RK1A 1Z4NA 4N6GA 1C1KA 2DKLA 5LBIA 4WXPA 4OP2A 3DFZA 4EHJA 3EZ7A 2AHMA 5ISMA 1JEAA 4K40A 4EUSA 4EY7A 3DLTA 2BCGY 4F4FA 3TZKA 5GOZA 4Z4EA 2XY4A 3CONA 3FYDA 4AQYM 3OIVA 2O4UX 5A5EA 2J8ZA 2PEZA 3WNVA 3PE4A 3ABZA 3I1FA 2E21A 3AKDA 4YCMA 3KE8A 1MB3A 2R25B 2W70A 4BN5A 5TSDA 1U0BB 4PFQA 3RS2A 1PR2A 1L4MA 2DAKA 2FN7A 1A9ZA 3AHFA 1YAJA 3OAAA 2XR1A 1J7KA 1P7PA 2I76A 2Q9CA 3VPHA 1Z73A 1QOZA 3HI6A 3HLYA 2DWCA 3KXPA 1L2CA 4WE3A 1S89A 1UZLA 4BWYA 4LQLA 4BVKA 2ZOSA 2EJCA 1XI2A 5AKIA 1IOLA 4P5EA 3A3KA 4JVSB 1AQUA 1H4SA 3FCXA 5KOHB 3L0ZA 2ZS7A 1SCIA 3QY0A 5SZJA 1UBEA 1OW3B 3DEHA 2ZG6A 4UFNA 3KUXA 1HA3A 1ZI9A 1SCNE 2HK9A 3NTLA 3TB4A 3KQWA 3VPCA 4XKJA 2CNBA 4X1YA 4GP9A 4MA4A 4CIDA 2YW2A 5JJBA 2HBYA 2ZJ0A 3E2IA 1IUKA 3C8DA 3LLCA 2LVPC 3CX3A 3F47A 2ORED 3GNTA 3PSHA 5HJ5A 3CZMA 4Z53A 4HPXB 4DR3M 1QGYA 5ALMA 2AZMA 1VDDA 3L7JA 4KK3A 1TMYA 4PZPA 9LDBA 4LJ7A 3BDIA 3NEJA 3AESA 2AVNA 2DPLA 3G1UA 2JJ8A 2CHVA 3HU2A 4PANA 4ZK6A 1T3GA 5JMWA 1L5MA 5HFNA 1JDBB 1EFDN 3AB7A 3X1KA 4E5SA 4U2KA 1YWGO 3A7EA 4HJRA 3RAFC 3RGWS 5D8DA 2CZQA 4D4MA 2BMEA 1JQDA 3I83A 1Q77A 5F7XA 4NH0A 2I5PO 4KH0A 3OHSX 4MV8A 5DWQA 1U0SY 1ZICA 3N6VA 1GT6A 3AVQA 2XCLA 2CJFA 1WQ4A 3P9QA 3SS9X 5LMNM 3AFIA 5BSUA 1NVFA 4Y1EA 1Z4MA 1YL5A 3BGOS 4RTQA 2DAIA 2P30A 2XNKA 4M9SA 2PE5A 1S9DA 4IICA 2Q29A 2FN4A 4F5EA 3SM9A 3OZVA 1YZ3A 1A4UA 1T3TA 3LPAA 3UUGA 4OBWA 4ZK2A 3MINA 4YRCA 1QR6A 3FDZA 1RYYA 4MGZR 5A3SA 2J3MA 3EWIA 2QAJA 4OW0A 1G2OA 4JC4A 1X37A 3I01M 3MWEA 3QWBA 1C1YA 2RH9B 2RAVA 4RCZA 3FNGA 1TJ4A 4A2QA 4CHGA 1K97A 4D26A 1IXSB 4ACAA 4L8LA 4PBRA 2NOAA 2ORVA 4RCYA 3D7NA 1C1XA 2BGNA 5EHZA 2DM6A 4G3XA 1XMXA 4QTTB 4BNMA 3OOYA 3ROPA 5AESA 1AZWA 1I14A 1ZN8A 4P7BA 3W9UA 3W6UA 2ZRDA 3HUDA 3HJRA 1THTA 1LLQA 1PL7A 4CIWA 4I5IA 1K0UA 4A8JC 1IBMB 2Q1UA 1WGNA 1SXHA 1YTLA 1IVSA 1ULTA 1XZQA 1O95D 4IOMA 2REQB 2NU7B 2GWHA 1H2WA 3HLKA 2PPLA 4TXNA 2OR3A 4O08A 3MYRA 3JW8A 4PS0A 2N1BA 2HMSA 4KIUA 2ODWA 3FLMA 9MHTA 3GOQA 1KI6B 3N6RA 1NHWA 4CL3A 4B7XA 4PO1A 3VGJA 4NESA 1FS6A 1ZXXA 2P4SA 2X19A 3ILVA 3BWBA 4TWRA 1LNZA 1G6KA 2CF6A 4YONB 2ORIA 4LZOA 3D3QA 3DMTA 4L15A 1AUVA 4N9QA 4FBLA 5I9MA 2WTBA 3E1KA 2A1TS 2XRZA 1JP7A 3N2EA 1Q0TA 3DZIA 2BTEA 5CDFA 1PEDA 5LMUM 4N0DA 3WLKX 3RE8A 3U17A 2XF8A 4EGQA 4KXXA 3R74A 2G67A 3GRFA 1GNTA 3PDJA 4N5HX 1ZUIA 3KXDA 521PA 1RVV1 1P4HA 1TMKA 5KDDA 3NBUA 5JAUA 1UWVA 1CR2A 1YQUA 3UHJA 2F3SA 2AN9A 3U7QB 1IPEA 1FE8A 1R4MB 4WK6A 1JR3A 4HYTA 3TVYA 1T0IA 2V7UA 3SX4A 4QBGB 3EG5A 4RESA 2H4FA 3E7WA 1NIPA 2D13A 4FX5A 2V7VA 1PNQA 3SBOA 4E13A 3KSUA 1M3SA 3W7AA 5H9VA 1TDZA 1SC1A 4TMKA 3A31A 4DF3A 3D0RA 4TLCA 1JHQA 5CNKA 5KNDH 3EOBI 2DWUA 3SHVA 4MK4A 3G88A 4EYKA 1G3RA 5CVEA 3QV2A 3W5BA 2X1LA 2YFYA 3H0KA 4JV5B 4WNAA 3SJ7A 4MITA 2DPMA 3K96A 1ZP6A 2CD7A 1GSHA 3HCPA 3O2NA 1YIDA 1B43A 3PXGA 2FPIA 1R7RA 4M0WA 1WF6A 4D41A 4JQYA 1UEIA 2PMKA 2XEDA 4AZWA 4I4IA 4OIFA 1V7CA 2WFLA 3WFJA 1ZPDA 4JVNA 2HW8A 2QMOA 2R46A 4IJVA 3NW9A 1XROA 4ANFA 2HSZA 5L3SA 1ETUA 3LUCA 3LXMA 1X1CA 2Q41A 3AF2A 2IU0A 3I8SA 4HVCA 3B2QA 2GZDA 2IOYA 3G0DA 2XJ9A 3SNHA 2EJSA 2GB4A 5CW2A 4QA9A 2OO3A 4FE7A 1KJ9A 5HZMA 2XWBF 4AG6A 5GJVC 2KX7A 1RXVA 4BLCA 3OZFA 4O8ZA 3Q3HA 3IQWA 3OCZA 2VT7A 3MWDA 4ZCRA 3I2KA 3TZ6A 1QLWA 4A92A 4JJZA 3WFZA 1LJLA 1UR5A 1T0JB 2BHSA 4GKKB 2B25A 3KQVA 4Q3AA 2G3YA 3ZLJA 5IS2A 1DZ3A 4CE6A 3Q87B 1QVVA 4Y2JA 4M8IA 4HADA 2L7IA 1HSOA 3L0SA 4J9VA 3CPHA 3RVBA 4NJEB 2P9ZA 6PFKA 3UJ8A 1K7XB 1TOAA 4FFBA 4KQCA 4OP3A 1U7HA 2A5DA 3PHLA 3GJ7A 4KEAA 3EFOB 3L82B 4WMLA 2PGJA 4I14A 2XLBA 3MJRA 2CKDA 2Z1DA 1QHNA 1Q22A 3KBBA 4PO8A 2N42A 4YUYA 4LPKA 3RVQA 3WJ2A 4FMPA 3QOXA 4DHEA 4IMIB 3T38A 5FD8A 4IIYA 3CCCA 1GNLA 3OT4A 4HH0A 1FP2A 1OFGA 2X40A 2ZRJA 1X3LA 1I94M 1TAQA 2D54A 3DL7A 1HR0B 4IXDA 2FUEA 4P7GA 4DR4M 4DA6A 4P31A 1UMDB 4WK2B 4G81A 5LIRA 5T4BA 3EEIA 4BLSA 1JHAA 4JODA 1I36A 5F76A 4BGDA 1ZBDA 4X41A 5A4JA 4XWKA 5EYPB 4JV5M 2P40A 4N8SA 2XMZA 5HS4A 4P6VF 5IKXA 5CCBA 1YA4A 3VNAA 1TEVA 2JGEA 2XRMA 3WZLA 2C7QA 4XM1A 4BKMA 4EJMA 1DEOA 2B1JA 5AW3A 4N3GA 2B7LA 5DHPA 1H9AA 2NWQA 3TZQA 4CI0B 3S2YA 3FOWA 1UKEA 1PVVA 2FN8A 2XXJA 3JV7A 3Q2IA 1RTKA 1WJGA 4RPLA 3VYWA 3X1XA 5D87A 1GFZA 1UKCA 4TTJA 2QRJA 1E6MA 3HFRA 1SD2A 3UMRA 1XDSA 4P3XA 2HSEA 5A3RA 3J27B 1UBTS 4LFCM 2R6GA 1Q11A 1ZWKA 3QX3A 1KTVA 1XRLA 2QA5A 1A9TA 4K0KM 3C7CB 2HDWA 2DR3A 1DB3A 4KKVA 3GBPA 1QFJA 1Z8HA 3D8NA 4ZT5A 3AIOA 4JB3A 5TNXA 4K9DA 3K2BA 3FDXA 2JGJA 5BSEA 1WMEA 5CD1A 1ICIA 3U3JA 1FF9A 3VU1A 4LK3A 3SVTA 4MO2A 4O3FA 5CLGA 4UE6A 4AO8A 2HBRA 1KY5A 3VR4A 4ZDWA 3ZZNA 3L1UA 2W37A 2FPMA 2R45A 5F2KA 4D99A 2P2GA 3SHOA 4D42A 2VL7A 4B32A 1PJTA 1TM1E 1KJQA 1TGVA 5GQSA 1ECBA 3Q3CA 2G7ZA 4K9SA 2XWQA 1ULUA 1KK3A 5A04A 1FRFS 3A32A 4DFDA 4UASA 1R0CA 1YDWA 2O14A 4LE1A 4LHEA 3LLUA 3E3OA 1G71A 1MZVA 4FMCF 3QOYA 1E1RD 3PGVA 3CNLA 4MUKA 3AEKA 5B3JC 2PUGA 3SY8A 4LTNA 3QMMA 2DFTA 1Z6ZA 4BATA 4D9EA 2ICAA 2DSNA 4MVJD 5B36A 1N3IA 1P80A 2IPLA 3I2JA 2BZGA 3T9CA 1OPRA 2KHZA 5F7OA 3TSAA 1G20A 1NW3A 3VM6A 1DLIA 2H4JA 4N7JA 1PLJA 4FD3A 2RK6A 4A6PA 5BORA 2XMDA 3I0ZA 4MR8A 3B5IA 3D7LA 4EJ2A 3HJHA 3SJCA 5LNK6 1FLNA 3VH2A 4Y2PA 3JVVA 4M9RA 4HD8A 4BNJA 1Z0AA 5ERGB 4R1UA 1LTKA 2C95A 3A6FA 4LVCA 5A4IS 1H66A 5KUTA 3JAWA 3LPMA 2F59A 3NT2A 1IDOA 4HDRB 1RRFA 5IJWA 4V2IA 2PFKA 3UAXA 4C7XA 4KNVA 3ZS8A 2GS9A 1ONSA 1YKGA 3EDCA 4MS4B 3LLVA 2Y1EA 1GL6A 3RW9A 5K6AA 2WB2A 4H4CA 2I6UA 1TCVA 1UIRA 2N35A 3CZ4A 3AIIA 4HDQB 1FLVA 1JR6A 2VRNA 1Z5PA 3PKJA 3RAPR 1R0LA 2JKVA 3HXKA 3E9CA 1UWCA 2YW9A 1E1QA 4D6XA 5LKRA 2FR8A 2B78A 3FCUB 4Y3UA 2QN7A 4JZKA 1L4HA 4Q3DA 4EGCB 5DHRA 2JI4A 4D3YA 4U2GA 1EDOA 3GLIA 3AHEA 1UPUA 1F3LA 4XEUA 2FPGA 4NFLA 4UDOA 5JXGA 5K20A 4I1SA 1DADA 3DQQA 3HGIA 2X4DA 2GF2A 4YCAA 5FNVA 4EDFA 4W8OA 2WJGA 4WLEA 2WFMA 1S01A 1ULSA 2I1LA 4XGIA 1AKVA 1XZAA 1DV2A 3ZGZA 1YKSA 3JALB 2CDBA 5DCUA 4YROA 1P91A 2YZ7A 1UC9A 2D0IA 5CU7A 1PYDA 1ZM3A 2BF4A 4M1EA 1ZMWA 1M6NA 3FFWA 4GSYA 4S1WA 1FL9A 1QQ7A 1PNRA 2HIGA 3RRMA 3IUQA 1Y6GA 1MQAA 4FW8A 5EWLA 3ZU6A 3DYBA 2BLLA 1YHZA 1VB3A 4DV5M 1X87A 4N7MA 3BK7A 3NHKA 4RHTA 3GAFA 3O84A 4RH0A 2BFCB 1KP2A 2OPFA 2J07A 1J4AA 1R0RE 1SA0B 1G55A 4OM7A 3PTAA 2O5RA 4QDTA 4J2OA 1SKAA 5FRDA 1SMKA 1GQRA 1FYXA 3SFZA 3DWFA 3NHLA 4UBNA 1A9PA 5IAJA 2DZDA 1ZL0A 2GK3A 4Y6LA 3Q5GA 2QUBA 2XMGA 2HKJA 2GNOA 1JXAA 1PL8A 3R5JA 4N5LA 2WRZA 1N0WA 1L5RA 1VSTA 2Q3HA 5D00A 4HLDA 1JAYA 3CEJA 1PUIA 4UAJA 5A5FA 3EGWA 4ESHA 3TEFA 4ECAA 3MN1A 3JAMA 2R62A 3CLRC 5ALGA 4JY7A 5DT9A 1XSEA 3GY0A 2NP7A 4KNWA 3WXMA 3DVRX 1DCTA 5EHIA 3MJDA 1TT5A 1EX6A 3X1ZA 1FP4B 4NENA 2XDQA 1BCSB 2RI1A 3WBJA 1BTOA 2R00C 4FYKA 2AG0A 4QPPA 1PFWA 3TAUA 2R86A 4JHLA 2PZFA 5EKSA 3QYEA 4FIZA 2R2GA 4NZ9A 5HFAA 3JY6A 4F96A 2C7BA 2AB0A 3EY9A 2VZ9A 1V2GA 1IN5A 1IG0A 3RARA 2D0PB 1KJJA 4E07A 1AHIA 1Y7PA 1E4YA 5K0JA 4KACA 3T1QA 2WJ4A 5EJ4A 2C2ZA 4ZOAA 4IS2A 3LT2A 5KTKA 3TL6A 3QZUA 4QGGA 1WE2A 4IDDA 2FFJA 1SVOA 3GLHE 4AJEA 4WADA 2G28A 2Q50A 1D6MA 3W5IA 5K99A 3COJA 4P0QB 4O4IA 3Q2KA 3VDUA 2Y99A 4ZI7B 1K86A 4FJ1A 2HMWA 1EM8B 4TXMA 5FEUA 5IT0A 5G02A 3D9QX 4TMYA 1OZGA 3WWDA 1UXJA 4Z0HO 2GEVA 2QTVA 5KWJA 5BQXA 3MFYA 2RKBA 4W5HA 2F5QA 3FM9A 4LZJA 3BSFA 3QVGA 1ZOSA 1JEJA 3PFCA 4J0DA 1CQXA 2YHAA 4NBWA 2Q49A 4WASA 2R1VA 2WU1A 3L7CA 3BBLA 3UKDA 1W2WB 3PNLA 4REQB 3RBVA 1Y0BA 5KTNA 2MMCA 1UM8A 2KBFA 3QITA 3K0SA 3H9GA 1KDRA 3IP1A 1BGVA 1EU1A 3NX4A 4O59O 4Q9HA 1GRVA 4KX5A 2HLDD 3F4KA 4LGVA 3RS0A 3RS8A 3NUGA 2DVMA 3SM3A 3GH3A 5EQTA 1R6VA 2CNWA 3AU8A 3J80A 3HCDA 4ROSA 4YEDA 4RY9A 3KWLA 4XGNA 4LIPD 5C31A 4B81A 2FEWB 3SS7X 1ONNA 4R9VA 1BVHA 5AKJA 4OYHA 5JD5A 4FGZA 1FQWA 1PGYA 2V97A 1UFKA 3FI9A 3OH8A 5AQ1A 1TLLA 1RLTA 2JFNA 4ZANA 4LX0A 4M0MA 1XZIA 4C5AA 3CGWA 4O2BB 5ALQA 1IPFA 1D4FA 1XP5A 1MAAA 1P8JA 3AEQA 3RRYA 4LJRA 1YC5A 3ROKA 2X77A 2J3JA 1ZJ6A 4J4BA 3TSZA 4HO1X 1P0QA 4J0QA 1V11A 4G5HA 3A1CA 3BXWA 3EBOA 5ALYA 3L02A 4GM4A 3EZ6A 1VBMA 4B83A 5F5LA 3O3OB 2VDRB 3WL7A 5J2UB 3GPXA 4P53A 3E84A 5B2ZA 2L0XA 1E32A 4N5DA 3L8YA 3ND5A 4AICA 4IV8A 3E46A 4I50A 4V3BA 2SICE 3CH6A 3MTBA 4IRMA 1TGUA 3F9IA 1GG5A 1H4QA 2HA6A 4H1WA 3P96A 5FSWA 3SXPA 3T7SA 5CNMA 4Y18A 3KAKA 2Y6UA 4V0OA 3TKLA 5JD6A 4RSGA 1AKWA 3DZ8A 3PQFA 2C8VA 1OIWA 4MTLA 2OFWA 1PWXA 3FOEC 2PLAA 5ICCA 1XE3A 4IG9A 2Q3EA 4CFSA 1ORHA 1DUIA 5FLYA 3A1VA 3W9BA 3CX6A 3KQPA 3VR4H 2RJNA 3K1YA 5KNCA 4JB2A 1GV1A 3HCCA 3QBEA 4IUDS 1A72A 2JIPA 2CEKA 2BBSA 4OGWA 4Z5XA 5IT9S 2DTDA 2QL9A 3LIPA 4JI7M 5DVZA 1RPZA 3WLRA 2Q2EB 4HUJA 2QDKA 2BEVA 2IW1A 2O48X 1RZRA 1I8TA 1BA3A 2ZJ1A 1L4FA 3HCFA 4ZO4A 4TMWA 3JPWA 1E99A 1R6DA 2WY2D 4F6CA 1TD1A 3SQOA 4EY3A 3U7RA 4DQLA 4AJ9A 1GKLA 5KC9A 1YB6A 4TSFA 2HAKA 4C9BA 2WV9A 5KKNB 1L1FA 4S3MA 3EEQA 3NC1C 2XNCA 1M0TA 2V7QD 1ZVJA 2Q6KA 3IE1A 1IBCA 3DC2A 3ADKA 4QNRA 4D56A 4LJKA 3UMGA 3RYCA 3R09A 3GCDA 3KR0A 3NHPA 3SAWA 5K3FA 1HLGA 3I6IA 1SG9A 2HCBA 1HQYE 1MORA 1KEVA 3EASA 1RR6A 3C24A 2VHTA 1ISPA 1T5BA 2G82A 5DM2A 5DI9A 4N0MA 4RHXA 1TW3A 5DTQA 1NI5A 1P6UA 3COWA 4G4IA 4FVTA 5TQ2B 3D31A 3CTPA 4J1QA 3O21A 5ALSA 3DWIA 3DOIA 4KAXA 4U3JB 4D8WA 1PX0A 3FSEA 4O2AA 4EYEA 4PONA 1MNAA 4KIWA 1WHTB 2V7BA 2FJUA 4ZJZA 3KSZO 1SZCA 1YDGA 3TOXA 5IYZA 1YQWA 4QEDA 1CUSA 2QMYA 3ITDA 3B5EA 1D5WA 4KIGA 1EZZA 1UZUA 3GLVA 3PVSA 4MWEA 4J75A 1U6KA 4DB4A 3BMOA 1RWNA 2GHQA 3H4IA 2OXTA 1U7UA 1RWXA 3AOEC 2PSEA 4X8OA 1JG3A 3HTXA 4E03A 2FH0A 4IOKA 2OB1A 4OAQA 3TDKA 3Q6MA 4EY4A 5A5DA 3I34X 4LCJA 2AZTA 1WM1A 3VKGA 3W2IA 4KYTA 3D4LA 4IBCA 4MW7A 5L8RF 2OHIA 2WSFF 3TQTA 3VVBA 4YMTA 4YRDA 1LQUA 4E5NA 3LD9A 2IUEA 2JEYA 4G85A 1OB2A 1M6HA 1USVA 2GHIA 4QUEA 4Y7DA 4E3WA 3GQBB 4HPWA 2HHLA 2WABA 1UCFA 4XCQA 2ZE5A 4XWAA 3WLIA 2FQWA 1JPJA 3O8OB 2DULA 1W5AA 4F5WA 1SPBS 3H2HA 3IQHX 4YAGA 3WO1A 1YVPA 3OY2A 3SPXA 3DHYA 4R5HA 5L45A 2P8JA 3AHDA 2Q5OA 4F86A 2CT8A 2G9VA 1LGYA 3R5KA 2OD9A 3CLVA 1NNUA 4LZLA 3N76A 2WJ6A 2Q9UA 3EA4A 1DGHB 4F4IA 3PFIA 3PNKA 4DDHA 3HWWA 4QGSA 2E5LB 2PL1A 2CXQA 1EFLA 3CQ9A 2X4GA 1PNOA 3EUAA 4OY3A 3ZXSA 4BQSA 4R31A 4R2IA 2Q1WA 1KMHA 3R3UA 3AF1A 5LQAA 2IRWA 5C5DA 2HX1A 3QJYA 1PZMA 2JPDA 2Z5LA 4WURA 3DUFA 1JIIA 3MGCA 1BMFA 1V8DA 4FUQA 3PZBA 2JFVA 1R3UA 3KLNA 3EK2A 4WK0B 4FOPA 2JFYA 6ADHA 1YE3A 2NU8A 3IDFA 4JVMA 3EC1A 1R6BX 2BVNA 3R3SA 4G84A 3T3DA 4OQMA 4NS1A 2F9FA 4PR3A 3RBAA 2PX3A 2LCIA 4RXTA 4TM8A 5FPHA 5KZMB 4YR9A 3H5LA 3RU7A 1P7VA 4JC0A 4R16A 4LC9A 4B3BA 1O95C 3QNWA 1QZXA 5ITSA 2R60A 3I39X 5F35A 3C6YA 2PKWA 4BXOB 4XAQA 1ID1A 3P4YA 2ZSKA 4DDWA 3TGLA 5JJIA 1ZK3A 2LWIA 5HQJA 4QUIA 4OBXA 3OQOA 5ITQA 4IKEA 3USZA 1LPPA 3BDVA 1CVRA 3WHPA 4PVCA 1XRQA 2NAFA 3GQ4A 1HYHA 4RVDA 4TV9B 1FIUA 4DXDA 1QPBA 3V2UA 1O96A 1WABA 2KE5A 1P17A 3HCBA 4QFBA 4I1VA 3UNXA 3LW7A 2OFFA 3URMA 3FFTA 5AK0A 1PSDA 3A14A 1IXYA 2PMDA 4NS4A 2FMXA 3GWZA 1D2GA 5D7BA 2WSSA 1U11A 1EUCB 5ITXE 2XT9A 4L5IA 1DWOA 3UTCA 2QRGA 3SHFA 5ALOA 4DA0A 3IKJA 2K6BA 2AMYA 4R41A 3P1JA 3OCVA 3PGMA 3C7AA 1JFRA 2CUNA 4YUWA 2QLLA 3IALA 1CZHA 3TX6A 4AJKA 2FSGA 4KVAA 1FPMA 1C7YA 4PRZA 5FA6A 5BW8A 5EMJA 1LFAA 2J9FB 4DC1A 4PLVA 1U9IC 5DGDA 1T5HX 1K8XB 4HAZA 1Z0UA 1USWA 2Q7OE 1SBQA 3JZDA 1U65A 4C7OA 2BDEA 1VLJA 2RHHA 1R9JA 4E31A 4N47A 2PS1A 1VKJA 1BKYA 4PSVA 1QB8A 2J0UA 3OZXA 2SCUB 3TUIC 4CKEA 3CLRD 3TVDA 1H22A 3IODA 3GWGA 4ENWA 4FMBB 1ZNQO 3WQBA 1W1UA 4EZBA 2C9YA 1MN6A 1TF5A 4J0KA 1T6OA 3KXLA 1GADO 2FMUA 5FBKA 3V80A 1QONA 4H16A 4XSGA 4BVLA 4LRXA 3VU3A 2X76A 3AUJB 1E2QA 4PRYA 5DOZA 4YJGA 4GWGA 5JJCA 3NWOA 2IVFA 1WNTA 2PTGA 3KZOA 2PD3A 3Q7IA 2JIMA 2UXDM 3TTXA 4M7PA 2BGMA 3B7GA 1RFGE 3A9TA 1HZZC 2A8YA 3UMJA 3VDNB 4PBSA 3OTQA 1PT5A 1TJ5A 2GNPA 4RZHA 3DJFA 4IWYA 1SBHA 3PGXA 1PQUA 4LX8A 4PZ9A 1OB5A 3HL4A 1G5TA 2EEZA 1P1CA 1WSBA 4JI0M 3R76A 4W9RA 1A2KC 1U0RA 5GGYA 2P0EA 3TQQA 4MWSA 1EHIA 3IEXA 2DEUA 4DKXA 1FX1A 3GLUA 4WOBA 1DWPA 1HRDA 3THWB 2M6SA 3OLXA 3GPBA 4EHLA 1YI8A 3LZDA 3ZK7A 2ZJZA 5ILGA 4J0FA 3EZ2A 1L5OA 5KNCH 2XVAA 4EY8A 1GO2A 1TKRA 4PNPA 2XTAA 3I6QA 4WOJA 4FDLA 4R6XA 3HABA 2JRLA 4MYRA 1V16B 2P2YA 3PXXA 2VWGA 1WPRA 5ALXA 1O58A 3ZKWB 3WWCA 4HWRA 2I2DA 4PWZA 1XNGA 1PTJC 1HUQA 2F90A 1XDUA 4QT0A 2HFKA 5KMGA 2XMQA 5C7OO 3SYKA 4F3YA 4AQYB 3U13A 5G1PA 1ECLA 3URKA 5G4KA 2FSIA 1GYQA 3HE3A 4UDNA 1QQ6A 1ADCA 1QYIA 4RD2A 4DBLE 5J47A 1KVUA 1ZOPA 2EW8A 4B6GA 3C6MA 5TEWA 1YI1A 4L3OA 1JTFA 4UDYX 5B6PA 3ANSA 1NVMA 1N2IA 1K5GA 2E87A 4XYLA 5DOVA 4F5ZA 5C1DA 4KMOA 4ND5A 2M60A 1M54A 3GZ4A 2CWWA 2BFOA 2DWPA 1S3IA 4KE8A 3HGQA 5L3VA 5C4GB 3LL7A 2Q5HA 3GV0A 4YVFA 3FE3A 4QOFA 1ZGJA 2FW1A 3OICA 1Z0SA 3ZTTA 3GEBA 3DWEX 1L8XA 4YCLA 5TGDA 3DEJA 3BF8A 3LP5A 2G80A 2IEIA 1K4KA 1RJFA 2Y0PA 4O33A 2J45A 4FFMA 1XCGB 3QBDA 1ZVQA 3KOYE 3RADC 4D8UA 4HEA1 1G41A 4TRJA 5A2QA 1EVLA 2FPKA 1JILA 5BT8A 1NN0A 3WGQA 3OZDA 2XDAA 3CT4A 2N75A 5L95A 2DG2A 1NWCA 5EIOA 3IMKA 4IGFA 4EX7A 2FPUA 3HEAA 2YIJA 2HK6A 4X60A 4DR3B 5DNCA 3NHRA 2ATVA 2IY7A 2ZUWA 3RUPA 2C1XA 1V7PC 3AVYA 5H80A 2R68A 4QDXA 4JIMA 5DX0A 4XQEA 1LY1A 2FNAA 1V71A 2XMPA 1A50B 2YXNA 4OI0A 5A2GA 4N76A 1U6JA 4RTKA 2SHKA 3KEGA 3AKZA 3GJQA 4F4DA 2OQ4A 2ABWA 3DD5A 3FKSA 1D2MA 5ECDA 2OYRA 3G8CA 3V4SA 5J58A 3GD7A 1DLJA 2P6UA 1P5HA 5T4HA 4UVDA 3P9CA 4O1HA 2JB9A 1QX3A 2XLJA 3TEMA 5ITRA 4LYGA 4UU8A 5BV1A 1J21A 2UXBM 5KNBD 1NC1A 3KJFA 5LMNB 4UU7A 5FUXA 2YX1A 3HPQA 4ZMSA 2CE7A 2C4NA 1Y5MA 4F1IA 1PKXA 3KP0E 5F33A 3N7TA 2A6PA 4PG5A 1T2DA 1DKUA 3GUZA 2OV2A 4YRMA 2X0FA 3OD5A 1IN7A 3IFSA 4ARVA 1ZA2A 2Y21A 2EA0A 4LSMA 2I55A 1N77A 2DTXA 4QTZA 1J0DA 4JK3A 2KQUA 1GQ2A 2YQ4A 4P22A 5MN4A 5FNVF 2Q99A 5AYVA 2CXOA 3HY3A 1ZDMA 2YNMD 1K75A 4EB6A 3KHSA 1UUFA 4LZZA 6ABPA 3EAGA 2XOEA 1PO7A 1PJRA 5IT5A 5KYWB 3U37A 4C7JA 2Q46A 1T0BA 3FWYA 1UKVY 1LLFA 3WRVA 1OTRA 5KCMA 2HBZA 5TPZA 2KZSA 4HDNB 3PRYA 4KSCA 3C5EA 4I0WB 4XZ3A 3TB6A 4BMCA 2ZUFA 2Y05A 3ZK9A 1EIJA 2GXQA 1GNRA 1KDOA 2BY4A 1FVFA 2Z1MA 1UC5B 4A0HA 4WQMA 4MKFA 4GMFA 5EHGA 2C78A 2G5CA 1H2HA 1IZ7A 1O94A 4CEHA 4M2LA 1XNHA 3F6BX 4Q7MB 3PYMA 3HB4X 2VTBB 1C7RA 3NTXA 4UUNA 1DP4A 3IOCA 4QATA 4U9UA 5K0EA 4CLRA 3NFRA 3R0ZA 1XMVA 3FPSA 2WM9B 1C4OA 2XEPA 1NTOA 4YDSA 1Q0UA 3CRMA 2JJYA 3HO1A 1DXQA 5BPFA 3WZ2A 2QQ8A 2YYZA 5CX4A 2P9QA 2YQ5A 3STUA 1YTUA 4GGOA 4QDUA 3ZC3A 4MW6A 3ZY4A 4FVMA 3LY8A 4AD8A 4K6FA 1PFKA 4EMUA 1NM5A 4XTCS 1EFUB 3AVVA 2AOUB 1U8YA 3IQZA 3OX4A 5LMUB 3MAJA 1JKJA 1PF7E 2VVTA 1X7YA 3U6OA 5JSYA 1IE3A 3MC1A 3REFA 1RKBA 2E6KA 2PGIA 3W0LB 3BF7A 5AVZA 3H05A 1WHCA 5JTUA 3NDBB 2D8MA 2I2XB 2EX1A 2N3ZA 3ZHBA 3O7MA 2XB9A 1KH1A 4EW6A 1E6WA 4FEGA 2YY6A 3DUWA 3LBYA 4N4AA 1CRWG 1ACMA 3IAFA 1Z28A 3UOGA 2IYLD 2VKQA 3HXPA 1KJ8A 1A77A 2COUA 4EKYA 1WCYA 3QWAA 2H4WA 2ST1A 1C7ZA 3UA3A 4R3DA 4AJOA 5DXFA 4IIVA 3HS3A 2R8PA 3I2IA 3Q3VA 4HFNA 4CMBA 4JUDX 1V3QE 1QR2A 3UHPA 4OHPA 1N8NA 1ABBA 1X1TA 1DJOA 3GB9A 5EMMA 4MVCA 1YRHA 4V39A 2HPAA 1XEWX 4O4IF 3DE6X 3VYTB 2H48A 1ZX1A 2FEAA 3OIDA 3G9TA 2EAUA 4UDXX 1IEXA 1V43A 2A5FA 2AFHB 4L5AA 1R2QA 2VCHA 3STVA 5E0KB 4LRYA 4DPLA 3O4VA 4S1PA 2JASA 3FN4A 1CQWA 1ZONA 2C0QA 3VZPA 3KJNA 5K01A 3O26A 5KINB 3Q7QA 3C4VA 4OHWA 4AWBA 1R9MA 3JQ8A 3OF3A 4HAUA 1G66A 2N1MA 4JENA 3T6PA 1GTRA 1XN1A 3CV3A 1P44A 3LZCA 2ZTUA 4ZICA 5LKAA 3GPCA 1UL1X 1UKAA 5B58T 2GN8A 2GO7A 5H68A 2P41A 4JCOA 4WLNA 2RHBA 4PR0A 3MIZA 3OLCX 4HWTA 3HCRA 4KR9A 1HETA 5AVSA 721PA 3L4BA 3DB2A 1ZR2A 1YR3A 4PG6A 2I03A 1YOVA 3U3XA 3THYB 3PQEA 1J42A 3ZCXA 1N2CE 3R0XA 3NHFA 3WBBA 2G25A 4LF9M 3DOEA 4D4KA 4MR7B 5J5VA 3V2GA 1PJBA 1N0IA 4P33A 4CTMA 1DTSA 4O4JA 2AOTA 5IRCD 1G9XA 3AMVA 2VP4A 4PSUA 2NTVA 3PP8A 5A71A 4CKBB 1PFYA 2X2EA 4HRVA 3OBIA 4LYFA 1MGOA 4G4NA 3HJ8A 1U0NA 3OUTA 3IUJA 3PNQA 2AJCA 3KQTA 3FNEA 1WX1A 3V42A 1KAOA 1P61B 3GRKA 2JF0A 2NIPA 5KPJA 1JHRA 3DEZA 4BECA 4XFJA 1H69A 1PT8A 4G1UC 4GLFA 3H5TA 4OJMX 2CWBA 3PC7A 4I50F 5FBWB 4IIJA 1VPEA 2Z5FA 5CDHA 1I94B 4G67A 4YAEA 3RUIA 3BHJA 1HG1A 3BCRA 4C4PA 4GEGA 3CG0A 1UFZA 1G5IA 4DR4B 2DXIA 4URFA 4L95C 3GRYA 3AM3A 4G5OA 4R2LA 1T0HB 3G0GA 3RSQA 1GYRA 2DFDA 2ZB3A 4HWSA 3E5HA 4OK6A 4EG4A 5IF3A 1P9WA 4CM6A 4CM8A 1RJWA 3P20A 1ZM7A 4O2RA 4P4UA 4N7RA 5FHQA 1I5RA 2IZ5A 3CB4A 2ZBPA 3J81S 4EGFA 4JBNA 3WYCA 4NQZA 1YRYE 4GRDA 4ZAWA 3LBAA 3QBVA 3QWIA 1CZRA 4ZT3A 3HO6A 4JP3A 3WJ1A 1HE2A 2YICA 4NV1A 2K7ZA 1Z39A 4C87A