4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Fidgetin-like protein 1
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
1XCGB 3IO3A 2QAGB 2B8TA 1Q20A 4QFMA 3KDSE 3SYLA 4V03A 2EFCB 3THYA 3K9GA 4YQFA 5GJBA 3SQWA 4LBYA 4M1TA 5JJIA 1C4OA 1ZU4A 5AJZA 2O5VA 1U8ZA 5DI9A 3SYNA 3DM9B 2J87A 5DO9A 3NH6A 4NYIR 3KKPA 3KKNA 2XOKD 4LJ6A 2BMFA 2IUSA 1E1QD 5G3ZA 5L3VA 4OHYA 3BWDD 2WSSD 3IQXA 3LQQA 2OUKA 4NCKA 1TUEA 4QGHA 3SFVA 4JVSB 2YC4C 1QHHA 2Q9AA 4B47A 4TLEA 1F2UB 1OE0A 1YRBA 1VCNA 5KU1A 3THWA 1CRPA 5EE9A 4QJ4A 2QAJA 2YWGA 1EFTA 1NKTA 3IIKA 3GJXC 1XCPA 1XJQA 3HPRA 2BMEA 1M7HA 3EZFA 4HLUA 2DFTA 4N0EA 4IEIA 5C1BA 4MGZR 1NF3A 1IN5A 1OW3B 1BS1A 2OSBA 1ZUNB 2ZJZA 3HU2A 3CPHA 4NPHA 4PQYA 4H1UA 2XB4A 4TT3D 2C95A 5AJYA 3A8TA 4CEJA 3E1SA 1GL6A 3I8XA 4AURA 1QHGA 1MABA 4YXWA 1XTQA 4BFZA 1F6BA 5EXTA 3GQBA 4K46A 2W83A 1XXHE 1OV4A 3X1YA 1XZQA 2A5DA 4C0AC 2BBTA 4AKEA 3K70B 3CM0A 5FBQB 4PPGA 3BXZA 3O8RA 3CX8A 3K9NA 2P67A 2QAGA 721PA 3B9PA 1P60A 1ZAKA 2ZJOA 1HT1E 2HYIC 2VA8A 4ZKDA 1LF5A 1JEDA 2RCNA 4C7OA 2VQSA 3EA5A 3FYHA 3WHLA 2JCSA 4RY2A 3PXGA 1KI7A 2AXPA 4M22A 4DEYA 4M9QA 1RJ9A 2IWRA 5DYIA 1DS6A 4IW3B 1G8YA 2PLFA 1DO2A 1VMAA 1NN5A 4TLDA 2WMOB 1ELOA 1U9IA 2FJUA 2UZ3A 3LD9A 1ODFA 1F2UA 1XNJA 2W0MA 4RD2A 1U8AA 3B1XA 3D3QA 2O0JA 4LBZA 3QF4A 3EPKA 1CXZA 2OFXA 4JMPA 2GBLC 2WWIA 2WIBA 1U0LA 1COWA 2ZRLA 2V4ZA 4DSNA 4LBVA 1XEWX 1YZNA 1XX6A 4YMUA 2ZS8A 2GILA 3ZVRA 2VP6A 3GJ0A 2JJ1D 2IF0A 4Q9IA 1K5GA 4DDTA 3X1XA 2GVDC 4TLBA 4EAQA 3TK1A 2DZOB 1MABB 2ZANA 1XDBA 1O87A 1P61B 1KKLA 1TADA 2BDTA 4D2IA 3PR1A 3BH6A 1NVUQ 3MCAA 2RGNA 4Q18A 3ZIAD 5CLQA 3GLHA 3JZAA 1WBBA 1BIFA 1I2MA 1TU4A 4I81A 3EX7C 3WP1B 3OE7D 3WBJA 4B73A 1GDDA 4JL8A 3L0IB 4Q47A 2ZJYA 3WRYC 4C0QC 3W6NA 1NIPA 3IQWA 1FFHA 4C7OB 4RZ2A 1GRQA 3B5JA 5JEEA 1ZNWA 3T1OA 3M4YA 2KB0A 4KV9A 3BFXA 2GBLA 2ERYA 3D7MA 3SBEA 1UBGA 2J7PA 4QC2A 4HAXA 5LBIA 2P65A 2ZRHA 4G5SA 4TQAA 1DO0A 4F4CA 5CITA 1U98A 5LD2C 2D2FA 1ZYUA 5CJ2A 3PV0A 3O47A 1DELA 1VKJA 2WM9B 3BS4A 2IYUA 2R2AA 2EFGA 1FUKA 1JR3D 1ZCBA 1IM2A 1TEXA 2D62A 2EW1A 3DDCA 2XSZD 2OV2A 4MGIR 4PTLA 4EIWA 3ZDQA 4XTCS 4E5UA 2PBRA 1M8PA 5JHHB 2QZ4A 3U3KA 1NI3A 3LRPA 2VHTA 3T34A 4D0GA 3HPQA 4OKSA 3PEWA 4WZBE 3X1DA 4PHTA 2X77A 3QG1A 3NHBA 4OHXA 5A4JA 3SFZA 4JBWA 1XXHA 1GFIA 2VHQA 3Q7PA 4M2LA 2R6AA 3AP3A 1BO6A 3S1AA 3LVQE 2QBYA 1E2LA 5TVKA 2VBCA 3IHLA 3A4NA 1UBCA 3GLHB 1KO7A 1G4UR 3DOEA 4DHEA 5HKKD 1WA5A 1ZIOA 1AS0A 1E9SA 1VHLA 1TMKA 1D9XA 2GZAA 4F93B 2BM1A 2F7SA 2G1KA 1J70A 1NN1A 2KSQA 2RH5A 4MYHA 4YDHB 3VHXA 3MWKA 1OHHA 2H17A 2YKGA 2ZTSA 1DADA 1KMHA 3CBQA 3CRVA 3T1VA 1LS6A 2HF9A 1Z6YA 4IKEA 4DKXA 3L8YA 1NVMA 1E9FA 3RC8A 1G16A 1S9DA 4NYMQ 4BQSA 2GKSA 2JLWA 1R4AA 1E3MA 2HJGA 3MLEA 1XTIA 2J9RA 2I4IA 2FG5A 4LX0A 4OHVA 4R2IA 3B60A 3VU9A 1SZPA 1K5DA 2JLRA 3CONA 2A30A 1OH8A 2CVHA 1ZW6A 1XJCA 4IXMA 2G3YA 2QMUA 1M2OB 4C0LA 2J1LA 4Z1MD 3WP0A 5FFMA 3F8TA 4X8HA 3GLFE 5JRZA 4XJXA 3PVSA 1ZU5A 3OIWA 3ADDA 1Z6AA 1P75A 2CCGA 4HLCA 2DWOA 3VMFA 4EPWA 5F98A 1VCMA 2CXXA 1FX0A 5JHGB 3A1TA 3K0CA 4N1AA 1N6NA 1IN6A 5SZIA 2XJ4A 1E2QA 1N6IA 2IUUA 3C7KA 5A5GA 5CLLA 1CJTC 3MFYA 1KSJA 1Z3IX 2QP4A 4PPNA 2QBYB 3KZ1E 4A82A 4LJ9A 3BOSA 2F1IA 2WJGA 4JVMA 4BLTA 1Z0KA 1GP2A 2ZI6A 2ATXA 1FPMA 3VR5A 1YJ5A 4H1VA 4QBGB 3J81k 4OK5A 1R7RA 3HR8A 1CP2A 3LX8A 3U3RA 1X8LA 1IY1A 3TW8B 4DLVA 1SHZA 2Q6TA 4GOKA 4BUJA 1JR3A 3RYTC 4A0FA 3PG5A 1VG8A 1Z47A 4M8NE 2FH5B 1Z28A 1JECA 3C14C 3P20A 5EZ6B 1NP6A 4HYYA 3R7WB 2XJ9A 2YC2C 4TLAA 1ZNXA 5EP3A 4D4JA 3CX6A 3QY0A 4Q5IA 2PZEA 3TSOA 2B7BA 1KO4A 2GZHA 3I3SR 1HEIA 3K9HA 2QORA 1EFCA 4TT3A 3W6PA 4UNQA 4L8GA 4ZO4A 1JJ7A 2DY1A 4TYNA 1NY6A 3QSYA 4FMDF 1G41A 3MJRA 1VG1A 2PCJA 2YWHA 1E2DA 4CRWB 1LY1A 4HDCA 4GZMA 1AIPA 1AZSC 4YMTA 2PT5A 4HAUA 2VP2A 1IQPA 1QZXA 5D3QA 1UKVY 4A92A 1TTTA 4US1R 2FFBA 1KHTA 1T3SA 2ZAMA 4O2LA 2P5SA 1KZGB 2H18A 1T5IA 2H92A 3OHMA 3PCRB 4US0R 821PA 8OHMA 1KSGA 5JI3E 1G7RA 4IVPA 2GHIA 1EFRD 1MKYA 5CYPA 3ZZ0A 4UXJA 3VNUA 2IS2A 3DEFA 3HP1A 2AX4A 3BD9A 1Z2AA 4DUGD 3NWJA 2DZNB 1A82A 3ZVLA 4MYCA 3GEIA 2GF9A 3P1JA 1KAGA 3UMSA 1G7SA 1SULA 4PQFA 2PLRA 2EYQA 2ZVPX 1ZP6A 1G18A 3R20A 3K9LA 2BCJQ 3DM5A 3CH4B 1Z0FA 2J0VA 1JALA 1NMZA 3THYB 2BKEA 5FTNA 4A3VB 1OIVA 5IF9A 3R7WA 5AUOB 4LHWA 4B3FX 1GL9B 2GEUA 4IFEA 4KFUA 1TPZA 1G4AE 4K81B 4LK2A 2FFHA 2F9LA 2QMHA 4JIMA 3THOA 1S3SA 1AN0A 1KY3A 4NMMA 4OI2A 3TLXA 3KJGA 5LB2A 3GJ3A 4HDQB 5P21A 4NBSA 1E9EA 1F5NA 2CBZA 2Q3MA 2C9CA 3KQKA 4RCYA 1TL7C 2P3SA 4D4LA 3NBYC 3FMOB 1Z29A 3SC3A 3THWB 1H8HA 3FMFA 4PR0A 3FKSA 2FSFA 1WMSA 4MYUA 1CBUA 3EXAA 3K0CC 1D5CA 4NCNA 1IAQA 4NONA 5KUTA 1GSIA 3BB3A 5HCIA 2VPPA 3EZ7A 2W2XA 3UPUA 2OFOA 1WRBA 1DAGA 5AJVB 1SVOA 1G6HA 3D8BA 2GTPA 5FOVA 2ZXUA 2OCYC 4YXWD 1GTVA 4OQNA 3EPLA 3DZ8A 5TB5A 3QXSA 3TAUA 3V4FA 3KQUA 1GKUB 4HLDA 2F9MA 4U5XA 1KI3A 1KO5A 1S0UA 4GSYA 1AA9A 5EXXA 2IL1A 4A8JC 2AN9A 2VYFA 1T8TA 3QPVA 1NLFA 1W2HA 5K8UA 2QL6A 1TEVA 2ZJ2A 4BE7B 1Z63A 4OJQA 1T9HA 5FI1B 1XTKA 1L7VC 2A9KA 1KDOA 5TV2A 4CVNA 4NYMR 4L9SA 4B6EA 2QI9C 1Q1EA 2C8VA 1Y3AA 4PANA 3EWAA 5KPDA 3VNVA 3L0OA 5KSZA 3FMPB 2ORWA 4Q9LA 3OEEA 3UIEA 4LJYA 3SU8A 1G3MA 3K8YA 2JLUA 2R62A 2ZE7A 5BYKA 4ITRC 4Q9KA 1KK2A 2IS6A 5FR1A 1EX7A 4JLOA 4HI0E 1B23P 1FZQA 1A7JA 3AP1A 4TSFA 2V1XA 4O0MA 1W0KA 4O2RA 3CZQA 1E94E 2ATVA 3A37A 1NNEA 5IK2A 1OJLA 1YR7A 3QNUA 3KFVA 5IHPA 3IDQA 3X2SA 4OQFA 3OF5A 3SN6A 1OXXK 3GLFA 2ZYWX 1CEEA 4GFDA 2QTHA 1HA3A 3QF4B 2DVWB 3ZVMA 1XPOA 3EIHA 2WJYA 1QF9A 1R5OA 2Z0MA 2ZR0A 3SEAA 4G5RA 3UMFA 3PFIA 1AKEA 1OKKD 2H7VA 4ZCLA 2FNAA 4IOKA 3EAQA 1II0A 3PENA 1R8QA 1RVDA 1X8JA 4MRVA 4PAQA 4AC9A 1CJKC 4HSEA 2HT1A 4AI6A 1NIJA 1DAFA 4ON9A 4TYQA 4KVAA 3I5XA 2DBYA 4PSKA 2B8WA 4DDUA 1U94A 2OLJA 1PVOA 3QEOA 2A5YB 4NDZA 1NL3A 4QGFA 4DB4A 3EPJA 3AP2A 2FSHA 5ELXA 2VSFA 4DZZA 2WV9A 1BMFD 5GJVC 2QAGC 3WY9A 4A36A 5TY0A 3AVOA 1XEXA 5B58C 4Y0VA 1GKYA 3FKSD 4AY2A 1JNYA 2BV3A 1J99A 4B3DA 1X3SA 1XPRA 3C5CA 3KL4A 2OM2A 2QA5A 4US2R 4S35A 2J7PD 3WNBA 2JJ1A 4V0NA 4XTRA 2AL7A 4AWXA 4JLJA 1WCV1 3P32A 3GLIE 4G5GA 3B7GA 5SZHB 4U00A 4M9SA 2JLSA 3LQRA 1MV5A 2FPMA 2VH5R 3KJIA 1AM4D 3C16C 2FEMA 2KWIA 4OL0A 4KSBA 1DARA 2ODNA 4B33A 3BB4A 5L3SA 4B3BA 1W36D 1P9WA 3SQXA 4PX9A 4TMKA 1SKQA 5H8WA 2HYDA 3SBDA 2MMCA 4HAZA 3RS4A 2CVFA 4S2EA 1I4TD 1LW7A 2FFAA 2VP5A 4R9UC 3RRYA 1UEJA 1YR6A 2IC5A 3OEHD 3FOZA 3DL0A 2CJWA 3SOPA 2J0QA 4P0TA 3LXRA 4DC9A 4M1KA 3W3ZB 1PUJA 3AVQA 2RAPA 3MAAC 1J90A 1BH2A 3CX7A 2ZU0C 4M1SA 1EFUA 2YOGA 3GJ4A 4A8JA 3AVXA 5B30A 5UKDA 3VR6A 3GLGE 2R6CA 1W4RA 1VTKA 4TN1A 4EJSB 5KSYA 3O8DA 4FN5A 4UNRA 4BLPA 3K70C 2ZRJA 4BPBA 2JIZA 2ZVQX 2D06A 4GOJA 5FPTA 4QOSA 2EWVA 2FZ4A 5HE8A 1PLLA 1QHIA 2FX3A 2P5TB 1E0AA 4B34A 5KOYA 3E2IA 5FUXA 1KY2A 5FBRB 2WAYA 3L43A 3G0HA 4TZ6A 3ADKA 2IEZA 1KDRA 2FE4A 3C15C 4Q00A 4WXRA 3JZMA 3TE6A 4A9AA 3TBKA 3AUXA 2CHQA 3BIFA 1WBDA 2QPAA 2BMJA 4JT2A 2YZ2A 3TH5A 3VU9B 1IN8A 2KBEA 3F3YA 1QHXA 2QP3A 4JJZA 1EK0A 1ZMXA 3QG5A 2WAXA 4RJLA 1G3QA 5A0FA 5JCZA 4BRUA 2MMGA 4Q02A 4IEEA 4IHQA 1DAIA 4Q7MB 1SVKA 5JS8A 5L3SB 1OT3A 1Z22A 1Q1QA 2EVWX 1E99A 5K8IA 3TUZC 3ZD6A 1II8B 3CH5A 1DG3A 4H9GA 4RKFA 1RRGA 1KI8A 1OHHD 2IT1A 1ZNYA 2JLXA 1LS1A 4CEHB 3B8HA 1Z83A 4LBWA 2N1BA 3HYRA 4TQUS 4B75A 5E7MA 3UG7A 5C46F 2WSSA 1AGRA 1Z08A 1M6NA 2FDCA 1R5NA 3T5GA 5JWHA 5AR1A 1OFIA 1V43A 2GVZC 1UKEA 4JVLA 1TF2A 4NCJA 4TL6A 3VR2A 3ETLA 4F4JA 2EWWA 3V4RA 4QHTA 3NBXX 4AYXA 2C5LA 2JJ2D 5KO2A 2GEDA 3QKUA 4DBLC 4EJSA 2BIFA 4LHZA 3GCGA 3VFDA 1TQ6A 3GJ7A 4XIGS 4AIIA 4IDNA 4FWGA 1G64A 4FMBB 5KTYA 4LJ4A 1VCOA 2GCOA 1V5WA 1JXOA 3Q85A 5KDLA 3U3MA 2VP9A 2KJQA 3SDZA 1WE2A 3EZ9A 3VHLB 1BYIA 4GZLA 2CNWA 3GMTA 1XTRA 3I72A 2ZRAA 1XMSA 1N0VC 4DJTA 3I62A 5AUPB 1YZGA 1DG1G 5CYOA 1EFRA 3LBNA 4HB2A 2ODEA 3AJIB 4TTQA 3T1QA 2OT3B 2EFEB 4Q1DA 3GJ6A 2ZI9A 5JS7A 1M1YE 1UJ2A 1YVDA 1DAKA 2F3RA 1J2JA 2MSEB 5AK0A 1RFLA 3RSLA 4TZ0A 3ZQ6A 1NSTA 2A5FA 4DLRA 3MHVC 5FR2A 1D6JA 4C30A 2PJZA 4DXAA 3OIVA 4V02A 1G19A 3SR0A 3THXB 2FU5C 2XEXA 1TF5A 3WMGA 1ZC4A 1NG1A 3IIMA 3L0PA 1FOEB 3QJYA 4LSGA 3SZRA 2VL7A 4URYR 3TSWA 1UEIA 2ZQ5A 2EFHB 1G21E 2PZFA 4JLKA 4B3GA 3K0SA 3WYGA 5KYKA 2GDJA 4Q19A 4A2QA 1X37A 3AKYA 2R9VA 1EG7A 2V6ZM 2XX3A 3NKVA 5CJPA 1G7CA 3K53A 4MKIA 4WOPA 4DSUA 3CKLA 1VG0B 4RD4A 2LKCA 5HKKA 4OK3A 5KHOC 4LC1A 3WRXC 1KDTA 5FPHA 3D31A 1XPUA 1COWD 2YWFA 4D80A 4ZCMA 3GD7A 4LOAA 3EIEA 4M9XA 4NP6A 1XU4A 5IRCD 3U44A 4RD0A 2QSYA 1ESNA 2OZEA 2OG2A 2CDNA 4E03A 5DLQC 4TYYA 1ZVQA 3CW2A 1VECA 2BOVA 4ARZB 2P0EA 3AVPA 3GP8A 4LCBA 5F9FA 4HAVA 1G3IA 1VYUA 2IXEA 4YMVA 1Q22A 2OBNA 1OXTA 3TAHA 4DSOA 2KE5A 4URVR 4PHFA 1FP7A 4MKHA 1P2TA 2XNDD 3H2YA 3TQCA 4NU0A 4EUNA 2OHFA 3RWOA 1GM5A 1YZLA 2G9NA 1W48A 1NJGA 3NTUA 3I32A 1LV7A 1JBKA 4HB4A 1OFTA 3VR1A 521PA 2J0UB 4NYJR 4Q4HA 2J7KA 3P26A 2DFNA 2QE7A 4LHVA 1HQYE 1E9AA 2YV5A 1DAMA 1LVGA 4OHZA 3LO5A 1NVWQ 4Q1BA 4FCWA 1E2NA 2DFLA 2ZS9A 3VTKA 3ZS8A 1ZUHA 5CB8A 3ND8A 2ZSEA 1OB2A 1D8TA 2WOOA 4D0NA 1A2BA 1ZD8A 4DLUA 3RRZA 1I4DD 3VAAA 1Z0JA 1MRNA 3NEJA 1YR8A 2ZEJA 2OESA 2C9OA 1XRJA 3ZH9B 3ZQJA 4QGGA 2CLCX 2GETA 4I1SA 5DSZA 3M1IA 4RSGA 4KO8A 2ZETA 2PZGA 3W3AA 1EXMA 3EWSA 1E79A 3R9IA 1CF4A 4L4UA 4A15A 3RS0A 1E32A 2HDNB 2G77B 2J41A 5J47A 5J40A 3U44B 4Z8XA 4UXIA 2JLYA 2VHCA 3A4MA 4LJ7A 4G1UC 4AD8A 5HE9A 3IILA 3QUSA 4MGYR 1FQJA 5JLJA 3B85A 1P9NA 1U90A 3FMIA 1OXSC 4ARZA 1DAEA 1G1MA 4XWKA 4WXPA 4TL8A 1N6HA 3BERA 1BKDR 1ZC3A 1MO5A 2ORVA 1FNMA 2O52A 2VIIA 1YKSA 2IA5A 5EE5B 4NE2A 1Z0DA 1MOZA 2NZJA 2JGNA 3W9YA 2HV8A 1FMLA 2XTZA 4GP7A 4BFVA 2FF7A 2NMVA 4PZZA 4Q1CA 1OH5A 1HTWA 4P3YA 1YQTA 1ONBA 3AV0B 4DIDA 4C0KA 2F55A 3PUXA 4QNMA 1R8SA 1PJRA 2XITA 4W5JA 1OH7A 1GOTA 4QHYA 1NKSA 5GJWC 1F48A 2GF0A 3O8CA 1SXJE 4LWZA 3A1SA 1Q0UA 2C03A 2QN6A 3RDPA 2OO7A 3CRMA 1CLUA 2C99A 3P27A 3GLFB 3U7HB 5FTKA 4B44A 2WVJA 4EPTA 4WW0A 4YONB 1OF1A 1SXJD 2BVNA 2J46A 1AS2A 4G5OA 5E95A 3ADCA 3SYKA 1AQYA 1QDEA 4Z54A 2H57A 3ONWA 1CKEA 5FI0B 5E7IA 1FL9A 2C77A 3GEEA 1H8EA 3CR7A 1ZIPA 1X1SA 2DYKA 4LHXA 3UK6A 1JB1A 4OQXA 4EFMA 3MUFA 2CL7X 4K8OA 4U02A 3VQTA 1YZUA 3EA0A 1B0UA 1KJWA 4JLPA 4B2PA 1A2KC 5M04A 5GVRA 1HUQA 4PO1A 2H8KA 3WNCA 3IUYA 2WWGA 5ANRB 2EQBA 4II7A 1UBFA 1CIPA 1FQKA 1KTVA 2A2ZA 3KXIA 4QBHA 1KNQA 3CB4A 1N6RA 4W5HA 4D4KA 2FZLA 2YOHA 2XNSA 4BECA 4DEXA 2F1JA 4KBGA 1SVIA 4DT1B 3UWKA 5JFGA 1KK3A 4UJ3A 1ZM3A 1R0WA 4NH0A 1OPXA 5EZ5A 2B6HA 1XEXB 1CRQA 3FTQA 3RLFA 4DLSA 1Q57A 2VRWA 1P9RA 2OILA 4HB3A 4JLMA 5DE3A 4MDEA 3AM1A 4Q1FA 4LGMA 3I61A 2ZROA 4JSYA 1R5BA 5KPJA 4JLBA 4IOJA 2O8DB 1U2RA 1S96A 4RZXA 5BN5A 2REXB 3LBIA 1I2DA 3NEYA 2VSOA 1AS3A 2C2HA 4BFUA 4W5WA 5CB6A 1N2CE 3ND9A 1IJEA 4CZ2A 2O8EB 4I1VA 3SJCA 3TW4A 3KQNA 1MO3A 4EKDA 4NZYA 1WP9A 4PC7A 1OYYA 5HTKA 4DWJA 1IY2A 3TR5A 2WWWA 3FVQA 1XZPA 4EPXA 2J5XA 3ASYA 4DLXA 2VP4A 4FCTA 1MO4A 1WF3A 5CDFA 2FFQA 4KU4A 3EPHA 2CJWB 2ZYUX 3VX4A 4RFVA 4IVQA 1FW6A 3SJZA 3Q9LA 2C98A 2DFKB 4DCUA 4P31A 5JJKA 3N2IA 5JRJA 3KKOA 2QEQA 3V9PA 1KOFA 1SQ5A 2OE2A 4A8JB 1RPZA 1XD2B 3QPUA 3OIUA 1FTNA 5DHAA 1R6BX 2VEDA 2WWHA 4EFLA 3OFNA 1QVAA 4WAUA 4XVRA 1KDPA 3K0EA 1CR1A 3MD0A 4GP6A 2HCJB 4IRUB 5GVSA 2FEOA 4PAMA 2Z43A 3W5JA 3KJEA 2WJJA 4D25A 4R2HA 2PMDA 1PV4A 2F1HA 4F7WA 2A3RA 4Q1EA 2NOAA 4QXAA 2NPFA 2XTNA 4HLQB 4NYJQ 4OI0A 2XNDA 2O8CA 2D4HA 2O8DA 3DZDA 3LXXA 2ZRMA 1KNXA 1SXJA 1AQUA 5FUWA 4B3CA 1SGWA 4HAYA 1BMFA 2V55B 4NCIA 2PX0A 1J8MF 2AKAB 2ZUDA 5CM9C 5BN3A 1GWNA 2W00A 4JLVA 2O8EA 2JAQA 3BFKA 2GWHA 2IYRA 1X6VA 4HUQB 3AF3A 3AGPA 5JJLA 2ODBA 1II8A 1ZRHA 3ICQB 2WWFA 1G5PA 1KI4A 4P33A 3MSXA 2YOFA 2ZYTX 3LW8A 1G3UA 4PO8A 2NO6A 1XMIA 4CEHA 4MRPA 2L0XA 4P4UA 5TXGA 5H68A 1KGDA 5FUVA 2LKDA 3QKSA 1Q3TA 1KK0A 1E6CA 2QGNA 1OFUX 1QHSA 3PIRA 2ZIAA 5EE3A 4EPYA 1L8QA 1OIWA 1E2GA 2YWEA 4Q01A 1N6KA 4EQ6A 2ZRKA 2XTMA 4NYIQ 3H4MA 2W6ID 2ONJA 4JL6A 1P4SA 1E0SA 3B1ZA 4MQBA 2R65A 4FW9A 4QBFA 1ZM4A 3PEUA 1G7TA 4XD7D 1E9CA 4PPQA 3UG6A 1JR6A 3B78A 5F2EA 4LJ8A 2ZUCA 4X8OA 3B1YA 3TSZA 4O3MA 2GCOB 2WJVA 1JJVA 1QRAA 4I99A 1SKYB 5G53C 4AG5A 4C0HA 3TR0A 3V00A 1JI0A 4DCSA 1QHYA 4LYHA 5FTJA 2V6IA 3K0AA 5HCNA 4JBXA 3IKJA 1RRFA 3CWZA 3N5CA 1E2EA 2V1UA 1OB5A 1XTJA 4M1MA 5FL7D 2VO1A 3SNHA 1G8PA 1N6PA 1SXJB 3GLGA 2AWOA 2GK6A 3CRRA 1SVSA 4W9MC 2N46A 1RC8A 3KUDA 4E22A 1UPTA 2ZRNA 1VIAA 3E70C 2ZSBA 2ZE8A 4DLYA 1JPJA 4JLAA 3L2OB 4KFTA 4JN6A 4HUQA 3X1WA 1RKBA 1HQCA 4OQMA 2RGBA 2IS1A 3U7FB 2GXUA 3W8RA 1NVXQ 3B6EA 3G5UA 4EPVA 1FP6A 2CHGA 4TMZA 1G8GA 2ZITA 4IDPA 4TSFD 4DRZA 5JWRA 3THXA 1S2MA 4MYTA 4Q7LA 3QI2A 3DVLA 3LNCA 4ZDWA 4ZCIA 3OEHA 1W44A 2PEZA 5IK2D 4M1OA 1N5JA 4B43A 4TYPA 4LI0A 2ZU6A 2V3CC 4M21A 1JAHA 2PEYA 4I1OA 1JXMA 3QXCA 3BBPA 2FV8A 1QBKC 5IT5A 3CLVA 5EP2A 3N2EA 1EESA 1ZBDA 3RSOA 3MMPA 3U5ZB 2AXNA 4LRSA 4BFYA 4L16A 2LWIA 4EDHA 2ODWA 5EUMA 1E4YA 1EWQA 3NHAA 2QTVB 4KHZA 2DCUA 3PEVA 2X2EA 1E98A 4TLCA 4QJ3A 2HLDD 5HZKA 3RANA 1W0JD 2ECKA 1Y63A 2RGGA 1XEFA 4UJ5A 2XB2A 1GKIA 4ZPXA 1DBSA 3TJZA 1W49A 2X19A 3QPWA 5FL3A 3R9WA 2Y8EA 3EARA 1HH4A 2W6JD 4HZUB 3RS3A 2B21A 2P2LA 2ZREA 2W0SA 5J4HA 2R44A 2DWPA 5AUQA 3U4QB 4ZDIA 4KLNA 3AF1A 5FBLB 3AVUA 1IN4A 1M7BA 2QGZA 1S8FA 3H84A 2CMKA 5C18A 3CNLA 4HATA 4BFSA 3PITA 3HYTA 4XVQA 4Q4AB 3T1TA 5DIFA 3OESA 5JSZA 1R0YA 2J0UA 4TL9A 1UDXA 1EFHA 2HJVA 4Q4HB 4RVCA 1JR3E 5FOXA 5DN6A 3FHTA 4GT1A 1Z6TA 3TNFA 2CL6X 3UWOA 1VPLA 3BJIC 5C4GB 4E09A 3U7GA 2GA8A 1EWRA 1OKKA 2RGXA 2GXAA 4M53A 1C1YA 3DPUA 4Q48A 4GNKA 4B32A 3LLUA 3TGPA 2GCPA 221PA 4QGAA 2GJ9A 3KJHA 1P2UA 2R6DA 2CLSA 5J5CA 3KTAA 3KUCA 4NL4H 4BFTA 1E2PA 3QKTA 2IYYA 2NIPA 2ANCA 4TMWA 4M9ZA 4URXR 4TTPA 2QENA 3KQHA 3NVAA 1FTSA 5CIQA 2FGJA 2V8OA 1NVVQ 2AFIE 2RGAA 1MRSA 2MSDB 4AG6A 2GJKA 1W4BA 1TQ2A 1M34E 1P2VA 3UATA 3U6KA 1XB2A 3VKWA 1KI6B 3Q5EA 4WA7A 5JZVA 1XWIA 3QXHA 4L9WA 2I1VB 1US8B 1W5SA 4JLDA 2GNOA 4Z8YA 1ZD9A 1OH6A 1TU3A 3IEUA 1ESMA 2ZAOA 1XMVA 1NG9A 2RMKA 1T5LA 4FWHA 2CCKA 4ABYA 4DCNA 4ERNA 2HF8A 2NTYC 2X2FA 2FPKA 3AKDA 4HZUA 4QRHA 4UQOA 4X8LA 4BFWA 4RKEA 3U4QA 3DKPA 5EXPA 5FTMA 5K8TA 1GZSA 4TMVA 4FWTA 4XD7A 4URUR 4Q9HA 3OAAD 1LFDB 1DAHA 1T91A 4A0GA 3B1WA 4MH0R 5KSPA 3REGA 1TQDA 2JJ2A 1G20E 3TMKA 4DLZA 3P4XA 4ZDJA 3RHFA 1PZNA 5EXSA 3NDBB 2FGKA 3FKQA 2I3BA 4FINA 4DVGA 2JDID 1E2IA 4GRAA 5EP4A 1E79D 4B6FA 2E87A 3RRMA 2PL3A 3ZVNA 4D26A 2V7QD 2QUZA 2QP9X 4UKDA 3QE0A 5H1YA 3U3OA 2W58A 4A2PA 4BZPA 4ZV4A 1IJFA 1MR3F 2JLZA 3LX5A 1U0JA 1BOFA 2HLDA 2GJAA 3I8SA 3KTAB 2OFWA 4PQRA 2ZJAA 3LLMA 1U81A 1KJZA 5E3HA 3W34A 3PUWA 3PUZA 3EG5A 4MRNA 4D4MA 1Z06A 2FPLA 2ZI5A 3RWMB 3C4JA 1S3GA 2ZE5A 2J45A 2XGJA 1R0XA 2QY9A 4GBMA 2D7CA 4V0LA 2V7QA 5LPNA 4R7ZA 2JIZD 4DDVA 3DHWC 3TVTA 2IXFA 2QG6A 4CT5A 1DEKA 2AR7A 4FI3C 3T06B 3NBFA 1OSNA 2D2EA 4IOMA 1R10A 1H8HD 1Z2CA 5AJXA 3TUIC 2ONKA 3PUYA 1E9BA 4MUBA 4NHOA 1YZQA 4CGZA 2R6GA 3A6PC 4DT1A 3HR7A 2OCPA 1ZM2A 2EYUA 1DTSA 2WMNB 2WKQA 2C04A 2F3TA 4YMWA 2H16A 3EIQA 1SHKA 4CIDA 3CF2A 1I4LD 2IW3A 2ZS7A 4KFRA 2EU8A 1YU9A 3Q5DA 3U6BA 1RRCA 3ZS9A 3KKMA 2JEOA 2WHXA 1MO6A 1TUIA 3I1FA 2V6JA 2QTFA 3FDIA 3WNDA 4BLRA 3SHWA 2GRJA 3GLIB 2CNWD 3A58B 4KITB 3C8UA 4PHHA 3QEJA 1HE8B 1Z8FA 2F6RA 3MWJA 3FPAA 1ZNZA 4HZIA 1G5TA 1A4RA 3SS8A 1NMXA 2XAUA 3K09C 3U60B 5DISB 4LUCA 2H1LA 5JMTA 2ZR7A 2BJVA 2OAQ1 4OQLA 1FMJA 3EC2A 3NH9A 1X86B 3VX3A 1S4QA 4M0LA 4FCVA 2A7QA 2O0KA 2JATA 2BBSA 4EPRA 1LTQA 3UKDA 5E4FA 5J4KA 5JCPA 1T0JB 4BEJA 1UBEA 1NN3A 3CWQA 4KJZA 4ZI3A 1YR9A 5FPYA 4PZYA 3KB2A 1W4AA 3OZXA 5FOTA 1G8FA 2KBFA 3CNOA 4V0KA 1KI1A 4F4IA 2WPDA 1XD2A 4HAWA 2IHBA 3TIFA 5JI2E 1S9HA 1WDTA 3P4YA 4GOXA 2ZJ5A 1RRPA 1UF9A 4BRWA 3DKVA 2E9SA 3GFOA 4OYHA 3ZZUA 5LD2B 3GJ8A 2AD5A 3AVYA 2DR3A 2IYVA 2QE7D 2P6NA 2WKPA 3QENA 1T0HB 2VF7A 1XF9A 1W36B 3QVUA 4PPFA 2AWNA 1A5TA 1MT0A 1DOAA 4KYUA 5FOUA 2GEVA 1LNZA 1L4UA 1HT2E 2WSMA 2ZSAA 2MSCB 2R8RA 4JYBA 3CR8A 3WMFA 4BEBA 2QMEA 4A1FA 2O8CB 4YC7A 4I4LA 4PC3A 3LW7A 4LYJA 2QM7A 1N25A 4BLOA 4DB2A 3KB1A 1F2TB 1RYFA 3I4LA 2C78A 5AJWA 4UXHA 3WYFA 1VDZA 4GI7A 2C9YA 3JVUA 1X8KA 3X1ZA 1AGPA 421PA 3AH8A 4TWZA 1DPFA 5EUQB 2F1RA 3BE4A 4TMXA 4Q9JA 3WMEA 4ZIRA 4IXNA 4KYIB 2G88A 1Q12A 2BCGY 2FSIA 3R9XA 3AVTA 1IHUA 1ZM9A 1KIMA 1RE0A 2XZLA 2IF2A 2BHRA 4X8MA 4A4DA 2NG1A 2ERXA 2W2TA 3LWNA 1GAJA 5BYJA 1FUUA 5JEDA 4R71A 2REBA 3QKSB 2NO1A 4LRWA 2NZ8A 4P32A 1Q3HA 1IOZA 1YE8A 4C3ZA 1CS4C 2GAAA 2Z4SA 3FWYA 4EQ6B 3GPLA 4C2UA 4ZKEA 4QKQA 2A78A 3JVVA 4JBYA 2UVQA 4JLNA 1D2MA 1F60A 1C1KA 1RW4A 2IUTA 5BXQC 3NC1C 3A1VA 2X8AA 1J7KA 4ESHA 2VLIA 3EZ2A 1YZTA 3NXSA 4MRSA 5F3WB 3F5FA 5B2ZA 4D6PA 2OBLA 4LJAA 4BZXA 2GCNA 4OHWA 5KDOA 1NLZA 4DDWA 4KFSA 4TTRA 3C41J 4EFNA 2E1RA 3K0AB 1W36C 4IOLA 4B2IA 1S1MA 2IBMA 2TMKA 2NQ2C 2RKOA 1UKZA 1W5TA 1LF0A 2FA9A 2XZPA 5AWFC 3RS7A 4CDGA 4CEIA 1P62B 1U99A 3A36A 3RC3A 4A6XA 3ZYCA 3GLGB 4MGKR 4KSCA 3LBHA 3B1VA 5KNBA 1F2TA 4C0JA 4U7DA 1VG9B 5DI3B 4CYMA 2DHRA 1IY0A 1TF7A 1VYVA 4ZIRB 1N0WA 3AVWA 5CDFE 3D6TB 1G291 4QM7A 2GXSA 2IYTA 2WKRA 3ICEA 5FTLA 3BH7A 1E2HA 1L4YA 3Q72A 2CE7A 2D74A 3BH0A 1D2NA 4B71A 1ETUA 3M6AA 1W1WA 1P72A 4AKIA 3O8BA 1IXRC 5J4VA 1PLJA 4LV5B 3MG9A 4NCHA 3FHCB 1OIXA 4LYFA 2P6RA 1KO1A 4GMXA 2QT0A 3NG1A 4M4SA 5H70A 1JAIA 4PO9A 3T35A 4ACAA 1X1RA 1P2SA 3PQCA 4P4SB 1IONA 4RFSA 1RZ3A 5DGXA 5CIWA 3R8FA 4PC1A 1W47A 5FL7A 2ZRCA 4QM6A 5K8LA 2O8FB 4KLZA 2J59A 2ZSFA 2LCFA 4MITA 1W7AA 2SHKA 3CO5A 1GUAA 2YVUA 4Q03A 2QRNA 4HEJA 1Z5ZA 2BEJA 1ANKA 1N6LA 3K1JA 5SZKB 2GXQA 1F3OA 4BGDA 3BGWA 1PUIA 1KO8A 3CIOA 4YLGA 3AF0A 4DLTA 2ZM5A 2A5JA 2HT6A 3ZZTA 2YHSA 3A1WA 5KDDA 2Z6VA 1TQ4A 2HCBA 3IO5A 1O3YA 1W2GA 4F38A 2Z4RA 3FB4A 3T15A 3A1UA 4MKGA 3H86A 5KSOA 1L2TA 3BORA 1IXZA 4Z51A 4TYWA 5B64A 1T3HA 2FMXA 4NKRA 1G9XA 1HV8A 1YHNA 3WHKA 4Q7JB 5DI3A 2W2VA 5EE1A 4B76A 1KMQA 3G82C 4BWYA 3UXMA 4Q4AA 5HZHA 1VCIA 2XXAA 5JSZB 2BBWA 1YZKA 4XWOA 2JA1A 3BAFA 2X1VA 5JECA 3AEZA 3H1TA 1N5IA 2XOKA 1W0JA 1IBRA 1QVRA 1WQ1R 1JQLB 1XEWY 3K0FA 1H8ED 5D3MA 1ZCAA 4I1UA 5HR5A 1NJFA 2BJWA 2HXYA 2WIAA 5BW8A 1OYWA 1Z0IA 5CK4A 2CHVA 1CJMA 4Y0AA 3W5IA 2RGDA 1RIFA 2YYZA 3IPYA 4WIAA 2PMKA 4P4SA 4RFSB 3VKGA 4LC0A 3IBGA 5FUYA 3GJ5A 3R8CA 2O8FA 3RRNA 3AF2A 4GDFA 2J3EA 121PA 1E96A 2WOJA 3IIJA 3U7EB 4A2WA 2A5GA 2KRKA 1G3RA 3OIYA 4NTZA 1KI6A 1SVWA 1VIYA 2QQ0A 1E0KA 1XTSA 2IYSA 4WBSA 4WVFA 4CF7A 1P5ZB 3B82A 2WICA 5L3RA 1US8A 4PHGA 5AUNB 5DN6D 3QIAA 1XP8A 2OCAA 4V0MA 4RZ3A 3NC0C 2UKDA 1SXJC 2GZDA 4LYAA 4TL7A 2Q3FA 1U0HC 4CW7A 3IBYA 4DCVA 4Q4JA 2PJRA 4QNRA 5FBWB 1GL7A 4BZQA 4QL3A 4RD6A 4XH9B 4AK9A 2BKUA 2BM0A 2ZRFA 3RABA 1P7CA 2AHOA 4BASA 5L3QA 5J4LA 2QROA 2O0HA 1GIAA 2JDIA 1N5LA 2W6JA 2WPDD 4R98A 1E1RD 2KI5A 1Z6XA 4GL2A 4C0SA 3ZD7A 1E9RA 1BYUA 3K0FB 1KSFX 2Q3HA 3NIBA 2QNRA 2DWQA 3NDPA 1QG4A 4KAXA 3ECCA 2G6BA 1OFHA 5FOSA 4AYWA 5GJCA 3W8NA 4GMDA 3KW6A 1IXSB 2RGEA 3QQ5A 1QHNA 1Q1ZA 2IYLD 4PFSA 3T12A 1R0ZA 2WBLC 3L8ZA 3LV8A 1UFQA 5G3YA 4C4PA 3KXLA 4JZKA 4RD3A 2Q9CA 4LV8B 2VF8A 5EQTA 1T8UA 1CULC 4A0HA 5EE0A 2NO9A 1E1QA 3I73A 4C0BA 2ZE6A 3PJRA 2ASEA 5DYGA 1ZD1A 2YNMA 5TMPA 1DVRA 2GJSA 2PCLA 2OXCA 2Z83A 3Q8XB 1E2FA 2RB4A 4M1YA 4F92B 1A1VA 2GK7A 4M1WA 3DOFA 4HUTA 2NO7A 4WZ6A 2OLKA 2ZRBA 4D82A 1Q44A 2VHUA 5J4YA 2BEKA 3A4LA 3I92A 3SI7A 5C4MA 3NBZC 4N0DA 1M74A 2FN4A 4IJMA 4CEJB 2Q9BA 4C9BA 3DMDA 4QG7A 1G5RA 3M0EA 1KI2A 1CR0A 2ZRIA 3SJAA 3W90A 3OEED 3FFBA 4MKFA 3VKHA 3BFVA 1E0JA 3T5DA 2ZI7A 4JS0A 1R2QA 3MWLA 4DSTA 1IN7A 3GLIA 1GNQA 6Q21A 1HYQA 2PX3A 1XMJA 5L3QB 3ZJYA 4MDFA 1E2JA 2IYXA 3SHFA 4Q1AA 4DUGA 2WTUA 4ESVA 2RGNC 1PLKA 1KYIA 2DB3A 1N5KA 3KXKA 1UDWA 4PC2A 3TVDA 2IX3A 4YDSA 1ZM7A 3C5HA 3CNNA 2DPXA 1NVVR 4OJKA 3L0SA 1U9IC 2WWXA 1NY5A 4IFBA 1RJ9B 1SVLA 4G01B 3RAPR 1H65A 3RNLA 4L15A 1QG2A 1EX6A 3AKCA 2WJHA 1M7GA 1VYTA 1CR4A 1P6XA 1KAOA 3AKEA 3FHOA 3AGQA 4ASUA 4E07A 1GVNB 1NRJB 3OE7A 1OXUA 3LDAA 4L5BA 5FH9A 3CF0A 2OAP1 1E69A 3Q7QA 3KFXA 4OK6A 2NPIA 4B74A 1D2EA 3HJNA 1CJVC 3CUEF 5LB4A 3REFA 2ORIA 3QOFA 1E2KA 5B57C 2IYWA 2G0TA 4JSTA 2RHDA 2OEPA 3GFPA 4DCTA 1UM8A 4HB0A 4O25A 3W6OA 4V0OA 5C2JB 3U2QA 2FWRA 1Z6GA 1ZINA 2D7DA 1JQJC 4Q66C 3HDTA 4P4TA 1KKMA 1CR2A 3IGFA 5JWOA 1NSFA 4BFXA 2ZSDA 5CK5A 4FD2A 1CU1A 3EASA 2BWJA 4POAA 4FWDA 2ZI3A 3K09A 3IHWA 3ZLJA 2J0SA 1E2MA 4LJ5A 3WXMA 4JYCA 3LVRE 1DE0A 2CE2X 2DWZB 2W6IA 2AK2A 3LAWA 4PC6A 4UNPA 2FSGA 4AYTA 3KQLA 2QPTA 4JKIA 1GILA 1KSHA 4PXAA 4UNNA 4QJ5A 1WXQA 3MRSA 3AB3A 4Q7KA 4EJSC 2FOLA 1NBME 4Q4LA 3TRFA 5CM8B 2AD1A 5G40A 5FBVB 5FOWA 4XSGA 3EW9A 3ADBA 1GNPA 3SJBA 3HU3A 2ZJBA 1OXVA 4FMDB 1AKYA 5F9HA 2AFHE 4GITA 1WB9A 2G83A 2OXRA 2RGCA 4B35A 4LHYA 3L82B 3SE0A 2GESA 5GADl 2CK3A 2ZUBA 3EZ6A 4RD1A 4B48A 4LY6A 4IDQA 3U61B 1FNNA 2PH1A 1II9A 4D81A 1K6MA 2PT7A 3BRWD 3DMNA 3QXXA 5DNYB 4OI1A 1JEEA 1EGAA 2AK3A 1W4CA 3GFTA 3LY5A 5SZJA 3LH5A 3BB1A 3B13B 2F43B 3IPXA 2CL0X 2V54A 3ZIAA 1UKYA 3HU1A 2EFDB 1G8HA 3AUYA 3B9QA 3H0KA 2K5UA 2QQEA 4D0LB 4JT4A 1XXHB 3RVBA 4W7SA 5DH9A 3S1AB 1MH1A 4V0ME 4CEIB 3E5HA 2QPOA 2O8BA 1G17A 2QM8A 4HLUC 2BBOA 4DIEA 3CZPA 4LZZA 621PA 5KNCA 1Q1BA 3AVVA 4A0RA 3EC1A 5EJEA 1VHTA 3I5YA 2Q21A 2I1QA 3ASZA 2JLQA 4GPTA 3MGCA 4IDOA 1HE1C 1KMHB 1GRRA 5FPKA 2B92A 3AF4A 3QKRB 4JVNA 4RZUA 4XVUA 3HWSA 3PUVA 1S1CA 4PZLA 1U8YA 3RS2A 3ZGXA 3Q3JB 1T4GA 2HEIA 4KXFB 4MUAA 3QBVA 3QBTA 3QVVA 1XD8A 2ZYVX 3TKLA 5LDDC 4ILEA 5TDHA 4LRTA 2N42A 1GNRA 2XZOA 2C96A 1AK2A 5BN4A 1W46A 2IK8A 2ZR9A 5FPSA 3VR4A 2VSXA 2P6UA 4URZR 3K70D 2JASA 2NGRA 1KK1A 1Z0AA 4WZAE 1D9ZA 1XD9A 2WWYA 2IS4A 2VP0A 4FMCB 4HDOB 4C2TA 4JKYA 5HPYB 2QU8A 4DLWA 1CTQA 1KZ7B 4UNSA 4YMSA 4G3XA 4QHSA 2VHJA 2OBMA 3MWYW 4XSHA 3CRQA 5IDVA 3WBKA 2ZRPA 4OI4A 4BLQA 5E7JA 1Q21A 2Z5FA 2F43A 1FX0B 3LA6A 3CF6R 1N6OA 3TUJC 4ASUD 1AZTA 2CLDX 2QT1A 2R6FA 4AKGA 1UADA 1GITA 3RS5A 4PAOA 4Q21A 4FMCF 2IHYA 3QXJA 2ZI4A 3GEHA 5DHFA 4ZI2A 1XJ0A 3GLHE 1J8YF 2O8BB 4LPSA 4PSAA 3OAAA 4KODA 2WJIA 4IVRA 4JL5A 2REOA 3PEYA 2XSZA 1SKYE 3B2EA 1ZUIA 2QRZA 1NBMA 2HXSA 5EP1A 1N0UA 2YJTD 3TQFA 1XBTA 4BLSA 1YRAA 1RYHA 4G5QA 2XXAB 2HUPA 3QKRA 2ZJ8A 4MA4A 4FWIB 4J0QA 1XFAA 2QMOA 2GAOA 2VTKA 3FE2A 4URWR 4XWAA 5D3MB 5TARA 5BQ5A 2NO0A 4A6PA 3BC1A 4KCGA 4Z1MA 1T6NA 2IWHA 1Z07A 1E9DA 4IDHA 3FFAA 3IEVA 2G0NA 4G0NA 4LDJA 3FGNA 4FXPA 3DO6A 4TMTA 1OLOA 2UZIR 1E4VA 2YINC 4XOIA 3T61A 2QSZA 3BK7A 1TNDA 2JLVA 1GRNA 1LB1B 4KBFA 1E1RA 3AQ4A 1K8RA 2IYZA 4RCZA 3VLFB 3CPEA 4FIDA 4TQ9A 1NLYA 5JBQA 1JPNA 1NMYA 4MRRA 2BMDA 3N70A 4KVGA 4F91B 4AKHA 4QBIA 2IXGA 4OBEA 2RHMA 3F0TA 3UMRA 2ZPTX 2ZRDA 1CJUC 1QHHB 2ANBA 2D3WA 4KI0A 4LV6A 2BC9A 2AKYA 4N3NA 1AJEA 2IYQA 4ACBA 2CCJA 1ZJ6A 5L8VA 3MJHA 1UAAA 1NN0A 1QZMA 4JJKA 3UANA 3WYAA 2WZQA 3CPJB 1TAGA 2H5EA 1N3BA 2CK3D 2ZRGA 4ZDKA 2CEAA 1TX4B 3U3JA 4PSVA 1T3LA 2G1JA 3CRW1 1KI9A 2OCBA 1SVMA 4LPKA 1P3JA 3KX2A 3KKQA 1NBMD 1KJYA 1GG2A 3LFUA 1XCMA 4Q4JB 4B3XA 1HURA 4CT4B 1G6OA 5KNDA 5G41A 2V9PA 1HY3A 5BWMA 3VR3A 4B2LA 1C9KA 2JJ8A 2B7CA 1P73A 3OFND 3QF7A 2IEYA 2Q0HA 1W0KD 2GJ8A
chains in the Genus database with same CATH superfamily
1V1JA 3DFFA 2VF2A 4QDUA 5IT9A 1N2IA 2B8TA 1KDZA 1FLNA 3THYA 2VATA 5F23A 5C1DA 4YQFA 1RPAA 2R6HA 3A3YA 3HI6A 4LBYA 4YRMA 3SQWA 1AKRA 1ZN7A 2ETVA 3PJEA 4PS0A 1C4OA 1OMOA 1SCKA 2QW0X 2EJBA 4M87A 1L4KA 4AKTA 1NXWA 4RUKA 1U8ZA 3UAYA 4X20A 4ZHQF 1R6XA 4C43A 1J5XA 5K20A 4RPIA 2J87A 1EFVA 2COKA 3HBLA 1DTWB 2RI1A 3MGBA 2XOKD 3LUCA 4S0XA 4LZPA 1QG6A 3ZU5A 3X1MA 2YQZA 1HORA 1H2ZA 2OUKA 3GH3A 1IFXA 3SFVA 4RS3A 1W5FA 2CNDA 2QZJA 1O54A 4X00A 3URKA 5K2OA 1OE0A 5EIFA 1YRBA 1VCNA 1A71A 3I6MA 4G1MB 5LKRA 5G1OA 1CRPA 1QIIA 1I2ZA 2YWGA 1KL7A 1NKTA 2E4AA 2ES4A 3I9NA 3HPRA 5JZMA 3TTVA 4EM6A 2R60A 4BNMA 1RAEA 3OQIA 4N0EA 3W8FA 4IEIA 2QRPA 3CVXA 3EXG2 4PG5A 4JI8M 3SF0A 4QO8A 4YDRA 5B1EA 2H1FA 3NFRA 3KUXA 3VPBA 1KVSA 5CPBA 4IZIA 1Q1NA 2PX4A 2QRVA 3PUJA 4MQ5A 5T8KC 2NU8B 5JZ9A 2I1LA 2YR0A 3PWKA 5AW1A 1CY1A 4YXWA 4BBPA 3NYRA 4DZRA 4M54A 4IICA 3GZ4A 4BKOA 3P5SA 4RDHA 4X54A 4OHKA 1T2EA 5EQJB 1XZQA 1DX9A 2A5DA 2BBTA 4BNDB 2X7HA 1GZHB 3CM0A 4HY3A 4FFNA 2W43A 4PPGA 4QPDA 1YC2A 1RYMA 1UFOA 2QYHA 1CS0B 3ZKAA 4HFRA 1BMTA 1DIBA 2P67A 3LPCA 3O9ZA 2PUCA 1YULA 2ZYGA 4GSKA 5LVAA 1X7ZB 1K1EA 1ZK3A 1P60A 4OB8A 4BJ1A 4F0JA 5EHNA 1XP5A 2HD4A 4YT8A 1LF5A 3E9CA 4W9NC 1P0MA 2H6EA 4C7OA 4IIEA 3BJEA 3TLEA 4HNAB 4GH9A 1FBNA 3V34A 1IEQA 4Q82A 4OBXA 1XALA 3PXGA 2NXCA 2AXPA 3K5PA 4GH5A 4M22A 5KVQA 2Z09A 4S24A 2WSYB 2H52A 2V3WA 1MMFB 2IUFA 2DSTA 1MA3A 3STTA 1QCCA 2JH9A 1BD3A 1DO2A 1FJ2A 4OSEA 2VI5A 2LR0A 4X61A 4TLDA 1EGVB 1JG4A 2FJUA 2UZ3A 4Y9TA 3CLSD 3FUWA 3ZXSA 4ID3A 3WK4A 3TLKA 1WTCA 3IT0A 1FLVA 1U8AA 3B1XA 3L40A 4KMSA 4S1WA 4B3JA 3QF4A 2R8ZA 3FCOA 1CXZA 2OFXA 2C5RA 2H7CA 5ITYA 4JMPA 1WUTA 4AU1A 2WIBA 5F1KA 2ZRLA 2V4ZA 2FPUA 3BHMA 4N39A 1FDTA 1T36A 4EHDA 4DUZM 1UC5B 1K63A 5EPUA 2DKOA 1YZNA 1Y1LA 3BXGA 4Q6BA 5FX2A 3OZAA 2PL5A 2F9FA 2QD1A 2VP6A 4KWTA 3VDXA 3ZVRA 1T10A 3QVJA 3O1IC 1K5GA 1FMFA 3X1XA 4EAQA 4PIVA 3LYLA 4LVUA 4E5NA 2ZANA 2ARKA 3B6JA 3KZMA 3PP8A 1P61B 1TADA 2BDTA 4CI9A 3ZIDA 4RE6A 1QAQA 5PNTA 1OX4B 2APLA 3HVIA 2RGNA 2ZK7A 4EA7A 5CLQA 3GLHA 1C4KA 2AN1A 4CIBA 1BIFA 1I2MA 1NUSA 3UXEA 2GTIA 3GCXA 4F9FA 2YYYA 4FX2A 3EX7C 3WP1B 4D7AA 2FW7A 2BDEA 1XMQB 4M55A 4JL8A 2C2WA 2Y67A 3PD0A 4NAHA 3L0IB 5MF6A 4Q47A 4G8BA 1GPMA 3WRYC 2C57A 4IIJA 1NIPA 2TECE 4C7OB 5AJTA 2ZIWB 4ANRA 3P0IA 2JHPA 2BEVA 3I0NA 4KV9A 3SHGB 1ZRNA 2OYRA 3SS9X 3D7MA 3CCBA 1E8NA 4JUCA 4F2PA 3BMOA 4QDOA 4QUDA 1PFYA 2AN3A 1BCRB 4G0QA 1IBKB 1JSCA 2J7PA 2P6MA 5GAJA 3RGWS 5C7OO 2OBXA 5BVGA 2FPRA 1DO0A 2X3FA 3K5IA 4DQLA 1JWBB 5KYVA 1Q7BA 3A25A 3PA6A 3RGPA 1NP7A 2FWAA 3WWEA 1OTYA 4HDNB 5DM60 1MGPA 5CITA 5ITTA 3RS8A 4B7GA 4RTMA 1DCFA 1M2OA 5EMJA 3GRRA 2X2PA 1VKJA 3BS4A 4PW0A 1RQ2A 2R2AA 1NAHA 4UBIA 1GU0A 2ZLBA 4JX8A 1ZCBA 2Z95A 2EZ9A 4W5NA 2D62A 1CWUA 3JYPA 4JXZA 4BNXA 3U6QA 4ZEWA 5HKOA 1SAYA 4XTCS 2Q4EA 3AB8A 3FMGA 3PSAA 4HGOA 4L0MA 1W85A 4Q16A 3HSYA 1PX0A 2ILVA 4J6FA 2V4UA 4WZBE 3NDIA 1WGNA 1GCOA 3D4PA 2FPGB 2X77A 4H17A 4X5OA 1Y6JA 1PTJC 1PL7A 3NHBA 3ABIA 3CVOA 1RP7A 1FS4A 1KOLA 4U2GA 1N5OX 4JBWA 4MI1A 2V59A 2O2EA 2R6AA 4F6LA 4MHOA 1U2GA 1X9GA 3BIJA 3IHLA 2YDXA 1QPGA 4LOHA 3GLHB 3DDZX 2QTBA 2OGTA 4RF1A 2B34A 3NAQA 1D9XA 2I7TA 3GGJA 5IUNC 3L02A 2CVPA 2G80A 1J70A 1NN1A 1Q1AA 5E7QA 2H17A 3KVNA 3A98B 2RK4A 1U28A 3EGDA 3O92A 1JKJB 1H0KA 2P7IA 1VGQA 4B87A 1MVLA 5BR8B 4DE5A 2QX4A 4IV5A 3T1VA 1KIFA 4IIJB 4L8WB 1T4CA 4DKXA 3DMYA 1BAPA 2ACEA 2OYSA 3L8YA 5BWOA 4EL0A 1H23A 2QZ9A 2OFFA 4ZCSA 3GGDA 4S12A 2WSBA 1GGVA 3AOEA 1I6LA 3OE5A 3D4LA 4G8CA 4D97A 2J9RA 3KLBA 1EHYA 1U5AA 2ZDGA 4LX0A 4OHVA 5U4XA 3OIFA 4O4IF 4OU5A 1EIWA 1GADO 1OH8A 3B20A 3DEIA 1BXRB 1E3WB 3H7AA 3LHSA 4IFTA 4IXMA 4QFDA 3H2GA 4RK0A 5D8DA 1KP2A 4HDNA 2DY0A 2G3YA 3UVEA 1KH1A 1OWMA 3SLKA 2KRUA 1M2OB 3G23A 4C0LA 3KS9A 5KOIA 4AS1A 4HQOA 1M2VA 1T5HX 3B9BA 3FPHA 3PK0A 4L8YA 3N28A 4YV7A 4F60A 5KNCD 1Y9ZA 3UAWA 3ADDA 4KHPM 2ZIEA 1AQLA 2HY7A 3GLTA 4BGEA 5CD1A 1DUIA 4KSYA 5TT0A 3HDYA 3S28A 4ARAA 1TZBA 3BBLA 1W85B 2IXBA 2CW5A 5ADVA 5JHGB 3FYTA 1CLEA 1LC0A 2FPGA 5TPWB 4F86A 4N1AA 3TEMA 4EATA 1SKUA 4YV1A 1X1AA 2ZYIA 1VL0A 3Q12A 1WD5A 1OC2A 2PBZA 1V4NA 2NX2A 2H7YA 2XJ4A 1N6IA 2Y0EA 3U6MA 3MFYA 1L5YA 1C1DB 1UBTS 2CDRA 3E0QA 2IY7A 5CXSA 1A4XA 4AJ9A 4F12A 5I9TA 4A82A 4M9RA 1SBQA 4EJ6A 2EKKA 4EKEA 3BOSA 1M3SA 2XI4A 1IBCA 3PF9A 5IBQA 1Z0KA 4IF4A 4DV3B 4FLFA 3IA2A 2KW5A 2D1YA 3J81k 4HQ0A 2HSDA 3ER6A 4OK5A 1R7RA 4F45A 2RHBA 3VDPA 2HNKA 1Q0ZA 2HU8A 2QU7A 1JKJA 3D8TA 3Q6IA 4YRPA 3R9KA 3GNSA 4WK6A 3U3RA 3BL5A 4L5JA 5LLDA 4DLVA 2Q6TA 4FGLA 1T4CB 1EGMB 3E6AA 3JSAA 3EOZA 4FYKA 2VAMA 3GPCA 1B6GA 4BUJA 1N2ZA 3GRKA 1OQAA 1LX7A 2IOQA 1VG8A 1Z47A 4M8NE 1V9LA 4I5DA 2ZUTA 2AC4A 1Z28A 1Z34A 3C14C 5EZ6B 4Y6PA 1NT4A 1C9JA 2YC2C 4E13A 3UF0A 1ZNXA 4UREA 4U2DA 5AKIA 2Z1DA 1VEGA 3VKUA 1BXRA 1E3WA 4Q5IA 2CDBA 1W59A 2P1DA 1CQPA 3SMSA 2P4UA 2ZXFA 2GZHA 1A27A 1HEIA 5DM0A 3CVYA 2CHEA 2O0LA 2F48A 4EF4A 2ABWA 2BR5A 3K0BA 5CRIA 2Y0TA 4R69A 4TT3A 1JJ7A 2DY1A 3GGSA 4H27A 1NY6A 3GRYA 4ZZ3A 5LCXA 1S01A 4V0QA 5KC8A 1G41A 1BE1A 1Z0SA 1VG1A 4X84A 5A5VA 3J81A 5AKXA 2PCJA 3Q8GA 1E2DA 2YWHA 1LY1A 3W3AD 4S1NA 4PYIA 1AZSC 3H99A 5TPWA 2PT5A 2QUKA 2A33A 2VP2A 2LD4A 4UBOA 1UKVY 2CZGA 1JNXX 1HR0M 3QYAA 1R8XA 4I50A 4CHTA 3EDCA 2XYPA 1I80A 2AZDA 1KZGB 1ZAEA 2F17A 1LDNA 4D9NA 1C1DA 1XTTA 2H92A 1SKAA 1JIIA 4US0R 8OHMA 3PFHA 2NQ8C 2F90A 3T8YA 3ZZ0A 2R5NA 1NLMA 4UXJA 3NZEA 4F84A 4G23A 4HPXB 4FDAA 3DH0A 4LDQA 4G5FA 4DR7M 5GWXA 1P2GA 3NWJA 4LXIA 5JAPA 3GEIA 3P1JA 1HNWB 1KAGA 2PPVA 3N2KA 1FFSA 2P5UA 2XF2A 1ECLA 1P77A 4A23A 2ZR8A 2PLRA 5JZSA 3M3HA 4MVJF 2B8NA 1CUCA 4H35A 1R15A 3DM5A 4MUKA 5HG0A 5JCJD 2VUUA 3I51A 1MEEA 1WDMA 2DPMA 2DFPA 4TV8A 4PINA 3IPLA 1JALA 3KS4A 1QFSA 4MEBA 3ZI0A 3AETB 4ZEOA 3L04A 5IF9A 2QD3A 1O94A 2XVXA 1QLJA 1KFBB 4MAAA 1XKQA 4YRZA 3QWLA 3BXPA 1P81A 3H1PA 4FKBA 4WMLA 4YAFA 3I9FA 1XVLA 5ESWA 3TSYA 2PV0A 3ZDDA 1X19A 2FFHA 2NU9A 3ANNA 3FYUC 4KX3A 4PSUA 2F9LA 5DXAA 1RHUA 1S3SA 2Q5IA 4NMMA 1GQYA 1YBAA 2V7VA 4OFXA 4DL9A 5HRCA 2Z8YA 3KJGA 4IKPA 3D1VA 3HDGA 1OU0A 1MVNA 3NT4A 5C34B 4NBSA 1F5NA 3ORQA 2CBZA 3LGXA 4JA0A 2C0QA 2C9CA 4L0DA 5DCWA 1TL7C 5H5JA 3ODPA 3SZGA 3V33A 5JU6A 1RYZA 2PJUA 2O2ZA 4N9QA 4Z0TA 2ECOA 3ZGYA 3NBYC 3QOXA 3RUDA 4DW8A 3D6JA 1H8HA 4EWLA 4DR1M 3PRKE 1IUNA 4FHZA 3T41A 3P9PA 4YJ3B 3KEFA 1WF6A 1CBUA 3EXAA 4NCNA 2FF5A 3BZBA 1IAQA 2AI3A 4MYUA 1MZPA 2PRJA 1YOBA 1GSIA 4V2UA 4RYDA 5KUTA 2BE7A 5KI6A 1YAHA 3EZ7A 1R9GA 1H1LB 1KPIA 2BGRA 2OFOA 3BEDA 4U6QA 5G2OA 1SVOA 3O1LA 3VHQA 3S81A 3TGLA 2A9RA 1LPPA 4N7RA 1FW8A 2EJTA 2X6RA 5CCDA 3UJAA 3A2KA 3EPLA 5TB5A 2AJTA 2EDAA 2I2XB 3V4FA 3KQUA 1GKUB 4LF4M 2F9MA 2XQFA 4LVCA 2IPLA 1KO5A 5TR9A 2BPOA 4IRMA 3FZEA 3IOCA 2QXUA 2AN9A 1NLFA 3GQBB 1W2HA 3PT5A 4G1VA 2BI7A 5K8UA 4WOCA 4K28A 4N3CA 3F4BA 1Z63A 2YV2A 2VYNA 2C2ZA 3NWBA 5T3YA 3WFJA 3I2FA 3WAGA 4EKNB 3NB0A 1B76A 4TV8B 1E3TA 3B3GA 3VI4B 4W7IA 5IPFA 3EWAA 5KPDA 4BNLA 3AETA 3VDUA 3UB2A 2NQ8A 1HFJA 3OQVA 1CR6A 3OEEA 4UJ3A 5FBHA 2VUSA 4LJYA 2WTNA 4MWCA 1TD9A 1E4OA 4A16A 1ISFA 1KK2A 1QO0D 4MGHA 2KZSA 4FS3A 5FR1A 3QOWA 2NU9B 2O5EA 3PQ4A 1VHWA 3JD4A 1A7JA 4RQUA 3SIPA 4TSFA 2V1XA 4G07A 4R8VA 2EARA 3MF4A 3MUNA 4YRIA 1PN3A 3CZQA 3O6VA 4Z9AA 3V1KA 2WIGA 3HCCA 1L3BA 1E66A 3A37A 3AI7A 5BV1A 1NNEA 2CLKB 4AW9A 4Z4HA 3I5UA 3STXA 4WZAA 2H5LA 3X2SA 4LF8B 3G9QA 3VZRA 3SN6A 1C7QA 1X87A 1XRSB 3S8YA 4HYTA 3PCTA 1CEEA 4GFDA 5CH8A 2QTHA 4NFHA 4R8LA 3VO1A 1M6HA 3ZVMA 3EFOA 3RTDA 3EIHA 1YR1A 3HL4A 3ZWKA 3R7FA 1XZBA 1QF9A 4N8EA 1P0PA 5G0SA 3QY9A 1R5OA 4G56A 4C07A 5LZ9A 2Z0MA 4G5RA 4MRMA 4LTDA 4IOKA 1C9NA 3U4IA 2QUHA 4AZFA 3O2NA 1II0A 1G38A 2PSJA 3HBJA 3LY9A 2AC7A 1X8JA 2QDKA 4KXXA 4PAQA 3GUZA 4W1PA 3JR5A 3O91A 5DTQA 5IAJA 1QUEA 4CLRB 1DAFA 1JVSA 1AMUA 3VXKA 2ORED 5CFNA 4TYQA 3QM1A 1O94D 2UUOA 4KVAA 4IPTA 1NW6A 2DBYA 4R6WA 4UFOA 3DMTA 1RLUA 3OD5A 4RELA 1EVLA 4D8VA 4DNPA 4UCFA 3KU1A 2OLJA 3GCZA 1R6DA 4JASB 3K1TA 1PVOA 1BQ3A 4NDZA 3LCMA 4J3NA 3DOCA 1KEKA 3M2PA 1VJ5A 1T2FA 2JFXA 4XR4A 2VSFA 4DZZA 2WV9A 1GGHA 2QN7A 2VDWB 4Z7QB 1M9NA 1M0SA 3BGSA 5G1NA 3EEOA 1RI5A 2PR2A 3NFYA 4I4TB 4UDNA 1F8FA 2YIJA 2PUFA 1XEXA 4GG1A 4R1UA 4O2BB 2NSHA 4CMBA 2DEUA 4BU1A 4Y0VA 1GQQA 2ZJ4A 3KOZE 5M3BA 1SUEA 2BV3A 2LDXA 4ZVRA 3VBEA 4M89A 1SK8A 1TLTA 2AN5A 3H1FA 3U6DA 2QA5A 1T25A 4ZYVA 4S35A 3TXAA 3O4IA 4V0NA 3HQ4O 1WCV1 4NCXA 3GLIE 1VI5A 3A3KA 3B7GA 2GYWA 5K0NA 1UJBA 4U00A 5L7WA 1ZV1A 4IMPA 5LMZA 1Y5IA 4YIKA 2FPMA 2VH5R 4BWFB 4EYSA 4PBTA 1AM4D 3C16C 4HNSA 4RK5A 3U7QB 3X2FA 4B33A 1M0WA 1DARA 1FRZA 1UK7A 2ODNA 1MX5A 3C1TA 3OWOA 3KV1A 3BB4A 2AG5A 2XUDA 3I12A 3JYLA 2XDQB 4PX9A 1N3LA 4OUDA 4RLSA 3F1LA 2UYGA 2HYDA 4CF4A 3VR6D 1DJLA 1JFLA 3SBDA 2GYYA 1X7GA 3SXPA 3DC7A 4LY3A 1SBTA 1FP2A 3FPCA 1I4TD 1A3CA 3DLHA 2VP5A 1W5EA 2Q0QA 3OD1A 4HMPA 4OAOA 5IDWA 1YR6A 1J2YA 2FE1A 1F2DA 3I2JA 1QP7A 3DL0A 1LZKA 4UM5A 1HK7A 3MJEA 3SOPA 4DLAA 2H1OA 1MAWA 1TXGA 5BSGA 1YI1A 3L0ZA 1OLSB 5CG2A 1G21B 1ECGA 1BH2A 3CX7A 2NU6A 2JIBA 3GJ4A 4A8JA 4ZEVA 1A0OA 1LSUA 4RKUF 3GLGE 1CUUA 2CXTA 2R6CA 4LFBM 1D5WA 3O8DA 3K70C 2AMFA 4L3VA 4GGOA 3OMWA 3MW8A 3R6GA 2ZVQX 2D06A 5FPTA 2FZ4A 3RK4A 1PLLA 2FX3A 2P5TB 1E0AA 1GCIA 4OEHA 2HZ7A 4Q12A 3MOGA 1BX0A 1KY2A 4JGIA 2MYTA 4GICA 5FUXA 2QSFX 1QQWA 3RJTA 4TZ6A 2QK4A 2WJAA 1KDRA 4Q37A 4AG3A 1RLOA 4ZICA 1CUBA 3C15C 4Q00A 1TQ8A 3HBFA 4WXRA 4BCBA 1OAOC 1UL1X 1Y81A 1ZGZA 1Z4JA 3GGGA 1NBOA 1KXZA 2QPAA 2VH1A 4R8RA 1KAEA 1U2SA 1F8GA 1VFPA 2OGSA 3C98A 5M34A 3TH5A 1T1EA 5AYVA 3VU9B 3TEFA 1MJNA 2JFYA 4UD2A 2QP3A 4XQ9A 3S2ZA 2PVCA 1Y98A 2Z3ZA 4JJZA 2PRYA 1QDUA 4X62M 1EK0A 4R84A 4UBLA 1O8BA 1VLHA 1G3QA 2AE2A 4BRUA 2QW1A 4Q02A 3CF6E 1GPJA 1IZYA 3GWZA 1FRQA 1DRUA 1GXSB 4Y9DA 1JMVA 1SVKA 2AMLA 5JS8A 1OT3A 1Z22A 1W9MA 3EUWA 3PSHA 3WGJA 4M0DA 3Q0IA 4OUDB 1EE1A 1JT2A 3U3ZA 4B9EA 2WFZA 1DG3A 4MV6A 3TD2A 1RWQA 2G8NA 4QD3A 1XROA 2IT1A 4A2WA 1T5DX 2WM2A 2AMYA 5SICE 5I45A 4E7OA 1YDWA 4CJXA 2PWBA 3AG6A 3PRJA 1QYDA 2PX2A 2FCRA 3FZQA 5FLXS 1E1CA 1G8SA 1AGRA 1Z08A 1C8LA 1M6NA 2F64A 1R5NA 3G2PA 3T5GA 5DK6A 1I4WA 4P54A 4C2BA 2GVZC 1UKEA 1MIHA 4H2DA 4HF7A 2QLFA 2NU6B 4TL6A 4WXYB 4JCCA 1IJKA 1F4IA 5HK8A 3VVLA 2EWWA 3UK1A 2QOEA 1YIAA 4LJRA 1Y80A 3NPAA 2GEDA 5B6IA 1JTVA 3LT4A 4V0SA 1PR2A 3UFXB 2FMIA 3ACDA 1X13A 4QQRA 3WIOA 9ATCA 5KWVA 4AY4A 2X5NA 2C5EA 3ZV4A 2G9VA 5KYWB 3AHJA 2P91A 1T1JA 3DT6A 3FPJA 5DGIA 1GJSA 3RASA 1R8YA 2P5TA 4ROSA 3CT4A 4MLCA 5B1DA 5KDLA 3EGWA 2VP9A 1DGHB 2KJQA 4HNQA 1VLJA 1WE2A 1HT3A 2BHTA 1QOZA 3SDZA 3VHLB 3ZCTA 1MF7A 4ZRDA 1R0KA 5A3RA 1XMSA 2OO9A 5AVWA 3I62A 1YZGA 5AM3A 5CYOA 1EFRA 1QQTA 3V7UA 3OC0A 3TW6A 2IH2A 2GN9A 1OUMA 2ADMA 5I9MA 5EG5A 5ILOA 2NZ2A 4OMCA 1DRKA 1RAGA 2PH7A 1M1YE 1UJ2A 1U8CB 1XL1A 3RSCA 1J2JA 1GXSA 2VAPA 3JQFC 4ND8B 3JASB 1RFLA 1MNQA 2I6XA 3RSLA 1MGOA 1AKNA 2UYCA 1P4HA 4Y2PA 3ZQ6A 4HGZA 1GRVA 2NACA 1V8FA 3AJEA 3RBVA 4FBLA 4O4HB 2BI8A 5FR2A 2BFBA 3NUQA 4BNZA 4V02A 3SR0A 1G19A 2MSNA 4L73A 5REQA 2O48X 1WS6A 2ZW9A 4G4OA 1PWZA 3J2PB 1TF5A 4ES6A 5L6LB 1EWTA 3GN2A 2QB5A 4B3SB 3UGKA 3JXEA 4L4SA 1G42A 1E1CB 3TSWA 4OL9A 1Q7EA 2LBCA 1UT6A 2EFHB 4JLUA 3C8DA 2ODAA 5CJPA 1EG7A 2I3ZA 2XX3A 4JOSA 3K53A 1J5PA 4RSRA 5D6OA 4DN6A 1HZZA 3DEYX 5LOVA 4DM4A 3L3BA 4BCDA 3H6GA 3M4JA 4RNAA 5HIKA 1WMBA 2LVPC 2G06A 2I65A 3BD8A 4GXTA 1SCDA 3AL3A 5FPHA 4I4TF 3VYRB 4TKVA 5K8CA 1L5ZA 3GOQA 3D31A 1G9SA 1COWD 1NATA 2PDAA 4D80A 1W4LA 4LOAA 4Y6QA 3UXHA 1DKUA 2JIRA 3T5AA 1T8WA 3KFUG 2HBYA 3F9RA 2XYGA 2XMQA 3NT5A 3EGEA 3ICPA 3L7KA 5KMGB 4V39A 2HQRA 4RD0A 2QSYA 4RK4A 1RQPA 4U6NA 4A27A 4D5GA 4E94A 1U2TA 4FXOA 4RU1A 4Q9NA 4YMLA 2PGNA 1YS1X 3CW2A 1VECA 5IUJC 2R86A 3V1YA 5BSUA 4AO7A 5AW7A 1TM1E 2ZUWA 4RACA 3O90A 4JK3A 4YJGB 3TAHA 2HRRA 1ORTA 4R9VA 3U7RA 3H2YA 3MEQA 4YJKA 4JI1B 3TX2A 3QE3A 5FYQA 2G9NA 3SZOA 1ZVJA 1IBMB 3NTUA 1NJGA 2DBRA 1MC5A 1LV7A 4N0MA 3VR1A 3WI7A 5AW4A 4PU0A 2HIHA 3JASA 5A9RA 5JDCA 2J0UB 2GTHA 3QUQA 3QLJA 4K2HA 2V6FA 3LE8A 4A26A 3MCWA 2DFNA 4O4HA 4EYEA 3ESQA 3A6GA 4XUCA 1K4KA 2G5PA 1ES9A 2YV5A 4TXLA 3DMRA 4RQTA 4IHKA 1QUFA 2M6SA 3CB2A 3GDGA 1Y4SA 3QELB 3GMIA 4KQHA 1CUVA 1TYZA 5AOVA 3P2IA 3VPAA 2I76A 4FCWA 1NVKA 3OO1A 2IEBA 4BNHA 1F4PA 2VJQA 1DL5A 2OP0A 4BVJA 1OZGA 4I8OA 3ND8A 2ZSEA 1D6SA 3R7SA 3MCUA 2FQ1A 1A2BA 1R16A 5LR6A 5IASA 2C5HA 5L45A 2AG0A 3ZV3A 2LNHC 3UWPA 2GHQA 4COKA 2C9OA 4RK6A 3IDAA 4I2NA 3OE1A 1TQHA 2GETA 2IV2X 1EE8A 4P92A 2C2GA 2VJMB 4MS1B 4HFJA 3T54A 4AJIA 3WAJA 3FHLA 4TKVB 1SCBA 1ESEA 2ASVA 1EK1A 2PZGA 3W3AA 1NI4B 1RWPA 4I3GA 4L4UA 4HAIA 4A15A 4RF2A 2JD2A 3WV4A 1ZH6A 3MUEA 3FMVA 5DFAA 2J41A 4XA8A 5F33A 3I4YA 2AJ8A 3DEKA 2ZBUA 3CFYA 3SKVA 1IZ9A 4Z8XA 1SCAA 2WAOA 1FDRA 3HGMA 4BO7A 4BU0A 3A4MA 3L4SO 4G1UC 1W87A 4WKGA 3ME5A 3EE6A 4AD8A 4AAYA 2WT8A 1P9NA 3FMIA 4CM4A 3WLPA 1FTWA 1E6MA 3CVWA 3E81A 4XWKA 1JU3A 2ZAYA 3D3WB 1JE0A 1F38A 5ENVA 2IIVA 1BKDR 4R2WA 5JY1A 2M60A 1MO5A 4GLFA 4OQDA 4TLMB 2H5JA 4ZVNA 5LYYA 3UJPA 1ZMWA 2JGNA 4BVHA 3IV6A 3R7LA 4W9RA 1LK0A 1ETHA 2I4RA 2XTZA 3MT0A 3PDHA 4COOA 5JYDA 4PZZA 4Q1CA 4JJFA 4YNBA 3ZDEA 4H08A 4OPMA 1GPDG 1ONBA 2RRUA 3AV0B 3KQMA 4NPAA 1DI0A 1NMSA 1U1IA 1XTBA 3C5EA 3PUXA 4QVGA 1KU6A 1XZNA 4LIPD 1GOTA 2IOHA 1R0RE 1F3LA 1XMQM 4QHYA 5GJWC 3W2TA 1I30A 4RTQA 2GF0A 1R12A 3ABQB 2CBXA 2NUAB 5AW8A 3BA1A 2Y1EA 3FWPA 4QUGA 2FW0A 3AJ9A 3R75A 3RDPA 2X22A 3NV7A 1GL3A 1SWVA 2FN8A 3CRMA 1BWRA 1CLUA 2GBGA 3GLFB 2ZB4A 3IH5A 3C3AA 2ZBPA 1MD9A 3IV7A 3P27A 5TMDA 1RYDA 3NHLA 3DLTA 2Y71A 4OM7A 1Q74A 4Y2UA 3M6WA 4H3HB 1K0UA 1ICIA 4IUYA 3QUBA 4PSDA 1SXPA 1AS2A 1VKHA 1Y6ZA 1ORDA 2M2IA 2QX7A 3BXXA 1VCHA 1W88A 2OO3A 1QDEA 3PNSA 4KG7A 4C08A 3DLPX 1I3MA 4WFIA 3S2EA 3S70A 1EFDN 2KW0A 3EDQA 4KXMA 4L9AA 3JD0A 4YQYA 2B3DA 3RS9A 1QYXA 2CLOB 4ZGBA 2C9DA 3CR7A 1ZIPA 1KQOA 2C1XA 1AKQA 1UPAA 3Q9UA 2HKJA 1HO3A 1NI4A 4I36A 3WMWA 2Z2XA 3EA0A 4HP8A 3S6JA 2PZMA 3B7WA 1WV1A 3K4PA 3KKEA 3DCJA 5GVRA 3FZNA 3PNLA 4TWRA 3BBZA 2C5GA 3D2BA 4II7A 2J67A 2R1TA 1KTVA 3A1EA 4QBHA 1ZI8A 5CNKA 1W52X 4YQEA 3KOXE 1TCCA 1V39A 4HGQA 4D4KA 2O1WA 2FZLA 3PZBA 4IDAA 5IJXA 3ZHOA 3KTDA 2CSXA 2DQ4A 4HMOA 2IHKA 3SC2A 4A8PA 1SWWA 5A6VA 2BEUA 3K96A 3D3WA 5AK5A 5DBEX 1ZM3A 1R0WA 2ET6A 2JHCA 4DV4M 1QYCA 1J4AA 2B6HA 4RXMA 3FTQA 4DLSA 1NDQA 4AL4A 1RYNA 1TKAA 3IXLA 4HB3A 3C3XA 4YJFB 2O23A 4CIXA 5DE3A 3OKAA 1A98A 3ZDXB 2ZP1A 1E3EA 3I61A 2DZLA 1GUDA 4CCAA 4UBJA 2O8DB 3HKCA 1CF9A 4ZCRA 5IXJA 1Q92A 1XT6A 4GWKA 2WT9A 4Z0PA 1H4SA 3A1CA 3WJ2A 4PAWA 3ICWA 1Y48E 4FCCA 3IJEB 1L8LA 2AYXA 3M6IA 4B3IA 1M75A 4H1HA 1I2DA 5FORA 2ZBVA 4YYZA 3OJXA 2V3CC 3QVGB 1G63A 4W5WA 1SOWA 2BELA 3ND9A 5LQAA 3F6PA 5DT9A 3IQIX 2XT0A 4OMUA 4BO0A 4KE6A 3R2JA 3BKWA 3HRHA 3SJCA 1X70A 4O4LB 4V24A 2MDTA 3B6KA 2DCMA 1F9AA 3S40A 5CXQA 1X80B 2OV3A 1JG2A 3PNQA 4Y2VA 1UP6A 4PC7A 4KKXB 5HTKA 5IXYA 1YC5A 3HV0A 4W63A 4FQ8A 3NU1A 2WWWA 3KYIB 4MQFA 3D7NA 1DWOA 1XZPA 4QDKA 1W88B 4X65M 3RTAA 3ASYA 2VP4A 3QBDA 3TLYA 3UGTA 4FCTA 1MO4A 1N5MA 3HCDA 2FFQA 4KU4A 4MHSA 3WLOA 4UHJA 3RRFA 1OBFO 3IRVA 2HLNA 1XJWA 5LP6C 3VC3A 4BO1A 2K7FA 4MUYA 3Q9LA 4B4WA 1YE5A 4P31A 3ZXXA 2R7AA 3OQBA 3M1AA 1P2BA 3CUSA 2GAIA 3KKOA 5EIOA 1SQ5A 2IPNA 3PPVA 3TTSA 4BS9A 5A1TA 1I7NA 5FNVB 3HEAA 5DHAA 3BL8A 4CHGA 2X7JA 3OFNA 1AMNA 1AD2A 3ADPA 3SEZA 1JT9A 2R8BA 1W30A 2HZBA 2FS1A 4MUNA 5AI9A 1NOIA 2WSCF 3MD0A 4GP6A 1ML3A 2WHYA 3AY7A 5TNXA 5KCMA 5GVSA 4UBNA 2Z43A 4XCQA 3SC2B 3KJEA 1W6RA 2FXIA 3B7ZA 1LKZA 1DINA 1FU8A 3IMCA 4EG5A 3U7JA 2IBSA 4A5SA 4D25A 2JVJA 5AQ1A 1RABA 3DPSA 2J5KA 4F7WA 2QGFA 2A3RA 2PX6A 2E1PA 4EEXA 1ILWA 5IH3A 4R68A 5A2QA 4NYJQ 2GN2A 1TIPA 3FUVA 2WVAA 2D4HA 3IKMB 5BSVA 2O8DA 4U5QA 4DG8A 2ZRMA 5BNIA 3MQFA 2VA9A 3EY4A 5FUWA 3T4EA 3OTOB 2VHZA 1PM5A 2W2KB 1E5VA 1HMPA 3LCCA 1Q0SA 3OTHA 3GIWA 4HAYA 1J8MF 4LISA 4RADA 4JLSA 2OOSA 1JHMA 4LQDA 2NN3C 1R50A 2JAQA 2BH2A 1E60A 5I7EA 1LDMA 5FP0A 5EL0A 3BSWA 4KNWA 1ULZA 3O8OA 1II8A 3DEZA 3EW7A 1MU5A 3ICQB 3QYJA 3KXEC 2F1OA 2QNIA 3MSXA 4IIXA 4KQJA 3R0IA 3LW8A 4MQFB 1XMIA 4LNHA 5AVVA 3S55A 4IJFA 2C7OA 4CEHA 3WB2A 1AHPA 4IUBS 1FFYA 2VLBA 2PQMA 1Y8RB 1AHIA 5TGZA 3LF2A 3QKSA 1UJCA 4ZT5A 1WU7A 1YFJA 2TMYA 2QTCA 4J2TA 3SCZA 4F8YA 2QGNA 3QBJA 4MUXA 2BFFB 1FYDA 1FDWA 1OXKB 2ZCVA 3BXFA 1YZVA 3QP9A 3GFVA 4EPYA 4EQ6A 5LWHA 3T5PA 3KXPA 1FMCA 2ZRKA 3BCRA 2W6ID 4JL6A 4EB0A 4INJA 3F8WA 1TRKA 5DX8A 4IIJF 4MQBA 1KFJB 2BKLA 1WIWA 4X41A 5L95A 5ED4A 2R65A 4FW9A 2I4OA 2XMGA 3FIUA 2B3TA 1PWHA 1ZONA 2XOXA 4JP2A 5EFZA 5B3KA 5CVCA 1GR0A 1JQEA 2ZUCA 3LO8A 4AP5A 3WC4A 2EKDA 2FX5A 2A58A 3SVLA 1JHRA 4OU7A 1Q16A 3A9SA 1GA1A 1PQYA 1MJFA 2B6NA 1SKYB 2WRZA 2YCBA 1V7ZA 2V9CA 3FSJX 3NKLA 4RJ2A 4LYHA 1XWWA 3UICA 1CDDA 4E2XA 2VJNA 1DAOA 1RRFA 3N5CA 1E2EA 3ELBA 3O03A 1JB0F 4GPEA 2YJ5A 1XTJA 5E3JA 5HQTA 1JEYB 1T1RA 2XGMA 2I6TA 5FL7D 2G1PA 3TJRA 3SNHA 5JNUA 3EVNA 1A8UA 2VHVA 1VMEA 2P3QA 5IKPA 2W2KA 5H82A 4O4JF 4IIFA 1PS8A 1UPTA 2ZRNA 1G5HA 1HPLA 1VIAA 2ZSBA 3CY6A 3R3YA 4JLAA 3L2OB 3JQ7B 4X1KA 1VMKA 2X9GA 4LRUA 3RKUA 3X1WA 4YUWA 1HQCA 1S02A 3O4JA 1FDVA 1R88A 3T7KA 1YR3A 1Y82A 1NVXQ 3B6EA 3O8OB 4HO1X 1M66A 4TMZA 4BRZA 3NOQA 5IJ9B 5K0BA 4EX7A 2OCLA 2ZITA 3D6FA 4IDPA 3FG9A 4K3VA 4LZAA 4TSFD 3UTDA 3ZNPA 4DRZA 1S2MA 3ET5A 1BA3A 5EEHA 1FB5A 4XX0B 5AW2A 4ZCIA 5U4QA 5DULA 1KFKB 4UUBA 1FYFA 2P4EA 1YA4A 3V1TC 2AG8A 1N5JA 2OQRA 4TYPA 4B43A 2FSSA 4UUAA 5I4BA 3OX4A 3MCVA 1O7JA 1E18A 3ZCPA 2BFFA 3QXCA 2FV8A 3TTXA 1H93A 3KV3O 3D1JA 1IUOA 1PGYA 3L06A 2AXNA 3IELA 5JAUA 1YJCA 3UV7A 1PFVA 2FDRA 2O2XA 4EDHA 3DLAA 3NDRA 4XGKA 3T4UA 3WIDA 1NUAA 1JV2B 4E2ZA 5IZ7D 2QTVB 3UT0A 1NU8A 3VPDA 4KR3A 4QJ3A 2GCIA 3STYA 2L7IA 1MX9A 2CUZA 1E1DA 1M1NA 2ECKA 3DLCA 3SF8B 2BTQA 1IE3A 1XEFA 2WG2A 3EDRA 5JO0A 2I7CA 1USUA 3ECAA 4JP1A 4PEVA 1TZJA 1C7RA 5IF3A 1Q0QA 4UJ5A 1TJ3A 2XB2A 1IBKM 2GRAA 1DBSA 2UZ1B 1W49A 1H85A 3ASVA 1L2CA 3QPWA 2IUEA 3HNPA 1T15A 3DWFA 5H3CA 1JFFA 3BTVA 2P2LA 5J4HA 1SQFA 5B4UA 5AUQA 1C14A 1XDDA 3HI4A 4LOLA 2O20A 4HDKA