4L16A

Crystal structure of figl-1 aaa domain in complex with adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
292
Chain Sequence
PTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTGIRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVARLKLPSVIFIDEIDSLLSESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKKFGCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fidgetin-like protein 1
publication title Structural insights into the unusually strong ATPase activity of the AAA domain of the Caenorhabditis elegans fidgetin-like 1 (FIGL-1) protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 90
structure length 292
sequence length 299
ec nomenclature ec 3.6.4.-:
pdb deposition date 2013-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l16A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l16A01
4ACBA 3U2QA 1MR3F 5ANRB 4Q7KA 3PUVA 2YYZA 2F7SA 4NU0A 1N25A 4N0DA 3ZDQA 4EQ6A 4PZZA 1E9SA 1UDWA 2O8FB 2VP9A 3DKVA 3REFA 3I5YA 2VQSA 1KDOA 3AKDA 2W2TA 2WJJA 3CX7A 3DEFA 3B1YA 1CJTC 1XMVA 1JR3A 1FMJA 4EIWA 3R9IA 4RD6A 4A1FA 5FPSA 2IUTA 4DDVA 1S3SA 3LNCA 3QXSA 4PPFA 1CU1A 5GJBA 2IYVA 2RGNA 2ZRGA 4IVQA 3C41J 1RFLA 2YZ2A 2QAJA 4P4TA 2X1VA 2FN4A 3S1AA 4A0GA 1KDRA 4FXPA 3C7KA 1ZW6A 2QEQA 1E96A 3U44B 2A2ZA 1E6CA 2CCJA 1JPNA 2ZEJA 3AVTA 4KVAA 2QU8A 3QKRA 2RGNC 4P4UA 3BB1A 4IW3B 4Q4AB 1XD2A 5D3MA 1R8QA 2C78A 4MKIA 4LRWA 5K8UA 3I4LA 3CUEF 2OM2A 2ZSEA 3QPVA 2VHUA 2HCJB 1CJUC 2JJ2A 3GJ6A 3PEWA 1HT2E 2ZS8A 4YXWA 4I99A 2R2AA 3ZD6A 5A0FA 4I1OA 1M7BA 2KSQA 2CEAA 4BASA 5B58C 4E07A 4JLBA 5JS8A 5KHOC 3RYTC 4A0RA 1TAGA 2ZRAA 4X8MA 3VMFA 4B33A 1DO2A 1Z22A 3VR3A 1XEXB 3VX4A 1QZXA 5KNBA 3NEJA 2VYFA 3PXGA 5J4KA 2XXAA 4UNSA 3A4LA 2A5YB 3PEUA 2V8OA 2G1JA 2DWZB 2ZREA 3ZS8A 4HB3A 1G21E 1KHTA 2RB4A 1Q3TA 3KQHA 1Q20A 2XJ4A 2WIBA 2ZI9A 4HB0A 4K46A 2R44A 1S9DA 2W6ID 3NBYC 4BUJA 2CVHA 1JR6A 4QHYA 5DNYB 1OB5A 2A9KA 3B9QA 3KFXA 1KI6B 4D2IA 1YQTA 2VRWA 3L0SA 2BCJQ 4G5QA 5DGXA 4AKEA 2R8RA 4NCIA 1NBMD 3U6KA 4U7DA 1GFIA 4KI0A 3AUYA 3WMEA 1ZNXA 2EWVA 4N0EA 3TUZC 1UBFA 2O8DB 3WBKA 4W5JA 5KNCA 1ESNA 2OT3B 2BBWA 4QG7A 4NCJA 1W49A 2NGRA 4NYMR 1VG9B 4QGGA 1G4AE 3CF6R 3OIYA 1TUEA 3U7HB 5HPYB 721PA 1W0KA 1SXJD 2WOOA 3VKWA 1GTVA 2BCGY 3O47A 3CBQA 4YDSA 1Z6GA 2ZSAA 1R7RA 2XB2A 3CX8A 2ZRPA 4AK9A 4LV5B 2CNWA 4M9QA 1J70A 1UKYA 4D80A 2EU8A 2ZAMA 5CITA 2OLJA 4JL5A 2GF0A 1P75A 1VYTA 4M1TA 4RFVA 2HT1A 5C4MA 4LJ8A 4P4SB 5H70A 3U4QA 2OG2A 3B5JA 4RKFA 3QENA 3H4MA 4IDPA 3LRPA 2AR7A 3E5HA 3GJ0A 5BN5A 3TJZA 2GJSA 4DT1B 4YMTA 4KLNA 2OCAA 3QJYA 1W46A 3HJNA 3A6PC 3QNUA 1NBME 2V1XA 4IDOA 1SVLA 4FWGA 3CRMA 2P5SA 3PUYA 1U94A 1ZM4A 2QY9A 4KSBA 1R5BA 2ODNA 5AUQA 2ZRIA 1N5LA 2DFLA 2QMOA 1CR2A 3KTAB 3QG5A 4LX0A 1BS1A 1I4DD 4HB4A 2Q3MA 3B85A 5C18A 3VHLB 1OYWA 2PBRA 3O8RA 3C8UA 1HEIA 3QBVA 2G6BA 4CT4B 5CB8A 1W36C 1T5LA 1HQYE 1EX7A 1NJGA 1FNMA 1UF9A 3KFVA 3BOSA 4TQUS 1E2PA 1TADA 1J2JA 1LF0A 4TN1A 2GWHA 2HF9A 4CVNA 3C5CA 4NYJR 3MWJA 2ZTSA 3H0KA 5FBWB 2FGJA 1SVIA 1SXJE 2CHVA 3DZ8A 2MSCB 3BH0A 1Z06A 2ZYVX 3EZ9A 2O8BB 3GEIA 3QG1A 3T1VA 3TQFA 4IRUB 2QT1A 2IBMA 2GJ8A 3M1IA 4ZI2A 3K9LA 4GDFA 1W4AA 4AY2A 4F38A 2K5UA 4FCVA 2BIFA 1QZMA 4DXAA 4HUQB 2GKSA 1MRNA 1NVVQ 2WPDD 2GK6A 5JI2E 3A1WA 3ECCA 2WSSD 3QF4B 4DSNA 1P6XA 2WVJA 1SVOA 4D4KA 4M9ZA 3IDQA 5FTNA 2YOGA 1U8AA 4LHZA 3CIOA 1G8GA 5F98A 2AXPA 1GNPA 4PZLA 5IK2D 3VKGA 2GAOA 4RD4A 1P2VA 3Q8XB 3VR5A 1N5IA 4FCTA 1PZNA 1S4QA 5G53C 4BEJA 3BE4A 4OHWA 2VHQA 3ONWA 3W9YA 1Z3IX 3AVPA 3GEEA 4B43A 3RS5A 3ADBA 4TQ9A 2GESA 4YLGA 5E7JA 1XNJA 3LX8A 3V4RA 2FZ4A 3OIVA 3K70B 1X3SA 2W58A 2RGDA 3SYKA 2OFXA 2XNDA 4FMCB 4NL4H 1FUUA 2RMKA 1QBKC 3AGQA 4HZUA 3B1XA 4A15A 2VF7A 1AKEA 3PEVA 1HTWA 1Q1ZA 1G291 2ZRFA 2OEPA 2ZI6A 1IN7A 5HKKA 1KO1A 1P4SA 4C30A 5JECA 4Q9HA 2AXNA 2NO1A 1RIFA 3UG7A 4C2TA 2O8CA 2ZJAA 1ZBDA 1H8HA 4MYHA 1KI8A 2QBYB 4M1YA 2H1LA 4QRHA 5C46F 3SQXA 2OO7A 3NXSA 2V1UA 2IW3A 2ZR9A 1AQUA 1Z0KA 4G0NA 3D31A 2FWRA 3AKCA 3UPUA 2J9RA 1UBEA 2QA5A 3NC1C 3QPUA 3RWOA 3GJ5A 1KI9A 3KKQA 3Q72A 2YWHA 5DI3A 3ETLA 2JDID 3VX3A 5GADl 1L4YA 5SZKB 2DZOB 4ERNA 4PHFA 4LY6A 1XMJA 2VBCA 4H1UA 3GQBA 3OEHA 3KJIA 4MITA 4CGZA 5J47A 4DLRA 1PLLA 4HEJA 1ZU5A 2JLWA 4LCBA 4W5WA 1YRAA 1X8LA 4TMZA 5CDFA 2JLRA 3RRMA 4NH0A 4F92B 2ZR0A 2FMXA 1U0LA 1MABA 1ZD8A 2IHBA 2BC9A 1E9BA 5JJIA 1AGRA 4LUCA 4RZXA 3RHFA 5C2JB 2CCKA 5JHHB 5F9FA 3F8TA 3T1OA 5B57C 2JGNA 2GDJA 3U5ZB 3VR1A 3NKVA 4JL6A 3Q5DA 1K6MA 4JLVA 4KFSA 1GRNA 4FWDA 5LBIA 4CEJB 5FPTA 4XVUA 1L7VC 4PSVA 2V55B 3LBHA 4DLVA 1GUAA 4C0JA 2GEDA 3EC2A 3IQXA 1X6VA 2D06A 2OAQ1 3UANA 3FKQA 1R0WA 3MCAA 4LC1A 2HXSA 2MMGA 4JLNA 1KSFX 1E0JA 1UKEA 1RRFA 2ZJOA 1CF4A 4PHGA 2V6JA 3ICEA 4XSHA 1VCMA 4HYYA 3CRW1 3FHOA 5KPDA 2VP4A 4R2IA 2JLYA 1P9RA 2H7VA 3TW4A 2ERXA 3LV8A 2YWGA 4M0LA 1YZUA 3B9PA 2MMCA 2XOKA 4TLDA 4Q1AA 1A5TA 2XSZA 1GIAA 1ZM2A 4ASUD 4NHOA 1K5DA 4YC7A 4KO8A 1TQ4A 1OFHA 2ZJ2A 1KNXA 1ZNYA 1S3GA 5K8TA 4TSFD 4OI0A 2V7QA 1ZC4A 1G5PA 3KW6A 1VCNA 5DN6A 3H84A 5KSZA 3QI2A 2B7BA 1OSNA 2AK2A 3NDPA 4F91B 2ZIAA 1VG0B 1E2QA 4MKFA 3GLHB 2AFIE 4IDQA 3QXXA 1JPJA 1G9XA 1H65A 1CRQA 5D3QA 2YINC 3VFDA 1N6IA 1V43A 3EZ2A 5KPJA 4N1AA 3BXZA 4Q1BA 5BXQC 4KYUA 1NNEA 3LLUA 5J4HA 3IGFA 2WAYA 4CDGA 4HLCA 1Q57A 4BE7B 2JLZA 1NG1A 4P32A 3VHXA 4YMUA 2NTYC 4OQXA 2RGCA 3CX6A 5AJXA 1E0SA 2LWIA 2QAGB 4G5OA 3MUFA 4MRRA 1EESA 2Z5FA 2ORWA 5FR2A 1I2MA 3FB4A 1NIPA 1SHZA 2GZDA 3TR5A 1R6BX 3QEOA 3TUIC 1RJ9B 1VDZA 1NMXA 4QL3A 4PR0A 3I92A 2OHFA 4JLJA 4CYMA 1AKYA 3CPJB 2ATXA 3AF1A 3X1WA 1KZ7B 3AKYA 1OE0A 2WWXA 3CR8A 3WNDA 4JBYA 2OUKA 1ZCBA 2J46A 1T4GA 4HLUA 4LHWA 2X8AA 3R9WA 4O0MA 2ONKA 3LQQA 1GRRA 3T06B 1A7JA 3THWA 3EPJA 2P6NA 3IO5A 2IS1A 4GRAA 2J7PA 4QGAA 2G9NA 4MDEA 2DY1A 3K70D 4KODA 4HLUC 4A0HA 1ZP6A 3X1YA 1UKVY 5CM8B 3OEEA 1SKYE 3EASA 1KJWA 4OK5A 3RRZA 3U7FB 4I4LA 2FSIA 1W44A 2GEUA 1Z6YA 1VTKA 1XCMA 4WOPA 3SOPA 2O8EA 1DO0A 3KZ1E 5EZ5A 1G7SA 4ABYA 4PO8A 3DOFA 2ZXUA 1NIJA 5EXPA 2XX3A 4TL6A 3P32A 4TTRA 1II9A 4EFMA 1QDEA 3KB1A 2BVNA 2ZI4A 3L0OA 4TMTA 3GMTA 5FL3A 2ATVA 2W2XA 2JATA 4URZR 2V9PA 1ELOA 2ZE7A 5HTKA 3KKOA 2VHJA 4LJAA 4B44A 1Z63A 2QUZA 1YZGA 1JQJC 3CONA 4U00A 5P21A 5IF9A 3GLGA 2QNRA 1PUJA 3T61A 1MO6A 4TLBA 3G82C 4Q9JA 2DFKB 3I3SR 1GM5A 1D2NA 3TVDA 4C0BA 5JZVA 3THOA 2J41A 1RKBA 2P65A 4DCVA 5FBLB 1AS0A 1E2MA 2H57A 5FOWA 1ZM7A 2VH5R 1KOFA 2CLDX 1TF7A 3K8YA 4LJYA 4F7WA 2YKGA 3QKSA 1XTKA 4ITRC 1IOZA 3AVXA 2QG6A 3EARA 4NYMQ 3AVYA 3VU9B 2X2FA 5JEEA 5EXSA 4JLAA 1W7AA 1ZD1A 1TPZA 1E0KA 1JALA 3AV0B 4GITA 1OIVA 4A8JA 3QXHA 3X1ZA 2QE7D 2D62A 2IWRA 1XXHB 4MQBA 5HCNA 3TQCA 1Z28A 3LBIA 5AK0A 2PMKA 3AF4A 1RZ3A 4UNRA 1S1CA 1G17A 2IS4A 1V5WA 3EIHA 2F43B 4A8JC 1JJVA 3LFUA 2ANBA 2I3BA 3QKRB 1ZCAA 4B73A 4TLAA 1XD2B 5D3MB 4Q19A 4C7OA 2IYXA 1R0YA 4Q1DA 3CO5A 4V0MA 2QM8A 4X8LA 1N6HA 2BBOA 3OIWA 2DWOA 3ZIAD 3RRNA 2EFEB 2NIPA 5G41A 1W48A 2OFOA 3BH6A 3UWKA 4KITB 1KI2A 2W0MA 2PZEA 4PPNA 3V9PA 1E2GA 1N5JA 3AF3A 1G6HA 2XTMA 2J0UB 2H17A 4HB2A 5EE0A 1TQ6A 1MT0A 4JVLA 4Q66C 1SVSA 3GP8A 3VNVA 1XJQA 1ZNWA 1ZVQA 3CPHA 1E32A 3IILA 3K53A 2CDNA 2VP6A 3DM5A 3FOZA 5FL7D 2VP2A 4PAMA 1P73A 2A78A 3TW8B 2X19A 5AWFC 1X37A 4US2R 1JQLB 2VP0A 3EA5A 3IKJA 2OLKA 5EXTA 4FINA 4RKEA 2EQBA 3FMIA 2IX3A 3RWMB 3NEYA 2O0JA 1JXOA 4JLPA 4J0QA 1XPOA 3UWOA 2QM7A 3NDBB 5EQTA 1DAMA 1U0JA 3A4NA 2IYTA 2KRKA 1Q22A 3THYA 2Z0MA 4Q1FA 3D8BA 1D9ZA 1OHHD 2JEOA 1JEDA 4LOAA 4FWTA 4JLKA 1YZLA 4X8HA 1U99A 4OK6A 5AJVB 2KB0A 1R10A 4RVCA 2FPMA 4TYYA 2BMEA 5DE3A 3TLXA 1XP8A 4GT1A 5KDDA 1VHTA 3SEAA 1KSJA 1VIYA 1OFIA 2CJWA 4NMMA 1PLKA 3THXA 4JBXA 2XAUA 2ZRHA 1GL9B 3A1SA 5C1BA 1OLOA 3AF0A 1KNQA 5HZHA 4Q00A 4XVQA 3D6TB 2PLRA 4A92A 4CEIA 1AGPA 1NRJB 3CRQA 1F2UA 4A0FA 4D26A 3EXAA 3G0HA 2IXGA 2JLQA 3FMFA 4YQFA 3HYTA 1SGWA 3BC1A 2QL6A 3TBKA 2NO9A 3D7MA 1SULA 1AJEA 2HF8A 4V0OA 3MJHA 4C0HA 1OH6A 4JLOA 2PJRA 1E9CA 1VECA 3OFND 3U4QB 1UAAA 4TTQA 2ZJYA 4QC2A 4MRPA 3B60A 3KQNA 2IYQA 4JIMA 4WZ6A 3QF7A 4G1UC 4GOKA 1R5OA 4YMSA 3JZMA 1NVXQ 3EX7C 2ZYTX 3DO6A 4Q18A 4CF7A 421PA 4TT3A 3FVQA 4RD3A 3BS4A 2WJVA 4B71A 5BQ5A 2L0XA 4LV6A 4V0NA 5KUTA 2QMHA 2ZRKA 3UMFA 1OKKD 4BZXA 1G3MA 4EPRA 1EFTA 4RD1A 5FOUA 1FOEB 3DZDA 1II0A 5TXGA 4AWXA 2C2HA 2IEZA 3KUDA 4FMBB 2ZANA 1EFUA 2B92A 2YWFA 3P4YA 4ZV4A 2VP5A 3NBFA 1FFHA 1K5GA 4NCNA 5FTJA 1Z8FA 3U3KA 3FHCB 1I4LD 5J4LA 3R9XA 1ANKA 1TU3A 4AKIA 3OF5A 4OK3A 3Q7PA 1E1QA 2GVZC 1EK0A 1YHNA 4AIIA 3BERA 4TMVA 4WVFA 1ZM3A 1KKMA 1E2LA 2IS6A 3SC3A 1A2BA 2DBYA 2ZVPX 4D0NA 3X1XA 2C9OA 1XJ0A 1G18A 3JVUA 1S0UA 1UEIA 3I32A 2OCBA 3FE2A 2FPLA 1COWA 5DI9A 3K1JA 1YR9A 2Z83A 3VKHA 4NYIQ 1AQYA 4P33A 2A5FA 3W5IA 2YV5A 5JFGA 3KXKA 4RFSB 1BMFA 4MDFA 5DSZA 4QHSA 2W0SA 3FHTA 1J7KA 2EFDB 2D4HA 4B6FA 3R20A 4M1MA 4DDWA 2VTKA 1GL6A 1NI3A 1XBTA 1LY1A 5GJCA 3ZZTA 3K0FB 4PC1A 1M6NA 1NKSA 4MUAA 4US0R 3N70A 4KCGA 2YNMA 3WP1B 1QVAA 1YZTA 4YMWA 3WYAA 1RYFA 1OKKA 3EZFA 2Q9CA 3KQUA 4NTZA 4ZCMA 1F60A 2JASA 4XVRA 1S1MA 4HZUB 3QSYA 4DVGA 1E2HA 3SDZA 2D2EA 4I1VA 2QRZA 1IXZA 4DCSA 1BKDR 1ZAKA 1LNZA 2PH1A 1QHYA 1GKIA 3P20A 2DPXA 1TF5A 1GVNB 4EPVA 1N0VC 1U8ZA 3RDPA 3LDAA 1QHSA 4KLZA 4MGYR 4BRWA 1N6RA 1EGAA 2O8CB 1XXHE 5FTKA 2R6GA 4OQMA 5CLQA 4EJSA 3MWLA 4NZYA 4D4JA 1FL9A 4GMDA 3WRXC 1VCOA 2FE4A 4BFSA 5FPHA 2JLSA 2X2EA 2ZPTX 2D7CA 3GLFB 2FU5C 1YKSA 5FI0B 5DYGA 4URXR 3EAQA 1KAGA 4WZBE 4DLXA 3JVVA 2QP4A 4EJSC 4ZDIA 2OAP1 4KAXA 5DI3B 4QJ5A 5TY0A 3ZQJA 4XTCS 4FCWA 3MGCA 4IDNA 3X2SA 1E4YA 5DISB 4V02A 4PAOA 1GZSA 1UM8A 1AA9A 1TF2A 4E5UA 4M1OA 4CEHA 1AN0A 5DHFA 3A1VA 2ZM5A 1KMHB 3EA0A 1YU9A 3LX5A 1OXXK 1OJLA 1P3JA 1NVWQ 4OJKA 4MYTA 2G3YA 2GXSA 4FD2A 1VIAA 3UMSA 1SKQA 3DDCA 3L8YA 4IOKA 1WMSA 4RD2A 4B3XA 4BFVA 1QHIA 5CIWA 1BH2A 1R4AA 1WA5A 3T5DA 3TH5A 4QNRA 3L2OB 3R7WB 3W8RA 4PZYA 5TV2A 4DLZA 4EAQA 1KSHA 4TYQA 4IFEA 2J0VA 2AN9A 1E79D 2P0EA 4RCYA 1YVDA 3IPXA 3OE7D 3BJIC 3B7GA 2G88A 2P6RA 3TGPA 3W90A 2Q9AA 2OXCA 4E03A 1IN4A 3CH4B 1TEXA 4OHYA 4MYUA 3T5GA 4O2RA 2ZU6A 1ETUA 4C0SA 3TE6A 5AJZA 1NY5A 1NKTA 4RD0A 1SVWA 3I8XA 4UNQA 1XPUA 4KYIB 2FEMA 4LBVA 5JCPA 4EPYA 1IJFA 1LB1B 1RYHA 3K0AB 1OH5A 1C1YA 3KJGA 1EFRD 1C4OA 3O8BA 5EXXA 1IY1A 2H92A 1XF9A 4HDQB 2CXXA 2V6ZM 4XD7D 2G1KA 3L82B 5CK4A 5L3QA 3OHMA 5EE9A 5EP1A 2ZRDA 1HQCA 1NN0A 1G5RA 2F9MA 3BK7A 3DM9B 2C9CA 1XDBA 1Q44A 4QOSA 2JIZD 4C9BA 2GILA 1KK3A 1MV5A 3A37A 4JL8A 3RRYA 2B8WA 3DOEA 5FI1B 3WYFA 1RPZA 2BKEA 2W6IA 2QORA 2OCYC 1GNRA 4WZAE 2HXYA 1XEFA 3QKUA 4Q4HA 4LJ9A 3FMPB 4XWAA 2WKQA 4EPTA 3LQRA 3WHLA 1CR4A 2KBEA 2UVQA 2R6FA 1W4RA 2XJ9A 4LJ5A 5IRCD 1OXUA 3LW8A 1NBMA 4AKHA 1F2TB 2F9LA 1NG9A 1NLYA 3VR2A 2PZFA 3MAAC 1KK2A 1FQKA 5CJPA 2ZUBA 2OBMA 1NN5A 4V0KA 3M6AA 3OE7A 2AKAB 3K09A 1KZGB 1VCIA 2Q9BA 2VO1A 1XU4A 5JSZB 2B8TA 1QF9A 2ODBA 5J4YA 2QMUA 2BM0A 3WMFA 4IKEA 3K0SA 1A82A 2ZJZA 1DVRA 2DYKA 5C4GB 4ZIRA 3TRFA 4GZMA 4GI7A 3W5JA 4LWZA 1FW6A 1CXZA 1D5CA 2B6HA 4O3MA 2ORVA 1OIXA 2BBTA 4JLMA 2YOFA 3TMKA 2JLUA 5FTMA 1FUKA 1SXJA 1OH7A 4TWZA 3RAPR 2OILA 4M53A 1FX0A 4D81A 4OI2A 5DHAA 3CZQA 1WDTA 1XZQA 4BFZA 1TTTA 5FOTA 2HYIC 1M7GA 1SXJC 2DFNA 3AVQA 1L2TA 3E70C 2AWOA 2F1IA 2QMEA 2C96A 2JIZA 2QGNA 4L9WA 3I8SA 2EW1A 3CLVA 1XD8A 2YHSA 3GJ4A 3N2IA 2P67A 821PA 4BLRA 2QENA 3NVAA 4TL8A 5BN3A 3QUSA 5J5CA 1SVKA 5AR1A 4C0KA 4WXRA 1EWQA 1MOZA 4C3ZA 4N3NA 4Z1MD 4QBHA 4FMDB 1AZSC 4E09A 2R65A 2ZSBA 3G5UA 4PQFA 4QKQA 1G3QA 1E3MA 2AWNA 1KI7A 2CL6X 4Q5IA 3UKDA 4JS0A 1G19A 1EG7A 1X8KA 2CL7X 3FTQA 3VNUA 4XOIA 2O8FA 2Q21A 2JA1A 3OIUA 3VTKA 2I4IA 4LYAA 1AS2A 4DCTA 2RH5A 5KSYA 1N6KA 4IXMA 2WJHA 4Q4JB 1XCGB 2QQ0A 4PQYA 4II7A 3SN6A 5BW8A 5FBVB 3J81k 3QKSB 1T9HA 5LPNA 2CHQA 1XZPA 3PEYA 1KI1A 1PVOA 3HDTA 2DWQA 3SI7A 1VHLA 4JKIA 2WPDA 1P2UA 1XTJA 3F3YA 4KSCA 3PUZA 4URWR 1Q12A 4D82A 2IXFA 4C0LA 2WSSA 4GBMA 1KSGA 1IQPA 1JB1A 1X86B 2QT0A 1GRQA 1EX6A 1BOFA 2ZITA 3CM0A 4MUBA 3U44A 2CMKA 3EIQA 5IK2A 1YRBA 3UK6A 1BYUA 4WIAA 1TQDA 1NSTA 4MH0R 2IT1A 3GEHA 4HDOB 1IJEA 4OHXA 1KO5A 2PX0A 4PPQA 3ZZUA 2LCFA 2OBNA 2WWGA 1T5IA 1ZINA 5G3YA 3GLFE 1M8PA 2NZ8A 4LHXA 3IPYA 3PVSA 1F3OA 2ZRJA 5FUYA 5L3RA 3FKSD 4TYWA 2XGJA 1NMYA 2WMNB 1P9NA 3W6NA 2QPOA 1E2FA 3MWYW 4TMKA 2IEYA 1KY3A 1N0WA 4LYHA 1N6OA 4BECA 5K8LA 5L8VA 2G83A 5IDVA 3AB3A 3FWYA 2CL0X 3AP2A 4JVNA 2QRNA 4QJ4A 4ZDKA 4D0GA 1Y63A 4GFDA 4NKRA 1JJ7A 2Z43A 3IHLA 3ZZ0A 2FFHA 3IBGA 1II8B 4EPXA 3Q7QA 4TZ0A 4XIGS 2GXQA 5FBRB 3REGA 5E3HA 1T8TA 3QOFA 2A5JA 3PUXA 3TAHA 1MH1A 2FNAA 2IHYA 1YZQA 1KI6A 1VG8A 1P62B 1CIPA 1T8UA 4OQFA 3GLIB 3PFIA 3MMPA 3EPKA 1FP7A 2VEDA 4I1UA 4IXNA 4AI6A 1ODFA 2HV8A 4EDHA 1IAQA 5DH9A 1CULC 4Q03A 4DHEA 4K81B 4W9MC 4BFTA 1FPMA 4JZKA 1KI4A 2JDIA 4KXFB 1F48A 2EFGA 3F5FA 2HLDD 4XSGA 3SFVA 4LSGA 1E9DA 1ZU4A 3TNFA 3THYB 2QGZA 1GP2A 1AM4D 2A30A 2FPKA 1Z2CA 4Q47A 3HPQA 2R9VA 3W6PA 4IJMA 4LGMA 3ND9A 3NHBA 3VAAA 1B23P 1VYUA 4Q02A 4LHVA 2BEKA 4BLOA 1NN3A 2JJ8A 4DIEA 1WBBA 4F4IA 4PXAA 4TYPA 1IHUA 4L15A 1XFAA 2PL3A 3IIJA 3THXB 5EUQB 1U8YA 3AVUA 2R62A 4F4JA 1XD9A 2PX3A 3LA6A 1FNNA 4M1SA 3AVOA 4IFBA 2DHRA 3CRRA 5J40A 2KJQA 5FPYA 4FMCF 3MFYA 1OFTA 1FTSA 3DPUA 4M22A 1F2UB 5EE1A 3ZGXA 2UZIR 521PA 2PCLA 4A9AA 2CE2X 4ZCLA 1IXSB 1HYQA 2KE5A 1KO7A 3EZ6A 1J8YF 1RC8A 4POAA 4UXIA 4DSTA 1CEEA 1GNQA 2ZE8A 4XH9B 2GJ9A 2QSZA 3NTUA 4BFXA 3MLEA 1GWNA 2PLFA 4D6PA 3P27A 3AVVA 1W4CA 2RHMA 4ASUA 1N6PA 5TARA 3ZVLA 4A6XA 4Q7MB 4QBIA 1W5SA 3W3ZB 2B21A 3SE0A 2J0QA 1O87A 3MJRA 4EPWA 2ASEA 3RC8A 1E9FA 1H8ED 3AQ4A 1FP6A 1OF1A 1RRGA 2FG5A 1R0XA 3U7GA 3RC3A 3AP3A 4TSFA 5AUOB 2BM1A 2P5TB 2IUSA 2EYQA 2W6JD 4P3YA 2P3SA 2PMDA 2JLXA 2I1QA 1UFQA 4EUNA 4FW9A 4QM7A 2FEOA 4TLEA 1S9HA 1CP2A 2JJ1D 3MSXA 1LS1A 1D2EA 1OYYA 3QE0A 3ADDA 4C4PA 2O8BA 2ZRNA 3LH5A 4B32A 5E4FA 1CR1A 2CLSA 1RE0A 3HPRA 3ZLJA 1DS6A 1KJZA 1OFUX 3I5XA 1UADA 1M34E 2ZVQX 4US1R 2FX3A 4MRSA 4DDTA 1ZC3A 1BO6A 3BGWA 3GD7A 4LI0A 3C14C 3QF4A 4M1KA 2PJZA 3IIMA 4ARZB 2QSYA 2RGAA 5JWHA 3P4XA 4PAQA 3SZRA 1US8B 1W2GA 1DARA 3CB4A 1GL7A 1GAJA 1Z83A 4MRVA 5KNDA 2Y8EA 2VHCA 5EE3A 4UXHA 2ZE5A 1Q1EA 2XZPA 2Q3FA 3BH7A 5E95A 3QBTA 4A2WA 1OPXA 4Q01A 3SS8A 2ZSFA 5JLJA 1T0JB 3B13B 3BAFA 4NCHA 2DZNB 3K9NA 4PHTA 2PEZA 3FFBA 4UKDA 4EQ6B 4PC7A 4DC9A 4DLUA 5B30A 1C1KA 2J87A 2VL7A 2ZRMA 2NZJA 1UPTA 2BMFA 3B1VA 4OL0A 3OAAD 5AUPB 1NLFA 1KMQA 2Z6VA 1QG4A 3D3QA 3KX2A 1I2DA 2A5DA 2ZU0C 3Q9LA 3CKLA 4BLSA 4UJ3A 2W6JA 4CW7A 3QEJA 4BEBA 2IL1A 2REXB 1CJVC 4JT2A 1UBCA 3AUXA 5DO9A 2IYZA 3W8NA 2FH5B 4W7SA 2ZQ5A 4XWKA 4JLDA 4ZKEA 5KU1A 1GKYA 1G3UA 4ESVA 3S1AB 3WY9A 3TK1A 3A1UA 1FQJA 2NG1A 4DUGD 4PX9A 4CRWB 1DPFA 3RS3A 1TEVA 3BRWD 3N2EA 5KOYA 2OFWA 4H1VA 4JJKA 2IUUA 1JAIA 4AG5A 1DAFA 2J45A 5JWOA 4MKHA 2O52A 1CRPA 3U60B 2ODEA 2F1JA 2GNOA 4WA7A 1Z5ZA 3RLFA 2IA5A 1X1SA 3QVUA 4D4LA 3CNNA 1HE8B 2VSXA 4HAYA 1XB2A 2IC5A 2REBA 3KKMA 3B8HA 2XTZA 1G3IA 1UEJA 2WHXA 2CHGA 1VKJA 4ZPXA 4O25A 3PCRB 2WWYA 1KDTA 1E2IA 3B78A 3BFKA 2XXAB 2ODWA 2F3RA 2IF2A 3OAAA 3B1WA 1GG2A 1IN6A 4NYJQ 2Q6TA 1E2KA 4CEJA 1NVVR 4U5XA 3A1TA 4CEHB 1RVDA 4XJXA 4EFNA 1MO3A 3KXIA 3X1DA 1DEKA 3B2EA 4IEIA 3SJZA 1GDDA 3NWJA 3UATA 4NPHA 2QE7A 4URUR 1DG3A 3GFPA 2WM9B 2OBLA 2F6RA 1Q1QA 5BN4A 1G3RA 5TMPA 1Q3HA 3ZQ6A 5H8WA 4DUGA 2OCPA 3GLIE 4OI1A 4YMVA 3O8CA 5HZKA 5EP3A 3GPLA 2OV2A 3PR1A 3CNLA 1G8YA 1FTNA 2NPFA 4PQRA 2HJGA 1E1RD 1DOAA 2DCUA 1XTRA 3ZIAA 4DB4A 4C2UA 4L8GA 3QKTA 4WW0A 3SHFA 4LZZA 2QZ4A 1KIMA 4Z54A 2O0KA 1LTQA 1TX4B 3GLHE 5FR1A 2A3RA 2VA8A 4YONB 2DR3A 2GRJA 2QP9X 2FFQA 1P61B 3SJCA 4IDHA 2BHRA 1E2JA 4BPBA 3LAWA 5DIFA 4ESHA 2WICA 621PA 5FL7A 3M4YA 2NOAA 3HU2A 3CF2A 4JSYA 4NCKA 4RZUA 4LV8B 4B3GA 1WBDA 5EP4A 1ZM9A 4I81A 2YC2C 4LPKA 4Q4HB 2B7CA 2G0TA 3WYGA 4BRUA 2CK3D 1L4UA 4IVRA 4UNNA 1RJ9A 5KDLA 2IS2A 2FSHA 2Q0HA 4Q4LA 3ADCA 1DADA 3K9GA 1OHHA 2RGBA 1W36B 2QQEA 1NLZA 2WIAA 1E9AA 3DMNA 1MO4A 3BD9A 3HYRA 3CW2A 2D74A 3MHVC 3TR0A 2R6CA 4DRZA 2BWJA 2GBLA 1R8SA 3QVVA 1O3YA 2I1VB 1TU4A 4GPTA 1Q0UA 3SBDA 4ZDWA 1KAOA 1E1RA 5GVSA 1SVMA 2JCSA 5DYIA 1JEEA 4HAZA 5FUWA 1Z29A 3A4MA 4Z8YA 1W0JD 1YR7A 2ZJ5A 1KK1A 2BDTA 1OW3B 3ADKA 3ZVMA 2GBLC 1G8HA 4JMPA 2FSFA 1JR3D 4A6PA 3KKNA 2GF9A 3T34A 2H18A 1D6JA 1HV8A 2ZRBA 2V54A 3DVLA 1FX0B 4G3XA 2AFHE 5CJ2A 1KO4A 1P9WA 2W2VA 2BMDA 3U3JA 4DEYA 4ON9A 2Q3HA 3RS0A 1DAGA 1G5TA 2P2LA 1HA3A 4OJQA 4ACAA 4QNMA 4GMXA 5FPKA 4AD8A 2WBLC 3LWNA 2C03A 4QJ3A 3PIRA 2QTFA 3OFNA 1KTVA 4LRTA 5B2ZA 3GJ3A 4D4MA 4BLPA 1LVGA 3K0CA 3TUJC 4OKSA 1M74A 2JJ2D 5EZ6B 2IK8A 4LBZA 4YXWD 4Q9LA 1OB2A 2HUPA 2GXAA 3QPWA 3ZD7A 3GJXC 3TIFA 2H5EA 3GJ8A 3GFOA 3LVQE 4I1SA 2D7DA 1OXTA 2FFAA 4BLQA 1FMLA 1OH8A 4O2LA 4Q1EA 1XMIA 1U81A 3M0EA 2J3EA 2J0SA 2HDNB 2IYWA 2ZUCA 3HP1A 2FJUA 3NC0C 3DMDA 1P72A 2RCNA 5EP2A 4HAUA 1S8FA 1KJYA 1W0JA 1XEWY 4URYR 5HCIA 3TKLA 4AYXA 2BJVA 2RGXA 1JR3E 3VU9A 3BB3A 1M7HA 2OESA 4TMXA 2NQ2C 2ORIA 3I1FA 1M1YE 2IYUA 4KHZA 2F1RA 2OSBA 3LLMA 4A36A 3TVTA 2GEVA 1XXHA 3ZJYA 4TL9A 3C15C 3EZ7A 4HZIA 4C0AC 1IN5A 3BFXA 2C95A 3BIFA 1J99A 1PJRA 1W2HA 2F43A 4TTPA 2WWIA 3ZVNA 3KKPA 1R5NA 4HAVA 2P6UA 3PUWA 5FUVA 2VSOA 4TLCA 1D8TA 4M9SA 2ZJBA 3PITA 3LD9A 1DAKA 3PQCA 4KBGA 1NY6A 1CBUA 2QN6A 4KFUA 4S2EA 3FYHA 1MABB 5DLQC 2WMOB 5L3SA 1AS3A 2VIIA 4GZLA 4B34A 1W0KD 3A36A 1EWRA 5E7IA 2REOA 2BKUA 2QROA 2J0UA 3IUYA 3SR0A 2GZAA 1Z6XA 2E1RA 3LBNA 5CLLA 2DB3A 4HAWA 2CNWD 4UQOA 2DWPA 2JLVA 1S96A 1Z08A 2H16A 1E94E 4LJ7A 2GZHA 2D3WA 3TSZA 4B48A 4DIDA 5FFMA 2GK7A 2IWHA 2MSEB 4Q9KA 4DKXA 3BORA 3F0TA 1N5KA 3EPLA 2ZRLA 2CE7A 4KU4A 5LD2C 1GITA 4FWIB 1OIWA 3Q5EA 3ICQB 1Z0JA 4NE2A 2FV8A 2N1BA 5JRZA 2UKDA 3ASZA 3UMRA 1W36D 2W00A 4PPGA 4GOJA 121PA 1IY2A 4W5HA 1RW4A 5CK5A 2H8KA 1Z47A 3IBYA 3ZVRA 3RS2A 5EJEA 3C5HA 2GAAA 4DSUA 2DVWB 3GFTA 3B1ZA 5IT5A 4TMWA 5SZIA 3QQ5A 4CT5A 4B3DA 3IQWA 4Q1CA 1U0HC 4ZKDA 1G1MA 4QBGB 2VSFA 2ZJ8A 1QHGA 4GNKA 5KYKA 1T6NA 2BEJA 3VR4A 3W3AA 1J90A 2GCOA 3EC1A 4RSGA 4IOMA 3LVRE 1PLJA 3CNOA 4OHVA 1A1VA 3NIBA 5LDDC 3DHWC 4JYCA 3TAUA 3B82A 5H68A 1OV4A 4JJZA 3SJAA 3CPEA 2KI5A 1E79A 1N2CE 2VF8A 3QXCA 5JCZA 1QHHA 4B3CA 1EXMA 1JXMA 1E2NA 4OBEA 3I62A 1IY0A 4MKGA 3A58B 3KUCA 1BIFA 3SHWA 1HUQA 5A4JA 4B3FX 2WKRA 2EFHB 3K09C 1KI3A 3LY5A 1Z0AA 1Z2AA 4M9XA 2WKPA 5JRJA 5BYKA 3THWB 2IF0A 1KKLA 4LBWA 2W83A 1EFRA 2CBZA 3T12A 4KV9A 1BYIA 4XD7A 2UZ3A 2VLIA 4BZPA 2XNDD 2XZOA 1IM2A 4DLSA 4R98A 5FOSA 2AL7A 3MRSA 3SFZA 2OXRA 3I73A 4Q9IA 1ZUNB 1SKYB 2YC4C 5L3VA 1X8JA 4MYCA 3I61A 2O8EB 5HKKD 4MGZR 4L5BA 5SZHB 3PV0A 4WBSA 4PC3A 2FF7A 2J5XA 1IN8A 3ND8A 5FBQB 2WAXA 4DCNA 4FWHA 2IYSA 1Z6AA 1AZTA 4JSTA 2ZR7A 4JKYA 4JT4A 3EW9A 3V00A 1H8HD 3L0IB 4QGHA 4F4CA 2C77A 4XWOA 2DFTA 4DSOA 1E9RA 5KTYA 3KQKA 2XZLA 1E9EA 2CLCX 1WXQA 1GILA 3GLGB 4TQAA 4ZDJA 3KQLA 4JYBA 3NHAA 3SNHA 3KXLA 2WOJA 2Z4RA 1IBRA 4NONA 2V6IA 3OEHD 4Q48A 1NMZA 4JN6A 1N3BA 4WAUA 1TL7C 3EWAA 4HATA 4LHYA 2RHDA 4RFSA 2GXUA 2F3TA 1E2EA 1CTQA 1KK0A 1NL3A 4AURA 3FFAA 3PENA 4BZQA 2WJIA 4DCUA 2E9SA 4RZ3A 1WF3A 2WWHA 3K0FA 1SHKA 2YVUA 1Z0IA 1Z0DA 3T15A 4R2HA 4BGDA 2PT7A 1WCV1 4DJTA 2R6AA 3NH9A 1FZQA 2ECKA 2PEYA 3RABA 3AH8A 2XITA 1NSFA 1NF3A 4BWYA 5JI3E 4BFYA 4L16A 4LYFA 4A82A 4A8JB 4Q4AA 4AYTA 1P60A 5AJWA 1X1RA 2VPPA 3T35A 4BFWA 4AKGA 3N5CA 6Q21A 1GSIA 4GP6A 1KGDA 3VR6A 4HDCA 4RCZA 4X8OA 2TMKA 4F93B 5J4VA 2XOKD 3P1JA 2XSZD 1L8QA 1YR6A 4Z1MA 3GLFA 4C7OB 4DWJA 1ZIPA 2A7QA 2ZYUX 3C16C 1DBSA 2WWFA 4JVSB 1XEXA 5HR5A 4Y0VA 3RSOA 3BBPA 2V7QD 4A4DA 5DN6D 4R71A 4B35A 2J59A 1YE8A 4BLTA 5CDFE 3C4JA 1DAIA 2AD5A 2RGGA 1YZNA 3WMGA 2GETA 1JNYA 5AJYA 2AHOA 3K0EA 1W1WA 4GP7A 4KFTA 5GJVC 4CIDA 5KDOA 4IVPA 5F2EA 4RJLA 3V4FA 2WZQA 4V03A 1KMHA 3AGPA 2YWEA 1F5NA 2ZSDA 1DG1G 1RRPA 3L43A 1TNDA 4BQSA 2ZYWX 3DL0A 5CB6A 1CLUA 3MWKA 5UKDA 4JVMA 3NG1A 5JWRA 2GCNA 3CWZA 4GOXA 2WWWA 1P7CA 4A2PA 4Z8XA 1PUIA 3RSLA 3R7WA 1HURA 3HU3A 3SJBA 3Q3JB 1TMKA 1XEWX 1G8FA 1SQ5A 4QBFA 2ZRCA 4KVGA 1G8PA 4L4UA 2O8DA 1R0ZA 1Y3AA 4PO9A 3FGNA 3KL4A 1DELA 2JAQA 4NYIR 2C5LA 3HR7A 1QHXA 4FN5A 1NVUQ 3OESA 3ZS9A 1R2QA 2O0HA 4DEXA 2G77B 3U3MA 2ZETA 4A2QA 4ILEA 1G6OA 1SZPA 1MRSA 1TQ2A 3KJEA 2IYRA 5JMTA 1I4TD 2FOLA 2A5GA 1KY2A 1E2DA 1GOTA 3AKEA 3FKSA 2N42A 4P31A 1TUIA 1NN1A 3WRYC 2HEIA 3U7EB 4GL2A 2CJWB 3K0AA 5FH9A 2J7PD 1MO5A 4FMDF 3OZXA 3W34A 1XWIA 4K8OA 5JBQA 2R6DA 1XMSA 3OEED 1HY3A 2RGEA 3EPHA 1XX6A 3BB4A 4CEIB 1VYVA 5SZJA 2BV3A 1CJMA 2G0NA 4P4SA 4B2PA 5G3ZA 4QM6A 4FIDA 1Z0FA 5TVKA 3AJIB 2LKDA 4LC0A 5EE5B 4DT1A 2PT5A 1E4VA 2C99A 1XJCA 1XTSA 2AX4A 2IYLD 1UJ2A 5G40A 3H86A 4H9GA 4OI4A 1WB9A 2ZE6A 5KO2A 1N6NA 2NO6A 2ZUDA 2HJVA 4U02A 5F9HA 1F2TA 5CYOA 3EG5A 4PFSA 3KTAA 4PTLA 1QRAA 4LYJA 2BOVA 4EFLA 5A5GA 4WXPA 4L9SA 4LJ6A 2HLDA 2NPIA 1JECA 5CYPA 3W6OA 5JSZA 2FZLA 1EFCA 3P26A 4KFRA 1WRBA 1HE1C 5BWMA 2J1LA 2SHKA 3A8TA 1LF5A 1DTSA 1WE2A 1G7RA 2YOHA 1KDPA 3GCGA 3UXMA 3U6BA 1JBKA 1W47A 1Z6TA 4G01B 3DKPA 1ZYUA 3RS7A 2E87A 4R9UC 5BYJA 1U98A 1NJFA 2EVWX 3L8ZA 4B2IA 2XEXA 4HUQA 2GJKA 3E1SA 3T1TA 4QGFA 4RY2A 1JAHA 2MSDB 2FSGA 4IHQA 1MKYA 1VPLA 3IEUA 1Q21A 2WTUA 1CR0A 2VHTA 1C9KA 2QPTA 2ZI5A 2D2FA 3HR8A 2PZGA 5HE8A 4DZZA 2ZAOA 3FMOB 2FDCA 1CJKC 4TL7A 3ZYCA 3SQWA 1U2RA 4Q7JB 5M04A 3IIKA 2AKYA 4Y0AA 1E99A 1XPRA 1U90A 2XNSA 1XCPA 1PV4A 3GLGE 5EUMA 1H8EA 2BMJA 4D0LB 1LV7A 1A4RA 4UXJA 1G7CA 2BBSA 2CVFA 3U3OA 2ZS9A 4AYWA 3ASYA 4HLDA 1UBGA 4ZI3A 1RRCA 4HLQB 2QPAA 4PHHA 4PSKA 3EWSA 3VLFB 2F55A 4URVR 1T3LA 5KSPA 3K70C 1ZUIA 4Q4JA 4B6EA 2JJ1A 3AEZA 4LJ4A 1IONA 4A3VB 1Z07A 2ZI3A 3AM1A 3MG9A 4HI0E 4M8NE 2ZI7A 8OHMA 4IOJA 2HCBA 1T0HB 2AD1A 5GJWC 1G7TA 4AG6A 3CWQA 1J8MF 3AVWA 1ZUHA 2QBYA 2GTPA 2HYDA 1E0AA 2O5VA 1U9IA 1NVMA 2J7KA 4IEEA 3L0PA 1T91A 2YJTD 4DB2A 4KJZA 5JJLA 5FUXA 3U61B 1E69A 1KO8A 4TYNA 5JJKA 4EJSB 4MGKR 1U9IC 4ZO4A 1K8RA 1T3SA 5JS7A 4B2LA 4UNPA 4DDUA 4D25A 3AP1A 1P2TA 2C04A 1OT3A 3AF2A 4OHZA 4KBFA 1ZD9A 2WSMA 3VQTA 3E2IA 4B3BA 2XB4A 2XTNA 4IOLA 4V0ME 1AIPA 1ZNZA 1XTIA 3BFVA 4OQNA 3MD0A 3H2YA 4PC2A 4Q7LA 1B0UA 3WXMA 3CZPA 2OZEA 5TB5A 2AK3A 4PSAA 4CZ2A 1LW7A 5L3SB 3EIEA 1QG2A 5GVRA 1HH4A 3RNLA 3I72A 4UJ5A 1II8A 1Q1BA 3CH5A 3IHWA 3K9HA 3KDSE 4FI3C 2C8VA 3RANA 5HE9A 3TSOA 1YZKA 1XTQA 4G5RA 1P5ZB 1W4BA 1ZMXA 1UKZA 1ONBA 1ZJ6A 4M4SA 5LD2B 1G4UR 3WNBA 5CM9C 4B75A 3GLIA 1G64A 1OXVA 4NBSA 3GJ7A 3NH6A 3H1TA 2NMVA 3UG6A 4MA4A 1N6LA 3QY0A 2HT6A 2QTVB 1KYIA 1ESMA 4R7ZA 1EFHA 4MGIR 2WJGA 4PC6A 1ZIOA 1D2MA 4B76A 1CS4C 5LB2A 1G20E 4TT3D 3HWSA 1LS6A 2C9YA 3LXRA 5H1YA 1ZRHA 4DLTA 5K8IA 2GA8A 3GLHA 2GCPA 3B6EA 3BWDD 4GSYA 4PANA 4PO1A 3RS4A 2NO0A 3SYLA 3JZAA 3UIEA 5L3QB 4YDHB 4NDZA 3QIAA 3CRVA 4AC9A 1LFDB 1VG1A 3PJRA 1IXRC 1HT1E 3WHKA 1WQ1R 4HAXA 2ANCA 5F3WB 4RZ2A 1N0UA 3TSWA 5KSOA 3SBEA 1P2SA 3KB2A 2GHIA 2GJAA 3Q85A 4HUTA 2FA9A 3RVBA 3WBJA 3FPAA 4M2LA 5ELXA 221PA 3U3RA 2QAGA 2WV9A 4V0LA 2PCJA 3O8DA 4DBLC 4BFUA 5IHPA 2IYYA 5CIQA 2F1HA 2GCOB 5TDHA 2V3CC 1E1QD 2ERYA 4NP6A 3IEVA 5B64A 2FGKA 1OXSC 5JHGB 4HSEA 3LO5A 1CKEA 2QAGC 4MRNA 4OQLA 1S2MA 5AUNB 5FTLA 1JI0A 2RAPA 1DAEA 2CCGA 4P0TA 3WP0A 1QHHB 1GKUB 1COWD 2KWIA 2V4ZA 3LXXA 4XTRA 2RKOA 2IXEA 4G5SA 3R8CA 1A2KC 4Q21A 4LRSA 5E7MA 5FOXA 2QI9C 4Z51A 3IO3A 4EKDA 2EYUA 3LW7A 1QHNA 1BMFD 2QP3A 4ZIRB 2EFCB 2LKCA 1VMAA 2QTHA 4B47A 4LBYA 1W5TA 3WNCA 1G41A 3KJHA 3CR7A 2Z4SA 1M2OB 2KBFA 3NBZC 4M21A 2OE2A 4TZ6A 3FDIA 2N46A 1SXJB 3T1QA 2GVDC 2WJYA 3PG5A 4DLWA 2BJWA 4LK2A 2EWWA 3CF0A 4LDJA 5JEDA 4M1WA 4OYHA 2C98A 5FOVA 2ONJA 3SU8A 4LPSA 1UDXA 3HU1A 4JBWA 4ZCIA 1F6BA 4C0QC 1WP9A 1QVRA 2ZS7A 2ZROA 4DLYA 1XRJA 1NP6A 4G5GA 2NO7A 1DE0A 5LB4A 4E22A 3NBXX 2FFBA 2X77A 4ARZA 4QHTA 1AK2A 4S35A 1T3HA 1D9XA 1US8A 2CK3A 1YJ5A 4B74A 1YR8A 3SYNA 1DAHA 3ZH9B 3R8FA 1E98A 4QFMA 1G16A 3QXJA 4QXAA 3K0CC
chains in the Genus database with same CATH superfamily
1T0BA 1MR3F 4B5LA 1UWCA 2XGMA 4XWTA 1UDWA 4BJ6A 4G9EA 3V8RA 4YRLA 4P92A 3PTZA 1JR3A 3CZAA 4DLAA 3G0CA 1QQAA 1DGBA 4BXOB 1SXGA 4JQZA 5KOJA 2FN4A 3T1YM 1ZW6A 3QKRA 5J1SB 2C78A 3CUEF 3GPIA 4FS8A 2VQDA 2ZS8A 4YXWA 4X65B 4O4HF 4E07A 5JS8A 4HLNA 3L7IA 4X8MA 3VMFA 4B33A 1BEEA 3LHFA 4R1TA 3L7JA 1QH1A 3V7WA 1Y5MA 3DKIA 5KNBA 1JW9B 2DGDA 4RHCA 1W52X 1JSLA 3QM1A 2A94A 4AU1A 5D87A 2RB4A 2W6ID 3ASUA 1NUSA 2ZR8A 2DAKA 3MBIA 3ZZNA 4FOOA 1DZ3A 1TVEA 2OUIA 1I0IA 4KWIA 3HJAA 3I9OA 2O2CA 2HBRA 4M1QA 4QG7A 3T3MB 3ZR4B 4BO2A 1SKBA 1YOBA 3AG5A 3Q2OA 1UKYA 1XTUA 3L6CA 1I32A 1WR8A 4LJ8A 1JAYA 4P4SB 4RKFA 3RGGA 4BLVA 3QNUA 3IEKA 2PRIA 4BC0A 3NJ4A 4I5IA 2QMOA 4IUBS 3RTBA 4QDXA 2XZUA 1XNGA 5ELLA 1IHYA 3NGXA 4CVNA 1T2DA 4HGPA 3V32A 4IBFA 1W4AA 4F38A 4DXAA 2XWBF 3VHRA 3GFFA 5JI2E 1JKIA 2PMWB 5D2CA 1W0CA 5FTNA 3QFSA 4RD4A 3JQAD 3K7EA 1PZNA 1F4LA 4XIFA 1DWPA 3BE4A 3EMBA 1JU4A 2Q5LA 1Z3IX 3SKYA 2DLDA 2G28A 4LXXA 5G0VA 1XQ1A 4B43A 4YCSA 2I0FA 2I76A 1V4VA 3E3NA 5T8KA 2BLNA 4MW6A 1BDHA 4C07A 1E89A 2FQWA 4Y2HA 4JV5B 3EQ6A 1ECGA 3G8CA 1ZBDA 1XDDA 3N0VA 1LLCA 5DXFA 3D31A 2FWRA 3BQMB 5JZMA 1AY0A 4KR6A 3CG4A 4F4FA 3Q88A 4NWIA 4PFKA 3U4MA 2DI0A 1GXSB 4RPJA 3QUQA 1YK1A 4TMZA 1J00A 3UT0A 2IHBA 3NP9A 4Y28F 5KVVA 3B52X 2YWJA 1KEVA 4TKMA 2XLJA 1PZEA 1GUAA 1YS2X 6ABPA 5C1DA 5IPFA 3OX3A 2YWGA 3HKPA 4WFJA 3MLAA 4KO8A 1S7CA 3DC7A 2O2ZA 2QZ9A 4PXSA 3OICA 5AVYA 4MKFA 4ZOLA 3WL7A 1T5DX 5JIBA 3GVPA 1H65A 2YINC 4Q1BA 4KYUA 5AKLA 2HBYA 4GC9A 2GDZA 1Q2UA 2GZDA 3JCZA 5ITUA 1W93A 1BXRB 2J46A 4B09A 2VJLA 4Z86A 2CP8A 2J7PA 4W1SA 2XFTA 3ODGA 1Q19A 3SAVA 1SUIA 2XYGA 4OK5A 4WCFC 1E1YA 1ZUNA 3WX0A 2UZAA 4I55B 1TZBA 4ABYA 2ZXUA 4MXDA 4EFMA 3DNPA 4COKA 3VTZA 3IPCA 2WJ3A 2V9PA 5AVVA 4X3PA 2EJCA 3A28A 4OAOA 5T41A 1U7WA 1DC8A 2CXUA 3EXEA 4MWEA 3OX4A 1RKBA 2EF0A 5FOWA 2O4UX 5HTOA 4HQOA 3DL4A 3SBOA 5B1IA 5FULA 1J0DA 1R00A 4EZEA 1YJAA 4EB0A 1L5KA 1ODTC 1W5EA 3AF4A 1YJBA 3D2CA 2QIOA 1R0YA 2IHZA 1B41A 1F14A 2GKGA 3ZIAD 5G41A 1B73A 2VDBB 2VBGA 3OZIA 3WL6A 3GP8A 4DRXB 1I01A 4D79A 1P73A 4US2R 2PG3A 1SU6A 2R68A 4FINA 1CG6A 4JLPA 1U0JA 1WDKA 3FGZA 1QFZA 2KRKA 5DWQA 1BCRB 3O03A 1AK9A 3EZNA 2CDBA 3TGLA 3BAZA 3QPAA 1PLKA 4Q4CA 2VUUA 3OJCA 3GAAA 4HFNA 3CRQA 2W7TA 4JI5B 1OAAA 4YQFA 2GPNA 4IQ8A 1WUIS 4JNKA 2QRJA 5AOCA 2WWTA 4O29A 4MRPA 3GZNB 1USWA 1PJIA 4IIVA 4KNYA 3IQZA 3A05A 1WCIA 1I7SB 5IM4F 1QGUA 1FOEB 1II0A 5TXGA 3Q12A 3CEMA 5C3MA 3DT9A 5IJ0B 1HKHA 1ZN9A 2WUFA 4DSAA 4WXMA 4EZBA 3Q7PA 2GVZC 1ZUD1 1EUQA 3H7AA 1ZM3A 3NT2A 3FE2A 3IALA 3TLMA 2ZQZA 5DSZA 4GKKM 5E4JA 4KCGA 4JEIA 3I2FA 3G8DA 2PY6A 2D2EA 3OTHA 1ZH6A 5CB4B 4E3WA 5E6JA 3GBVA 2D8AA 2R6GA 4HS4A 3MWLA 4WDQA 4BNYA 4YP0A 3UFXA 3JVVA 2QP4A 1EVYA 3CLHA 3S29A 4P6VF 1RBZA 1YVEI 4DEVA 4N9WA 2ENUA 5BPHA 1XQYA 1KMHB 1OXXK 4MYTA 4E4RA 3ER6A 3MGGA 3IE1A 3TZLA 3T5DA 3L2OB 2K4MA 1J23A 1HETA 4BS9A 2Q9AA 4E03A 2FMTA 5FTWA 4LE1A 3T5GA 1J25A 3CLRD 4H7KA 4Q24A 2ZIFA 3BWEA 4DA8A 1GCIA 1RYHA 1OH5A 1VKOA 4EP1A 1IY1A 5L3QA 4MVWA 3PFFA 1ODSA 5EE9A 1MFZA 1MC4A 2WY2D 2LVAA 5LYJA 4WZAE 1GZDA 4FYPA 2WKQA 2FKNA 1Y4UA 1P7PA 5CJPA 4V0KA 3IUNA 2JHAA 2Q9BA 3AW9A 2NNWB 1L1QA 2HMVA 2F5OA 1GN9A 1M2OA 4F9GA 1FFDA 4LG1A 2PKYX 1WHSB 4MW7A 2A0UA 5BV0A 1PWZA 5ITVA 4P7BA 4OX9Y 1P18A 4H17A 3P2EA 3UGQA 1SRRA 5IU6A 3P9NA 1KJQA 3I8SA 5DBGA 4YO7A 4II2A 5H3HA 4BVEA 1QOQB 5IT0A 1CZLA 2VDVE 2RJ3A 3H8WA 3RASA 3WHPA 1LUAA 3BDVA 3FTQA 5IKOA 4O59O 5J2UB 3ED1A 4IXMA 2NVBA 2V96A 4MVJE 3ZC7B 2NYRA 2GZ2A 1YFKA 3PA6A 1Q12A 4D82A 5DM4A 1P44A 4UREA 1KF0A 1GRQA 3UJNA 1U31A 3U44A 1K27A 3GAZA 4TRNA 3WIEA 3UK6A 1QH9A 1WUHS 1N5OX 2C0CA 5I5EA 2PX0A 2QX4A 2AZ4A 5A2QS 1KEUA 5JJ5A 5L3RA 1E2FA 2IEYA 4K9RA 1A95A 4NAHA 5B1EA 4QJ4A 1OAIA 1AUVA 1DCKA 1CC1S 1YT5A 3REGA 1Q3CA 2C88A 3DDNA 4G89A 4XPZA 2ICAA 4RVFA 3GF4A 4Q03A 3OQVA 4BFTA 2SKDA 4AW4A 1P1CA 3PJEA 2R1VA 5DBIA 4LCJA 2W71A 1AQIA 1Z2CA 3BHJA 1C4WA 5B1SA 2YJ6A 1KFKB 1DC6A 1VYUA 4M0WA 4LHVA 4N6OA 3SFTA 3SG0A 3HG7A 2OXEA 1FNNA 3CRRA 1S2GA 2KJQA 1KS9A 3HXPA 3TOXA 4KRFA 2XGNA 4DSTA 4RLHA 4XH9B 1UC9A 1PFWA 1WGNA 4CM6A 1N6PA 3C3CA 1J9EA 1L3BA 2FW1A 3FX2A 5IMSA 3WKAA 5B1HA 1TC1A 2IUSA 4YJKA 4CQMA 4IMRA 4UTOA 3LT4A 2C2ZA 1ICEA 3ZJ5A 3MSXA 4R1LA 2AKEA 5IAGA 4QPDA 4PEVA 2BGKA 1UADA 4CFZA 3DAYA 3WISA 4KWEA 4F71A 4KN6A 4M1KA 3AO0B 1V92A 3E84A 1US8B 1EUDA 1GL7A 3PC8A 2AW5A 3Q8XA 1FSSA 1TLLA 1JJFA 3OPYB 5DHUA 1HTTA 1Z25A 3VC3A 5AQ1A 3CW8X 3KX2A 4X1IB 5ITXE 4TRRA 3G6KA 4X9XA 3ZLVA 3JQFC 2XWJI 3F9CA 5KQSA 3A1UA 5LP6B 1M10A 1NBEA 1WZNA 2NXNA 1BSVA 1CRPA 3LJKA 2IA5A 2DR0A 3GJSA 1XB2A 3SS7X 5DCYA 3LPCA 2IV2X 4ICIA 4ALNA 3B1WA 3JQDA 3T95A 3LC1O 4OJTA 5H4HA 4BGVA 2DC1A 2ID4A 2OBLA 1GPJA 5IMBA 5BN4A 3ETEA 3RRFA 3RAGA 3SXPA 4BJ1A 2IPAB 4REZA 2VSYA 4LZZA 2C3YA 3GLHE 2VA8A 4IKPA 3SR3A 5EKTA 2BRUC 4YCLA 3TWMA 1UFOA 3BCUA 1I2BA 3KHSA 1WBDA 2IXTA 4BRUA 1Q0QA 5KDLA 2Q0HA 3S2GA 2QXUA 4QT4A 3DDUA 3FCYA 1AZLA 3E9DA 1Z5OA 3FNFA 3EMKA 1V4NA 5BMOA 3FN4A 2VCEA 1KK1A 4XJSA 5FAKA 2GBLC 5I7WA 4TYMA 4EI8A 1EBUA 1TJ4A 1KO4A 5KTPA 5LUBA 1IJBA 1DAGA 3A25A 4OXQA 3OE4A 3J7AS 3SX4A 2PSFA 5IUJC 1CB0A 3PF8A 3N8KA 1KTIA 3FZQA 3SF8A 3M0EA 1PR9A 3SEFA 1KPHA 2LGJA 1RDFA 4Z0HO 1M5RA 3JD1A 5JVDA 4RX1A 3VU1A 1ZD4A 4EHLA 3Q7RA 4KHZA 1FU7A 4HEA6 3SSOA 4E30A 4KT0F 2W8BB 4X84A 3WOHA 2CUZA 1QIIA 4TTPA 1BHO1 4M7OA 2BISA 3ZNQA 3DT6A 1FZTA 2HMTA 2JD2A 1R12A 2FRVA 1Z26A 1IVNA 3TNJA 5AW1A 3M1LA 2V4MA 1Z08A 6LDHA 4BV8A 4DDKA 5CT9A 3P8ZA 4HDSB 2P27A 3IAAA 3TI7A 2Q0XA 3Q1LA 5JXHA 1MG5A 1UIRA 5DWVA 4R8RA 4EHJA 4IS3A 4O02B 4HEOA 3HUDA 4EUEA 3LVFO 4UFNA 3RS2A 1J8VA 3IELA 1WLYA 1Q11A 1MTZA 2QCUA 3WB9A 1IEVA 4Q1CA 2DTDA 3RAFC 2HHCA 3NOQA 4WZAA 4NNJA 1PLJA 3AY3A 3JQGB 3FOBA 4LAFA 3VAZA 3QU4A 1W25A 4MEBA 4BNIA 2Q5CA 4E4YA 1AQNA 5BYKA 4LZWA 1BYIA 4EITA 4IBKA 5KTMA 1Q92A 2ZG6A 5E9AA 2A6PA 2D5AA 1WW8A 2O8EB 5HKKD 4L5BA 3PRYA 2NUPB 1D7AA 3U62A 3W5SA 4F4CA 1V8OA 4QVGA 4CM4A 1SKAA 4YP5A 5KYGA 1WXQA 5T5QA 3KQLA 2IHTA 3L93A 4ZVUA 4GKAA 1LBTA 2WJIA 2PH5A 2D5CA 4DCUA 2E9SA 4MVJA 4HG2A 1T9BA 4FD3A 4G8JA 5ALLA 2X4LA 3Q3EA 3LL4A 3DHNA 1JHXA 4AYTA 3T35A 3N5CA 3ROXA 3R3XA 2L19A 2W93A 1J5EB 4D02A 2O2GA 4OPMA 2VT6A 2X4IA 5DN6D 6ADHA 2F9FA 1ECBA 2IP1A 4QO8A 4KGZA 2ZSDA 4QDUA 2TSYB 1RRPA 1NQOA 3UAGA 4QXRA 5CB6A 4JVMA 2DLNA 4DG8A 4RJTA 1KMMA 2QNIA 2ZTCA 2R6ZA 3OG9A 4UUNA 1G20B 3BVPA 1ULAA 2CWBA 1MRSA 2SCUB 3NOXA 4RHUA 3KU4A 2HSGA 3U7EB 2CJWB 2GM3A 3FMVA 4F5EA 4PG4A 2UZ1A 2OGTA 4UE2A 4KFCA 4LQLA 3A4IA 1E4VA 1C1XA 5CNIA 4QU9A 4IPTA 1KBOA 1V1MB 2ZE6A 5F9HA 4CM3A 3EG5A 4PFSA 5DB4A 4DV5B 2V7WA 1QE0A 2G40A 4LEIA 4C0XA 5GY7A 1WRBA 1PL8A 1TVCA 3UH1A 1DRKA 3TIGA 1XUOA 3I45A 3GCGA 1XV5A 5ENDA 1MO2A 1CDEA 1W47A 1P1IA 2WF6A 5AVOA 2MCFA 4ZQGA 1YONA 2DFPA 2QLLA 2CZQA 2VSQA 4GRIA 1U2RA 4YASA 4LY3A 3KVRA 3HA7A 3DNMA 4D0LB 2BMJA 4N3CA 1A4RA 3HB1A 4EKNB 1B26A 4CCAA 4GQBA 3PQ2A 5ITXA 2W42A 1G2OA 4Z0PA 1P0CA 1T3LA 3PWKA 2JJ1A 1IVYA 4A3VB 2Y0CA 3K6SB 2FP3A 2XWPA 1J07A 2O01F 1CFZA 2O5VA 4PFJA 4X1KA 2YWDA 1ID8A 4GLOA 3WWYA 4YCBA 4Z9XA 1ZGAA 3NKLA 4OHZA 1A9XA 3KP0E 1AIPA 3WLKX 2VAPA 2PYZA 1Y4SA 1IIRA 4INJA 1DAPA 2DJIA 4DR5B 2YMQA 3E21A 3TSOA 5B7NA 2GHRA 1G4UR 1TGYA 4D97A 3ZGNA 3TL6A 2D13A 1QUTA 4KAFA 1VL5A 1E5VA 3C45A 4B8WA 1EDOA 1RQGA 5CBKA 1NVGA 3MFQA 1JL3A 2H51A 5H1YA 3GLHA 2P91A 1TT5A 4G26A 3V7NA 1LFDB 4YO8A 1J4AA 5ALKA 3ELWA 2XD9A 4YALA 3UYLA 2GJAA 1KJJA 4G84A 4CIXA 4RVGA 1XEAA 3IKMB 3GO8A 3IJEB 3AHHA 4GYKA 1EINA 4UD2A 1SXHA 3LO5A 2QAGC 4TTIA 1OLXA 4LZPA 1GKUB 1R6XA 1VFNA 3OY7A 3LW7A 5BSKA 2OZLA 2QP3A 3C1UA 1IL0A 4C76A 4LBYA 4EG0A 1CS0A 3ZI7A 2OE2A 4LQDA 3T7IA 4HVCA 1DLIA 1C8LA 4DDHA 3OE5A 2FWJA 1QYWA 3BA1A 4CHTA 1IQUA 1WP9A 2Q8PA 2EHJA 5AM4A 4L8YA 2X77A 1E66A 3SQDA 2HQOA 1DEAA 3C48A 5BN3B 1ZQ1A 3QXJA 5A05A 1SKMA 4HS9A 4N0DA 1ULZA 2VP9A 1E6LA 2JZ1A 3AESB 4DJJA 4N9QA 3OLXA 1CJTC 5TQVA 1FMJA 4WDRA 1MIOA 1VG5A 2IUTA 5JTTA 4J0DA 3CPSA 2ZRGA 4UZEA 2C2XA 4O4LF 3VOTA 3A9SA 1GNLA 3RYTC 3VR3A 3LX6A 4U6NA 5CGZA 3JAWB 1RHMA 3IS3A 2CL5A 2XXAA 4Z9FA 1Q3TA 3PB3A 5DGTA 1VE5A 2ROQA 4Y2SA 4EYKA 4D2IA 5JR3A 2IY8A 4AKEA 3D7LA 1Z33A 2H7XA 3AUYA 1N2EA 4P3OA 2DBZA 4YT5A 1U1CA 2JLAA 1VG9B 3CKMA 2X6TA 4GYWA 2Y1XA 3DQQA 1Z7WA 1M2WA 2BH2A 1V48A 2DXIA 3LDHA 3A0RB 3LSTA 3FDJA 3KPWA 1B8PA 3H9GA 3C3EA 2WP8J 2GJSA 4YMTA 3MAJA 1PAUA 1UIMA 3NVDA 2ODNA 2TRSB 2DFLA 3ZWDA 5C18A 2WZDA 4TQUS 1TADA 3RNOA 1W87A 3C5CA 3O4VA 4JI6M 4IF6A 3A1WA 3HKEB 1SC1A 3JPYA 4GZ6A 5DKFA 1U8AA 1G8GA 4ZYXA 5LDHA 1P2VA 4LY0A 5KVCA 4G25A 3RC2A 3CJRA 1HSZA 3HUUA 4BNFA 3TM5A 4M0DA 3MWDA 2LXNA 1I7PA 5JARA 1VL2A 4QUDA 2RMKA 1N4AA 3OBIA 2PSJA 3HX3A 1G291 4J2HA 1P4SA 4ZCPA 3QOYA 5A04A 1HNWB 4U2BA 2F2TA 3AKCA 2L42A 1UBEA 3NC1C 2ID8A 3FM9A 3ID6C 2GD0A 2VJQA 2H07A 3W1VA 2I7PA 4LY6A 4H1UA 4W5OA 3GEPA 4CISA 4LF4M 3NWEA 5I4BA 3RAJA 5EUCA 4IV0A 1PDWA 4X91A 5F9FA 3F8TA 2VF4X 1BFUA 4EGAA 1M67A 3FSEA 5FPTA 3M8KA 3I9LA 3EC2A 3C6MA 1TD1A 4LC1A 4Q4DA 3PQ8A 2HXGA 1GPNA 1B0AA 3DV9A 5JROA 3UUFA 3HTXA 4FKMA 1E8DA 4HWGA 4N12A 3TW4A 1GQRA 2ERXA 2WSIA 2W2PA 2XSZA 1Q7RA 1K5DA 4PTYA 3ZKWB 3NTXA 5B3JA 3AZOA 2ZOSA 1YDFA 3HJHA 1J9GA 2Q28A 2ZIAA 5ITSA 3N2KA 5LDGA 3AI7A 1LPBB 5I8PA 4KMMA 4BKRA 1MRZA 3FFXA 3PDUA 4BE7B 5A7GA 4YMUA 3QWHA 3W5UA 4OQXA 1QBGA 2DLCX 1I2MA 3OPNA 1YB5A 3WLSA 5AI5A 1L6IA 2A8YA 1PV1A 1WCWA 1Y6JA 3WLQA 1S2OA 3D6AA 5GGYA 4DR2B 4HLUC 4TUYF 5DRYA 4KV7A 5CM8B 3CVOA 2R8YA 1K86A 3O7WA 1XCMA 3KZ1E 1HG0A 2R5FA 1LLDA 2W2NA 3L0OA 4KUGA 4BMCA 4E1BA 1PUJA 1UANA 4F3KA 1YB6A 5THXA 2QJFA 1GM5A 3TVDA 5J63A 1IB0A 4DCVA 1NRWA 1A71A 5JPIA 3UAWA 3PFNA 5CFRA 1X9HA 1FEZA 2VDQB 5T6MA 1RHKA 1DSSG 3D5TA 4L5YA 3KCQA 1P6UA 4GITA 1OIVA 3NYRA 2D62A 1X74A 1Z28A 1HDRA 2ACEA 4ZREA 1RZ3A 3MELA 4JI8M 4OP2A 1JHAA 1C9YA 5KREA 4Q1DA 4FFLA 2HPHA 4C21A 1CDZA 2BBOA 2DWOA 6CHYA 2AI2A 4EX7A 5A6SA 1QC5A 2BWBA 2YY5A 1VBMA 5ECWA 3U0BA 2CDNA 3DM5A 4CNQA 4BNVA 4M54A 4PAMA 2AOWA 2VHVA 3QFHA 2YQ4A 1PR4A 4FIZA 3HBMA 2I6FA 1XROA 1PT8A 1JXOA 1T29A 3NTVA 3NDBB 3VVLA 5JAMA 3UT5A 1A27A 2JEOA 5CA1B 1CUGA 1D0IA 3MB8A 3PNMA 3AHCA 2QPLA 5F64A 3U31A 3QNWA 5ICGA 2XAUA 3A1SA 3PXDA 4WESA 3FJOA 2O59A 2OV8A 4WCDA 1F2UA 3E1KA 1C30B 4UCXA 1V7CA 4ONEA 3FPCA 4MJ7A 1OBOA 1UAAA 3H18A 1ND6A 3KQNA 4DBGB 5GIOE 1GAEO 4EGFA 4F4UA 1FTWA 4Q18A 4CF7A 4O2AF 2BFWA 1L4NA 2QMHA 3UOWA 2OV3A 2ZRKA 5TT0A 3S2FA 3HRHA 3DZDA 5K3SA 4LHSA 3U3KA 3DBVO 2MGWA 4F06A 2HDOA 1UWKA 3V1MA 1S0UA 2HHLA 4K0KM 4RGVA 3G3EA 4Q3NA 4A5SA 2A5FA 3R5HA 4M6WB 2V6FA 1JLKA 3H6GA 5IBQA 4B6FA 4M1MA 1Y1PA 4D3SA 2LCIA 4J4TA 1F60A 4IWNA 1PQWA 2VP3A 1IATA 2HA6A 1UEXC 1QHYA 1TDJA 1W94A 4KLZA 2H00A 5AOBA 1QQTA 3JWGA 3FUUA 1DJQA 1NURA 4RAQA 4CU2A 1ZI6A 5BMVB 2JLSA 2ZPTX 3GLKA 4DLXA 2VDNB 3L7BA 3AWIA 2GPTA 1UBOS 4JGGA 1QONA 2C3MA 5I4KA 4OJKA 2OBBA 1K3WA 4IKOA 2UVDA 2HBZA 4NAUA 1LKZA 2ZWOA 2C7GA 3S81A 3W8RA 4DLZA 3ETJA 4P8RA 2P0EA 2IY9A 1JG6A 5CVJA 2OXCA 1OQAA 4OHYA 3CS3A 1AKQA 4O2RA 3VU3A 3C3BA 3UC5A 2GR9A 2AXQA 5LXTF 3SC2A 4XW2A 1V5GA 5BT9A 1M6VB 2X3YA 1MG0A 1EFRD 3L06A 4INZA 4XLTA 4CBVA 3LRTA 1JRLA 1EJ0A 3CNHA 3WZLA 3U19A 4C9BA 5FI1B 5JQGB 2HXYA 4BP9A 3BMNA 1L5FA 2FUCA 2XRMA 4H77A 3MUOA 2HK9A 3K6JA 1O96B 5G4LA 4AKHA 4RHFA 2ZUBA 3C3KA 1X0XA 3MCZA 4BNMA 2IBTA 2RGWA 4B7FA 4CMGA 4GI7A 3L25A 1HJPA 1TTEA 1IPEA 2A92A 2FLWA 3B1FA 3KOMA 1OTRA 4D81A 4LF7B 1TECE 4QICA 1ZK0A 1C0PA 2Q27A 3ZWNA 2C2BA 1ZMTA 2C96A 4W6ZA 4L9WA 2WU1A 1FSFA 3A1EA 2I1WA 2O2JA 2CUTA 3A9TA 2AN3A 1M2FA 1BWPA 5MHTA 5CH5A 2UYHA 3OT1A 1G19A 4RHXA 3P94A 3D0RA 3PVZA 4OW0A 3UJAA 1ULHA 1DIBA 2QQ0A 2G8NA 4CG3A 2EHDA 2APLA 4RV9A 3PEYA 3S68A 1VHLA 5JS1A 2BHSA 4PG7A 1FP1D 4EEKA 3K73O 1R6DA 2WFMA 3HEMA 3U5TA 4MH0R 4V2IA 1EK6A 4W5RA 3H2ZA 5CLGA 4PVCA 4KTVE 4R2LA 3QJ5A 4ZT4A 3D0KA 4ZDKA 3QLVC 4GFDA 3CN7A 3X3HA 1NULA 1TYBE 4I1RA 2QDXA 1NXOA 1PFGA 3OM0A 4UHHA 1YZQA 3I34X 4LRUA 2PM8A 4Z5XA 1H0KA 3GR6A 5LFAA 4MQEB 1IAQA 4DABA 4B3SB 4GDMA 1Z15A 4KPEC 1AM4D 1C0LA 3W6PA 3JYLA 3VAAA 2GEFA 1U5AA 4HZGA 4XD2A 2Z5GA 3CLSD 4F4IA 4ZT3A 3THXB 2XRZA 5EJ6A 2R62A 3LA6A 1A4IA 3BJRA 3JQBA 2Q1YA 3MFYA 2QN3A 2GKOA 1A8UA 4A9AA 2CE2X 1IXSB 1OBHA 2GJ9A 3SYTA 2I99A 3I4VA 3WLAA 5BSVA 3AFIA 3P0FA 1P4JA 1AUPA 5CG2A 1FP6A 1KQFA 1R0XA 3AP3A 4LS3A 2KW5A 4EX6A 3GJTA 3L6DA 2DEUA 5B6JA 3V2UA 1JFFA 3P7MA 1OYYA 3DDZX 4C4PA 1CR1A 4C29A 1V8DA 4D41A 1GTL1 3I5XA 2Y1GA 2PWZA 1BO6A 2FPGB 4Q3LA 3N58A 4DNFA 2H2GA 3QU5A 3WGQA 2P9EA 3PNKA 1E92A 1GAJA 5JOQA 2XZPA 3BTSA 2PS3A 4RULA 1N9ZA 3I5AA 1Z4MA 1FTQA 2AXEA 2PBFA 4YRGA 2P5UA 1QZUA 1UCFA 4NVRA 1B6GA 1EEXB 5IG2A 2JAOA 5A0VA 2XH9A 4JUIA 5E3JA 3QEJA 1JDVA 3NIDB 3O4GA 1CY7A 5DO9A 4W7SA 3OF3A 4N8DA 3GCWA 1F8FA 3T6KA 2MJ5B 3A9VA 1IOVA 2A0FA 3PFGA 3DEZA 1PJZA 1WMEA 1Z5ZA 4C4YA 2AOVA 2VYND 2PQ0A 1W581 5ALNA 4Y2PA 3R0ZA 1KDTA 1MX3A 2VT7A 4OLBA 2V7BA 4O8ZA 3KXIA 4IJQA 2Y4OA 3B2EA 2WM9B 1YASA 4B40A 2WINI 2G9VA 4FP9A 5H8WA 5HK9A 4OI1A 1P2FA 2DPHA 1NJ8A 2XUFA 4L07A 4WJZA 3BWXA 5CFQA 3TTWA 4I9NA 2DR3A 2B83A 3JWIA 4HGZA 2WYWA 5B6IA 5DU2A 3KPYA 5EZYB 3NHLA 3TDNA 1RLUA 3VPDA 3ELDA 2IS2A 2NN3C 4NE9A 4GX1A 1HSOA 2K6BA 3AV3A 3H5NA 1ZZGA 5CAEB 3G8AA 2I1VB 4P3PA 1XTZA 2REQB 4ZDWA 3UCXA 3U81A 1Z29A 4XDYA 2BDTA 2FWPA 2WMYA 3RSQA 1TU0A 1HMPA 1CQJA 4QTZA 4DXHA 3M7IA 2QTAA 1QFXA 4A3SA 2W2VA 1RMYA 3C6QA 1HQDA 4GEWA 4F72A 4DLKA 3D8TA 4P5DA 1NR1A 3FCXA 3ABOB 1AGXA 1M74A 2R85A 4YJFB 4C2AA 4LNAA 5GTDA 4MWZA 4GQAA 1NW3A 5G2OA 2EEZA 1N1DA 3ZLBA 2QJRA 5LJIA 2XQVA 4KDFA 4LDAA 3HP1A 1MC1A 1K3XA 3MILA 4XJTA 4ER5A 2J3IA 1JTFA 5FORA 2ZBFA 1I80A 2BGGA 4QOHA 3QPBA 3UY4A 4LFAM 1JKJB 3PSHA 3ZVNA 3IUPA 2DAEA 2JY7A 4PGFA 4B6PA 3ANSA 1SUEA 4KH0A 2XQFA 2WHRA 1T0IA 3FCUB 3SR0A 2E6KA 5EN4A 3TNYA 2JLVA 1E94E 3JQ7B 3NHSA 4B48A 4F4DA 1YB1A 3H1AA 3LVWA 1PR3A 1N5KA 1YRWA 4KN8A 3FCAA 1OXMA 2IOFK 3IE0A 3UC9A 4BWFB 5KYXA 5K20A 2J07A 5BUCA 5F3WA 2UYCA 3W6ZA 2ZJ8A 4YAEA 2D7GA 1BHJA 4FEGA 3W3AA 3KZCA 1ZG3A 3CR3C 1ISIA 3NIBA 3DHWC 1QHFA 1OV4A 1W2WB 3AHGA 3W8FA 3ZEAA 4LE0A 4A91A 1YC2A 1H94A 4I4IA 1MU5A 2ZM6B 1EVKA 4KV9A 1X3LA 2UZ3A 1UT8A 1QVWA 2XNKA 5BRAA 5TGZA 4DCNA 3WICA 2AIRA 1Z5UA 2MIIA 4LVNA 2FYTA 2C77A 1ZV1A 2VCHA 3E6AA 1QS0A 4NESA 3BXEA 1E9VA 2I4LA 4DMRA 1ONPA 3PQ5A 3EWAA 3BT7A 5KTKA 1WF3A 3L02A 1M1ZA 1EQAA 2CLFB 3RABA 2ZVDA 2XITA 4NJMB 1EGVB 4ODIA 3ZWMA 5JDCA 5LOVA 3O2NA 1SCUB 3BXFA 4CQLB 4C7OB 1DBSA 2XADA 2SNIE 3DFFA 4O33A 4B80A 3BBPA 5LWHA 4BVGA 1Q3BA 4HN4B 1QIGA 4K88A 1EJBA 3AY7A 4RK5A 1B16A 1GJTA 4RJLA 4J90A 3UNXA 2JF0A 4OVZA 1WUYA 3C24A 1F5NA 2G0AA 2F62A 1E20A 4L22A 4JEUA 3R7LA 5K2OA 4TXJA 4MB2A 4N5LA 5BVGA 2Y1OA 4CLDA 4UHKA 3CEJA 4D57A 4A2QA 4MYDA 4IZOA 3FKSA 3CXRA 1NN1A 1MO5A 1QIDA 4TTJA 3W34A 2LBPA 5E6SA 1HY3A 5ALHA 2HO4A 2BV3A 2PHZA 4B2PA 4LC0A 4L4XA 2VDOB 5F23A 1WB9A 5KO2A 4ND5A 2HJVA 4OQ4A 1ZVKA 4MP3A 4BNXA 2R25B 1YS6A 1EFCA 2XMGA 4EL5A 1E62A 1Z39A 3FAZA 3G2IA 1KDPA 3DKPA 3E1SA 2QQFA 4OSEA 5GONF 3IT2A 4IHQA 5A3JA 1MKYA 1EIWA 4QXMA 4CM1A 5G0UA 4XQEA 1TPYA 4EG1A 3IOYA 3ZYCA 3D6MA 3HVIA 3V4ZA 1AGYA 1G7CA 4ZI3A 2QGFA 4HLDA 4WY8A 5IT4A 2WF8A 3I8OA 3JRWA 4MICA 4QU5A 1HDGO 8OHMA 2LIVA 3LF1A 2DHEA 3CWQA 1J8MF 1ZUHA 5IJZA 5KB3A 3UJDA 4IEEA 4MR8A 1MD9A 3LHSA 4ANRA 5CVVA 4FMPA 3G2MA 5EWJB 5HKAA 4B3TM 1XZHA 1DTWA 3IB6A 2V74B 1INLA 3H05A 1EGQA 2UAGA 4M8SA 3UWDA 3U48A 2WZBA 2H63A 1BE6A 5TB5A 2W48A 1YMUA 1E4EA 2F67A 4BO0A 3GXOA 1P0IA 1K06A 3X44A 3K9HA 1GSOA 4DUYM 1VDMA 1XFDA 16PKA 4QTTB 3N0RA 1O8BA 5LD2B 4B75A 5KEIA 4NBSA 3PPYA 4KQIA 2GYUA 5T7BA 3OZUA 4DA4A 1DGFA 3DUWA 3KBOA 1Z2NX 4PANA 3G7UA 3DZKA 1L3IA 4WD3A 2GHIA 4HUTA 3AR5A 2PGNA 5A9SA 2XOXA 5ELXA 3L1KA 2PCJA 2GCOB 5I8WA 4QO7A 1TZCA 2AG8A 1BMFD 2LKCA 1GEEA 2HQBA 1W5TA 2O25A 2QVZX 5JAUA 2JHFA 1CQZA 3OU7A 1NWCA 2ZYRA 4PICA 3TAXA 1WMBA 5DLEA 3QELB 1Q7TA 5HIMA 2VYVD 3AIIA 1C3LA 2ZROA 3U4GA 5LB4A 3W68A 5IX8A 5HF8A 4ND8A 2ZSIA 4RENA 1XZMA 1BX3A 3KJNA 3H4VA 4AJEA 1IUPA 5HMLA 4Q7KA 4R8MA 2X0FA 1P5JA 3PU6A 1CK4A 2G07A 4OIMA 3G85A 2O1EA 4RACA 5AKYA 3DEFA 3O21A 4MI6A 1NW6A 3OU2A 1S3SA 3V8MA 1IRXA 2IYVA 4KWTA 4IVQA 3C41J 1WJGA 1E6CA 1O9GA 4LXHA 4IW3B 3T7CA 3SICE 4PSCA 3VMMA 2OM2A 1VI5A 1UPBA 3DVAA 3DH0A 3MINA 1Z3CA 1DO2A 3WVNA 4RO0A 3OZFA 4QYMA 3D3WB 3A4LA 2V8OA 2DWZB 1U0SY 3RSGA 1YB4A 4GZ5A 2R44A 1JSXA 2RI0A 1U7OA 3VPSA 2UXBB 1OZAA 3QVSA 3INRA 1HFEL 4AQYM 1CFJA 2C5GA 3NEPX 1W49A 1CZRA 3EB9A 1EXDA 2NZXA 1UBLS 3JAKB 3MTQA 5MF6A 5HPYB 1BZYA 1JEOA 3HKDB 3U6MA 1TZMA 4QQKA 5CITA 3P0JA 4N7JA 4M1TA 3RFCA 2GZMA 4DIKA 1GO2A 2XBUA 3E5HA 1FYWA 3NV7A 4DT1B 2BHNA 2VH1A 1Z4LA 2C97A 1WABA 2P5SA 2DAMA 2H1HA 1CHNA 3RS9A 2H1WA 3E2MA 3LP6A 2HCTA 1MMFB 3OTWA 3RBAA 4PX2A 1ILEA 3KK0A 4IJKA 4TV9B 3D0OA 4Y2XA 1QCCA 3TCKA 2OM6A 1XL0A 3QLEA 4PYMA 2GK6A 4HAOA 1U0NA 1YD7A 1TAUA 1P29A 3TZEA 4G9GA 1N5IA 2ISQA 4BEJA 1TJ3A 3AEUA 1IBMM 3AVPA 2BGUA 5JUWA 2GESA 3L49A 3BWMA 4YUWA 2W58A 1BKSB 2XNDA 4OP1A 2I7CA 2H0QA 4CMAA 1Z4IA 2NTJA 3B20A 4YAGA 1KXJA 1JHZA 2O5CA 4MVJM 1X1AA 2GPBA 1R0LA 3E9SA 2OO7A 2B8NA 1AQUA 4G0NA 5EMLA 3UBTA 2GARA 3KVVA 5C53B 2N47A 4ERNA 1PS0A 4Z2YA 4MITA 1ZU5A 4YFVA 4F5YA 1RWNA 5TEVA 4YUZA 3AR8A 3VR1A 1UQTA 2J6IA 3NHZA 1X1QA 2ADMA 2XMBA 4XIYA 1QX4A 4FWDA 5CMLA 4Y1RA 1ODKA 5H80A 3V8BA 1N8KA 5BWNA 2D6FA 4XSHA 4GOND 3HCEA 2VP4A 3RF7A 2H7VA 5ECDA 4KXQA 4PYLA 5DEIA 1ZM2A 3K9OA 3IQDB 3EVBA 1K75A 1OFHA 1EK5A 1KNXA 1N3LA 3QWLA 2ZFUA 4TSFD 1Y6QA 4OI0A 2XUAA 1DTEA 2Q1UA 2B7BA 5CPBA 4EABA 4BRZA 4HGNA 4XM2A 3JATB 1PZGA 2GCIA 1NNEA 3U9SA 4MQLA 1R9GA 4P32A 1ZS9A 2LWIA 5BP7A 1IQRA 3TUIC 3BG5A 1FSPA 3JD4A 3CPJB 5TSDA 1BHSA 2WWXA 3WNDA 4B3RB 1JJBA 1XK6A 1PI3A 2EWMA 1N2OA 5DP1A 4U4AA 4ZVLA 3L6RA 1A7JA 4GP9A 3DTYA 2D8MA 4DY4A 5K0JA 3D6FA 1W44A 5F3DA 3N2NA 1ZOIA 3FCCA 4GMGA 1XMOM 4C7KA 1X1BA 3UXYA 4F86A 1TM4E 4CMIA 1JKMA 4GX2A 5AVXA 2DFKB 3WIUA 3A3NA 5DGHA 5K3CA 3KJFA 4C0BA 4W82A 4OEHA 2H57A 3GG9A 4GM0A 4NRWA 3C3MA 4MWDA 3TLYA 1FFXA 1ZD1A 5K6AC 5DK6A 3AV0B 2Z04A </