4L1PA

Crystal structure of human rtf1 plus3 domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
127
Chain Sequence
HMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-associated protein RTF1 homolog
publication title Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03126 Plus-3 Plus-3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.30 Mainly Beta Beta Complex paz domain paz domain 4l1pA00
2DB9A 4L1UA 3U1UA 2BZEA 4L1PA
chains in the Genus database with same CATH superfamily
4NGDA 3QIRA 4NGCA 4W5QA 3HVRA 4W5TA 3DA5A 4NHAA 1T2RA 4Z4GA 1U04A 4L1UA 1SI2A 2XFMA 5JS1A 3HO1A 5T7BA 1R6ZA 3O6EX 3MJ0A 1T2SA 3HM9A 4Z4IA 4W5RA 3O7VX 4Z4CA 2L5CA 3DLBA 2BZEA 4L1PA 4Z4FA 4NGBA 3O3IX 4OLAA 1VYNA 2FFLA 1R4KA 4OLBA 3F73A 4F3TA 1Z26A 4Z4EA 4NGGA 4NH5A 2DB9A 3HK2A 3U1UA 3O7XA 5KI6A 4Z4HA 2L5DA 4NGFA 2QVWA 4KREA 4W5OA 5JS2A 1SI3A 4NH6A 3HJFA 4KRFA 4W5NA 3DLHA 4NH3A 1Z25A
chains in the Genus database with same CATH topology
4NGDA 3QIRA 4NGCA 4W5QA 3HVRA 4W5TA 3DA5A 4NHAA 1T2RA 4Z4GA 1U04A 4L1UA 1SI2A 2XFMA 5JS1A 3HO1A 5T7BA 1R6ZA 3O6EX 3MJ0A 1T2SA 3HM9A 4Z4IA 4W5RA 3O7VX 4Z4CA 2L5CA 3DLBA 2BZEA 4L1PA 4Z4FA 4NGBA 3O3IX 4OLAA 1VYNA 2FFLA 1R4KA 4OLBA 3F73A 4F3TA 1Z26A 4Z4EA 4NGGA 4NH5A 2DB9A 3HK2A 3U1UA 3O7XA 5KI6A 4Z4HA 2L5DA 4NGFA 2QVWA 4KREA 4W5OA 5JS2A 1SI3A 4NH6A 3HJFA 4KRFA 4W5NA 3DLHA 4NH3A 1Z25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB9 A;  4L1U A;  3U1U A;  2BZE A;  4L1P A; 
#chains in the Genus database with same CATH topology
 4NGD A;  3QIR A;  4NGC A;  4W5Q A;  3HVR A;  4W5T A;  3DA5 A;  4NHA A;  1T2R A;  4Z4G A;  1U04 A;  4L1U A;  1SI2 A;  2XFM A;  5JS1 A;  3HO1 A;  5T7B A;  1R6Z A;  3O6E X;  3MJ0 A;  1T2S A;  3HM9 A;  4Z4I A;  4W5R A;  3O7V X;  4Z4C A;  2L5C A;  3DLB A;  2BZE A;  4L1P A;  4Z4F A;  4NGB A;  3O3I X;  4OLA A;  1VYN A;  2FFL A;  1R4K A;  4OLB A;  3F73 A;  4F3T A;  1Z26 A;  4Z4E A;  4NGG A;  4NH5 A;  2DB9 A;  3HK2 A;  3U1U A;  3O7X A;  5KI6 A;  4Z4H A;  2L5D A;  4NGF A;  2QVW A;  4KRE A;  4W5O A;  5JS2 A;  1SI3 A;  4NH6 A;  3HJF A;  4KRF A;  4W5N A;  3DLH A;  4NH3 A;  1Z25 A; 
#chains in the Genus database with same CATH homology
 4NGD A;  3QIR A;  4NGC A;  4W5Q A;  3HVR A;  4W5T A;  3DA5 A;  4NHA A;  1T2R A;  4Z4G A;  1U04 A;  4L1U A;  1SI2 A;  2XFM A;  5JS1 A;  3HO1 A;  5T7B A;  1R6Z A;  3O6E X;  3MJ0 A;  1T2S A;  3HM9 A;  4Z4I A;  4W5R A;  3O7V X;  4Z4C A;  2L5C A;  3DLB A;  2BZE A;  4L1P A;  4Z4F A;  4NGB A;  3O3I X;  4OLA A;  1VYN A;  2FFL A;  1R4K A;  4OLB A;  3F73 A;  4F3T A;  1Z26 A;  4Z4E A;  4NGG A;  4NH5 A;  2DB9 A;  3HK2 A;  3U1U A;  3O7X A;  5KI6 A;  4Z4H A;  2L5D A;  4NGF A;  2QVW A;  4KRE A;  4W5O A;  5JS2 A;  1SI3 A;  4NH6 A;  3HJF A;  4KRF A;  4W5N A;  3DLH A;  4NH3 A;  1Z25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...