4L1QD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 94
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l1qD00
5HE3B 2P9PC 3MZLA 3DM0A 3V5WB 3UKUC 5TF2A 3MMYA 2P9IC 3PXWD 4CI1A 4JSNC 1U2VC 2AGZA 3JRPA 3FM0A 4CZYA 3K26A 4GMBA 4A0BB 1XKSA 3SBQA 5HE0B 3CIKB 4LGNA 4JD2C 2W18A 3F3FA 3I7OA 3IIYA 4O3UB 3EWEA 1PBYB 2CE9A 3RN1D 4A08B 5CYKA 2HKRA 2YNOA 2Z2PA 1GG2B 4L9OA 3OKYA 2QXVA 5FKTA 2IWKA 3EI3A 3NVNA 5C9ZB 5B4WA 4BUJC 3UVOA 4QRJA 1L0QA 3L4MD 5FXYA 5THAA 1U4CA 2P9UC 4A0AA 4CZXA 2H9LA 4J77A 3FGBA 3ZWLB 5EAMA 4L1QD 3IJCA 2P9LC 4E54A 2H9NA 3SHFA 3I2NA 4CZVA 3MKQA 3NVQA 4BL0A 3U4YA 1FWXA 5EARA 4A2MA 2H47A 4PSWB 4PNKB 1GP2B 4JXMA 1XHMA 1S4UX 2OVQB 5AFU3 2OVPB 5GMKn 3AL8A 3HFQA 4J78A 3SBPA 4PXWA 1P22A 5IT9g 4D6VA 3RN0D 2PM6B 3EMHA 4E5ZA 4OWRA 5TEFA 3V9FA 3DSMA 4GQ2P 1GOTB 3JZGA 2EBSA 3EI4B 2O9KA 2P9SC 5EM2B 3IIWA 4OZUA 2MTAH 3UKRC 3A0FA 2AQ5A 2I3SA 1N6EA 3UVMA 3MXXA 4GQBB 2AGWA 2XYIA 5IJ8E 1K8KC 2H6KA 4J8GA 3UVNA 4I79A 2BBKH 2J57G 1MG2A 5FA5B 2YMUA 2IAAA 2CN2A 3FRXA 3JZNA 3DWLC 2HYEA 3V7DB 2H68A 2CE8A 2UZXB 4ZOYA 2HKMA 3EI1A 5EALA 3JB9L 3C5MA 5AJAA 4J79A 1TBGA 2IWFA 1A0RB 4GZ8A 4X63B 2PM9A 2QC5A 1N6DA 3B7FA 5HE2B 4A0BA 2Z2OA 4L3GD 3RLMD 3CFVA 2AGYA 3PSLA 4TZ4A 5C2VB 4J8BA 1OMWB 5HE1B 3K27A 4PSXB 1SQ9A 2OK6A 2TRCB 4A08A 1PGUA 5IJ7E 1ERJA 4D0KA 3C9CA 4LG8A 2OVRB 4JSPC 2H6NA 4NSXA 4QT8A 5HQGA 5CXCB 5FQDA 2YNNA 4BH6A 5I5MA 4A11A 4FB1D 2I3TA 3C75H 2YNPA 2P9NC 4IA9A 1PI6A 2IURA 4A09B 2G9AA 4XYIA 4HDJA 2XL3A 4ERZA 2OIZA 4CY3A 1PEVA 2H3XA 4XEIC 3KRXB 1VYHC 3EU7A 4J84A 4ZN4A 4GGDA 4J87A 4CC9A 4CY1A 5K1CC 3VH0A 3MZKA 2XL2A 3I7KA 3EI2B 2YBAA 4GM8A 3SVWD 4ESGA 3EI3B 3IJ0A 4A7JA 1SQJA 3BWSA 3PVUB 3OL2B 3AH8B 5SXMA 5IGQA 3SJLD 4FA5D 2AH0A 3SLED 2GC7A 3GFCA 3SFZA 3DXMC 4J0WA 2Z2NA 3I8EA 3VA6A 1Q47A 5EMMB 4U1EI 2Q7QA 1QNIA 4J81A 5H14A 3AL9A 3MKSB 2I0TA 3DXKC 5HYNB 2HESX 4CY2A 3PSCB 4XYHA 3RMZD 4QQEA 3ORVD 3EG6A 4FA9D 5FLXg 1MG3A 4ERYA 1SHYB 4QL1A 5GXIA 4GM3A 4O3TB 4ZOVA 2YB8B 3UR4A 5CXBB 4E5ZB 2H6QA 3VGZA 3KRWB 3SBRA 5FKSA 5GXHA 3SXTD 2AGLA 2HJBA 3PE7A 4JT5C 4GM9A 4Y5RD 2P9KC 5CXCA 4FWWA 4J73A 4FHLA 4K3ID 3SWSD 3J81g 2IUPA 3NVXA 4GGCA 1NR0A 4JSXC 2H13A 3RSEC 2HJ4A 2OK4A 4AEZA 4EWRA 3F3PA 5C2WB 3C99A 3BG1A 1B9XA 4X3EA 5TEEA 2PBIB 4ERQA 3I7HA 4FAVD 3IJ1A 4H5IA 3EI1B 3N0EA 1B9YA 4H5JA 2AGXA 3RFHA 2B5LA 2UZYB 3OTTA 2GNQA 2PM9B 4O9DA 3OKWA 4JT6C 4AOWA 4R7AB 1K32A 4CY5A 4CI3A 4GQ1A 2BCJB 3SCYA 3AFCA 3JROA 4A2LA 4O1QD 3RFGA 3ULEC 4FA4D 5A2Qg 2H9PA 4IMMA 4ZOZA 4X60B 3EI2A 5H17A 1YFQA 2H14A 4O45A 3OL2A 3PVWB 3JAMg 2CO0C 3PXTD 4FAND 2GC4A 4N14A 4GGAA 1R5MA 3I8CA 5K19A 3RRMC 5CYKB 4A11B 5IGOA 3OKYB 4LG9A 3OKTA 3I7PA 2IUQA 4X61B 2CO0A 3EI4A 3I89A 2HXCA 4PBZA 5EM2A 5I5JA 3SN6B 2IUVA 4PC0A 1JOFA 3OW8A 4A0AB 4J82A 3I7LA 5EMLB 4FA1D 4ZOXA 4Y7RA 1NEXB 3J80g 4E54B 2OJYA 3BG0A 5EAPA 5EMKB 1GXRA 3F3GA 4PBYA 2CN3A 2B5NA 2B5MA 5TDHB 3PXSD 1XIPA 5EMJB 5CXBA 3JZHA 3GREA 2I0RA 3JPXA 4YVDA 4Z8LA 2G99A 4K3JB 3SMRA 1JMZB 3IKOA 1JMXB 4U7AA 4CI8A 3I7NA 4L3HD 3P4FA 2J56H 3AL8B 4KFMB 3L4OD 2J55H 5KDOB 3UVKA 1TYQC 5FKQA 3W15A 2XU7A 5I5IA 2I0SA 4UI9R 4JSVC 4CI2A 3CFSB 3E0CA 1OLZA 2PM7B 5JWZA 2B4EA 2H9MA 5AMSA 3UVLA 3N0DA 1JJUB 2CNXA 2AH1A 4G56B 4ES0A 4MK0B 1MDAH 5FKRA 4J86A 4J0XA 1N6FA 4A09A 5GSAA 1RI6A 5IC7A 3ODTA 5H1MA
chains in the Genus database with same CATH superfamily
5HE3B 2P9PC 3MZLA 3DM0A 3V5WB 3UKUC 5TF2A 3MMYA 2P9IC 2QZPA 3PXWD 4AN0A 1A12A 4BCBA 4CI1A 4JSNC 1U2VC 2AGZA 3JRPA 3FM0A 4CZYA 3K26A 4GMBA 4A0BB 1XKSA 3SBQA 5HE0B 3CIKB 3IJEA 2QR5A 4JD2C 4LGNA 3ZDZA 2W18A 3F3FA 3I7OA 3IIYA 4O3UB 3EWEA 1PBYB 1VZ2A 2CE9A 3RN1D 4A08B 2VDKA 5CYKA 2HKRA 2YNOA 2Z2PA 1GG2B 2VZ3A 4L9OA 3OKYA 1GOFA 2QXVA 5FKTA 2IWKA 3EI3A 3NVNA 5C9ZB 5B4WA 4BUJC 3UVOA 3O4GA 4QRJA 1L0QA 3L4MD 5FXYA 5THAA 1U4CA 2P9UC 4A0AA 4CZXA 3K72A 3ZDYA 2H9LA 4J77A 3FGBA 3ZWLB 5EAMA 3GC3B 4L1QD 3IJCA 2P9LC 4E54A 2H9NA 3SHFA 3I2NA 4CZVA 2VZ1A 3MKQA 3NVQA 4BL0A 3U4YA 1FWXA 2EICA 5EARA 4A2MA 2H47A 5E6UA 4PSWB 4PNKB 1GP2B 4NC4A 4JXMA 1XHMA 1S4UX 2OVQB 1K3IA 5AFU3 2OVPB 5GMKn 3AL8A 3HFQA 3V4PA 4J78A 3SBPA 4PXWA 3VI3A 1P22A 5IT9g 1JV2A 4D6VA 1UOOA 3RN0D 2PM6B 3EMHA 4E5ZA 4OWRA 5TEFA 3V9FA 3DSMA 4GQ2P 1GOTB 2EIDA 3JZGA 2EBSA 3EI4B 2O9KA 2P9SC 3IUQA 4BP8A 3IIWA 5EM2B 4OZUA 2MTAH 2VC2A 3UKRC 3A0FA 2AQ5A 2I3SA 1N6EA 3UVMA 3MXXA 4GQBB 2AGWA 1GOHA 2XYIA 5IJ8E 1K8KC 2H6KA 4J8GA 4WK4A 3UVNA 4I79A 2BBKH 2J57G 1MG2A 4G1EA 1TYEA 5FA5B 2YMUA 2IAAA 2CN2A 3FRXA 3JZNA 3DWLC 2HYEA 4G55A 3V7DB 2H68A 2CE8A 3EQ9A 2UZXB 2HU7A 3V4VA 5E6SA 1UOPA 2HKMA 4ZOYA 3EI1A 5EALA 3JB9L 3C5MA 5AJAA 4NBMA 4J79A 1TBGA 2IWFA 1A0RB 4GZ8A 3T3PA 4X63B 2PM9A 2QC5A 1N6DA 3B7FA 5HE2B 2EIEA 4A0BA 2Z2OA 4DNVA 4L3GD 3RLMD 3CFVA 2AGYA 3KCIA 3PSLA 4TZ4A 5C2VB 4J8BA 1OMWB 2VDRA 5HE1B 2VDPA 3K27A 4PSXB 3ZE0A 1SQ9A 2OK6A 2TRCB 4A08A 1PGUA 1BPOA 5IJ7E 1ERJA 4D0KA 3C9CA 4LG8A 2OVRB 4JSPC 2H6NA 1I2MB 4NSXA 4UM9A 4DNUA 4QT8A 5HQGA 3ZDXA 5CXCB 2VDLA 5FQDA 2HU5A 1H2WA 2YNNA 4BH6A 1QFMA 2EIBA 5I5MA 3K6SA 4A11A 4FB1D 2I3TA 3C75H 2YNPA 2P9NC 4IA9A 1PI6A 5M5TA 2IURA 4A09B 2G9AA 4XYIA 3EQ7A 2HU8A 4HDJA 2VDNA 2XL3A 4ERZA 2OIZA 4CY3A 1PEVA 1H2XA 1C9LA 5M5SA 3FCUA 2H3XA 4XEIC 3KRXB 1VYHC 3EU7A 4J84A 4ZN4A 4GGDA 4QAMA 1L5GA 4J87A 3IULA 4CC9A 4CY1A 5K1CC 3VH0A 3MZKA 2XL2A 3I7KA 3EI2B 2YBAA 4GM8A 5C92A 3SVWD 3MVDK 4ESGA 3EI3B 3IJ0A 4A7JA 1SQJA 5M5UA 3BWSA 3OL2B 3PVUB 3AH8B 5SXMA 5IGQA 4O02A 1VE6A 3SJLD 4FA5D 2AH0A 4WK2A 3IUMA 5M61A 3SLED 2GC7A 3GFCA 4MMZA 3SFZA 3DXMC 4J0WA 2Z2NA 3I8EA 4JHPC 4O2WA 3VA6A 1Q47A 5EMMB 4U1EI 2Q7QA 1QNIA 4J81A 5H14A 3AL9A 3IUJA 3MKSB 2I0TA 3DXKC 5HYNB 3ZE2A 2HESX 4CY2A 3IUNA 3PSCB 4XYHA 3RMZD 3EQ8A 4QQEA 3ORVD 1GOGA 3EG6A 4MMYA 4FA9D 5FLXg 1MG3A 3NIFA 4ERYA 1VZ3A 1SHYB 4QL1A 5GXIA 1E5TA 4GM3A 4O3TB 4ZOVA 2YB8B 3K71A 3UR4A 5CXBB 4RE5A 4E5ZB 2H6QA 3VGZA 3KRWB 3SBRA 1T2XA 5FKSA 4BCDA 5GXHA 3SXTD 1H2ZA 2AGLA 2HJBA 3PE7A 4JT5C 4GM9A 4Y5RD 2P9KC 5CXCA 4AX4A 4FWWA 4J73A 4FHLA 4K3ID 3SWSD 3J81g 2IUPA 4AMZA 3NVXA 4GGCA 1NR0A 1M1XA 4JSXC 4Z7NA 2H13A 4WJKA 4AN1A 3RSEC 2HJ4A 2OK4A 4AEZA 4JHNA 4EWRA 3F3PA 5C2WB 3MUOA 3C99A 5FFGA 3BG1A 1B9XA 3O4IA 4X3EA 5TEEA 2PBIB 4ERQA 3I7HA 4FAVD 3IURA 5E6RA 3IJ1A 4H5IA 3DDUA 3FCSA 3EI1B 3N0EA 1B9YA 4H5JA 2WQ8A 2AGXA 3RFHA 1C9IA 2B5LA 2UZYB 3OTTA 2GNQA 2PM9B 4O9DA 3O4HA 3OKWA 4JT6C 4AOWA 5M5VA 4R7AB 1K32A 4CY5A 4CI3A 4GQ1A 1JTDB 2BCJB 4WK0A 3SCYA 3AFCA 3JROA 4A2LA 4O1QD 3RFGA 3ULEC 4RE6A 5M5RA 4FA4D 5A2Qg 2H9PA 4IMMA 3QI0A 4ZOZA 4X60B 3EI2A 3GD1I 5H17A 1YFQA 2H14A 5FFOA 4O45A 3OL2A 3PVWB 3JAMg 2CO0C 4NENA 3PXTD 5HDBA 4FAND 4AMYA 2GC4A 1O6GA 4N14A 4GGAA 1R5MA 3I8CA 5K19A 3RRMC 2VDMA 5CYKB 4A11B 5IGOA 3NIGA 3OKYB 3OKTA 4LG9A 3I7PA 2IUQA 1E8MA 1O6FA 2CO0A 3EI4A 3I89A 4X61B 2HXCA 4PBZA 5EM2A 5I5JA 4D9SA 3SN6B 2VDOA 1UOQA 2IUVA 4PC0A 1JOFA 3OW8A 4A0AB 4J82A 1QFSA 3I7LA 5EMLB 4FA1D 1UTCA 4ZOXA 2VDQA 2BKLA 4Y7RA 1NEXB 3J80g 4E54B 2OJYA 3BG0A 2JKXA 5EAPA 5EMKB 3IVMA 1GXRA 3NIDA 4BP9A 3F3GA 3VI4A 4PBYA 2CN3A 4G1MA 2B5NA 2B5MA 5TDHB 3ZE1A 3PXSD 1XIPA 1U8CA 5EMJB 5CXBA 3JZHA 3GREA 2I0RA 3JPXA 4UM8A 4YVDA 4Z8LA 2G99A 4K3JB 3SMRA 1JMZB 1H2YA 1JMXB 3IKOA 1E8NA 4U7AA 4CI8A 3I7NA 4L3HD 3P4FA 2J56H 3AL8B 4KFMB 3L4OD 2J55H 5KDOB 2XDWA 3UVKA 1TYQC 1VE7A 5FKQA 3W15A 4BCCA 2XU7A 5I5IA 4MMXA 2I0SA 4UI9R 4JSVC 4CI2A 5C86A 3CFSB 3E0CA 4DNWA 1OLZA 2PM7B 5JWZA 3OF7A 2B4EA 2H9MA 5AMSA 3O4JA 1YR2A 3UVLA 3MUNA 3N0DA 1JJUB 2CNXA 2AH1A 3QHYB 4G56B 4L1MA 4ES0A 4MK0B 4Z7QA 1MDAH 2XZGA 5FKRA 4J86A 4J0XA 1N6FA 4IRZA 3T3MA 2XE4A 4A09A 5GSAA 4Z7OA 1RI6A 4NAAA 5IC7A 3ODTA 5H1MA
chains in the Genus database with same CATH topology
5HE3B 2P9PC 3MZLA 3DM0A 3V5WB 3UKUC 5TF2A 3MMYA 2P9IC 3PXWD 4CI1A 4JSNC 1U2VC 2AGZA 3JRPA 3FM0A 4CZYA 3K26A 4GMBA 4A0BB 1XKSA 3SBQA 5HE0B 3CIKB 4LGNA 4JD2C 2W18A 3F3FA 3I7OA 3IIYA 4O3UB 3EWEA 1PBYB 2CE9A 3RN1D 4A08B 5CYKA 2HKRA 2YNOA 2Z2PA 1GG2B 4L9OA 3OKYA 2QXVA 5FKTA 2IWKA 3EI3A 3NVNA 5C9ZB 5B4WA 4BUJC 3UVOA 4QRJA 1L0QA 3L4MD 5FXYA 5THAA 1U4CA 2P9UC 4A0AA 4CZXA 2H9LA 4J77A 3FGBA 3ZWLB 5EAMA 4L1QD 3IJCA 2P9LC 4E54A 2H9NA 3SHFA 3I2NA 4CZVA 3MKQA 3NVQA 4BL0A 3U4YA 1FWXA 5EARA 4A2MA 2H47A 4PSWB 4PNKB 1GP2B 4JXMA 1XHMA 1S4UX 2OVQB 5AFU3 2OVPB 5GMKn 3AL8A 3HFQA 4J78A 3SBPA 4PXWA 1P22A 5IT9g 4D6VA 3RN0D 2PM6B 3EMHA 4E5ZA 4OWRA 5TEFA 3V9FA 3DSMA 4GQ2P 1GOTB 3JZGA 2EBSA 3EI4B 2O9KA 2P9SC 5EM2B 3IIWA 4OZUA 2MTAH 3UKRC 3A0FA 2AQ5A 2I3SA 1N6EA 3UVMA 3MXXA 4GQBB 2AGWA 2XYIA 5IJ8E 1K8KC 2H6KA 4J8GA 3UVNA 4I79A 2BBKH 2J57G 1MG2A 5FA5B 2YMUA 2IAAA 2CN2A 3FRXA 3JZNA 3DWLC 2HYEA 3V7DB 2H68A 2CE8A 2UZXB 4ZOYA 2HKMA 3EI1A 5EALA 3JB9L 3C5MA 5AJAA 4J79A 1TBGA 2IWFA 1A0RB 4GZ8A 4X63B 2PM9A 2QC5A 1N6DA 3B7FA 5HE2B 4A0BA 2Z2OA 4L3GD 3RLMD 3CFVA 2AGYA 3PSLA 4TZ4A 5C2VB 4J8BA 1OMWB 5HE1B 3K27A 4PSXB 1SQ9A 2OK6A 2TRCB 4A08A 1PGUA 5IJ7E 1ERJA 4D0KA 3C9CA 4LG8A 2OVRB 4JSPC 2H6NA 4NSXA 4QT8A 5HQGA 5CXCB 5FQDA 2YNNA 4BH6A 5I5MA 4A11A 4FB1D 2I3TA 3C75H 2YNPA 2P9NC 4IA9A 1PI6A 2IURA 4A09B 2G9AA 4XYIA 4HDJA 2XL3A 4ERZA 2OIZA 4CY3A 1PEVA 2H3XA 4XEIC 3KRXB 1VYHC 3EU7A 4J84A 4ZN4A 4GGDA 4J87A 4CC9A 4CY1A 5K1CC 3VH0A 3MZKA 2XL2A 3I7KA 3EI2B 2YBAA 4GM8A 3SVWD 4ESGA 3EI3B 3IJ0A 4A7JA 1SQJA 3BWSA 3PVUB 3OL2B 3AH8B 5SXMA 5IGQA 3SJLD 4FA5D 2AH0A 3SLED 2GC7A 3GFCA 3SFZA 3DXMC 4J0WA 2Z2NA 3I8EA 3VA6A 1Q47A 5EMMB 4U1EI 2Q7QA 1QNIA 4J81A 5H14A 3AL9A 3MKSB 2I0TA 3DXKC 5HYNB 2HESX 4CY2A 3PSCB 4XYHA 3RMZD 4QQEA 3ORVD 3EG6A 4FA9D 5FLXg 1MG3A 4ERYA 1SHYB 4QL1A 5GXIA 4GM3A 4O3TB 4ZOVA 2YB8B 3UR4A 5CXBB 4E5ZB 2H6QA 3VGZA 3KRWB 3SBRA 5FKSA 5GXHA 3SXTD 2AGLA 2HJBA 3PE7A 4JT5C 4GM9A 4Y5RD 2P9KC 5CXCA 4FWWA 4J73A 4FHLA 4K3ID 3SWSD 3J81g 2IUPA 3NVXA 4GGCA 1NR0A 4JSXC 2H13A 3RSEC 2HJ4A 2OK4A 4AEZA 4EWRA 3F3PA 5C2WB 3C99A 3BG1A 1B9XA 4X3EA 5TEEA 2PBIB 4ERQA 3I7HA 4FAVD 3IJ1A 4H5IA 3EI1B 3N0EA 1B9YA 4H5JA 2AGXA 3RFHA 2B5LA 2UZYB 3OTTA 2GNQA 2PM9B 4O9DA 3OKWA 4JT6C 4AOWA 4R7AB 1K32A 4CY5A 4CI3A 4GQ1A 2BCJB 3SCYA 3AFCA 3JROA 4A2LA 4O1QD 3RFGA 3ULEC 4FA4D 5A2Qg 2H9PA 4IMMA 4ZOZA 4X60B 3EI2A 5H17A 1YFQA 2H14A 4O45A 3OL2A 3PVWB 3JAMg 2CO0C 3PXTD 4FAND 2GC4A 4N14A 4GGAA 1R5MA 3I8CA 5K19A 3RRMC 5CYKB 4A11B 5IGOA 3OKYB 4LG9A 3OKTA 3I7PA 2IUQA 4X61B 2CO0A 3EI4A 3I89A 2HXCA 4PBZA 5EM2A 5I5JA 3SN6B 2IUVA 4PC0A 1JOFA 3OW8A 4A0AB 4J82A 3I7LA 5EMLB 4FA1D 4ZOXA 4Y7RA 1NEXB 3J80g 4E54B 2OJYA 3BG0A 5EAPA 5EMKB 1GXRA 3F3GA 4PBYA 2CN3A 2B5NA 2B5MA 5TDHB 3PXSD 1XIPA 5EMJB 5CXBA 3JZHA 3GREA 2I0RA 3JPXA 4YVDA 4Z8LA 2G99A 4K3JB 3SMRA 1JMZB 3IKOA 1JMXB 4U7AA 4CI8A 3I7NA 4L3HD 3P4FA 2J56H 3AL8B 4KFMB 3L4OD 2J55H 5KDOB 3UVKA 1TYQC 5FKQA 3W15A 2XU7A 5I5IA 2I0SA 4UI9R 4JSVC 4CI2A 3CFSB 3E0CA 1OLZA 2PM7B 5JWZA 2B4EA 2H9MA 5AMSA 3UVLA 3N0DA 1JJUB 2CNXA 2AH1A 4G56B 4ES0A 4MK0B 1MDAH 5FKRA 4J86A 4J0XA 1N6FA 4A09A 5GSAA 1RI6A 5IC7A 3ODTA 5H1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 B;  2P9P C;  3MZL A;  3DM0 A;  3V5W B;  3UKU C;  5TF2 A;  3MMY A;  2P9I C;  3PXW D;  4CI1 A;  4JSN C;  1U2V C;  2AGZ A;  3JRP A;  3FM0 A;  4CZY A;  3K26 A;  4GMB A;  4A0B B;  1XKS A;  3SBQ A;  5HE0 B;  3CIK B;  4LGN A;  4JD2 C;  2W18 A;  3F3F A;  3I7O A;  3IIY A;  4O3U B;  3EWE A;  1PBY B;  2CE9 A;  3RN1 D;  4A08 B;  5CYK A;  2HKR A;  2YNO A;  2Z2P A;  1GG2 B;  4L9O A;  3OKY A;  2QXV A;  5FKT A;  2IWK A;  3EI3 A;  3NVN A;  5C9Z B;  5B4W A;  4BUJ C;  3UVO A;  4QRJ A;  1L0Q A;  3L4M D;  5FXY A;  5THA A;  1U4C A;  2P9U C;  4A0A A;  4CZX A;  2H9L A;  4J77 A;  3FGB A;  3ZWL B;  5EAM A;  4L1Q D;  3IJC A;  2P9L C;  4E54 A;  2H9N A;  3SHF A;  3I2N A;  4CZV A;  3MKQ A;  3NVQ A;  4BL0 A;  3U4Y A;  1FWX A;  5EAR A;  4A2M A;  2H47 A;  4PSW B;  4PNK B;  1GP2 B;  4JXM A;  1XHM A;  1S4U X;  2OVQ B;  5AFU 3;  2OVP B;  5GMK n;  3AL8 A;  3HFQ A;  4J78 A;  3SBP A;  4PXW A;  1P22 A;  5IT9 g;  4D6V A;  3RN0 D;  2PM6 B;  3EMH A;  4E5Z A;  4OWR A;  5TEF A;  3V9F A;  3DSM A;  4GQ2 P;  1GOT B;  3JZG A;  2EBS A;  3EI4 B;  2O9K A;  2P9S C;  5EM2 B;  3IIW A;  4OZU A;  2MTA H;  3UKR C;  3A0F A;  2AQ5 A;  2I3S A;  1N6E A;  3UVM A;  3MXX A;  4GQB B;  2AGW A;  2XYI A;  5IJ8 E;  1K8K C;  2H6K A;  4J8G A;  3UVN A;  4I79 A;  2BBK H;  2J57 G;  1MG2 A;  5FA5 B;  2YMU A;  2IAA A;  2CN2 A;  3FRX A;  3JZN A;  3DWL C;  2HYE A;  3V7D B;  2H68 A;  2CE8 A;  2UZX B;  4ZOY A;  2HKM A;  3EI1 A;  5EAL A;  3JB9 L;  3C5M A;  5AJA A;  4J79 A;  1TBG A;  2IWF A;  1A0R B;  4GZ8 A;  4X63 B;  2PM9 A;  2QC5 A;  1N6D A;  3B7F A;  5HE2 B;  4A0B A;  2Z2O A;  4L3G D;  3RLM D;  3CFV A;  2AGY A;  3PSL A;  4TZ4 A;  5C2V B;  4J8B A;  1OMW B;  5HE1 B;  3K27 A;  4PSX B;  1SQ9 A;  2OK6 A;  2TRC B;  4A08 A;  1PGU A;  5IJ7 E;  1ERJ A;  4D0K A;  3C9C A;  4LG8 A;  2OVR B;  4JSP C;  2H6N A;  4NSX A;  4QT8 A;  5HQG A;  5CXC B;  5FQD A;  2YNN A;  4BH6 A;  5I5M A;  4A11 A;  4FB1 D;  2I3T A;  3C75 H;  2YNP A;  2P9N C;  4IA9 A;  1PI6 A;  2IUR A;  4A09 B;  2G9A A;  4XYI A;  4HDJ A;  2XL3 A;  4ERZ A;  2OIZ A;  4CY3 A;  1PEV A;  2H3X A;  4XEI C;  3KRX B;  1VYH C;  3EU7 A;  4J84 A;  4ZN4 A;  4GGD A;  4J87 A;  4CC9 A;  4CY1 A;  5K1C C;  3VH0 A;  3MZK A;  2XL2 A;  3I7K A;  3EI2 B;  2YBA A;  4GM8 A;  3SVW D;  4ESG A;  3EI3 B;  3IJ0 A;  4A7J A;  1SQJ A;  3BWS A;  3PVU B;  3OL2 B;  3AH8 B;  5SXM A;  5IGQ A;  3SJL D;  4FA5 D;  2AH0 A;  3SLE D;  2GC7 A;  3GFC A;  3SFZ A;  3DXM C;  4J0W A;  2Z2N A;  3I8E A;  3VA6 A;  1Q47 A;  5EMM B;  4U1E I;  2Q7Q A;  1QNI A;  4J81 A;  5H14 A;  3AL9 A;  3MKS B;  2I0T A;  3DXK C;  5HYN B;  2HES X;  4CY2 A;  3PSC B;  4XYH A;  3RMZ D;  4QQE A;  3ORV D;  3EG6 A;  4FA9 D;  5FLX g;  1MG3 A;  4ERY A;  1SHY B;  4QL1 A;  5GXI A;  4GM3 A;  4O3T B;  4ZOV A;  2YB8 B;  3UR4 A;  5CXB B;  4E5Z B;  2H6Q A;  3VGZ A;  3KRW B;  3SBR A;  5FKS A;  5GXH A;  3SXT D;  2AGL A;  2HJB A;  3PE7 A;  4JT5 C;  4GM9 A;  4Y5R D;  2P9K C;  5CXC A;  4FWW A;  4J73 A;  4FHL A;  4K3I D;  3SWS D;  3J81 g;  2IUP A;  3NVX A;  4GGC A;  1NR0 A;  4JSX C;  2H13 A;  3RSE C;  2HJ4 A;  2OK4 A;  4AEZ A;  4EWR A;  3F3P A;  5C2W B;  3C99 A;  3BG1 A;  1B9X A;  4X3E A;  5TEE A;  2PBI B;  4ERQ A;  3I7H A;  4FAV D;  3IJ1 A;  4H5I A;  3EI1 B;  3N0E A;  1B9Y A;  4H5J A;  2AGX A;  3RFH A;  2B5L A;  2UZY B;  3OTT A;  2GNQ A;  2PM9 B;  4O9D A;  3OKW A;  4JT6 C;  4AOW A;  4R7A B;  1K32 A;  4CY5 A;  4CI3 A;  4GQ1 A;  2BCJ B;  3SCY A;  3AFC A;  3JRO A;  4A2L A;  4O1Q D;  3RFG A;  3ULE C;  4FA4 D;  5A2Q g;  2H9P A;  4IMM A;  4ZOZ A;  4X60 B;  3EI2 A;  5H17 A;  1YFQ A;  2H14 A;  4O45 A;  3OL2 A;  3PVW B;  3JAM g;  2CO0 C;  3PXT D;  4FAN D;  2GC4 A;  4N14 A;  4GGA A;  1R5M A;  3I8C A;  5K19 A;  3RRM C;  5CYK B;  4A11 B;  5IGO A;  3OKY B;  4LG9 A;  3OKT A;  3I7P A;  2IUQ A;  4X61 B;  2CO0 A;  3EI4 A;  3I89 A;  2HXC A;  4PBZ A;  5EM2 A;  5I5J A;  3SN6 B;  2IUV A;  4PC0 A;  1JOF A;  3OW8 A;  4A0A B;  4J82 A;  3I7L A;  5EML B;  4FA1 D;  4ZOX A;  4Y7R A;  1NEX B;  3J80 g;  4E54 B;  2OJY A;  3BG0 A;  5EAP A;  5EMK B;  1GXR A;  3F3G A;  4PBY A;  2CN3 A;  2B5N A;  2B5M A;  5TDH B;  3PXS D;  1XIP A;  5EMJ B;  5CXB A;  3JZH A;  3GRE A;  2I0R A;  3JPX A;  4YVD A;  4Z8L A;  2G99 A;  4K3J B;  3SMR A;  1JMZ B;  3IKO A;  1JMX B;  4U7A A;  4CI8 A;  3I7N A;  4L3H D;  3P4F A;  2J56 H;  3AL8 B;  4KFM B;  3L4O D;  2J55 H;  5KDO B;  3UVK A;  1TYQ C;  5FKQ A;  3W15 A;  2XU7 A;  5I5I A;  2I0S A;  4UI9 R;  4JSV C;  4CI2 A;  3CFS B;  3E0C A;  1OLZ A;  2PM7 B;  5JWZ A;  2B4E A;  2H9M A;  5AMS A;  3UVL A;  3N0D A;  1JJU B;  2CNX A;  2AH1 A;  4G56 B;  4ES0 A;  4MK0 B;  1MDA H;  5FKR A;  4J86 A;  4J0X A;  1N6F A;  4A09 A;  5GSA A;  1RI6 A;  5IC7 A;  3ODT A;  5H1M A; 
#chains in the Genus database with same CATH topology
 5HE3 B;  2P9P C;  3MZL A;  3DM0 A;  3V5W B;  3UKU C;  5TF2 A;  3MMY A;  2P9I C;  2QZP A;  3PXW D;  4AN0 A;  1A12 A;  4BCB A;  4CI1 A;  4JSN C;  1U2V C;  2AGZ A;  3JRP A;  3FM0 A;  4CZY A;  3K26 A;  4GMB A;  4A0B B;  1XKS A;  3SBQ A;  5HE0 B;  3CIK B;  3IJE A;  2QR5 A;  4JD2 C;  4LGN A;  3ZDZ A;  2W18 A;  3F3F A;  3I7O A;  3IIY A;  4O3U B;  3EWE A;  1PBY B;  1VZ2 A;  2CE9 A;  3RN1 D;  4A08 B;  2VDK A;  5CYK A;  2HKR A;  2YNO A;  2Z2P A;  1GG2 B;  2VZ3 A;  4L9O A;  3OKY A;  1GOF A;  2QXV A;  5FKT A;  2IWK A;  3EI3 A;  3NVN A;  5C9Z B;  5B4W A;  4BUJ C;  3UVO A;  3O4G A;  4QRJ A;  1L0Q A;  3L4M D;  5FXY A;  5THA A;  1U4C A;  2P9U C;  4A0A A;  4CZX A;  3K72 A;  3ZDY A;  2H9L A;  4J77 A;  3FGB A;  3ZWL B;  5EAM A;  3GC3 B;  4L1Q D;  3IJC A;  2P9L C;  4E54 A;  2H9N A;  3SHF A;  3I2N A;  4CZV A;  2VZ1 A;  3MKQ A;  3NVQ A;  4BL0 A;  3U4Y A;  1FWX A;  2EIC A;  5EAR A;  4A2M A;  2H47 A;  5E6U A;  4PSW B;  4PNK B;  1GP2 B;  4NC4 A;  4JXM A;  1XHM A;  1S4U X;  2OVQ B;  1K3I A;  5AFU 3;  2OVP B;  5GMK n;  3AL8 A;  3HFQ A;  3V4P A;  4J78 A;  3SBP A;  4PXW A;  3VI3 A;  1P22 A;  5IT9 g;  1JV2 A;  4D6V A;  1UOO A;  3RN0 D;  2PM6 B;  3EMH A;  4E5Z A;  4OWR A;  5TEF A;  3V9F A;  3DSM A;  4GQ2 P;  1GOT B;  2EID A;  3JZG A;  2EBS A;  3EI4 B;  2O9K A;  2P9S C;  3IUQ A;  4BP8 A;  3IIW A;  5EM2 B;  4OZU A;  2MTA H;  2VC2 A;  3UKR C;  3A0F A;  2AQ5 A;  2I3S A;  1N6E A;  3UVM A;  3MXX A;  4GQB B;  2AGW A;  1GOH A;  2XYI A;  5IJ8 E;  1K8K C;  2H6K A;  4J8G A;  4WK4 A;  3UVN A;  4I79 A;  2BBK H;  2J57 G;  1MG2 A;  4G1E A;  1TYE A;  5FA5 B;  2YMU A;  2IAA A;  2CN2 A;  3FRX A;  3JZN A;  3DWL C;  2HYE A;  4G55 A;  3V7D B;  2H68 A;  2CE8 A;  3EQ9 A;  2UZX B;  2HU7 A;  3V4V A;  5E6S A;  1UOP A;  2HKM A;  4ZOY A;  3EI1 A;  5EAL A;  3JB9 L;  3C5M A;  5AJA A;  4NBM A;  4J79 A;  1TBG A;  2IWF A;  1A0R B;  4GZ8 A;  3T3P A;  4X63 B;  2PM9 A;  2QC5 A;  1N6D A;  3B7F A;  5HE2 B;  2EIE A;  4A0B A;  2Z2O A;  4DNV A;  4L3G D;  3RLM D;  3CFV A;  2AGY A;  3KCI A;  3PSL A;  4TZ4 A;  5C2V B;  4J8B A;  1OMW B;  2VDR A;  5HE1 B;  2VDP A;  3K27 A;  4PSX B;  3ZE0 A;  1SQ9 A;  2OK6 A;  2TRC B;  4A08 A;  1PGU A;  1BPO A;  5IJ7 E;  1ERJ A;  4D0K A;  3C9C A;  4LG8 A;  2OVR B;  4JSP C;  2H6N A;  1I2M B;  4NSX A;  4UM9 A;  4DNU A;  4QT8 A;  5HQG A;  3ZDX A;  5CXC B;  2VDL A;  5FQD A;  2HU5 A;  1H2W A;  2YNN A;  4BH6 A;  1QFM A;  2EIB A;  5I5M A;  3K6S A;  4A11 A;  4FB1 D;  2I3T A;  3C75 H;  2YNP A;  2P9N C;  4IA9 A;  1PI6 A;  5M5T A;  2IUR A;  4A09 B;  2G9A A;  4XYI A;  3EQ7 A;  2HU8 A;  4HDJ A;  2VDN A;  2XL3 A;  4ERZ A;  2OIZ A;  4CY3 A;  1PEV A;  1H2X A;  1C9L A;  5M5S A;  3FCU A;  2H3X A;  4XEI C;  3KRX B;  1VYH C;  3EU7 A;  4J84 A;  4ZN4 A;  4GGD A;  4QAM A;  1L5G A;  4J87 A;  3IUL A;  4CC9 A;  4CY1 A;  5K1C C;  3VH0 A;  3MZK A;  2XL2 A;  3I7K A;  3EI2 B;  2YBA A;  4GM8 A;  5C92 A;  3SVW D;  3MVD K;  4ESG A;  3EI3 B;  3IJ0 A;  4A7J A;  1SQJ A;  5M5U A;  3BWS A;  3OL2 B;  3PVU B;  3AH8 B;  5SXM A;  5IGQ A;  4O02 A;  1VE6 A;  3SJL D;  4FA5 D;  2AH0 A;  4WK2 A;  3IUM A;  5M61 A;  3SLE D;  2GC7 A;  3GFC A;  4MMZ A;  3SFZ A;  3DXM C;  4J0W A;  2Z2N A;  3I8E A;  4JHP C;  4O2W A;  3VA6 A;  1Q47 A;  5EMM B;  4U1E I;  2Q7Q A;  1QNI A;  4J81 A;  5H14 A;  3AL9 A;  3IUJ A;  3MKS B;  2I0T A;  3DXK C;  5HYN B;  3ZE2 A;  2HES X;  4CY2 A;  3IUN A;  3PSC B;  4XYH A;  3RMZ D;  3EQ8 A;  4QQE A;  3ORV D;  1GOG A;  3EG6 A;  4MMY A;  4FA9 D;  5FLX g;  1MG3 A;  3NIF A;  4ERY A;  1VZ3 A;  1SHY B;  4QL1 A;  5GXI A;  1E5T A;  4GM3 A;  4O3T B;  4ZOV A;  2YB8 B;  3K71 A;  3UR4 A;  5CXB B;  4RE5 A;  4E5Z B;  2H6Q A;  3VGZ A;  3KRW B;  3SBR A;  1T2X A;  5FKS A;  4BCD A;  5GXH A;  3SXT D;  1H2Z A;  2AGL A;  2HJB A;  3PE7 A;  4JT5 C;  4GM9 A;  4Y5R D;  2P9K C;  5CXC A;  4AX4 A;  4FWW A;  4J73 A;  4FHL A;  4K3I D;  3SWS D;  3J81 g;  2IUP A;  4AMZ A;  3NVX A;  4GGC A;  1NR0 A;  1M1X A;  4JSX C;  4Z7N A;  2H13 A;  4WJK A;  4AN1 A;  3RSE C;  2HJ4 A;  2OK4 A;  4AEZ A;  4JHN A;  4EWR A;  3F3P A;  5C2W B;  3MUO A;  3C99 A;  5FFG A;  3BG1 A;  1B9X A;  3O4I A;  4X3E A;  5TEE A;  2PBI B;  4ERQ A;  3I7H A;  4FAV D;  3IUR A;  5E6R A;  3IJ1 A;  4H5I A;  3DDU A;  3FCS A;  3EI1 B;  3N0E A;  1B9Y A;  4H5J A;  2WQ8 A;  2AGX A;  3RFH A;  1C9I A;  2B5L A;  2UZY B;  3OTT A;  2GNQ A;  2PM9 B;  4O9D A;  3O4H A;  3OKW A;  4JT6 C;  4AOW A;  5M5V A;  4R7A B;  1K32 A;  4CY5 A;  4CI3 A;  4GQ1 A;  1JTD B;  2BCJ B;  4WK0 A;  3SCY A;  3AFC A;  3JRO A;  4A2L A;  4O1Q D;  3RFG A;  3ULE C;  4RE6 A;  5M5R A;  4FA4 D;  5A2Q g;  2H9P A;  4IMM A;  3QI0 A;  4ZOZ A;  4X60 B;  3EI2 A;  3GD1 I;  5H17 A;  1YFQ A;  2H14 A;  5FFO A;  4O45 A;  3OL2 A;  3PVW B;  3JAM g;  2CO0 C;  4NEN A;  3PXT D;  5HDB A;  4FAN D;  4AMY A;  2GC4 A;  1O6G A;  4N14 A;  4GGA A;  1R5M A;  3I8C A;  5K19 A;  3RRM C;  2VDM A;  5CYK B;  4A11 B;  5IGO A;  3NIG A;  3OKY B;  3OKT A;  4LG9 A;  3I7P A;  2IUQ A;  1E8M A;  1O6F A;  2CO0 A;  3EI4 A;  3I89 A;  4X61 B;  2HXC A;  4PBZ A;  5EM2 A;  5I5J A;  4D9S A;  3SN6 B;  2VDO A;  1UOQ A;  2IUV A;  4PC0 A;  1JOF A;  3OW8 A;  4A0A B;  4J82 A;  1QFS A;  3I7L A;  5EML B;  4FA1 D;  1UTC A;  4ZOX A;  2VDQ A;  2BKL A;  4Y7R A;  1NEX B;  3J80 g;  4E54 B;  2OJY A;  3BG0 A;  2JKX A;  5EAP A;  5EMK B;  3IVM A;  1GXR A;  3NID A;  4BP9 A;  3F3G A;  3VI4 A;  4PBY A;  2CN3 A;  4G1M A;  2B5N A;  2B5M A;  5TDH B;  3ZE1 A;  3PXS D;  1XIP A;  1U8C A;  5EMJ B;  5CXB A;  3JZH A;  3GRE A;  2I0R A;  3JPX A;  4UM8 A;  4YVD A;  4Z8L A;  2G99 A;  4K3J B;  3SMR A;  1JMZ B;  1H2Y A;  1JMX B;  3IKO A;  1E8N A;  4U7A A;  4CI8 A;  3I7N A;  4L3H D;  3P4F A;  2J56 H;  3AL8 B;  4KFM B;  3L4O D;  2J55 H;  5KDO B;  2XDW A;  3UVK A;  1TYQ C;  1VE7 A;  5FKQ A;  3W15 A;  4BCC A;  2XU7 A;  5I5I A;  4MMX A;  2I0S A;  4UI9 R;  4JSV C;  4CI2 A;  5C86 A;  3CFS B;  3E0C A;  4DNW A;  1OLZ A;  2PM7 B;  5JWZ A;  3OF7 A;  2B4E A;  2H9M A;  5AMS A;  3O4J A;  1YR2 A;  3UVL A;  3MUN A;  3N0D A;  1JJU B;  2CNX A;  2AH1 A;  3QHY B;  4G56 B;  4L1M A;  4ES0 A;  4MK0 B;  4Z7Q A;  1MDA H;  2XZG A;  5FKR A;  4J86 A;  4J0X A;  1N6F A;  4IRZ A;  3T3M A;  2XE4 A;  4A09 A;  5GSA A;  4Z7O A;  1RI6 A;  4NAA A;  5IC7 A;  3ODT A;  5H1M A; 
#chains in the Genus database with same CATH homology
 5HE3 B;  2P9P C;  3MZL A;  3DM0 A;  3V5W B;  3UKU C;  5TF2 A;  3MMY A;  2P9I C;  3PXW D;  4CI1 A;  4JSN C;  1U2V C;  2AGZ A;  3JRP A;  3FM0 A;  4CZY A;  3K26 A;  4GMB A;  4A0B B;  1XKS A;  3SBQ A;  5HE0 B;  3CIK B;  4LGN A;  4JD2 C;  2W18 A;  3F3F A;  3I7O A;  3IIY A;  4O3U B;  3EWE A;  1PBY B;  2CE9 A;  3RN1 D;  4A08 B;  5CYK A;  2HKR A;  2YNO A;  2Z2P A;  1GG2 B;  4L9O A;  3OKY A;  2QXV A;  5FKT A;  2IWK A;  3EI3 A;  3NVN A;  5C9Z B;  5B4W A;  4BUJ C;  3UVO A;  4QRJ A;  1L0Q A;  3L4M D;  5FXY A;  5THA A;  1U4C A;  2P9U C;  4A0A A;  4CZX A;  2H9L A;  4J77 A;  3FGB A;  3ZWL B;  5EAM A;  4L1Q D;  3IJC A;  2P9L C;  4E54 A;  2H9N A;  3SHF A;  3I2N A;  4CZV A;  3MKQ A;  3NVQ A;  4BL0 A;  3U4Y A;  1FWX A;  5EAR A;  4A2M A;  2H47 A;  4PSW B;  4PNK B;  1GP2 B;  4JXM A;  1XHM A;  1S4U X;  2OVQ B;  5AFU 3;  2OVP B;  5GMK n;  3AL8 A;  3HFQ A;  4J78 A;  3SBP A;  4PXW A;  1P22 A;  5IT9 g;  4D6V A;  3RN0 D;  2PM6 B;  3EMH A;  4E5Z A;  4OWR A;  5TEF A;  3V9F A;  3DSM A;  4GQ2 P;  1GOT B;  3JZG A;  2EBS A;  3EI4 B;  2O9K A;  2P9S C;  5EM2 B;  3IIW A;  4OZU A;  2MTA H;  3UKR C;  3A0F A;  2AQ5 A;  2I3S A;  1N6E A;  3UVM A;  3MXX A;  4GQB B;  2AGW A;  2XYI A;  5IJ8 E;  1K8K C;  2H6K A;  4J8G A;  3UVN A;  4I79 A;  2BBK H;  2J57 G;  1MG2 A;  5FA5 B;  2YMU A;  2IAA A;  2CN2 A;  3FRX A;  3JZN A;  3DWL C;  2HYE A;  3V7D B;  2H68 A;  2CE8 A;  2UZX B;  4ZOY A;  2HKM A;  3EI1 A;  5EAL A;  3JB9 L;  3C5M A;  5AJA A;  4J79 A;  1TBG A;  2IWF A;  1A0R B;  4GZ8 A;  4X63 B;  2PM9 A;  2QC5 A;  1N6D A;  3B7F A;  5HE2 B;  4A0B A;  2Z2O A;  4L3G D;  3RLM D;  3CFV A;  2AGY A;  3PSL A;  4TZ4 A;  5C2V B;  4J8B A;  1OMW B;  5HE1 B;  3K27 A;  4PSX B;  1SQ9 A;  2OK6 A;  2TRC B;  4A08 A;  1PGU A;  5IJ7 E;  1ERJ A;  4D0K A;  3C9C A;  4LG8 A;  2OVR B;  4JSP C;  2H6N A;  4NSX A;  4QT8 A;  5HQG A;  5CXC B;  5FQD A;  2YNN A;  4BH6 A;  5I5M A;  4A11 A;  4FB1 D;  2I3T A;  3C75 H;  2YNP A;  2P9N C;  4IA9 A;  1PI6 A;  2IUR A;  4A09 B;  2G9A A;  4XYI A;  4HDJ A;  2XL3 A;  4ERZ A;  2OIZ A;  4CY3 A;  1PEV A;  2H3X A;  4XEI C;  3KRX B;  1VYH C;  3EU7 A;  4J84 A;  4ZN4 A;  4GGD A;  4J87 A;  4CC9 A;  4CY1 A;  5K1C C;  3VH0 A;  3MZK A;  2XL2 A;  3I7K A;  3EI2 B;  2YBA A;  4GM8 A;  3SVW D;  4ESG A;  3EI3 B;  3IJ0 A;  4A7J A;  1SQJ A;  3BWS A;  3PVU B;  3OL2 B;  3AH8 B;  5SXM A;  5IGQ A;  3SJL D;  4FA5 D;  2AH0 A;  3SLE D;  2GC7 A;  3GFC A;  3SFZ A;  3DXM C;  4J0W A;  2Z2N A;  3I8E A;  3VA6 A;  1Q47 A;  5EMM B;  4U1E I;  2Q7Q A;  1QNI A;  4J81 A;  5H14 A;  3AL9 A;  3MKS B;  2I0T A;  3DXK C;  5HYN B;  2HES X;  4CY2 A;  3PSC B;  4XYH A;  3RMZ D;  4QQE A;  3ORV D;  3EG6 A;  4FA9 D;  5FLX g;  1MG3 A;  4ERY A;  1SHY B;  4QL1 A;  5GXI A;  4GM3 A;  4O3T B;  4ZOV A;  2YB8 B;  3UR4 A;  5CXB B;  4E5Z B;  2H6Q A;  3VGZ A;  3KRW B;  3SBR A;  5FKS A;  5GXH A;  3SXT D;  2AGL A;  2HJB A;  3PE7 A;  4JT5 C;  4GM9 A;  4Y5R D;  2P9K C;  5CXC A;  4FWW A;  4J73 A;  4FHL A;  4K3I D;  3SWS D;  3J81 g;  2IUP A;  3NVX A;  4GGC A;  1NR0 A;  4JSX C;  2H13 A;  3RSE C;  2HJ4 A;  2OK4 A;  4AEZ A;  4EWR A;  3F3P A;  5C2W B;  3C99 A;  3BG1 A;  1B9X A;  4X3E A;  5TEE A;  2PBI B;  4ERQ A;  3I7H A;  4FAV D;  3IJ1 A;  4H5I A;  3EI1 B;  3N0E A;  1B9Y A;  4H5J A;  2AGX A;  3RFH A;  2B5L A;  2UZY B;  3OTT A;  2GNQ A;  2PM9 B;  4O9D A;  3OKW A;  4JT6 C;  4AOW A;  4R7A B;  1K32 A;  4CY5 A;  4CI3 A;  4GQ1 A;  2BCJ B;  3SCY A;  3AFC A;  3JRO A;  4A2L A;  4O1Q D;  3RFG A;  3ULE C;  4FA4 D;  5A2Q g;  2H9P A;  4IMM A;  4ZOZ A;  4X60 B;  3EI2 A;  5H17 A;  1YFQ A;  2H14 A;  4O45 A;  3OL2 A;  3PVW B;  3JAM g;  2CO0 C;  3PXT D;  4FAN D;  2GC4 A;  4N14 A;  4GGA A;  1R5M A;  3I8C A;  5K19 A;  3RRM C;  5CYK B;  4A11 B;  5IGO A;  3OKY B;  4LG9 A;  3OKT A;  3I7P A;  2IUQ A;  4X61 B;  2CO0 A;  3EI4 A;  3I89 A;  2HXC A;  4PBZ A;  5EM2 A;  5I5J A;  3SN6 B;  2IUV A;  4PC0 A;  1JOF A;  3OW8 A;  4A0A B;  4J82 A;  3I7L A;  5EML B;  4FA1 D;  4ZOX A;  4Y7R A;  1NEX B;  3J80 g;  4E54 B;  2OJY A;  3BG0 A;  5EAP A;  5EMK B;  1GXR A;  3F3G A;  4PBY A;  2CN3 A;  2B5N A;  2B5M A;  5TDH B;  3PXS D;  1XIP A;  5EMJ B;  5CXB A;  3JZH A;  3GRE A;  2I0R A;  3JPX A;  4YVD A;  4Z8L A;  2G99 A;  4K3J B;  3SMR A;  1JMZ B;  3IKO A;  1JMX B;  4U7A A;  4CI8 A;  3I7N A;  4L3H D;  3P4F A;  2J56 H;  3AL8 B;  4KFM B;  3L4O D;  2J55 H;  5KDO B;  3UVK A;  1TYQ C;  5FKQ A;  3W15 A;  2XU7 A;  5I5I A;  2I0S A;  4UI9 R;  4JSV C;  4CI2 A;  3CFS B;  3E0C A;  1OLZ A;  2PM7 B;  5JWZ A;  2B4E A;  2H9M A;  5AMS A;  3UVL A;  3N0D A;  1JJU B;  2CNX A;  2AH1 A;  4G56 B;  4ES0 A;  4MK0 B;  1MDA H;  5FKR A;  4J86 A;  4J0X A;  1N6F A;  4A09 A;  5GSA A;  1RI6 A;  5IC7 A;  3ODT A;  5H1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...