4L1UA

Crystal structure of human rtf1 plus3 domain in complex with spt5 ctr phosphopeptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
ITHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-associated protein RTF1 homolog
publication title Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/peptide
total genus 38
structure length 130
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03126 Plus-3 Plus-3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.30 Mainly Beta Beta Complex paz domain paz domain 4l1uA00
4L1PA 3U1UA 2BZEA 4L1UA 2DB9A
chains in the Genus database with same CATH superfamily
3O3IX 4Z4FA 2L5CA 3QIRA 4W5RA 1SI2A 4KREA 3DLBA 1Z26A 2QVWA 2L5DA 4NHAA 1VYNA 3DA5A 3O7VX 4NGDA 2DB9A 3HM9A 3DLHA 4Z4CA 3U1UA 4Z4GA 4NGFA 4NH3A 3HJFA 2BZEA 2XFMA 4NH5A 4W5TA 5KI6A 4W5QA 3MJ0A 4NGGA 1SI3A 3HK2A 3F73A 1R6ZA 1R4KA 5JS1A 4KRFA 3O6EX 4F3TA 4Z4IA 4L1UA 3HVRA 2FFLA 3HO1A 5T7BA 1T2SA 4L1PA 4OLAA 4NGCA 1Z25A 4OLBA 4NH6A 1U04A 4Z4HA 4NGBA 1T2RA 3O7XA 5JS2A 4W5NA 4Z4EA 4W5OA
chains in the Genus database with same CATH topology
3O3IX 4Z4FA 2L5CA 3QIRA 4W5RA 1SI2A 4KREA 3DLBA 1Z26A 2QVWA 2L5DA 4NHAA 1VYNA 3DA5A 3O7VX 4NGDA 2DB9A 3HM9A 3DLHA 4Z4CA 3U1UA 4Z4GA 4NGFA 4NH3A 3HJFA 2BZEA 2XFMA 4NH5A 4W5TA 5KI6A 4W5QA 3MJ0A 4NGGA 1SI3A 3HK2A 3F73A 1R6ZA 1R4KA 5JS1A 4KRFA 3O6EX 4F3TA 4Z4IA 4L1UA 3HVRA 2FFLA 3HO1A 5T7BA 1T2SA 4L1PA 4OLAA 4NGCA 1Z25A 4OLBA 4NH6A 1U04A 4Z4HA 4NGBA 1T2RA 3O7XA 5JS2A 4W5NA 4Z4EA 4W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1P A;  3U1U A;  2BZE A;  4L1U A;  2DB9 A; 
#chains in the Genus database with same CATH topology
 3O3I X;  4Z4F A;  2L5C A;  3QIR A;  4W5R A;  1SI2 A;  4KRE A;  3DLB A;  1Z26 A;  2QVW A;  2L5D A;  4NHA A;  1VYN A;  3DA5 A;  3O7V X;  4NGD A;  2DB9 A;  3HM9 A;  3DLH A;  4Z4C A;  3U1U A;  4Z4G A;  4NGF A;  4NH3 A;  3HJF A;  2BZE A;  2XFM A;  4NH5 A;  4W5T A;  5KI6 A;  4W5Q A;  3MJ0 A;  4NGG A;  1SI3 A;  3HK2 A;  3F73 A;  1R6Z A;  1R4K A;  5JS1 A;  4KRF A;  3O6E X;  4F3T A;  4Z4I A;  4L1U A;  3HVR A;  2FFL A;  3HO1 A;  5T7B A;  1T2S A;  4L1P A;  4OLA A;  4NGC A;  1Z25 A;  4OLB A;  4NH6 A;  1U04 A;  4Z4H A;  4NGB A;  1T2R A;  3O7X A;  5JS2 A;  4W5N A;  4Z4E A;  4W5O A; 
#chains in the Genus database with same CATH homology
 3O3I X;  4Z4F A;  2L5C A;  3QIR A;  4W5R A;  1SI2 A;  4KRE A;  3DLB A;  1Z26 A;  2QVW A;  2L5D A;  4NHA A;  1VYN A;  3DA5 A;  3O7V X;  4NGD A;  2DB9 A;  3HM9 A;  3DLH A;  4Z4C A;  3U1U A;  4Z4G A;  4NGF A;  4NH3 A;  3HJF A;  2BZE A;  2XFM A;  4NH5 A;  4W5T A;  5KI6 A;  4W5Q A;  3MJ0 A;  4NGG A;  1SI3 A;  3HK2 A;  3F73 A;  1R6Z A;  1R4K A;  5JS1 A;  4KRF A;  3O6E X;  4F3T A;  4Z4I A;  4L1U A;  3HVR A;  2FFL A;  3HO1 A;  5T7B A;  1T2S A;  4L1P A;  4OLA A;  4NGC A;  1Z25 A;  4OLB A;  4NH6 A;  1U04 A;  4Z4H A;  4NGB A;  1T2R A;  3O7X A;  5JS2 A;  4W5N A;  4Z4E A;  4W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...