4L3ED

The complex between high affinity tcr dmf5(alpha-d26y,beta-l98w) and human class i mhc hla-a2 with the bound mart-1(26-35)(a27l) peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
199
structure length
199
Chain Sequence
b'KEVEQNSGPLSVPEGAIASLNCTYSYRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Computational design of the affinity and specificity of a therapeutic T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eD02
1NSNH 3D0VA 1RAMA 2P5WA 2G5RA 4FFYL 1OLLA 5SV3A 4O9HH 4ZFGH 4K8RC 1E4JA 4G5ZL 2D7QA 1WICA 4ZNCD 5CKGA 4BQCA 3QIUD 4HZAA 1BD2B 2NY2D 4LHUB 2P24B 2IFFH 3HG1E 4RRPA 1ITBB 4HLJA 1FNGA 1XZ0B 3U9PL 1U8IA 1DQJA 1VGKB 2OJEA 4XBGB 3BGFB 2H26A 3QXVA 4ONFH 1AH1A 3P73B 2C1PA 5GS3A 2R0LH 1J1OL 4Y5XC 3IXAA 2Q3ZA 4KJQD 4EI5D 2HG5A 4NP4L 2VO5A 4PJ5E 2MKLC 1MFDL 1FN4A 3QDMB 1A6VL 4FP8H 1NGXB 5DJZB 5FUCE 3ZKMD 5T5FH 4KK6D 5EOCL 4OQTH 3D3VB 3G6JF 2J6EA 4HPYL 1QA9A 5TE6H 3FZUD 4P2RB 5KS9E 3BWUC 3CFJB 2B5IB 2EYRA 3U2SA 2VLLA 1OP3K 2Y7QB 1P4IH 4XCFL 1R5VA 1J8HD 3GJFH 4YHLL 3VXUD 1RV6X 2DJ4A 1RZ7L 4HJ0C 1A3LH 3RWHB 4M5YH 4E0RA 2VL5A 4R4FH 4LDOB 3L3OB 3E3QC 4AT6A 1RZKH 4EUPG 4G9FB 1X3DA 2MCPL 4I5BB 1QSEE 4JKMA 2OP4L 1U8NB 1RULH 4Y4KD 1FLRL 5E9DA 5EUKA 4FABH 5HDQH 2PO6B 3MUZ1 3MUHL 1J1PL 4CVXA 1MREH 1X5KA 5BVJA 2HTLC 5C07E 3C60B 3VXRB 2BMKA 1N7ML 1UVQB 2R56H 1E27A 5IW3A 4PJAF 5GS0D 3VFWB 2PYEB 3BQUD 4UIKL 4GAJL 4OI7A 5HVFB 2EE2A 1FYTD 2B4CH 3QG7H 4YXKL 3JZ7A 5EO0A 4ZFFB 3QUML 3WFHB 1WWCA 3BIAX 1IEBB 2ZUTA 2FJGA 5I30L 3O3BB 3MRIA 5HGAA 1XF2B 1MRFL 3BWAA 3SCMD 1G1CA 1G7HA 4ZSOB 4L3ED 2P43B 1Q1JH 2MQCA 1A6ZA 4ODXB 1MVUB 1JRHI 2KQMA 4XPTH 43C9A 4ELMB 3RPIB 4PJDF 4I1NB 3KR3H 2C1OA 2WWKT 1MCWM 3VFUB 5HVHB 3QHTC 3OKEA 3ARBD 4LVNC 3HZKB 4D0DB 1LO5B 2BNUA 2ERJC 5EBLA 5HHXL 5L2KE 1H5BA 3RWJB 2UY7A 4OCMC 3DI3B 3H0TB 2VXQH 4KAQL 2E7BA 4F80A 3WLWC 4LLUA 4WVRA 1I9IL 1I7TB 1U8JA 4L29A 4NC0B 4XXDA 2E7CA 3BKCL 5LGKA 3BESR 1S7UA 5E8EB 4QO1A 3QJHA 4I77H 5KVGL 5JHDA 3LQAC 2GCYB 5HYQA 4HH8A 4R0LC 3WSQH 1IQWL 5CUSH 5LAXA 1AXTH 1E4XH 2IH3B 1A4KA 4KZDL 5HHME 2VISB 3VFGL 4RAVB 4EUPH 2JB6B 3BJ91 2VWEC 1BIIA 4Y16B 3N50A 2P48B 4KKBC 1JWUA 4Z6AT 4LHJB 3BP6A 1ZMYA 3A67H 1B9ZA 3EZJB 3SE9L 4ODVH 3SOBH 4C83B 1AR2A 5TE7L 1ZLVH 4HUWA 5E08L 5I16B 3RAJL 5F96H 3BKML 5JW4Q 1I3UA 2BDNH 3BPNB 4WI5A 2DQGH 1AGFB 4I18C 3L3IB 4UV4L 3GK8L 1C08A 4LEOB 5CCKL 1CXHA 2Q7YA 2Z31D 1T1WA 4NRZA 3G6AB 1DP0A 3EO0B 1MI5B 2R29L 3W5NA 1LE9B 5F3BB 4XRCA 1NQBA 3MODH 4NSKB 2VITB 5JDSB 4X80L 2DB8A 1R24B 2AJVH 4M48H 1BM3H 3WJJC 1DLHA 1TENA 1LP9A 4OCYH 4PLJD 3QDJB 2PUQT 2VE6B 4L4JA 5BZDB 3P0YL 5L7XH 1E6OH 2Z93A 1U93B 3MBXL 4JM2F 2ADJB 4J3UA 3SGEI 3LZFL 2Z92A 7FABL 1FG9C 1R3LA 4IIQA 3VI3F 5DRWB 2NR6C 4MA1C 1FAIH 4ODWB 5ISZE 3VJ6B 2J6EL 5K9JL 5LQBL 2FWOA 2N7AA 1K5NB 5FKPA 5HI3C 1FJ1A 2EYSB 5IMMA 3UTSD 1EIBA 4FQ1L 3LRHA 1RU9L 5J7CC 5EWIL 5FO8B 2GSGA 1UYWL 1V7NH 1HHJB 1GC1C 3S5LB 3AMLA 4HLZG 4LNRB 4LU5L 4G80B 3KLAB 3G5YA 3SDAD 2EKSB 3OB0K 2LABA 2UZXB 3CVHB 5A2KH 4XWOD 3CMGA 2J4WL 4FQXD 1EDQA 5HD8C 2OBGA 1LQSR 4KPHL 3GMPB 4OSUL 5CSZB 3ZL4H 4JFHD 2FIRT 3B5TA 1TIUA 1EEYB 1TZIA 1WZKA 4I3SL 1QSVA 1U8MB 4BKLB 5GZOC 4G8EB 3O2DA 3BE1H 4OFDA 2O5XL 3TESA 4UT7L 1EEZB 1KTDA 2AJUH 3UYRH 3TNMA 2Z8WC 3SE3C 4JO1H 5CFHA 3HS0A 2AXGB 1DBML 2JIXD 2DQEH 3FFDB 3MOAL 4KVCL 2DQFB 3BDXA 2XA3A 3BP7B 3WO3B 4HJJH 2VDRL 2ZCKL 1A8JH 1JE6A 3HNVL 3VCLA 3PQYE 2CDGB 1WQVT 4HBCL 4MNQD 3U6RB 3UJJH 5HYSA 1CDGA 3C6SA 1J18A 1CTNA 1JF5A 1RIVL 5C0CE 2FR4B 3G6JE 3DUSB 2EXYC 2XWBA 4GOSA 2X09A 3ALWA 1L6ZA 4H25A 2QQNL 3L3JB 2OK0H 4HUXB 4XCNB 1OGAB 4YHYB 3G5VA 2UVEA 3DYMA 3QPXH 4TSCH 3RFZC 2B8OT 3U1SL 3C5SA 3UJIL 1C5DB 3T3MF 3BZEA 2YRPA 4PJ7A 35C8H 4G9DB 1JN6A 2NTFB 2MQ3A 5ACZB 3H9SB 5J0BA 3LKQB 4KU1A 1CGSH 2E8YA 5D9SB 5EUOB 4K94H 3TM6A 4N8VA 3SDCC 3ULUF 3BVNA 3AS3A 4NYLB 1C12B 3UBXB 3GJEB 1LO3H 4LPXA 5D1ZB 5BXFB 1YZZA 2V9QA 4GRLA 3QUXB 3VFNA 4ELMF 1ONQA 4J1UB 4PJAE 1OM3L 4JFEE 5HYFA 5ICZB 3ARDC 4UI2A 2NY3D 2VR9A 4X5XA 1N3NB 4BQ8A 3I2CH 5T1DL 1IAOA 5BO1H 4ZTOH 1BF8A 2BC4A 3C8HA 4JPIB 4C56B 3O6ML 4OZIF 3HUJE 2B7DT 2DD8H 2CO6B 4OCSH 2A6DB 5I1EH 1QPPA 3ARPA 3O6KL 1SVZA 5FF6B 4YK4C 5AAMA 4HGMA 4XNQA 1CE1L 3CSYB 4C4KT 1ORQB 4QHKI 5B4MC 3V4VH 3KPTA 2YRLA 1RZ8B 3O6LH 3MBED 4MXWH 2ZOLA 5F44A 1K8DB 1H15A 1XCTB 3KPRA 2X10A 3KPSE 4UU9A 5TQ0H 5CJOH 4PJDE 3MSPA 4GXVH 1UM5H 4M7KL 1LO4L 4ELKB 3AS2A 3TC9A 4N8CH 3GSNB 1XAUA 3MGOA 4WI9A 3RVWC 3ZSSA 1RUPL 4YHOL 5D7JB 1QLRB 1S7RA 5INCA 3MRKB 3GMLB 2CK2A 4XC3H 1DBJH 3DXAD 1RZIA 1A6TA 4L8CB 43CAB 3Q3GB 3MRDB 3I50H 4ONHA 5EO1B 4ODUA 1NDGB 1IGTB 2CMRL 3FB8A 4LDEB 3U46A 1RD6A 3QULB 4YE4L 1I8KA 2R9HD 1NEZG 1BQLL 1XGQB 3D25A 4OTXH 4WEUD 1MCWW 2P5EE 5FYKL 3GBLA 1HXMB 3TJHC 5L0QC 4WRLA 1INEH 2C7UA 2ZOKB 2CUMA 3HI6H 5IQ7L 1IRAY 4QOKA 4HDIA 6FABL 4LLMA 5JXAL 1QFUH 4IHOB 1EFQA 5ANMA 3T2PA 2R4SH 5HPMA 2AEQH 5IUSA 3LN4B 3O2VL 2O61B 5FIEA 3TO2B 3QZWG 5HXMA 1FZOB 1U58B 1I8MB 1P4LB 3OPZL 5F9AC 3KXFE 1MFBL 1FGVH 4LP4A 4DVBB 3P30H 4DKFL 4G3YH 5IVXB 4E41E 3IB4A 3AU1A 4MA7H 3PUCA 2B1HH 4OV5A 3C5ZB 5I9QB 3O2DL 3T0WA 4EUPB 3WUWG 3JTTB 4ZPVB 5TE4H 2EYTA 1JI2A 5C8JA 2Q8BH 3LEVH 4PJHB 2AABL 1QYGL 2VAJA 2F5BH 3LKOA 3QNYA 3QWQB 5D93B 2E6PA 2ZNWA 4PY7B 1WBXB 5HDBF 5SWZA 5C0FB 2NY4B 2Y1VA 2OMNA 4AEIH 3O4LE 2BNQD 5ESVB 4MHHI 3TZVD 1NPUA 2DQJH 3IDXH 1IGML 1MLBB 4PTTB 3QIUA 1B6UA 1MFCH 3G04B 5DEGA 5E95B 1QSFD 3L5WB 3NZ8B 3VI3E 2Y06L 1B0GA 1Z9LA 1H5BC 3HI5L 2CDFA 4UZGA 1CCZA 4U1GC 3T0XA 2AERT 1UEMA 4OGYL 1CTOA 4OCNC 3TBWA 2WNGA 3RKPA 4PB9L 4D3CL 1YYMH 5I1AB 4M03A 1FCCA 2D3VA 2FHCA 2O5YL 1GOHA 5HGBB 3UPAA 5JMRA 3QQNA 4PG9A 1WAAA 4OKVB 1MHPL 3SKOB 2HA1A 5EZOL 3V6ZB 4TULL 1BZ7A 4X4XA 1HEZB 2XZAL 1F4WL 4E42A 1AGDB 1A0QL 3IKCA 3HPJA 1TVBB 2Y07L 1D5MA 4M93C 3U9UA 2R2EB 3PG2A 3VXUA 5FOBB 1M05A 2B2XL 2A2QT 2CRIA 2XXMB 4UDTB 3D3VE 2YPLE 5DC0A 3REVB 1BREA 4P2RE 1MCCA 1R6VA 1SM3H 3G5ZB 3MRCB 5FCUL 4TRPH 4F7EB 3JWOL 5IMKA 2X5PA 4PUBH 3KYKL 5JXED 3BSZH 5BV7L 4M6NH 4JFDD 1ERNA 4TTDD 4D9QE 1HINL 4QHLA 2K3TA 3HMWH 4Y4KA 2CIIB 2X4RA 1GOFA 1S7XA 5CEZE 4U6TA 3GSVA 4FQCL 4M9PA 4UAOC 4PGCB 3UMTA 4OBSA 3C6LB 1U6AL 3I84A 2A6IA 3GMMA 4WEBL 2WANA 3RL1A 5DJCA 1G7PA 1UA6L 5KSBA 2XG5A 2XWTA 1Q9KB 3EO1B 3IF1A 3SDYL 4BQ6A 2HT4C 3ARYA 4RFEA 3BQUA 1HHHA 5D1XD 3MACL 3WHXA 4KH2A 4UINH 3TIDA 5EUOF 2CQVA 1FYTA 4OLVH 1K3IA 4FG6C 1GZPA 4JFFD 1IL1A 1GGCH 1TVHB 4L9LB 4RWYH 3RVUC 3BKJL 3L5IA 2W65A 4LGRB 1AHWA 2VIRA 1SJXA 1OCWL 2PYEE 3ES6B 4IRZH 1C5CL 2GT9A 5E99L 3SCMA 4NQTA 4L3EA 1UKQA 3GI9H 5D8JL 3MA9L 1FH5L 5IBUG 1AD0A 3OKYA 4XH2B 5B3JF 1U8HB 2YOCA 3T2NL 4Z7UB 1A21A 3HMXA 1GYAA 4U33A 4AIZA 1YECH 3ULUE 4YX2L 2CUIA 3ARBA 5BCAA 1LK2A 3EJJX 4ZSOE 4YR6B 5H35A 5CJ8A 1E4KA 5IROA 5FYLL 4J7RA 3NABH 4ELME 1G7JA 1MHEA 3AREB 5I8EA 3LY6A 1EK3A 1WEJH 4H26A 3HNTH 1KC5L 3U4BL 4RDQG 3BAEH 4ERSH 1BD2D 4HC1A 4ETQB 4LLVA 5HI4D 3OKKB 4OZIE 4MDJA 2D9CA 5HSFA 5I1GH 4PJ5A 4P9HC 5B39A 1X6NA 1I7UA 4L4VB 1INQA 1T66C 3RU8L 1KCRH 5ECJE 3RHWK 3MLRH 1NKOA 1NMCB 3ILPB 1NFKA 1PZ5A 5MHSD 1DUZA 15C8L 4DN4L 1QQDB 3O3AB 2P46B 3CK0L 5JORA 4WDIB 3QDMD 1X5YA 1FIEA 3W39A 1KTLA 2WP3T 1ES0A 5EFIB 3JTSA 5DJ6B 2QR0B 2FB4H 2XA8L 3HRZA 4N0UA 3CCHA 4RAUB 4D8PB 5CJXC 1MHHA 1JHTA 3EOAB 3FMGL 4DQOL 3IJHB 2V9TA 1UH3A 2E9JA 2IGFL 2OTWB 5KTEH 1KULA 2Z31A 2DWEA 2XOTA 4BZ2H 2X2YA 5EU4A 2RGSA 4G9FD 1T5WA 4S2SB 4M9OA 1FL3A 2Y25A 3HI1A 1R3HA 3PWPD 4ZXBB 3SDDD 5TF0A 1X4ZA 1DBAL 5IVXF 4KRPD 1FFPB 2AJZA 3A6BL 5F93C 5AZEH 3D18B 5GXBB 4HKJB 4HGWA 1MI5E 4XX1G 1QR1B 3C60D 3QHFL 4JFOA 3PIQA 3VXRD 1AC6A 5DFTA 2QADC 1LE5B 4CADB 5JZ7D 4PRDB 1YPZB 5C09E 3UTTE 5T3ZL 1Q94A 2DYPA 1SEBB 4LLQA 2NLJB 4GRLC 3KLHC 1OHQA 3KPMA 5JR1L 3MRBB 4YPGB 4LCUA 4R7NB 5TPWH 5J13C 2BOCA 4N5UA 3UTSA 5KSVA 4KDTA 2BVOA 4P5TB 1XF3A 2Q1EA 1SBSL 4KVNL 5HHVL 4PJBB 2SEBB 4UB0L 4RGOL 1U95A 2OL3B 3SDAA 3WN5C 3NH7L 4PS4H 4LNVA 4QHMB 4XP6L 2BFVH 4Z5RA 3VRJA 1CXLA 4FQXA 3QAZB 5HDBE 3GNMH 1MNUL 3MFFA 2CD0A 5DLMH 1CDIA 3QUKA 5CHNB 2UWEB 4FQQA 1AGCB 4G6AD 4QKXB 2VN4A 2BSTA 3TA3A 4ZO6A 5C0GB 4XCYA 3F7QA 4KKLC 4PRHD 4UIMB 4GMSL 4N5EC 5GS0L 2B0SL 1UM6L 1EH9A 3MROB 1FG2B 5GGQL 4W6XB 2JIXA 2XZQH 4G42A 4U1LB 4UBDD 1WTGT 4QYOB 5DJ2A 1S9XB 2YD9A 2IMMA 1BFVL 1NCCL 2VDML 4DW2L 2D4FA 2C9AA 5M95B 5CD3A 1UJTA 5ABDE 4Z8FH 3KYAA 1CFQA 1FFNA 2AQ2A 4Y16D 4FFZL 5CEYA 5DD0L 1WFUA 4LSVH 5GJTL 2V5MA 1T1YB 4XVUC 1UJ3B 2Q86B 3DGCR 2A9MH 2HYMA 4P3DA 5IW6B 4P99A 2HFGL 3CPLB 3S6CA 1N5YL 4URTB 5F1KC 4FFWD 3UEZA 5GS1A 4J12A 4KROB 4Z78A 3LQZA 2DM2A 2A0LD 1FNEB 5GRUH 4TSAH 5FM8A 1MCKA 3VXSB 4ZD3L 4Y2DD 2APTA 1GGYA 1R5IB 1NEZB 2NY0C 4KY1L 3ARGD 5J1AB 2NXYB 3VD3A 1SJVA 5DDHB 3TYFB 2WLYA 1NAKH 3VRIB 5LKNA 1ZS8B 3QR2A 3MJ7B 5FECA 5DD5L 5ERWA 1F4XH 3ELAT 3VWKB 3WD5H 4KQ3H 1BVKB 4PRBB 4F8QA 2GAZA 4XI5C 3VXQB 2H32A 4WU5B 4YEFA 3CLEL 3TYGL 2ATPB 3QDJD 5HHPB 3EGSB 1J0IA 2QHRL 1A2YA 2GFBB 3PXJA 1TTUA 5JOPD 1JK8B 3H9SE 3IAPA 5IJVA 2VDOL 2EC9U 5E2UH 3BXNA 4OLXL 3OAYH 5EUOE 1ED3A 3QZWB 1BF2A 2APVA 1OWRM 3V4PL 5IEHB 4FFYH 1P2CA 2UZYB 5A16A 1KLUA 3TBTB 3SGKC 4DCQA 2NY2C 1S7SB 4FQLL 2LAAA 4ZUSB 4POUB 4R26H 3S97C 3U9PH 1CFTB 3WNPA 4BSWA 1QRNE 3RIAF 4ZO7A 5HYJE 3CFKA 3NA9L 4JJ5A 1B0WA 3SEPA 4C56E 3BW9A 1MJJB 4MD4A 3B5HA 4O5LL 4XAKD 2J88H 1J1OH 5TH2A 1CIUA 2O5ZL 3DVNA 3V0WL 1AD9B 4KJQC 4EI5C 1PEZA 2A6JA 4MNHA 1VACA 2EDRA 3X11A 3DLQR 1GVIA 1QBLL 3IETB 3KYNB 1BOYA 1YMHB 2BRRH 3KHOA 3DXAA 3ZKMC 5EOCH 2HWZL 4KK6C 5D6CA 5J6HB 3F7YB 5EC1A 3MO1A 5D5MF 2YN3A 3DX8B 3MRQB 4HPYH 4PRAA 3EHBD 5TFSL 3RWFA 1X44A 3FZUC 3L6FB 3VH8G 2JTDA 3IXTA 1HI6A 4ZDHA 4OM0L 5L88L 1CQKA 4AEHH 4YHLH 3MRLA 3FONA 5KSAC 5DD6A 2PXYB 1C5BL 4U3XA 2IH1B 4APQB 1JPGB 1ZGLB 4D0CA 4FA8A 1KLFA 5C0CA 2GITB 2MCPH 1Z9OA 4HWBA 5F70A 2HFEB 1X6LA 3QDHA 1S9WA 2OP4H 3VXTA 1NGWB 4XMKL 5HVWA 2I24N 1QVOB 4Y4KC 1FLRH 1EVTC 2CUHA 4I4WA 4MNGB 1A7NH 4UMGA 3V5HA 5KN5B 5DR5H 3EYSL 3MUJA 4NQVA 4P57A 2I26N 3V9FA 1QNZL 3MV8B 3RNKA 3GSOA 2IQ9L 1NDMB 4KHTL 5FDWB 3BQUC 4PLOB 3IU3A 2VLKE 4UIKH 1LD9A 5IF0B 5F3HA 1SY6A 1W0VA 1ZHNA 1OGAD 2AI0L 3C2AH 4OZ4B 4LVHC 1YJDC 4YHKL 3WFCL 1MQ8A 5CP7A 5FM4A 1U92B 1CFNB 2IADA 3PL6D 1HHGA 2HKFH 4WUUE 4OUUA 3PWLB 1MRFH 5LBSL 3X17A 1WITA 3SCMC 4PJ9D 1BLNA 3CD4A 4M1GH 4LSRL 1K2DB 4JRYD 5IVXE 2BVUA 3SKMB 2FGWL 3H9SD 4RGMC 1FVDA 4PJBF 3TZVA 5J9PA 5BZWA 4HUKB 3QFJE 4HIHB 2QL1A 3HUJA 2V2TB 5IHUH 4WWKB 4EEEA 3ARBC 1QSFA 5HHXH 3C09B 3HKFA 4GRWH 1FVCB 1F5WA 3BEWA 1F3JB 1KB9K 5FO9A 1DEEA 2WM0A 4EBQL 5I1JL 3DX7A 3KNBB 2UWEF 4KAQH 4GQ9L 3RA7L 1I9IH 4YHPA 5ETUA 1RIUL 1ZHKB 3O45A 4OZFG 4PRIE 3MZGB 3KPLA 4F7TA 5KVGH 5DD1L 4UT6L 1INDL 1IQDB 2NY1B 4NN7B 5IBUB 4JQIH 4JZJB 3SPVA 1F6FB 1H0DB 1N0XL 3O2WL 4LSQH 1L7TH 4LVEA 4OZGF 4PTUB 1HYSD 1BAFL 2XQBL 3FO1B 1XT5A 1M1SA 5E8NA 4CUCA 4OIIH 4OLWL 5J6GA 1J05A 3K3QA 4JG0L 5IBLD 1L4IA 1NL0L 1OP5H 4LCCB 5TE7H 5E08H 3ET9F 2P5EA 1OT2A 1YEKL 3C2SA 3KDMA 3SBWA 2NXZB 3BKMH 2DL2A 3EFFB 3LRSA 4U1HB 1NGPL 1YEJL 4KRMB 1PBYA 2EEBA 4PP2B 5JXEA 3FO9B 4FNLL 1YN6B 4JFDA 4NKIL 3DBXA 4UV4H 3GK8H 5EU3B 5IIEB 5JPMA 1VCAA 1K4DB 3E6FA 1FV1B 1HXYA 2Z31C 3GO1L 2XY2A 5TDNA 3LPGA 5E00B 2ZJSL 4IM8A 3LEXA 5EORL 2V2XA 2IG2L 4X80H 5DJ8A 4P3WA 3RWDB 2CLVB 3T65A 5ILTL 3HNSL 1S7WB 5D1XA 2RCSH 3Q6GL 4G8GE 2G2RB 1IMHC 3MNZB 2C26A 4X4ME 4RWHA 4GRMA 4YC2B 2ZUXA 3P0YH 3LN9A 4GAYA 3T4AA 1HILB 1C8PA 3PWNA 3S96B 1JHLL 1A4JB 1KEML 3MBXH 1L6XA 2M26A 3LZFH 2RB8A 5E8DL 3PNWB 1EJ6A 7FABH 1CGWA 1MLCA 3EDEA 4N1CA 4MJ6A 3WLBB 3V5KB 3D9AH 4PJFB 5DJAA 3TO4D 2FBOJ 3FRPG 3LRGA 5IB1A 2ZKHL 5JW5B 2CKBA 3S37L 4R3SA 3BRFA 4OFVA 3MJ9A 4FQ1H 2Z8VC 1NBVH 4PJ8B 3HE6B 4KDTC 1GXEA 4RQQB 1R3KB 2EDQA 4EN3B 3MRGB 3TNNB 2XN9B 4OZFH 5E5UB 2XTLA 4L8SC 3SDAC 5I74B 1O0VA 2V7NB 2GK0B 2NY4D 4HWBL 2A1WL 4XWOC 1W72B 2J4WH 4YDVB 1CS6A 3OAZK 4XP5H 4QEGA 3TBSA 2Z4QB 1JTPA 3S34L 4GXUN 4OSUH 1BD2A 2P24A 3D87B 4KTDH 1P7QD 2AV1A 4I3SH 3MLXL 1XZ0A 2ADIB 1VGKA 1C16A 4LVOC 2O5XH 1VADB 4NNXB 4UT7H 4NQDB 1IVLA 3M8OH 4MJIB 1AQDB 1A7PL 4HH9B 1B90A 3PE9A 3TIEA 1DBMH 5F7HA 3R06B 2DLTA 1SVCP 3MOAH 1BZ9B 1SY6L 2XZZA 4KVCH 4ODTL 1Q9OB 3M17B 2VDRH 1T2JA 2ZCKH 3QDMA 1I8LA 5DJZA 1NGXA 5KW9L 4M3KB 1NKRA 1WZ1H 4HBCH 2FD6L 1J0KA 4MXVF 4XHJD 2DQCL 3VI4F 3SJVE 1OTSC 4JFQB 1X5XA 4CVWA 3CFJA 3DVGB 2Y7QA 2APFA 5D5ME 1R3IL 4CVZB 1T0MB 5GSVB 2BNRD 5B21A 5HGHB 4O2CA 4HMCA 2PETA 5AWNL 4R4BB 4WY7L 5EIQA 5EC2A 1HIML 2QQNH 3MV9D 3DTXB 2FSEB 4B7LA 5C0BB 1YNTB 2UUDK 3L3OA 4R90H 3MJ6A 2F5AL 4G9FA 1YMMB 1CICD 2AJYL 1F4YL 1T04B 2YS4A 1I7RB 5GS1C 2JKXA 4YDKL 1U8NA 3SKNB 1RJYB 3UJIH 1UM4L 2ARJB 3PV6B 2IEPA 3QXUA 2PO6A 2RBLA 1NCBL 1GGIH 3RUGF 3C60A 2YZ8A 3VXRA 1RMFL 1UVQA 4QXUL 4X99B 4F7CB 4K3DL 4XTRD 3ZE1F 5BVPL 1BQSA 3GRWA 3P4OB 3E6HB 4CDHA 3OB0H 5I71C 3NIGF 4B0MM 4F2MA 3MGTB 4YDJB 2OTPA 4U0RC 4D94A 1IM9B 3QH3B 3RTQD 2NY3C 1XCQB 4ZFFA 4YHNB 4FQ2L 5T1DH 5EN2B 1JYWA 3WFHA 2P47B 1IEBA 2GQHA 1YPZE 3O3BA 5E2JA 3O6MH 2ICWB 4HD9A 1XGYL 1XF2A 5C0AB 1P9MA 12E8L 2Y5EA 32C2B 3O6KH 4ZSOA 2VTFA 1A7BA 4ODXA 4U1MB 1MVUA 3HCVA 4Y4FC 1CE1H 5D7IB 5DD3H 1RVFH 1NGQL 5CLWA 3K8KA 3MBEC 5C0JB 2FIKB 3VFUA 4XT1C 3L5XL 3DURB 4PJBE 1LO4H 2VXSH 3HZKA 1LO5A 5ID0B 1KPUB 3EUUA 2H8PB 3RWJA 4O4YL 4PRPB 2ZUSA 5TGBB 3ARED 4OD2A 3H0TA 1B6DA 4HS8L 1F97A 1FQ9C 1I7TA 2UWEE 2D0GA 4LHQB 4XP9H 1KJ3H 3CU7A 3LKSB 3MREA 3TGXA 2C3HA 3FB6A 1KCVH 5E8EA 5E2VL 2EDBA 1DL7L 3DUUB 5EU6D 3IU4L 4AM0B 2DIAA 2GCYA 3EOTH 4L4VD 4W6WB 2HT3C 3AXLA 1HKLH 3KWWB 5FYKH 2IH3A 4M5ZH 4NJ9H 3KYMB 4UILL 2VISA 1TXKA 4PBVC 4QRUB 4RAVA 1OARL 1FDLH 4OD1L 1HH6A 2CKBL 1Z5LB 4Y16A 1EZVX 2WZPD 4GRWB 2BVTA 4JRWA 5IQ7H 3MJ9L 4S1SL 2Z8SA 4HEME 1GHFL 4C83A 4R4ND 5JXAH 3S9DB 1E4XI 4DWHA 5I16A 1IGYB 2VDNL 2ZUVA 4MD5B 1I7ZA 1AXSB 4F58L 4N9GB 2XTJB 1UCTA 1AGFA 1KN4H 1QBMH 3L3IA 3MNWB 1FNHA 2X9WA 5DRNB 3WBDA 3OPZH 3ZKXB 4LEOA 4U1KB 5CBEB 4DKFH 3RY5A 4PGDA 3DIFB 5FGBC 2XG4A 1JNHB 2LV4A 3G6AA 2F8VA 3EO0A 2HMID 4PYGA 1LE9A 5F3BA 5EOQL 5F6IC 1OQXA 2WUCL 4ENED 1CLZL 1CXIA 1FL6B 5CJQL 4NSKA 2VITA 4HZLA 5JDSA 3F7PC 1QYGH 2I07B 3VXSE 3QDJA 2VE6A 5BZDA 3F58L 1IGFL 3DECA 3KAAA 3SO5A 1UEYA 1T20B 4Q2ZB 1U93A 2ADJA 2R1WB 4J3TA 2DMCA 3SE8L 3TZVC 3OJMB 4K71B 1CYGA 1IGMH 3PDOB 1TJIL 4P2QD 4ODWA 3VJ6A 3RVVD 2IAMB 4LARH 5DHVH 1E0OB 3HR6A 3A6CL 4NQCE 1K5NA 2EYSA 2IBGA 5IFHL 4YFEA 1N2RB 4LQ1A 3PXHA 3TN0D 2YUZA 4GG8B 5C0ND 1ZANL 5FO8A 3HE7D 4P5TD 4F7MB 1HHJA 2X4SB 3S5LA 3MRNA 4LNRA 4JE4B 5GGUA 1CXKA 3KLAA 3QWOB 2EKSA 4PB9H 1IAKB 3EDFA 5I75B 1EV2E 3CVHA 5FHBL 4D3CH 1FBIL 3ZDZF 3MLZH 1ZA6B 4U1IB 3IRPX 4CDGC 1FIGL 1VGEL 5EZOH 1AGEA 4TULH 1H8OA 3VXPB 1T21B 3GMPA 3EW3B 5CSZA 2XZAH 1KB9J 1F4WH 3FHAA 1H9VA 5T1KB 3TEUA 3DRQB 4YEEA 1EEYA 1KUMA 1U8MA 4BKLA 4G8EA 2WBWB 1NAMB 4JFPB 4PY8I 1EEZA 1RZJL 2B2XH 2VDPH 1ZT1B 3GRWL 4XPBL 4MCZB 3PP4L 2VYRE 1MPAL 2XKUA 1G0YR 3CDCA 2AXGA 3NZHH 3SBWC 2N7BA 3FFDA 3JWOH 4OZFB 5CSGA 1NJ9B 2DQFA 1YC7A 3RBGA 5JXEC 3BP7A 1CFBA 1JF1B 5BV7H 3NAAL 4TTDC 5FDYA 1CVSC 1A9BB 5F89A 2EIDA 3RWGB 2CDGA 2JCCF 3U6RA 4FQCH 1CGVA 1ORSB 4IOFD 3FKUS 1U6AH 3MQIA 2EZ0D 1RHFA 2VXUH 3TBVA 4MXVE 4WEBH 3VI4E 4JN1L 3GMNB 1UA6H 2C3XA 3Q5YA 4NFDA 2FO1A 1QLFA 4UTBH 4JGJA 3PHOB 4Z7VB 4TUOB 3LSOB 2YD4A 1G7LB 3L3JA 5D1XC 3QUZB 1RK1B 4HUXA 1CDBA 1PYWB 4XCNA 1OGAA 4YWGH 3B2VL 4HQQL 4GSDH 4H0IA 5FFLA 4IRJB 1G7IB 3C5JA 4YBHA 4M62L 3MV8E 3PL6A 4BSVB 4PJCB 4HKZB 5BW7A 1JL8A 1C5DA 1OCWH 3FN3A 5E99H 2BY2A 1A6WL 4G9DA 2NTFA 4JRYA 5T3XE 5ACZA 2NXYD 3JUYA 4KUZL 1AJ7L 3H9SA 3LKQA 2I9TB 5D9SA 4U49A 3T2NH 2W9EH 2YPVL 3T0VA 4XXCA 3IDJB 3R4DA 5CP3H 5ADOH 5E5MB 3GJFA 1RZGB 4MLSA 1C12A 4HCRH 1OAUL 4NYLA 4OLZH 3RUGE 3VWKD 2R4RH 3GJEA 4YHIB 4OCWL 5D1ZA 5BXFA 1RPQA 2XPGB 4J1UA 4XAWL 5IJKA 5ICZA 4BFIB 5F7FA 1ZTXH 1KG0B 3NIGE 5FYLH 5IP4A 2GJJA 1J1XL 2EE6A 5D2NB 1SJHB 5F1NB 4JPIA 4PPTA 2WBKA 1KC5H 4DZ8B 1OPGL 1QO3B 3U4BH 4BUGA 1KBGH 2A6DA 5HI4C 1IAIH 5FF6A 3AB0B 4NRXA 5FYJE 4IRSC 5DFWH 4DK3A 4KC3B 3QEUB 1JGDB 1ORQA 2DKUA 4M8VA 2IJ0C 4MXQC 3BGFC 3F12A 1K8DA 1XCTA 4Y5VB 4BQ9A 4MJ5B 3VGAC 3GMOB 3GSNA 1S9YB 4KK8D 4DN4H 4M6MH 4PGJA 1NLDH 3CK0H 4GW1B 5GJSL 1RJLB 1BX2B 1QLRA 3HZYB 3MRKA 3GMLA 4EQ2A 4MAUL 4CBPA 2OM5A 2XZCL 1I8LC 3FT2B 4LDLB 1EAJA 43CAA 3Q3GA 3MRDA 5BS0B 2OSLB 5EO1A 1AO7D 1FNAA 5I66A 1OL0A 1RZFL 1NDGA 4RMWA 4TVSa 1IGTA 2AP2A 4HWNA 5F1IB 4YH6A 4P23D 3BGAA 3QULA 2HLAB 3I6KB 1G6RH 2PXYD 3FMGH 4DQOH 1XGQA 5M7QA 4AZ8A 1Q0XL 5D7SL 3ARWA 4QWWD 3X3GH 3OF6A 4KJWC 5DT1L 4Y7MA 2IANB 4FQIL 2ZOKA 2OZ4H 5D96B 3RJQB 1BFOB 1QKZL 2E9WA 3SDDC 5I0DA 1DBAH 2I60L 1T7YA 4IHOA 4KRPC 3TCLB 5IW1A 4GFTB 3A6BH 1KFAL 3SGEH 5AD0B 1EHLH 2AJXL 2WMPA 3GJFK 3LN4A 4MS8D 4G8FB 2O61A 5E6IB 3G6DL 3TO2A 1YEGL 2EO1A 2J5LB 4M7JH 1YEIL 1FZOA 2ARJQ 3C60C 3CVHL 3QHFH 2Y4SA 1EO8L 3T0EB 3LKRB 1U58A 1P5VA 4N0RA 5I1DB 1WUNT 1P4LA 5JZ7C 5T3ZH 4OZHB 4DVBA 4DGYH 4JN2B 1MJ8H 2ZUYA 2EE9A 5IVXA 5JR1H 5A2LH 1ADQA 4R8WL 1U91B 5FUZL 3STZB 4EUPA 3GIZL 4WUKL 3VDCA 4S1QH 2BSRB 3IJSB 1W8NA 4GMTL 1SBSH 1X7QB 4PJHA 2HRPH 1EEUA 5HHVH 1P9MC 5D70L 4PJGB 4RGOH 3FB5B 3NH7H 1UWEL 4YXHL 1WSST 2NX5B 1D7FA 2UYLB 5IB3B 1RIHH 5C0FA 1WBXA 4ZOAA 3T1FB 5D7LB 4TVPE 1R5WB 5KVMC 5ESVA 4YHZL 3D0LB 1NSNL 1MLBA 3BP5B 3VGBA 4O9HL 4WWKD 1S8DB 1A1OB 1ZK9A 3G04A 4G6AC 2R2HA 4X6DB 4JFYB 3L5WA 3NZ8A 5HI5C 1DVFB 5FYJD 1D5BB 2BX5A 1QHPA 4WO4B 2L0DA 1HHIB 4QRTB 4GMSH 5E4EB 5GS0H 4YPJA 3K0WA 1UM6H 4F3FB 2AVGA 4NC1E 1XR8B 3T1WA 2R0LL 4UBDC 3L3GA 4W4NA 5I1AA 1BFVH 1NCCH 2VDMH 4KKCD 5HGBA 4DW2H 4YHML 2NY1D 3DSNA 4NQDE 4OKVA 4R96B 3SKOA 1FZMB 3V6ZA 2ZUQC 4MJIE 4NO3B 4FP8L 3MLVL 3ZDZE 1QLEH 1HEZA 3QHZL 2GTWB 4CKVX 1N5AB 5T5FL 3U30B 1AGDA 2N4IA 3WO4B 5DHVB 1TVBA 3JXAA 5TE6L 5GGTH 3OWEA 4XMPH 2R1YB 2R2EA 5DD0H 1OOAA 2VDQH 3QDAA 5FOBA 3L3HB 2EXWD 1P4IL 4GW5B 3F65A 1CU4H 4UDTA 4EIZC 4M5YL 2NXZD 3VXMB 3REVA 1N5YH 1CICA 3MRCA 4F7EA 3AAZB 4FFWC 4TUKL 2W92A 3HR5A 5C2BH 1XR9A 2YA1A 4LLAA 1KJ2H 4DKDC 1HDMB 4ZUWB 2A0LC 4WHTB 1BVLB 3WNNA 4ZD3H 3MZTA 5DVKA 5C0BE 4Y2DC 4ZAKB 4X4MA 4KY1H 3C6LA 3ARGC 3W5MA 1YMME 3GSWB 4TNVK 2JCCE 4PGEB 2DI9A 4PJCF 5JNYB 2OR7A 1DQLH 1MCJA 3ZYIA 1ZLVK 5DD5H 1N6VA 1Q9KA 1WVZA 3OX8B 4WFFE 1UXWB 3EO1A 3MCKB 1QFWM 1VFOA 2R56L 3JV5A 4GS7C 1OAZH 4P46D 5ESAB 2H3NB 3CLEH 3TYGH 4WENB 2QHRH 3GSNL 1JPSH 3WXWL 3IFOB 1NC2D 2B4CL 3QG7L 4OLXH 4L9LA 2ZP0T 5E24E 1DQQB 25C8H 1J86A 3ES6A 4K3EL 1DTUA 4I0PB 1MCFA 4OKDA 1JYVA 4LASL 4QGYA 3UJTL 2WINA 4XH2A 4Z7UA 3NA9H 4XBPB 3WFEH 2C5DC 5CIPH 4PJ8D 3HE6D 5C0AE 5SX5H 3RPKA 4O5LH 2DBLH 3ZKNC 2X4UB 1T7ZA 4EN3D 2O5ZH 2XN9D 4YR6A 2EDOA 1DANU 1QBLH 3H8NA 3AREA 1OTUD 3EYFB 2MKWA 2VN7A 5H37G 2VXQL 5ESQB 1OAKL 1JPFB 4NN5B 4V1DB 4QY8B 1J10A 5FAAA 5TFSH 4FS0A 3EHBC 5EO9B 3OKKA 1IZJA 5D4QA 4HPOH 4PRPE 4OM0H 5L88H 5EU6A 2Y72A 3RIFK 1NMAH 1U2CA 4L4VA 1KCKA 4NQSB 4NQDD 1P53A 4HIJB 4I77L 4ODSL 5FK9B 3ZE0F 3ZE2F 1FPTH 4JDVB 4Z7OF 3ILPA 3NVQA 3MLSH 3DVIA 2JB5L 1E4XL 1QQDA 1ADQL 2P1YA 3O3AA 5E03A 3PHQB 2VR4A 4WDIA 4OF5A 2CLZB 3MPCA 4Y89A 4XMKH 2YEZB 4P2YA 3A67L 4ODVL 5EFIA 5KJRH 3O3DB 5DJ6A 3BMWA 1ZT4B 2QR0A 5HDOA 3EYSH 2H6PA 4WFEE 5J57B 1J0HA 3S8WA 2L7UA 4RAUA 4O02H 1LEKA 2DQGL 4OM1L 2IQ9H 2VAAA 4KHTH 4U3CA 3EOAA 4U7SA 3IJHA 1QZ1A 2OTWA 4LKXB 3QA3B 2I5YH 3ARRA 4JAMA 1BOGB 1Q9LB 4S2SA 5E56A 3DMMB 2XTJE 4OZHF 4YHKH 3WFCH 3MUY1 3P11L 5BQ7A 4BZ1H 3PL6C 1FFPA 1FORL 3MODL 5MENE 1PKOA 3NCEB 3D18A 4HKJA 1GPOL 4OLYL 4WU7B 4LSRH 4PJ9C 1BM3L 5D6DA 2FGWH 1IKNA 1IC4L 4LKCB 5DO2D 5DMKB 1QR1A 5L7XL 3ETBF 2IBZX 3BN9C 3EAKA 4KHXL 4CADA 1KN2L 3KYOB 4PJGF 5ITFA 1E6OL 1DBBH 4JR9L 1YPZA 1FYHB 4WFGE 3UTQA 4P2QA 1MVFA 4Z7WF 3UO1L 4YLQT 2NLJA 2AKRB 1G6RB 2X1XR 2Q76B 3WCYA 1FAIL 5IJKC 4XWGL 3MRBA 4YPGA 4R7NA 5ALBL 1IM9D 1RZKC 4NHUB 4EBQH 5I1JH 1N6UA 2CRMA 3BISA 4P5TA 4LEXH 3MLYL 2R1XB 5H37H 4M3JA 1EAPB 4PJBA 4NUGL 4MQ7B 1V7NL 1KT2B 2OL3A 3W81A 1MRDH 2I9LA 4QHMA 2JK5B 4NUJB 1DN2A 4UNVA 4K07A 2AK4D 3JWDH 1CD9B 5CHNA 5DWUH 1L9MA 1AGCA 1HYSC 3MV11 4Y0GA 3ZL4L 5HHOB 3TH2T 2ICEB 3T2OA 4G6KH 2B4CC 4OCXL 4JRXB 4IDLA 4OLWH 2AXJA 4KDVA 4UIMA 4JG0H 1NL0H 2YD2A 4GG6F 5L2JB 1M7DB 2MJWA 3MROA 3UYRL 1FG2A 5GZND 1JHKH 4Q6IB 4JDZB 4UOJA 4EVNB 1S9XA 4FNLH 2DQEL 5TJWK 5J1TC 1ZVHA 4FXKA 3W9EA 1S7TB 2ZPKL 3S98A 1OY3B 1DQMH 3NFNB 1NBQA 3U7YL 4MLIA 4H8WL 1L7IH 2HFFB 3FFCB 2FEDD 2PKDA 1B4JL 4JFZH 4QXTB 5E0QA 3UJJL 1TQBB 4PP1D 2VJXA 4WFED 2ZJSH 3LDBB 4JREC 1BVZA 1PX3A 3CAFA 5EORH 1AXIB 2IG2H 1UJ3A 2Q86A 3HNSH 3VWJC 5ILTH 1OAQH 4PGBB 2YHGA 3ALPA 3Q6GH 3LH2H 3MA7A 3CFCL 3OAUL 4M1DL 2DTMH 3CPLA 2EC9T 2Q7NA 3BZDA 4L4TD 2PTVA 1JHLH 1KEMH 4GBXB 3RZWA 1U9KA 5D2LF 3NPZB 2FH6A 1Y6KR 1CIDA 3PGFH 1FNEA 1F11B 1VFMA 2YZ1A 5CKAA 1F45A 4R2GB 4CMHC 1R5IA 1F13A 1NEZA 3STLA 3TO4C 2ZKHH 3O6FD 1DQDL 3S37H 3TYFA 1IBGH 1YC8A 1ZS8A 3CLFH 3MJ7A 2RQ8A 1ND0A 4X6CF 4DUWA 1CFSB 4LK4A 3VWKA 3I75B 3SDXB 4PJCE 1BVKA 4PRBA 3BDYL 1YN7B 3VXQA 4W4OC 1RFDL 4WU5A 2ATPA 5HHPA 4HUVB 3EGSA 3V6OE 2BERA 2GFBA 2ATKB 4IDJH 1JK8A 2OR8A 3CIQA 5I1LB 3HG1B 4HWBH 2NY4C 2A1WH 1IC5H 4JKPL 2WWMD 3QZWA 4P48A 3V6OC 1SYSB 3I2CL 3S34H 5DRXB 3TBTA 2IAMD 4FTVD 5TDOA 1YUHB 3A6OA 3ULVF 5I1KL 4ZUSA 3MLXH 2ESVE 1CFTA 3DSFL 1J0ZA 1KEGL 5FEBA 5C9JB 3WUWA 5GGVY 1MJJA 3EO9H 1CE6B 3EOBB 4JHAH 4M1CC 1A7PH 4PGZA 1NGYA 1P69B 4RFOL 3MCLH 5TQ0L 1AD9A 1FSKB 5I15L 5CJOL 1UM5L 4UV7H 3NPSC 4NKMB 3IETA 1GZQB 3B83A 3KYNA 3U4EB 5KW9H 2P8PB 3MUGB 4NKOB 1YMHA 5T1LB 4AENB 5J6HA 4XHJC 5DZNA 4DAGH 3OR6B 1DBJL 1ZSDB 3DX8A 3MRQA 5CS7A 3UTOA 5T1KD 1VERA 2HT2D 1HHKB 2FECL 3I50L 3L6FA 3GHBL 5F7YC 1D9KB 3Q48A 1R3IH 3CX5K 3KVQA 4P23A 1MAML 5AWNH 4WY7H 1QSEB 1SQ2N 2PXYA 7CGTA 1HIMH 3MJ8B 3GBNH 5BS0E 1JPGA 5CIPB 2GKIA 4X6EB 1ZGLA 3ZE0E 2F5AH 3ZE2E 3G5XB 3LB6D 3MRFB 1F4YH 1CICC 1I1AB 2GITA 3UX9B 4Z7OE 2H45A 3GGWB 5C07B 3E8UL 2HFEA 2GJ6B 2DBJA 1C1EH 5SWSB 4YDKH 2RIKA 1PAMA 3S35L 1NGWA 1EO5A 5DUPH 1UM4H 1QVOA 3CDFA 5GGRB 2WBJB 2LU4A 4GLRH 4PG2C 1QFUL 4MNGA 2OL3L 2AEQL 5D7KE 5KN5A 2YUWA 3QQ3B 1Q8MA 3S88H 2IANE 2MHAB 2ICWI 1RMFH 4X7EC 3S36L 1LEGB 4O51B 4K3DH 3MV8A 1LEIB 4J4PA 5EOTB 5BVPH 4XTRC 1NDMA 3KGRA 3H6JA 5FDWA 4FN0A 5GRJL 4LHUG 2QBWA 3QUZD 1FGVL 5IF0A 3P30L 2W60B 3B9DA 3OAZH 3QO1B 2MNUA 5KVDH 3T0EE 3RTQC 4MA7L 2M2DA 1OQOA 4L9LC 4IRJD 1U92A 1CFNA 1EBAA 1FFOB 1U36A 3MXVL 1XGYH 4YFLI 4LVNB 4KI5F 4OZHE 2ERJB 2X4PB 2DIBA 3DOSA 2B20A 3RZCB 3LEVL 4ORGA 1R0AL 4E9LA 1K2DA 3U0TA 3UTZB 2F5BL 4RGND 5L2KB 3MNVB 4IJ3B 3RDTC 1NGQH 4CU6A 1QHOA 4AEIL 4HIHA 2V2TA 4F9LC 3L5XH 4WWKA 4PJGE 5C0DB 2R23B 3IDXL 3FHQA 1YY9D 1MFCL 4PV8B 4Z7WE 1IGJB 1G7QB 2YBRA 1UB5B 2BSED 3IJYB 1JPTL 4LCWB 3KNBA 4RZCB 4HS8H 2J7LA 3INUL 1PFCA 5E94B 4YNYB 1IM3B 4NKQB 5SV4A 5IESH 3QQ4A 3HA0A 1RURH 2FHBA 2NW3B 2H2PD 5HHMB 4PIRF 5IM7A 4U05A 1DL7H 1IQDA 3IU4H 1ZLWK 1YYML 4JZJA 4LSDA 5MI0C 3BPLC 1H0DA 4U3HA 4K94C 4P9ML 2J8UF 3M07A 2VLME 3FT3B 4PTUA 4WI7A 3FOMB 1FGNL 1NMCC 4UILH 1G9MH 3FO1A 5DC4B 4OD1H 3F62A 4I18B 3WS6C 1KPVB 3RWCB 3UTPE 1LNUB 3MJ9H 1BGXL 1GHFH 1QBAA 4JZNB 4R4NC 4LCCA 1XF5A 3EOYG 1KELL 4P3CL 4YBLB 3D85B 3EFFA 4MB5A 1BZQK 5CGYD 4EDXB 3DX9B 4U1HA 1NBYB 3MCG1 4GG6E 1BBJB 3QEQD 3FO9A 1SM3L 4J6RL 1YN6A 4X7TA 4TRPL 5HGGS 4PUBL 4DOHB 1DDHB 3BSZL 1VKXB 3B9KB 1HWGB 5IIEA 3D39B 1K4DA 2E7HA 1FV1A 1I9EA 1R3JB 4PY8J 5K9QG 5KOVC 5BRZB 1N4XL 5EOQH 2IAND 1OTTD 2WUCH 5E00A 1CLZH 2HAZA 2FEEI 3ECBB 4LBEB 4MA1B 3ZTNH 2CLVA 1S3KH 1QOKA 1X5HA 1HCVA 2G2RA 3MNZA 5TDPB 1IGFH 5E6ID 1HILA 4QRQB 4OLVL 2Y9RT 1WWWX 4PLKD 1H3PL 4CW1B 4K9EL 3M1BB 3ZDYE 3S3JA 3PNWA 4PJEB 4D9LL 2X42A 3V5KA 3OBAA 3TT3L 2FRGP 1CT8B 5CJ5A 4PJFA 3NFSL 5D2LE 3RVVC 2P44B 3A6CH 3GB7B 4IRZL 4L1DA 5JW5A 1U8QB 4I2XA 4Q9CA 3O0RL 5ENWA 4S1RL 3GI9L 4UDUA 5IFHH 4X5WB 1XGUB 1ZANH 4HFWB 3TN0C 3WFDH 5IFJB 4PJ8A 3HE6A 3HE7C 4RQQA 5CEZH 2X7LB 3B8SA 4X6CE 4EN3A 3MRGA 5IKCA 2WQ8A 3TNNA 2XN9A 1YECL 4UQ3B 2NX5D 5FHBH 5FHAL 2GK0A 3O41B 3VW3H 1W72A 1ZV5A 5D7LD 1OGTB 4YDVA 1EZVY 3NABL 4UOW1 4X7FC 1JZ8A 3PABA 2Z4QA 3KJ6H 2ZZUT 1U2HA 2GJZB 3HNTL 3BO8B 4OD3H 4LLWB 1A5FH 1DVFD 5GRYA 4ERSL 3P77A 1H3VA 2ADIA 3LS5L 4LSPL 2IPTH 4WO4D 1G9EA 3ULVE 4NQDA 1RZJH 3AY4A 4MJIA 1X5LA 3QDGB 1AQDA 1MPAH 4JGUA 4OAWB 3DYPA 4R7DB 3LQMA 3PQYB 4HH9A 3CSPA 5J06A 1GAFL 1TCMA 5T3XL 3MLRL 3O81A 3U82B 1Q9OA 3M17A 3NAAH 3G6JB 2CLRB 4O58H 4POZD 2O93L 3VXNB 5AZ2H 2X4QA 1J8KA 3ULUH 4JFQA 2EZ0C 5A2IH 1BIHA 1JZ7A 2FB4L 4L3CA 4CVZA 1T0MA 3RX8A 5GSVA 3BUYB 1FVEB 1JJUA 5HGHA 4F7PB 1JYNA 3TWCL 4R4BA 1MFAH 3V5DB 1UJ3C 2F58L 3DTXA 2FSEA 5DHXB 5E4IA 5EZLA 5C0BA 1YNTA 3VXMD 1MCEA 1YMMA 5KTEL 1T04A 5FYJL 1I7RA 3B2VH 4HQQH 1JV5B 3ISWA 4NZTH 4M62H 3SKNA 1RJYA 1UQSB 2ARJA 3PV6A 1UGNA 3ARDB 1A6WH 2ICES 3EJZD 2GEEA 4HULB 2XNAB 1OD9A 3HTLX 5AZEL 5CILL 3O3EB 2NXYC 1AJ7H 1RI8A 4ZOCA 4PJAB 2D0FA 4D0BA 4X99A 4IEFB 3CSBA 4F7CA 1IGCH 4OBRA 3VWKC 4Z77B 3P4OA 4OCWH 3TPKA 2IPUG 1TZGL 4JPVH 5ELIA 3RBSA 4YK4B 3PDGA 3MGTA 4YDJA 3U79A 3UZEA 2OJEB 4YUEL 1IM9A 2OQJB 3QH3A 4P59H 3VMOA 4N0CD 1I1FB 1CBVL 1XCQA 4YHNA 5EN2A 3WMSA 1JMXA 2ICWA 5C0AA 3IXAB 4I0PD 32C2A 3FL7A 3O9WD 4OLUH 4PJDB 4KI5E 4U1MA 5DFVD 5D7IA 3DVFA 4DVRH 4PS4L 1AR1D 1TJHH 2ZG2A 4GW4A 4KI5C 5C0JA 2AK4A 2FIKA 1HOCB 2J12B 5KSUB 3DURA 1J0YA 1QA9B 2WIIA 4X83A 3GNML 1F02I 3P9LB 1KPUA 5ID0A 4J2XA 2H8PA 4KK8C 1FFRA 3VXOA 1KIQA 5GJSH 4M43L 3I6LD 3VFPA 4KFZC 1YQ2A 2XZCH 3D69B 3WV0A 3I85A 5DTFB 1F8TL 5DC9B 4G8IB 5L0QB 2YRZA 5DGQA 4V1DD 4TNWF 3LKSA 5HHOE 4NKDB 2AGJL 3X3FL 3DHMA 3P9MB 3OTTA 3W0WB 3DUUA 3HZMA 3O8XB 4P23C 4AM0A 5FB8B 2Q20A 4HIIB 5E9DB 5EUKB 1UWXK 3MR9B 1Z9SA 2NNAA 3OJDA 3KWWA 5GGVH 3KYMA 4JPKL 4QRUA 3RI5K 4HUNB 5K9OA 3O4OB 4QWWC 5DT1H 2J8UE 1Z5LA 4X8XA 4RAHA 1E27B 4JB9L 3F6LA 4CJ0A 3DWTA 1NC4B 5FYLD 3UBXG 4PBWD 5KVEL 1CZ8L 3C9NB 3KXFB 2AJXH 3TH3T 5TQ2L 3M45A 4KTYA 2A9ML 1IGYA 3UDWA 3CX5J 3FFCE 1K85A 4L4TA 4MS8C 1AXSA 3O11B 1UWGL 1ZWIA 4N9GA 4E41B 1XMWA 1EO8H 1T03L 2FJGB 3VH8A 1W72L 3FTGB 5HGAB 1P6FA 2PW1B 4FMFA 4NBXB 4U1KA 3QXDB 5J12C 2F53E 5BMFL 4WI4A 4TSAL 4Z7NF 3UPRB 1JNHA 5DMIH 4PJEF 3QNXB 5FUZH 3V6FB 3GIZH 4WUKH 1FL6A 2GIYA 2C1OB 5I8KL 4LPYA 1NAKL 1OWWA 2P49B 2HTKD 4GMTH 1X5AA 1ZXQA 2VZ3A 3O4LB 1F4XL 1Y0LB 2I07A 4PREB 1E28B 3FRUB 5D70H 5EBLB 3RY6A 1H5BB 3ARTA 4JM2B 4YXHH 1FNFA 1N26A 1T20A 2ADFH 1QRKA 2DKSA 4Q2ZA 3WKMH 5SWZD 4J3OC 5E2UL 3PDOA 1U8JB 4XXDB 5L6YL 3BH9A 4EI6B 5I6XC 2IAMA 4FTVA 4WWKC 1UZ8B 2X4OA 3QJHB 3SKUD 3C09C 2X6MA 4G6JL 3UC0H 4KK9D 1N2RA 4OJFH 4R26L 4GG8A 4HHAB 4F7MA 3SO3B 1A1MA 1P7KA 3QISA 3H2WA 3QWOA 2J88L 1IAKA 2DQIL 3LKPA 4YHMH 3GBMH 4MJ4A 4U1IA 4NN7C 4XB8A 4HUWB 1IJ9A 3VXPA 3MLVH 1MFNA 3QHZH 4WI8A 2BRRL 3L95A 5T1KA 5T3ZD 3EDDA 4C58B 1M6OB 2YPLB 2R8SL 2P7TB 3DRQA 5I17B 3UP1A 4JRXD 1NAMA 3GMQA 4JFPA 3VE0B 2EXWC 1L0YA 4AEHL 1ZT1A 2DJSA 3E3QE 2HJLB 3MRJB 3LCYA 2P8MB 2Z91B 4NRZB 5FUOH 2ED9A 4OZFA 1KF9B 3WUZA 1NJ9A 4TUKH 2EECA 1JF1A 1TVDA 4DKAA 2M8XA 4ZUTB 1A9BA 3PWVA 1DLHB 2EDFA 1LP9B 3V79C 3RWGA 3L7FB 3T8XA 3VA2C 1ORSA 3W2DL 2D7TL 5L9DL 1N6QL 1QP1A 2E6JA 2I25N 5KVFL 2Z93B 4JO2L 3N85L 1A7NL 1OP5K 3GMNA 5DR5L 4U0QB 1MIEL 2GJ6E 1R3LB 3ARFB 5SWSE 5GS2D 3PHOA 5MEPB 4Z7VA 2FBJH 4TUOA 3LSOA 2H9GB 1G7LA 2YD5A 1J7VR 4P46C 3N1MC 5E8OB 4JVWA 3QUZA 1RK1A 2F74B 5FKPB 4CL7A 5D71H 3GSNH 5IMMB 1PYWA 1QBBA 3EYUL 3WXWH 5FGCE 3QCVL 1UACH 4QRSB 3C2AL 1JCKA 3FQTB 4IRJA 4BSVA 4HUMB 4HKZA 3NFPB 1ZLUK 4K3EH 2HKFL 2ZCHL 3G5YB 4X9BA 4LASH 3TF7C 3UJTH 4M1GL 2I9TA 3T4YB 1YQVL 2YD6A 1T0NA 2FH8A 3IDJA 4WJ5A 3JUZA 1YNKH 5E5MA 1RZGA 4BUHA 3WS3A 2XKSA 4YHIA 3HB3C 3HE6C 4PJ8C 4YAQB 5IQ9B 1AKJB 1M71B 1A02N 4EN3C 1F6AA 2XPGA 1TZIB 5IHUL 2NMSA 4S11A 4ZO9A 4BFIA 5L8JB 1GL4B 3OKDB 3HG1D 4OZIB 4U1NB 1MCSA 5D2NA 1OTUC 1SJHA 3D5OF 5F1NA 1IILE 1KCLA 5EULV 4NQUA 4DZ8A 4FQPA 3HS0B 1QO3A 1OAKH 5CJBA 2QQLH 5F9DC 2B39A 5F9WC 3FRPA 3PGDA 1T80A 3QEUA 1G0XA 1JGDA 4CMMA 4LPCA 4U2ZA 4LCWE 1CFVL 4PJ5D 5ITBH 4ODSH 1KLGB 2EH7H 4JQIL 4Y5VA 1KENH 4MJ5A 1IAII 4U1SB 2JB5H 2VWEE 3GMOA 4LSQL 1L7TL 1RY7B 1S9YA 4UUJB 2DLHA 4Y19E 1ADQH 4LL9A 4MWFB 4DJMA 1RJLA 1JYXA 3IFLL 3HZYA 1UB6A 5C08E 4C54A 5IMLB 3ZKSD 4NO2B 4OIIL 3MYJB 5A3ID 1EGJL 5FCSH 2OSLA 4LGPB 3BIKB 3W11C 4EOWH 1V3JA 3B4NA 3HPLA 2Q87A 3QEQA 4CVUA 2EEAA 5DK0B 1D9KD 4PJIB 4W6YB 1PG7H 3DI2B 2CRYA 2DS4A 3GIVB 1ULVA 1B0RB 3BZEB 1DLFL 4OM1H 1QSED 1JN6B 2FEEL 3W9DB 2IFGA 2CGRH 4OF8A 4IMLB 2QADB 2IANA 4EZMA 1I1AD 3BVNB 4UOW0 2X1WL 4GAGH 5DYOB 5FOJA 5C07D 1FO0H 1A9EB 2XT1B 2GJ6D 1BFOA 4NNPL 3P11H 4LRNL 4DOHE 4LGSB 3K2UL 1FORH 4GRLB 3TCLA 3SHSA 4KUCF 5AD0A 2WBJD 2R39A 1RK0B 3D39E 1GPOH 5C09B 4OLYH 3UTTB 4G8FA 4Y4HD 2RCSL 5E6IA 5DUBB 3NACH 1IC4H 2D0HA 5BRZE 5DO2C 1BBDL 4KHXH 2KZWA 2OXGA 3LKRA 5IB2B 1KN2H 4AQ1B 5I1DA 1S7VB 4GKSA 5JA8B 2ZSWB 4JR9H 1NCDH 1LGVA 5IVNA 4HJGB 5C3LD 2F54E 5DK2B 1NGZB 4OZHA 1QD0A 3WN5B 4TOYL 3UO1H 3KPOB 2A73B 3D9AL 2ICCA 5CZVL 2DYPD 4XWGH 1U8OB 5ALBH 1KGCE 1U91A 3STZA 1C7SA 3IJSA 1NAML 4JQVC 3DHJA 4PJEE 1MF2H 5M94B 3F7VB 1X7QA 3MLYH 3WIFB 1NBVL 3VA6A 1PJ9A 2NW2A 4JY4A 4NUGH 4PJGA 3RZCD 1DUYB 3FB5A 3N1FC 3FOLB 2NX5A 2UYLA 4NN6C 5IB3A 1EHNA 1NFDB 1JVKA 1P5UA 3T1FA 5L2KD 3WE6B 5D7LA 1R5WA 1MIML 2AQ3A 3D0LA 3O3UN 2Z8RA 4P5MB 3BP5A 3VG9C 4XP5L 3R8BB 1T89A 1S8DA 1A1OA 4MVBD 4X6DA 3LEYH 3FB8B 4JFYA 1DVFA 1IEAA 5DQJB 3U46B 2F15A 2DQDL 4OCXH 1TITA 4KTDL 4WO4A 1I8KB 2Z0BA 3TA3D 1HHIA 4QRTA 2HRLA 1EFXB 1U42A 4RMTA 1TPXC 4F3FA 3M8OL 1K6QH 3PV7A 5GZNC 1XR8A 4XNZB 4KKBD 5FGRA 1F3DH 4ZYKA 5HHMD 4F37K 1ZE3C 4QOKB 1NUDA 5E7FA 5F9JB 2YD1A 4P5KB 5T33H 2ZPKH 8FABB 1F2XK 1VHPA 4R96A 3HZVA 1U41A 5B3NA 1FZMA 3QDGE 3CC5A 3H7LA 2JJSC 2W91A 2GTWA 2PTTB 4FXLA 4OF0A 4H8WH 1N5AA 5F1OB 3U7YH 1WZ1L 1B4JH 1YA5A 5CINL 2BJML 5DHVA 4PP1C 1LP9F 1WTLA 4QRRB 1YEFL 2R1YA 4GW5A 2IBZY 1ZAGA 2CDEB 1CD0A 3CFCH 3OAUH 4M1DH 2BCKB 3QXAB 3VXMA 3PWUA 3REWA 4OV5B 4R90L 4XBEL 3AAZA 4TUJA 3QWRD 5BJTB 5IT2L 5C6TL 2KBGA 3BGMB 4YFDB 3GSQB 4AY0A 2APBA 3ZKXC 1HDMA 3B9KD 2PYFB 4IOIB 4WHTA 4ZUWA 2J8OA 4ZAKA 5HYEA 5EOCJ 3EBAA 1DQDH 4LMQE 4X4YB 3O6FC 4K3HA 1YY8B 3GSWA 3EFDL 4PGEA 5JNYA 4OF3A 1GGIL 5J11C 3DO3A 3OX8A 1UXWA 2NR6D 3MCKA 4MYWB 1Z6JT 3BDYH 2RR3A 3QG6B 5LCVL 1RFDH 5ESAA 4WFHE 2H3NA 3FQRA 5HI3D 1XGRB 4HLZH 3RY6C 4UNUA 4FZEL 5ISZD 5A40E 3IFOA 4JCLA 1MH5B 2P5WE 2FJFB 4JKPH 5E6ZA 2DMBA 1QRNB 2WWMC 5IB4B 1DQQA 3EYVA 4NFCA 3BRDA 5HYJB 2ICWJ 3LS4L 3X14A 2O26U 3N1QC 4I0PA 3TBWB 4EI5B 3O9WA 4HAGA 2IAMC 2L7JA 1HZHH 3MOQA 5I1KH 2RJMA 5C0EB 3DSFH 3IFPB 4ODBD 4XBPA 3STBA 4PG9B 1KEGH 5HD8D 3TJEH 4DGVH 5DD3L 4X4XB 1RVFL 3I02B 3QFDA 1LMKA 3BD5A 1FP5A 4N90E 3DRTB 4RFOH 1QFWL 5I15H 1J8HB 3QQ9C 2VXSL 1DE4B 1MJUL 5I75C 4OFYD 5KSAB 1M05B 3EZ8A 1ZLSL 2LE9A 4ZS6D 3EYFA 3OXSA 2L4OA 2AEWA 5ESQA 2HVKB 5ICXB 4V1DA 2FCBA 3CFBB 3WNMA 3LN5B 2GYSA 5EO9A 2HT2C 3GHBH 4XP9L 1NMBL 4PD4K 1KJ3L 1WCBB 4N68A 1JP5A 1MAMH 3FAWA 2VDKH 4M4RA 1KCVL 3NCFB 3CUPB 4NQSA 1S7XB 3GSVB 4LFHG 5CP3A 4YIQB 5DEFB 4HCRA 3EOTL 4GAFB 4PJIF 2ILLA 3FQUA 4MA3B 3PQYD 1HKLL 4HF5L 3HHRB 3RL1B 3VGFA 4M5ZL 4NJ9L 1G7PB 3LB6C 2X1OA 1PQZA 3PHQA 1FDLL 3E8UH 3W0WE 5C0CD 3ARUA 3F7RA 2A9NL 2CLZA 4TQEL 3BQUB 2NY7H 1QTYT 1HHHB 3S35H 5IR1B 5E9DE 2YEZA 1T22B 3QPQD 1MQKH 3CSGA 1FYTB 3ULSB 4HIEB 3O3DA 4J23A 1A6UH 1ZHLB 1ZT4A 2OL3H 2VLKB 4LVHB 2MMXA 5E5RB 3IVKB 4GKZA 5HY9B 4HMDA 3S36H 4BFBD 5T5NF 5EDXA 2ZWLT 2YPKB 3WNOA 2A77H 1KN4L 1QBML 2EIZA 5GRJH 4WUUB 1JWSA 4LKXA 3QA3A 1FZKB 2ITCB 4NIKB 4DFIA 4FQJL 1BOGA 2BHUA 1Q9LA 1UXSB 1G9NL 3DMMA 1TETL 2VXTH 3MXVH 1JNNL 3AS1A 2DM4A 1NCWL 3ARDD 3QFJB 5GRXG 4AG4H 1R0AH 4WGWB 3NCYP 3OV6A 3BOVA 4LKCA 1MHEB 4JFED 4RGNC 1JZ4A 3QIBB 3KYOA 3JBG7 1U8LA 5JA9A 4KTEL 4JG1L 2FX7H 4F15C 2MFNA 1NFDF 2AKRA 1G6RA 3G08B 5DI8B 3I3DA 1YY9C 5JIPA 2AJ3B 4LARL 4PRIB 4HXAH 2Z35B 4NHUA 4NT6B 5B39B 1C7TA 1JPTH 2X70B 3ZSTA 1BECA 1MCPL 2OZ4A 4TSBL 3INUH 5D2NC 1FO0B 1LDPH 3R0NA 5KBNC 2R1XA 3QUYD 1HNFA 1PZ5B 1EAPA 1KT2A 3KPSD 1EVUA 4LCIL 2AW2A 2JK5A 2MPAL 4NUJA 3BHBB 2H2PC 3F5WB 5JHDE 1D6EA 1DBKL 2MSPA 1KPRB 4P9MH 3MLZL 4NNYA 3JTSB 1Q9WB 2YUXA 1FGNH 1EERB 4NPYB 5JLZB 3HRZB 1HQRB 2ICEA 4NZUH 4JRXA 3DARA 1BGXH 4N1HB 1MHHB 5IG7B 1M4KA 5DUML 5L2JA 1M7DA 3LMJH 3TJHD 2DWEB 5C1MB 1KELH 4P3CH 4YQXH 2VDPL 5IK3B 4OLEA 1IT9H 5CGYC 1CGXA 2P5ED 4Q6IA 3CGTA 3NZHL 5FGSA 4J6RH 1S7TA 3O8XD 2F8XC 5C9KA 3NFNA 2V7HB 3AVEA 1EHXA 4ZUVB 1I85A 2CJUH 4FMKA 4OCLC 2HFFA 5A2JH 4G8GB 1FRGL 4QXTA 4JFOB 3PIQB 3UZVB 1N4XH 1UH4A 1OTTC 5FV1L 2VXUL 1SJEB 5D96C 1T83A 1NC4D 1Q94B 1IGIL 1LP9E 4PGBA 3S3SA 4AYFA 4UTBL 5IVZB 3OKNA 4MB3A 3KXFD 1MWAH 5HHQB 1I4FB 5AUMB 1WWAX 2QSQA 2LFGA 2J5LC 4E41D 1H3PH 4K9EH 4KJPD 5GQBA 1F6LL 3IDYC 4YWGL 3IAGC 4H1LG 4D9LH 4S0TD 4GSDL 4ZNEA 4WW2A 5FYKE 1F11A 3TT3H 1LO2L 5HJ3B 4L8SB 1VEOA 3NFSH 1QR4A 3PWJB 3S37X 4IIQC 1WBZA 2AK1H 1PY9A 5E8PB 3O0RH 3PF2A 4S1RH 1JZ3A 2QSVA 3T3ME 1AE6H 4HWEL 5GGTA 3I75A 3SDXA 2W9EL 5F7NC 2ITDA 1YN7A 3O4LD 4TPRH 5ADOL 4OLZL 4HCRL 2C4XA 2R4RL 4JO4H 4HUVA 2BSTB 1WAAF 3IT8D 4JM2D 2ATKA 1WC7B 1ZLWH 5MERA 2X89A 5FHAH 1HKFA 5I1LA 2WAHA 3HG1A 2V5RA 1MCOL 5F7UA 1ZTXL 1SYSA 3GDBA 4P49A 2DIJA 1KJ2A 3AFLA 1YUHA 1S5IH 1I3RB 5DJ2B 4LHUD 1KBGL 4LSPH 3LS5H 2X4TB 1IAIL 2CK0L 2DJUA 2HLFD 2Y6SD 1W0WB 4WO4C 4EQ3A 5CBAB 4MNQB 5C9JA 3OSKA 5E4EC 3EOBA 4P0DA 3MLTB 3FN0L 3BYTA 3GI8H 3ZHLA 3RHWF 1Z0MA 1CFQB 2BVYA 3BZ4B 3VG0H 1GAFH 5T3XH 3SJVB 5CEYB 1M7IB 3P0VL 5KS9A 4NKMA 4M6ML 2D7MA 1Y18B 1KNOB 1NLDL 2YD7A 3U4EA 1MEXL 2P8PA 3MUGA 4NKOA 5D5MB 4POZC 4AENA 3FJTA 4LLYB 5DJ0B 5KSBF 3OR6A 4YO0A 1ZSDA 3H9YA 2BY0A 4LIQE 2FX8L 2A74B 4WCYH 3D3VD 3P9WB 1UKTA 1HHKA 2YPLD 3U30C 5LGHL 3WO4C 1D9KA 1VFUA 5GS1B 5ACLA 4P2RD 5C7XH 1EBPA 4XPAL 1A14L 1BFSA 1A7RH 4PB0H 3TWCH 1QSEA 3MJ8A 2F58H 4QHUB 1WZLA 4D9QD 5CIPA 3MX0A 1G6RL 2HH0L 5CEZD 2C3GA 1FNLA 3G5XA 3MRFA 5H94B 1KJVB 5FYJH 1I1AA 5FECB 1NFIB 3BH8B 4PJIE 4JLRB 2PW2B 3GGWA 5C07A 3X3GL 1WF5A 4CGTA 2GJ6A 5CZKA 3BFOA 1CL7L 5SWSA 2OZ4L 3BDBA 1MJ7L 2VZ1A 4RMUA 4N8PA 2H32B 2YUVA 4L8DA 4ZS7L 5GGRA 1QEWA 2WBJA 1I1CA 5IMOB 4U0RB 3EJZC 4Y4HA 1VFAB 1FCGA 5CILH 3LD8B 4EDWL 1EHLL 2PO6D 3QQ3A 1ED3B 2MHAA 3K4DA 4HAFA 1LEGA 3JVGA 4O51A 2CRZA 4M7JL 3ARFD 4NO5B 5A16B 1LEIA 5EOTA 4JY5L 1KLUB 1Z2KA 4GLRI 4HFUL 1TDQA 1TZGH 4RFNC 4LPVA 4Y4FB 2PYED 4DGYL 4Z7QF 2W60A 4YUEH 3WXVH 1MJ8L 1TTGA 5DJDB 3QO1A 4N0CC 1IZKA 3MBEB 4X8JB 1CBVH 4DGIH 2D7NA 3JWOC 2MOVA 1FFOA 4S1QL 5BV7C 2X4PA 3HC3L 4EXKA 3HC0B 3RZCA 4I0PC 3O9WC 4MNHB 1SYVB 2A6JB 4P2CG 2HRPL 3UTZA 3ULUD 4RIRA 2KZ1B 4X7DC 1U8PB 2X9YA 5L2KA 5DFVC 3MNVA 3OHXB 1RIHL 4OI8A 1AR1C 3I6GA 4XGZA 3KPRE 1V7ML 2EIEA 1CLCA 3X13A 1AKJD 2AQ1A 2NY5H 2R23A 4XMLL 3ARZA 3IXTB 5AG9A 3TPUB 4PV8A 1IGJA 1XGPB 1G7QA 4M43H 1NFDE 1UB5A 1HN1A 2FJHB 4RZCA 5JW4N 2VL4A 5E1AB 2LTQC 3E2HB 5F6HI 1F8TH 5E94A 1J5OL 1IM3A 4KJYA 3MOBL 3RWIB 4DKEL 2YK1H 3ZYZA 1T6WA 4WI2A 2NW3A 2AGJH 3X3FH 2LQRA 4P4RB 5SX5K 1WIOA 3VXTB 4LPUA 2LU3A 4OZGB 4H20L 1I3VA 4I4WB 4BFEA 2X1PA 3FT3A 3T09A 4XNYL 4JPKH 1EEQA 3WDHA 1QLEL 4LSUL 4I18A 3WNKA 4NQVB 4QOKE 3RWCA 4JFXB 1LNUA 2VXVL 4JB9H 5ICYA 3RNKB 4TVPH 3Q1SL 3B3IA 4MSWB 5EU7C 5GGTL 5JMOC 4XMPL 5ANME 4JZNA 5KVEH 3IU3B 4J3XA 1CZ8H 2VDQL 1YDPB 4I13B 2FZ3B 4PD4J 5TQ2H 1CU4L 4LOUD 4EDXA 3DX9A 1NBYA 1ZVYA 1BBJA 3P4LA 3HRPA 1UWGH 3CZFB 2OJZH 3NA4A 4QRRE 1S7QA 3OGCB 3QWRA 4LF3B 5CP7B 1T03H 1W72H 3B43A 3WJJA 4V2BA 4OGZA 1DDHA 4I9WE 5C2BL 3B9KA 1EX0A 5T1MB 5BMFH 4MDIB 1KJ2L 4RMRA 1R3JA 1OSZB 2D7OA 5BRZA 2QADD 2BNQB 1W0YT 5I8KH 3ECBA 1MI5D 4LBEA 3VFRA 1DQLL 5IEKB 2XRAL 2HTKC 2H1PH 3VFOA 4GUPB 3Q5TA 4KRLB 4KKAD 3I3BA 5C09D 3UTTD 3BJLA 5TDPA 3P40A 1OAZL 5ISZA 5FO9B 1DEEB 4G43B 4OT1L 1TFHA 4NQCB 4QRQA 5I73B 3JV6B 3DX7B 1PKQB 2FATL 1JPSL 4CW1A 4L8BB 3M1BA 5JIIA 1MY7A 4A2LA 4DZBA 4JCMA 2JELH 4FOMA 4W81A 4MX7B 4N9OB 1MCIA 4YHPB 2HKHH 4OF7A 5L6YH 4N1EA 25C8L 1CT8A 3VRLF 2APXA 3RQ3A 3GB7A 2PR4L 4K7PL 1CLYH 3QIUC 4F7TB 1U8QA 5JTWA 4LAQH 4G6JH 2MTPA 1V8HA 3NCMA 4KK9C 4X5WA 3CFDB 1XGUA 4QF1B 2V17H 4HFWA 5CEXB 5IFJA 3WFEL 5JUEL 4R97B 1CGTA 2X7LA 1HYRC 3HLAB 1HSBB 2C3VB 2E3VA 5B3JE 2G75B 1AGBB 5I8OH 2DBLL 5E8NB 1MWAB 4UQ3A 2DQIH 3X12B 1UWXH 4KKLD 5J6GB 4OFYA 5K9KB 3O41A 5LWYH 4N5ED 1I8IA 1JUFB 1GGBL 1OGTA 1WAAE 2NTSP 2BVPA 3BPOB 3LRSB 2GJZA 3CMOL 3BO8A 4A6YB 4LLWA 2R8SH 2VC2L 1J8HE 3WIIH 3DBXB 1OLZA 1IARB 3BEVB 3S4SG 4HPOL 4HK0B 4NCC1 2N1KA 1NMAL 5FA3B 1EFXD 4OAWA 4R7DA 1XIWB 3PQYA 1FPTL 2DTSA 3LKNB 3GMRB 4NJAH 4Q6IC 3MLSL 4C57C 1PGRB 1RQ5A 3ARVA 3BN3B 3G6JA 2CLRA 2DAVA 3OJVC 3VXNA 5D1XB 1JMZA 1RUAL 4Y2OA 1T3FB 4ACPA 1VESA 3W2DH 2D7TH 1I85C 5EBMB 3CXDH 5L9DH 4G7YL 4XNMA 2Y5TA 1N6QH 4JFFB 5JPNB 8CGTA 5KVFH 5KJRL 1PG7W 2W0PA 3CH8A 4JO2H 1TQBC 3N85H 4NZDA 3VD5A 5KSBE 3BUYA 1MIEH 3LDBC 3V5DA 4XVTL 4O02L 1F58H 3IS0X 1FYTE 2QJDA 5K9QI 5GS0C 3R1GL 3EYUH 2I5YL 3JSSA 2ZSVB 3QCVH 1D5ZB 3IDMB 3LQAL 1JV5A 2IC2A 3RGVB 1UQSA 3DV4B 3SGJA 4WW2C 4BZYA 3RUGB 2DQTH 3RNQB 4L3EE 3ARDA 2ZCHH 4BZ1L 3VGEA 1CK0L 4YXLH 1X4YA 1AHWC 2XNAA 3RJDA 3O3EA 4R6UA 4PJAA 2FDBP 4JFEA 4HG4K 1ACZA 1YQVH 4HS6B 3TBSB 3QCTL 1F2QA 4Z77A 2WK2A 4IS6B 1CD1B 1DBBL 4M4PA 3C08L 4IRSB 2A6KA 2AV1B 5D1ZD 4QXGH 1X5IA 2DLFH 3QUXD 1C16B 2OQJA 5DVLA 4NQEB 5DJXB 1I1FA 4FQHB 1E4KC 5IROC 4WHDA 3RVTD 1QRND 4Z7QE 4CN1A 5HYJD 3VGAB 3QUYA 4OB5L 4H1LB 3TIEB 4C56D 4LEXL 2YR3A 3KPSA 5CSBA 2R0WL 1KV3A 1S78D 5CZXD 1N59A 4PJDA 3IGAB 1DSFL 1A6AB 3IRZA 5C0RL 1MRDL 3VD9A 5F7KC 3CXHK 1CFVH 1D5IL 4XCCH 2DDQH 2WSKA 1OD7A 2PNDA 1HOCA 5KSUA 5FUCC 4I3RL 3LV3B 3IKKA 3JWDL 2FX9L 3P9LA 5F21B 4XPGL 5DWUL 2W38A 1FSKC 2G9HB 4Z0XA 3MGAA 3IFLH 4Q9BA 4O2CB 5KSAD 2YC1B 4G6KL 5D7JD 5EC2B 3D69A 5DTFA 1AQKL 2GTZB 5A3IC 1EGJH 1EJOL 1WT5A 4G8IA 4ONGL 1CWVA 2UVFA 4ZO8A 3RRQA 4K7FA 3IDIB 4N0UE 1JHKL 4NKDA 2DQUH 3PWPB 1D9KC 3P9MA 3SDDB 3ZZ1A 5B8CB 3K1KC 3W0WA 4KQ4L 3O8XA 4KRPB 5FB8A 1GC1L 4NM4L 4HIIA 5AYQA 1DLFH 6CGTA 2NQCA 3MR9A 2BK8A 4HV8B 1DQML 4F57L 1JTTA 4LPTA 4JQXA 4DEPC 4OGAD 1D6VH 1L7IL 1I1AC 4JFZL 1ZLUH 1OB1B 3N0PB 3OF6D 1P1ZB 4QHNA 5KZCB 4J3SA 4NNPH 1NC4A 4LRNH 5DS8B 3K2UH 5FO7B 4F2MB 3C9NA 3KXFA 2WBJC 1EA9C 1OAQL 3BT2H 5TF1L 1WJ3A 3LH2L 4Y4HC 2VLKD 4PLJC 3O11A 2DTML 3V95A 5DMGD 2QSCH 3HUJF 4U7KA 4E41A 4XC1L 1BBDH 5I18L 3V8CA 3JVGC 3FTGA 2PW1A 5CAYB 5FV2A 3QXDA 4HUUB 5F88B 4TOYH 5EBGA 3NN8B 2C4FU 3PGFL 4KMTL 4S1DD 5C2UB 3NTCH 3GSXB 4WUUD 1NANH 5CZVH 3UPRA 3OKLB 1CR9H 4I3GA 3HCVB 4M8QB 4ZFZB 1J12A 3QNXA 3RGHA 3UTSE 3QEHA 1A7QH 3V6FA 1RUML 1U3HB 2XWJB 1IBGL 1NAMH 4EJ1C 3EJYD 3C5ZD 3CLFL 3OQ3B 3QO0B 2BOBB 3O4LA 1Y0LA 4PREA 3T0BA 1E28A 3FRUA 4LSTL 2DMKA 1OW0A 3QFJD 3RZCC 4JM2A 4Y5YB 4HT1H 2G60L 1IC1A 1TMCB 4OD2B 4IDJL 4PRHB 3QIBD 4Q9QL 4IJ3C 5SX4H 1MIMH 1IC5L 4JFHE 4FQXC 1Q72L 4EI6A 3NCJH 3GUTB 1UZ8A 3MREB 4MVBC 3FB6B 4YDLB 4LHUA 4PRID 5FKAB 2DQDH 3VRLE 2P42B 3LIZH 4KKNA 2ZUQB 1GSMA 3TA3C 4XBGA 2EDLA 3WHE1 5EPMB 5DVNA 3AXLB 4HK3J 3IS1X 1PW3A 4HHAA 1XFPA 1JGVL 5DGRA 3P73A 4KZEL 3V7AE 3EO9L 1BJ1J 4JZOB 1HH6B 2QSTA 4JHAL 2RAMA 3H3KA 4D9RE 3H42H 1WZMA 1OP9A 5FXCH 4BM7A 3MCLL 5GRZA 4DN3L 4UV7L 1QFOA 4MNQE 1IFHL 2B1AL 4RISL 1CDUA 5IGXL 4LQFH 4RBPH 4KDWA 1I7ZB 1TJGH 3D3VA 4DAGL 1M6OA 2YPLA 5CINH 4ZTPL 2BJMH 2P7TA 3R8QA 4B41A 2DLIA 4NGHL 5I17A 4PJXB 4PYHA 4P2RA 4BH7B 1YEFH 4QTHB 3VE0A 2YKLL 4JO3L 1N64L 4Y2DB 4MA8L 4PGDB 2ED7A 2HJLA 3MRJA 5EZJB 5L8KB 3ARGB 1X5GA 1QFPA 2P8MA 3RWHA 2Z91A 1WV7T 4YBLC 3GBNL 4XBEH 1QUNA 4Q7DA 4HZLB 5IT2H 2F19L 5C6TH 2JCCB 1IE5A 4UQ2B 3UBXI 4GS7B 3V52H 4ZUTA 3L7EB 4I5BA 4UTAL 5KANG 3L7FA 4JHWL 1C1EL 4XVSH 3B9KC 5FYKU 3SY0B 3WKNA 2ENSA 5DUPL 4N0YH 4HKXB 5CWSB 1NCUA 3JWDC 4G8GD 4ZG1A 2ED8A 3EFDH 3KJ4C 4QTIH 1XF4B 3C6LD 2E9BA 4BSJA 3EYOB 2R0KH 3S88L 3ARFA 3GSRB 5MEPA 2IMNA 2JLLA 2UY6A 3GHEH 4WI6A 5LCVH 2H9GA 1FC1A 1HK6A 4JDTL 4ZOEA 5E8OA 3VFWA 2F74A 2PYEA 1WISA 2F8OA 4GKNB 3MV01 4FZEH 3VGDA 3NGBC 4QRSA 4OFPA 5EIVA 3KPPB 5EU5B 3ZDXF 3FQTA 3MRNB 5KVDL 3NFPA 3LS4H 4WHYG 5F7DB 5GGUB 3MLWH 2ZUWA 1CXFA 1EXUB 1B3JA 3P2TA 4CNIB 1MOEA 1V3LA 3T4YA 1FLTX 4Y8AA 5CGMA 1AGEB 4ELMA 3RPIA 5D72L 1MUJB 3QJFB 4YGAB 4YAQA 5IQ9A 3QEGL 1AKJA 1M71A 5ADPL 1QFWH 4ONOA 5DMJB 4D0DA 1MJUH 3OKDA 4OZIA 5K93A 4U1NA 1ZLSH 4OI9A 3DXAE 4Z9KB 4ZS6C 1LVEA 2XQYG 2D2OA 5EA0L 1S5HB 5FA4B 1I3GL 3VDBA 4D9RD 1NMBH 5IESL 1LK3L 1RURL 2F9BT 5F89B 1ACYH 4QXWA 4B53A 1KLGA 1NH6A 1OTSD 2R9HC 3TBVB 4U1SA 4HF5H 4UUJA 3SJVD 3TVMB 4FHBD 1G9ML 4MWFA 5CJXA 2W9DH 2XICA 1QLFB 2JB6A 4GXUM 1WFOA 2XKNB 4OZGE 2A9NH 4TQEH 4RA3A 2X1QA 1U3JA 5IMLA 4NO2A 3MYJA 2NZ9D 1JGEB 3QPQC 1PEWA 1VEPA 2W0FB 3P4MB 2OI9C 3BIKA 3B9AA 1FZJB 1PG7X 5MEQB 2Y36L 5DK0A 4PJIA 1WIPA 3C5JB 5HGDB 2JJUA 3KS0J 3PL6B 1N8ZB 4KK5D 4NHCH 3GIVA 1B0RA 3VGHA 1JNLH 3KPNB 4PJ9B 3DV6B 1D5XB 3CFEB 2BZDA 4H88L 4K7PY 3S4SB 4JRYB 3W9DA 4AMKL 5MENB 5JO5B 3T3PF 3I9GH 1PLGH 4FQJH 4X98B 5BOZG 4OUOA 4IMLA 2VLRB 1G9NH 1CN4A 4JKLA 5DYOA 5I1CL 4QT5B 1MI5A 4X0KB 3GJFB 1TETH 1BPVA 1A9EA 2DI7A 2LVCA 1UADC 1JNNH 3IDGB 4WHYH 3SGJC 1NCWH 4ZXBD 5JQ6L 3ZTNL 1R24A 1RK0A 5C09A 3UTTA 2H2SD 3IAQA 1S3KL 5DUBA 1IKFH 5INDB 4M7ZC 3NIDF 2BNQE 3FT4B 1IC7H 5IB2A 3J7HA 5EBWB 1S7VA 5GGRY 1P84K 1U3YA 2ZSWA 4KTEH 4YGVB 4HJGA 3KLSA 4JG1H 5DK2A 1NGZA 1BQUA 3WN5A 3WIHA 4WW1B 1QSFE 2RHEA 3KPOA 2A73A 2EDDA 5DRWA