4L3ED

The complex between high affinity tcr dmf5(alpha-d26y,beta-l98w) and human class i mhc hla-a2 with the bound mart-1(26-35)(a27l) peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
199
structure length
199
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSYRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Computational design of the affinity and specificity of a therapeutic T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eD02
1EJ6A 2XTJD 4BFBD 5IOPB 2XTLA 4PRID 5E00A 1EDQA 2Q7NA 4G6AC 4GMTH 3UJIL 4OV5B 3X13B 5I17B 4YBQD 3KLDA 4F8QA 2RGSA 1FFNB 3PDOB 3VFGH 2NY4C 4UBDC 1S9XA 3RL2B 3VFNA 1MLCA 1LP9E 4PJ5B 1B6UA 1F6AB 1A6PA 5DFWH 3KPMA 6FABH 1IQDB 1F5WA 3NAAH 4KWUA 3SGEH 5BV7L 5DRZA 1MCWM 3QIBD 4XCCH 1M1SA 1LE9A 4OQTL 3S88L 3C6SA 1JJUA 4XNXH 2FD6H 5IJVB 4LSUH 3MOAH 3WNNA 1Q72L 2IADB 2GJZA 1KB9K 1OT2A 5I1GH 4HS8L 2EDTA 5T1KD 3CPLB 4X6CB 2Z8RA 3T0EA 4IOIB 4G8EB 2EIZA 4JY6A 1U8NA 4M5YH 1MCWW 2VLJD 1CE6B 1U9KA 1YC8A 2Y5EA 3PL6B 4MJ6A 2KDGA 4JFYA 3PQYE 2N4IA 5GPRA 2BHUA 3MLUH 3CSYB 3PDGA 4L3EA 4G6ML 3B2VH 4I2XB 4FXKB 1CGXA 4MDJA 4JFQA 4HHAB 3RNKB 3W2DH 3NN8A 1J5OH 2P49B 3O11B 2F8VA 4HDIA 5GGVH 4YHLL 5GQBA 1J1XL 3H2WA 1ND0B 4QKXB 4XNQA 3V0VB 4ZFOL 4OKDA 5HHQA 5I1LA 3N1MC 2VTFA 4NRZB 4MS8D 3A6CH 3MA9H 2F15A 4U6XB 3PXHA 2FJGB 3BESR 3WN5A 3FAXA 4HJ0C 1JGEA 2X70B 1J87A 4N0FB 4S1RH 1I8LA 1MAKA 1NBVH 2H45A 5JOFA 3ARBA 2VXVH 2CLVA 5EFIB 3SPVA 4LEOB 1FIEA 3CUPA 3S5LB 4X7CC 4XH2A 1EXUB 3MOBH 4KI5D 3TZVB 2X4SA 2YD7A 1P7KB 4EI6B 3NIDE 5J4MA 1OSZA 3OKKA 3TP4A 2XNAA 1QBLL 1KEGL 1QBAA 3QFDB 1CICB 4YFLF 3IYLW 25C8L 1E6OH 1A5FL 2JB6B 4HV8B 3UYOD 4OGYH 1JZ4A 1U8LA 3QO1A 3K8LA 3VXOA 3IDUA 2IH3A 3EDDA 3U7YL 3DSNA 4IDLA 2OJEA 3AS3A 1NJ9B 2ZUTA 2DYPA 2AVGA 5DUMH 5CZVL 1FFRA 1ZHKB 2IAND 3LEVL 4M61A 1PSKL 3HR5A 4EDWL 5CJXC 3QIUA 4AQOA 5E24E 1KJ2H 1XGQA 1S7XA 4RWHA 4WEMB 4LSSL 5B4MD 2Y4SA 4RGMC 3Q1SL 4P46B 5GS0C 4KRPB 3KWWB 2PN5A 4WENB 1R3KB 3DX7B 1OM3H 1FV1B 4LU5H 4Y5XA 4UU9B 2HLFD 3E3QE 5E8DL 4YWGL 1P53A 2YKLH 4Z7OE 5I30H 2PYEB 2EC8A 3AREA 1U95A 3MRJA 3SE8L 3CU1A 3RX5A 3SCMC 5C07E 4NQXA 2DLIA 1VADB 2HFFB 1NGQL 4J23A 3T08A 3VFRA 3TIDB 2ZOKB 3GSXB 3MA7A 1INEH 1FSKC 4JPVL 2Q6WB 3I75B 2PO6D 3LCYA 1FZJB 3GBML 5CP7B 1MRFL 1TDQA 1AY1H 2HLAA 3OF6D 1T1ZA 4PTUA 4GRLB 1J1PH 3C5SA 5FFLA 1HIML 4TQEL 1V7ML 1RFDH 5HHME 4H8WC 4MQXC 4RFEA 3H3PL 5CUSL 4JGJA 4MSWA 4KKCD 5EU5A 3EO1A 1SJEA 2QADB 3CZJA 3EFFA 3QNYB 5GGUA 1F4YH 3U7AA 4MXWL 1NC2A 4PJHE 4LDOB 5B39B 4A6YH 3MV8D 4XNZB 5DJ8B 1KJ3H 5DTFA 1UH2A 4F9LC 2GI7A 4N8VG 3MV9A 4BA8A 2FECI 3UTPD 4GJTB 3ZTJG 1FNFA 3VXPA 5ITBL 5KSBF 3RWJB 3EYSL 5CEYA 2AV7B 4GUPB 1S7UA 3OX8A 3HZKA 2DDQH 4TTGA 2O26U 1YA5A 1F02I 4AEIH 3V6FB 5C0BE 4JG0H 2SEBB 4GQPH 3VFPB 3WS6C 1A3LH 3TWCH 1NCNA 5IIEA 4LNVA 4KXZI 5T1LB 2ATPA 3PHOA 3D87B 1FNAA 3ILPA 4Q9QL 5I9QC 2K7QA 1TETH 2EYTB 1HYSD 3L3DB 5GRYA 2VXQL 3HG1A 1EEUA 4TUOB 4PG9B 1C8PA 3O3BA 1GC1C 3BAEL 5DC0A 2H8PB 4FQQB 3IJHA 4ZUUB 2NY6D 2I9LA 1Q9OA 5IF0B 5SWZA 3FOLB 2UZXB 4WHTA 3M45A 1SM3H 4RDQG 4WU7B 5JIIA 2H32A 5EZOL 1DQDH 3O8XB 3MLSL 2AJYL 1G9NH 2D2OA 4NQEE 3P73B 5I1EL 4Y5VC 1IC5H 1A1MB 2Y06H 4F7PA 1HHHA 3QUZB 5FM5M 4MCYA 3DO3A 1MFCH 2XQYG 2CDGA 1QFWH 3OKEB 3TGXA 1GIGH 3PWPA 5DLML 1NKRA 4WI8A 4G80B 4Z7UA 1QTYT 4O02L 2CJUH 4QOKB 5FV2A 1OSPH 2F5AH 3T0EE 2CKBL 5IB4A 4NC2B 3TVMC 4F8TA 2OXGA 2ZCHL 3SE3C 1MCDA 2JIXD 3SGKC 4V1DD 1QFOA 4KAQH 1AGFB 5ADPH 3FB8B 1QKZL 3HE7D 4HIHB 5AUMA 4L3EE 4TSAL 1LE5A 3GMPB 1KV3A 4JZOA 5I15H 5TDNA 5BVPH 3D69B 4Z95L 4X9BA 3GB7B 5JHDD 4G6JL 3KYNB 4XNMB 5HVHB 5KVEL 4HKXA 1P6AB 1WZLA 3UBXI 1BJ1J 5EBMB 1UFUA 1GZQB 4NWUH 3NTCL 3OV6A 4XBPA 1PLGH 4YDLC 5I18H 4NRYB 1FL3B 2E27L 2IALA 5C0RL 2UWEA 1MREL 1WZ1L 1I9RH 3LIZL 1JUFA 3ZKSD 1KLFA 4ZUWB 4X7SL 1OTTD 4LLUB 1C1EL 2X4OB 3TBYB 3TC9A 1W0YT 1KENL 3D39A 5IB2B 3U6RB 1KT2B 4KK8C 3VD9A 3TO2B 4HC1A 4BZ2L 3VFTA 5CJXA 4L3CA 5IVZA 3B9KB 5BV7H 4XZUA 2BVPB 2YMXH 4WI6A 1NFDA 4OQTH 1U8HA 3S88H 4OB5H 4EJ1C 43CAA 3EHBC 3K2UL 3L7FB 4K9EC 3BQUC 1QSEA 3IETA 1Q72H 5FK9A 3QP3A 2XTJE 3MCKB 4X7DC 3RU8L 4HG4J 1UWGH 4PRIE 3BKJH 4XPBL 1UCTA 3SCMA 5FUOL 3SKNB 2AK4A 2A6JA 2JK5B 3RUGE 3RZCD 4ODWB 1KNOB 1Q38A 2EYRA 3GKZA 2EH8H 1HN1A 4KUCF 4ODVL 1IBGL 5SX4I 1T80A 3MCLL 4K7FA 4YNYB 1A6ZA 5IK3A 4M62L 4KJYA 2I24N 2WUBL 2PTVA 4QRQA 3VXNB 4Y19B 4M8QA 1E6JH 4G7YL 3EOTH 2P5EB 4YHLH 1OAYH 3V6ZA 1TCRB 1T66D 4R90H 2VR5A 5ITFB 3FONB 4ODSL 3DMMC 4OM1L 3G6AA 4XPHH 5F8QC 3QO0A 4QGYA 4C58B 5HY9B 2YD5A 3BPNB 3MRMA 5J13C 4TUJB 1D5IH 4F9LA 4AEHL 3ZL4H 4KK8D 4N5UA 5DD3L 3T4AA 2XG4A 4Z7VB 2BVQB 4PJIF 4EUPH 1NLBH 1ZGLB 2AXGA 5D72L 3VWKC 4G8IB 4CBPA 5FM5O 3RWEA 2EXWD 2E6JA 3UBXB 2CD0A 4D9RD 4M1CD 1A1OB 1JPSH 2EDLA 3FJTA 3GSWB 1KEGH 5IHUL 4PREA 2VLJE 3DVIA 3C9NB 1A5FH 4F37K 3MO1B 3WS6A 5CLWA 3VGFA 1XGUA 4POZC 4ZFFA 3MV9E 1RU9L 1JWSB 3HFML 3MRNB 3STBA 3O2WL 1RZGA 3GMMB 3B3IB 4K3GA 4GBXA 4MNGB 1TZHA 3GMLA 5JO5B 3QZWB 4X4XB 1PSKH 1P1ZA 1J0JA 2Z35A 5F3BA 4JHBA 4R7DA 2PYFB 4PS4L 1OGAA 5JPMB 2YBRA 3WHXA 1H5BC 5L2KD 5LGKA 5I8EB 4K3DH 4OCSL 5IW1B 2KUTA 3BP4A 4DGYL 5E8DH 4YWGH 1NMCB 3HG1E 3I6LD 4TSBH 5DK2B 2GY5A 3DMMD 2YZ8A 4XC1H 4GRMA 3JV6B 1OW0C 3MR9A 5C09D 1CGVA 4KJQC 1FIGL 5SV3A 5D71L 5EO1A 1U58A 4CW1B 4ZUVB 1WBZB 3EYFB 1UXWB 4JO4L 5AZEL 5J57B 1BQSA 1NGQH 1WQVT 1IGYB 5HGBB 5C0FA 5GZOC 3P4OB 3N1PC 1FVDB 2OI9C 3I2CL 2AV1B 2I27N 3MLWH 5F89A 4J3UA 5HVGB 3LPFA 2IANE 3MJ9H 2ZPKL 3TVMA 4RIRB 4TQEH 1XGYL 3HR6A 1MCSA 1V7MH 2GFBB 2Z31B 3BD5A 3SE3A 2Z8SA 3S36X 4EQ2A 2B4CC 5CUSH 4NN6C 4OCRL 5IMMB 4D9QE 3PWPE 4G8GD 4UAOC 2BSRB 2AQ2A 4Z7UE 1VDGA 4Y2DB 4NPYB 1OAZL 3LEXB 4LOUC 4PRAB 4N9GA 1OPGL 3DLQR 5DFTA 5J11C 1QYGH 1UM5H 4KHXL 4OLYL 3U4BL 3BH9A 1RK0B 4I18A 4OFPA 3WDJA 3DGCR 4NBXB 4UINH 4OJFL 2ESVB 4G42B 3CC5A 4JJHA 5ITBH 3QUYC 1PG7L 4PY7A 3X14B 4ZNCD 3REWA 5DYOA 1HCFX 1INQA 4R0LB 4LLWB 4QHMB 4FABH 3VFWB 2X4TB 4B50A 1I7TB 3OAZK 4CRPA 4QWWC 4U1SB 4JFOB 2OQJB 4RAVB 1HNGA 2P8PB 3SY0A 1OGTB 1A1NA 4JKPL 2X4RB 5TE6L 3OR6B 4Q9QH 1GYAA 1N7MH 4ENEC 1IGFL 2X89D 3DX6B 5HPMA 5KN5B 1T1XB 2D0GA 5J89A 4M9OA 3MV01 2VXSL 1BWWA 3QDGD 4PGDB 1PX4A 1XGRA 4LMQE 4MDIB 3D39E 4M5ZL 3BQUA 5IBLC 3RPIA 3OR7B 4Q6YA 5ENWA 5CFHA 3SQBA 2HKHL 5I76A 4U1GB 2CDFA 1NAML 1T20A 3UTPE 3N06B 1ZHNB 4NM8H 4PV8B 4QCIB 3QH3B 3CSGA 5KSBA 4Z76B 1NUNB 1HNFA 3GI8L 5JUEL 4ZMAT 2AJYH 3D6GA 5I1EH 4U6HB 3VH8B 4YGVB 1NFDE 1MCEA 3QT2A 1BIIB 3FRPG 1I1CA 2BC4A 3HE6B 4JFEB 4NP4H 5SX5K 4PRHD 4XB7A 4PJ9C 1QSEE 2HJFB 5GJTL 4X99B 2ITDA 2B20A 1TVHB 3NZHH 2L7JA 3L7EB 3QUYD 4U33A 5KW9L 5ISZD 2AK4E 4OZ4A 2NY7L 3HPLB 3S37H 2CKBH 4ELKB 5LGJB 1ETZA 4KKBC 4S1SL 4NN7B 5GS1C 3BUYA 3MRDA 3O0RH 4GKZB 2IQAB 3GK8L 4I3RL 1QKZH 4K94C 4TSAH 3U4EB 2PXYD 3FOMB 4GW1A 5JXAL 4P2QA 2M8XA 1FNHA 1RY7B 3MSPA 1EHXA 1S7RB 4ZAKB 5AD0B 4WNQA 2B1HL 4LKXA 3VWKA 4GAYB 4RAUA 4B7IA 5KVEH 3ABZA 2GSGB 3HI1B 3F7VA 5ALCL 1NFKA 1N2RB 4PRDA 2BNUA 4WW2F 2WBJC 1AD9B 2F8OA 5M95B 1MREH 5F9DC 1WFNA 2P7TB 1MCKA 3LIZH 4MAUH 5K9QI 2CXGA 4JZNA 3LN4A 4XHJD 4Z7QF 4X7SH 5D93B 1C1EH 3VXUB 3MV7D 4YXLL 4TSCH 5AWNL 3B6SA 2Q3ZA 5EU3A 1KN2L 3TO4D 2FX8H 2WIIB 3FB5A 3WFHA 3Q2CA 2QLVB 5JDJA 4UTBL 4BZ2H 4KQ3L 3QWOA 3CK0H 3N1FC 1LMKA 3T65A 4LLQB 4P9HL 2G60H 3QEHB 5DMKB 5E9DA 1E0OB 4ODTH 1KCUL 1KTLB 1N5AB 1YNKL 1ZE3C 4P3CH 1KTRL 1H5BA 3UJTH 1WBYA 5JHDE 1E4WL 4PJ8C 4DZ8A 1F2QA 4HT1L 3IKCA 4OUUB 3RU8H 3CNKA 4MYWB 5IFJB 1D9KB 4KH2A 2VDOH 1OW0A 4KRNA 2YEZB 5FUOH 4YPGA 1U8OA 1S7VB 1F4HA 1OGAE 2NLJB 5FDWB 3A6BH 4ODVH 3WFBH 3SO5A 3KPOA 4PJXA 1H9VA 5JOPE 3KXFB 4N5EC 3U83A 3BO8B 4RRPG 4NDMB 1T0PB 3NFSL 1R3JB 2Y5TB 3TBVB 1IM9B 3H6JA 2EICA 3G5YA 4XHQA 1HOCA 1J8HD 4IHOB 2W0KA 3DI2B 3MRFB 4F15B 4JRYB 3B83A 4NQVA 3OGCB 3QULB 2GTZA 4YHNA 1RZJH 3S5LG 1DUYA 3G5ZA 3X3GL 3Q5TA 2R4SL 5EOCJ 5LCVL 5GGQL 3TH2T 3WJLC 3W11D 1JHLL 5B8CC 1KJ2B 5D72H 3T0BA 1C12A 1QQDB 5I19L 5KSAD 5D1XD 3TFKC 3DTXB 1MRCH 2AEPH 4DUVA 4RZCB 3ARDC 3FT3A 4LAQL 4BYHA 1ULVA 5D7JA 1HH6A 1BP3B 1MFBL 2F19L 1U3YA 1VENA 3HFMH 1Z3GL 3O2WH 2I60H 2BRRL 2H6PB 4X8XA 1DEDA 5GGRA 4FQIH 4KROB 4XWGH 2OK0L 3Q48A 4BUGA 1JZ3A 3FHQA 5KS9B 3R06B 2XZQH 1B6DA 3H9SB 3RL1A 1MQ8A 1BHGA 3WKML 4PS4H 5E2WH 4OZFG 1CQYA 3P77A 4XVUD 3R1GL 3FAWA 4PJIA 4WGWB 4OCSH 5K9OB 5D5MB 2BOBA 2W9DH 2Y6SD 3BKMH 4DGYH 1FCGA 3QDJD 5T3ZE 1AI1H 1QO3B 1FORL 3IGAA 3E6FB 1GGUA 2HT4C 4WW2C 5HYIA 4U1IB 1JNNL 5BS0A 1DANU 5D71H 4PJ9A 1FBIH 3IU4L 1MNUL 4JO4H 5CLTA 1HK6A 1LD9B 3QJHA 5FGRA 1IEBB 3I2CH 4YE4L 2VXUH 3TEUA 5H35A 5KSBE 3RHWF 1PQZB 4DWHA 1AD0A 3KPQB 5HJ3A 5IQ9B 2KZWA 5GRUH 3MLRL 5ANME 1R5VB 2ZPKH 1XGYH 3ARWA 3LB6D 3LD8C 5ALBH 5C0ND 5GS1A 3V7MA 3RGVD 3UAJD 5B39G 4L1DA 1KULA 1DEEA 2CUMA 3ROOB 1NCWL 3WIFB 4X6EA 5C6TL 4O2CB 1KPVA 4J8RB 1B4RA 1OP3K 4FQ1L 4OLZH 5ICZA 1DUZA 4E9LA 4BKLB 1CK0L 3RWGB 3MQIA 3FFCB 1FYTA 4J3SA 1DSFL 4OLYH 4TVSa 5DEFA 3S97C 5DRWB 3SDDD 3U4BH 4Z0XB 4LHUD 2NZ9C 5C09E 4BSVB 5I16A 2WBJA 4FZ8H 4P2QE 3GSUB 4EBQH 3QRGL 4GAJL 1CG9A 3QCVL 5EUKA 3VI3F 1KPRB 5DHVA 4NKIL 2XZAL 2R69L 5ICYB 4KKNA 4XBGA 1ZANL 1MJ8L 4QRRB 1V8HA 4JKPH 4NZUH 5JW5A 3IXAA 4X6BA 3K4ZA 5TE6H 3WNPA 1F6LL 4IMKC 3LRHA 3ULUH 5J6GB 3PGFH 1RMFH 1IGFH 2EDEA 1QBBA 4X6FB 1CWVA 2VXSH 1A22B 1CLOH 4HKJA 5I73C 1QR1A 2I07A 1MLBB 1MFEL 4PJ8A 3ARQA 3D48R 4M5ZH 2NTFB 1AGEB 4P2RD 5F96L 3WHE1 3BJ91 4PJGB 1JF1B 1KIRA 3IS1X 2W59A 4N0YL 2G9HA 1V3LA 4C56A 3BKYL 3GI8H 4GS7B 3U36A 5E9DE 4BH8A 1OOAA 1LEGA 2BSED 5HYQA 3BXNB 3R0MA 4L4VD 2EXYD 4TVPL 4KZDL 3AS0A 1CFBA 2GCYB 3U48A 1UB6A 1KPUB 3J7HA 5MHSD 2XN9A 3BH8B 5KSVA 2BCKB 3CCHB 5D1ZB 2VL5B 4JDVA 5E08L 2NZ9D 3V7AG 5HYFA 4Y2OA 5KW9H 2FO4A 2D9CA 2V2XB 5CIPA 2NY7H 2HMIC 3BN9D 4S1SH 4Z77A 4MVBD 1BFSA 3C5JB 1X5XA 4HFUH 3RI5K 3QDGE 4Y16D 3TYFA 4UDUB 1CYGA 3GK8H 1F3JB 5D6DC 3FT4B 3NPSB 2EH7L 3WJLA 4S0SD 3NABL 4ZS6D 5J6HA 1QR4A 4AEEA 5ACLA 1KFAL 2HTLC 3R8QA 5BZDA 2A73A 3AXLB 3CFKA 4DKEL 5B8CA 5BV7B 1KCSL 1RVFL 4G9DB 4PD4J 4RDQF 3UTOA 5DVLA 3K8KA 5E56A 4ZG1A 3QNZB 3ARDA 4JM2F 4XAKE 3T8XA 2G5BA 2DM7A 4NZRL 2AXFB 1FLRL 3EOBA 2A74A 4H88L 4FMFA 5DUBA 2ADFH 5DGQA 1Z9LA 5LXGH 1KN2H 4HIIB 4UTBH 1LHZA 3DRQB 4HW6A 2NY1B 2CLZA 2AJSH 4K2UL 1YEGH 3ZO0A 3TJEL 1KCUH 5H94A 1MIML 3W0WD 1FFOA 4CVZB 2VDNL 2HFEA 4OCYL 5FM4A 4DUWA 1F8TL 1QLEL 2G2RB 3B9AA 2P8MA 3VFMA 2GITA 4XXDA 4ALAH 2WQRA 4HT1H 1CFVH 4Z8FH 3WFDH 3G5VA 2VDKL 1M05B 1P4LA 4NFDA 1PZUB 3KYAA 3HLAA 3QBTB 1UKQA 3PWUA 2LAGB 4GKNB 4WW2A 1ONQB 2YD4A 4WY7L 1WAAE 4TN9A 2J88L 3T77A 1IGIL 3INUL 4LCCB 4L4TA 5IVNA 1P7QB 3KPRA 5DC9B 5I8KL 3C8KB 4PJIE 3LKSA 4Z9KB 3VGEA 2IJ0C 4H25A 2CLRB 5J1AB 4KPHH 4HWBA 1HWGB 4BM7A 4L5FH 3OAZH 3TJHC 4PRPD 5BS0E 1U92A 1ZA3A 5E7BA 3VXMD 2BVOB 5FYKD 2BRQA 2ENYA 3MRIA 4YHZH 3VDBA 1NC4A 5HHOA 4GXVL 4Y1AA 1K8IB 3RVVC 4TUKL 4GSDH 4Z0BL 5IR1A 3X3GH 3MODL 2JE8A 4DTGL 3GM0A 4GG8A 2ZSVB 1II4E 3BISA 3CLEH 4K3HA 2AW2A 1FYHB 1AO7A 1F3RB 4GRWH 1JHLH 2V6HA 1UADC 5EH1A 3GIVB 4YK4C 4OGAD 5B3NA 1D5XA 2ENSA 1FZMB 2CKNA 4QXGL 1O5DT 4BSWB 2C3XA 3WL9B 4JANA 5SWSA 3I02A 2VYRE 5FF6B 1C08B 1EO7A 1KIPB 2C1PA 4LAQH 4S2SB 3B4NA 4K3EL 5C2UB 3QXAB 5EPMA 1FYTE 4Q9CA 1Z2KA 2BFVH 3LN5A 1MFBH 1Q0XL 1Z3GH 3QZWG 2BRRH 3C8HA 3U7WL 1NDMA 1A9BB 3KLHC 3GRWL 4IMKA 1BZ9B 2LE9A 1NCCL 4B0MM 2XWJB 3CZFA 2BNRB 4I0PD 4ZPVB 1J0IA 4X9GA 4WUUD 5HGAA 2XKSA 3K3QA 4LSTL 3AB0C 4YHYB 4TPRH 2FHFA 5JW4Q 3D0LB 2ZOLB 3DYMA 4HLJA 4HMEA 5T33H 4K23L 3SDYH 3A0OA 1RUPL 3BW9A 5KVFL 3QXUA 3WKMH 1H15B 4UUJB 2IBZX 2R0LL 2E8YA 3WV0A 3FQUA 3DPBA 3KS0J 4GO6B 4YR6A 3CH1B 1F90L 3KPSB 3FKUS 4FQXB 4MLSA 1FORH 4XPAL 3TNNA 2FYYA 3D3VB 1NDGB 1MF2L 2KBGA 3FB6B 4PY8J 4JM2C 3GMQB 2J5LB 1MNUH 3RVXD 1I1AD 2FZ3B 4POYA 1SBBA 2VZUA 4C56E 3PWVB 2APBA 2MQ0A 1YUHA 1I1FA 2LABA 3VDCA 2GK2A 5I75B 3MLRH 3WHE0 3CLFL 2O5YL 3U46A 1U8JA 2XN9E 3FO1A 2GJ6D 5D6DA 2XIDA 3BD3A 3U9UB 1J18A 4ZOEA 5C6TH 3TV3L 2O61B 5EDXA 4FFYL 2D0HA 4KJWC 3FN0H 1RK1B 5F1OB 2DQDH 4U2YA 3CDCA 1VPOL 1R5WB 5J3HC 2VLRA 3D18B 1CK0H 1N59B 1TVDA 2O5ZH 5IVXB 3HI6L 1MCLA 3SKOB 1X7QA 2B7DT 5CJOL 1H0DA 4Y8DC 1G7MB 4GAJH 3LY6A 5FYLE 3P0GB 3L5WA 1BQLL 3HZMB 1DE4B 3S34H 3IDXL 3CVHA 4NKIH 1OB1A 4PJBB 1Z5LB 4OFYD 2YSSA 1ZANH 5HHNB 1MJ8H 3JWOL 1ZA6B 1T7WA 3U4AA 5ETUB 3SGJC 5JHLL 4U6TA 4YDKL 1V7NL 5DR5H 1SYVB 2LV4A 1N64L 1B3JA 2R56H 1M7DB 3BPCA 1CDUA 2DTSA 2FHCA 5F93C 2P24A 4P5TB 4DEPB 4X5XA 2CKBB 3O45A 1MFDL 2OJZL 1GPOL 1CGUA 1UEMA 2JF1A 4R8WH 3WIHL 3X12A 4HIJA 3BWUC 3VH8G 5FYKL 2APWA 4ORGA 3BKYH 1QSFA 5K59F 5EULV 3BIKA 2PUQT 2MPAL 2YA2A 3OG6B 1S9VB 4TVPH 4L8BA 3V2AR 3K80A 4F2MB 1LO2L 2OL3H 2ORBL 5TDOA 5FB8A 4FTVD 2VLKA 1BQHB 12E8L 2QKIA 3ALPA 4ZDHB 1BVKB 2OZ4A 1XF1A 4L9LC 1Q1JL 2EZ0D 2AJXH 1ZVSB 3MNVB 2Q20A 3IDMB 4L4JA 1BF2A 4M8VA 4QHNB 4WFFD 4ZYKB 5L7XL 3VCLA 1EX0A 4NQTA 4QXWA 1K6QL 5C0GA 5FO9A 3DGGA 3O9WC 2DN7A 4CMHB 4L4TE 3KPRE 1UB5A 4Z7QE 4LCIL 4MXVF 1DLFH 1KGCE 4XI5D 2A83B 4HLZG 4KK6C 4QRSA 2EH7H 2A9NL 2EKJA 2OMNA 2P8LA 4IRZL 4M4PA 1K2DA 1ZWIB 1KFAH 1BQUA 1Y0LA 4NZTL 1S9WA 2DM3A 4DKEH 4OLUL 2FJFB 1U6AH 2ICWA 4N8VA 1RVFH 2OR7A 2JB5H 2WINA 4L4VE 1XCTB 5HHOE 1S7QB 3ARRA 4Y1AE 4Q2ZA 2BMKA 5HDOA 5KG9A 3TPUB 3KJ4C 1U3ZA 4ZFZB 3RWIB 1VKXA 3ETBF 3PHQB 2XRAL 5SWQA 3CDFA 3JWNC 1P4BL 3WLWC 4OCNC 1LK2B 3DVNA 4H88H 4WO4C 1SEQL 4ZS7H 2V2WA 1G0XA 5HYJD 1I8IA 4PJEF 3NA9L 4Y4FB 2HG5A 3F65A 5SWSE 3O6MH 3MV8B 3UDWC 2H1PL 3MRQA 3SO3B 1CXHA 1JWUA 3WSQH 5LWYL 2WAHA 4DVBA 2BXZA 3ULVF 4J3OC 4K2UH 4XP6L 3VFOB 2FL5A 4CMMB 3T2QA 3UTSB 1MCCA 1S5HA 4AT6A 1MIMH 5HGHA 1D5ZB 5KZCB 1CFSB 2VDNH 3OJ2C 4OCYH 4E5XB 3P9LB 1QPXA 3V9FA 1DLHA 1QLEH 4HJJL 4KV5F 4P4KD 5JXEA 1JF5A 3BWAA 3KNBA 1BZ7A 4NKOB 5I6XB 4I8DA 2R2BA 1S7SA 5C2BL 1AGCA 1FE8L 5DJYB 3EYQC 1T0MB 5JMOC 3E0GA 3DYPA 3FO2A 3IFOA 4WY7H 4HX1A 4JM2A 2KZ1B 2K3TA 5H2BB 1B0RA 5MP6L 2J88H 3KLSA 1IGIH 3INUH 2A6KA 3AC0A 4MMXC 5IWLC 4PJCF 1ZGLM 3PIQB 5JW3L 5ERWA 3UX9B 5I8KH 3C6LD 3GNML 3IDNA 1KN4H 4XCYA 3CX2A 2XFXB 4XGZA 3GSNA 5IG7B 1LK3L 4NQDD 3OPZH 1WIOA 4PIRF 2NY6B 3WNOA 4KK9C 3KYKL 4N1EA 1L6ZA 2UUDK 3UYPA 3W9EB 3D0VB 4NJAL 3T0VA 2PTTB 5A3IC 2E9JA 4JY4A 4OUOA 4GXVH 1Q9WA 1P4IL 4HQQL 1EHNA 1VGEL 4DN3H 1FLTX 3K46A 2R39A 2HAZA 1NEZB 2R1WB 1CGSH 2LTQB 1PJ9A 3OAYK 1OT1A 1VA9A 4X6CF 4X8JB 3GMNA 3WIIL 1GSMA 5BMFL 1EHAA 2VLRE 4F7CA 4K3EH 1MWAH 1FN4B 4V1DB 2VQUA 4MJ5B 3GGWA 4XP4L 4S1DC 2NY0D 1S78D 1H3XA 3O3UN 3HE7B 3SGJA 1S7WA 3U7WH 1DJSA 5GGTH 1D7FA 4F57H 2E7CA 3N0PB 1UA6L 3QUKA 1FNLA 1A4JB 5J1SC 2AQ3A 4KZEH 1Q9KB 3AROA 2Q86A 5E5MA 1RUPH 2CDEB 3N9GH 1JPTL 2YD2A 1A2YB 5D7LE 3RPKA 1CLZL 4X0KA 4Y4HC 3PWJA 5INDB 1KUMA 4JZJB 4P23C 4RQQA 2R9HC 1Z9SA 4UI2A 1LO5A 2AKRB 1MF2H 3LSOB 1A6VH 2X1WL 1KLGA 3T2PA 3FRUA 3TBWB 3CDGB 1I7UA 3GSRA 4IJ3B 4F58L 5L9DL 4EQ3A 4L9LA 1XCQA 2AI0L 4CVWA 1G1CA 1QSFE 3GJEA 3KPNB 2F74B 4CADB 1ED3A 2CR6A 2F53D 2E8ZA 4GT7A 3VXTA 1C7TA 2BY1A 4I9WD 4YDVA 3O9WA 5J12B 2Z4QA 1NGZB 3VI3E 3WLBA 4NWTL 1K4CB 2VLKE 2FR4A 5CD3A 3RKDC 4HGMA 3F5WB 3TV3H 1SY6L 4AMKL 4FFYH 3FO9A 4WGVB 5DS8B 3IDIA 2H41A 1U93B 3NPZB 5BVJB 4AEFA 3MRLB 4YHOL 4L8DA 4QRPD 4Z5RA 4MD5B 3QUMA 2GAZA 3P30L 1YNTB 5EO0A 3SGDH 2H3NA 3Q6FB 5CJOH 5IEHB 3WDHA 1AP2A 1FNSL 2FSEA 3DBXA 1HI6B 5IW6B 3ARFD 1NAMB 2OCFD 1BQLH 4WO4A 1TQCB 3IDXH 4NO0A 1RZKC 2C7UA 3JWDC 2YHGA 5E2VL 3M8OL 1UQSA 3H9HA 3UDWA 2LU7A 5JHLH 3ELAT 4QT5B 1IKFL 1V7NH 4HFWA 4XAWL 1Q94A 3BMWA 3FFDB 5EB9A 2NY3D 4DGIL 4YXHL 4EI5D 1HXYA 4AENB 4HWEL 2UZYB 4LPWA 5I0ZA 3CMOH 1D5MB 3HAEG 1MFDH 1LILA 1LO4H 3PV6A 4JGMA 4W81A 3WIHH 2FO1A 2HH0L 3FZUD 1LGVA 1U0QA 5HHVL 4KFZC 1E4KC 1NL0L 5F88A 1C5DB 3BP5B 1E28B 1FDLH 1BBJA 2NY2D 2NW3B 1IL1B 1EFXB 1OP9A 5IWLA 3QQ9D 4UV7H 5F1KC 1GVIA 1WSST 1VACA 4P3DA 3MFGB 2R1XA 3D25A 5IMOA 5TH2A 4PB0L 1PKQE 2FIRT 2RR3A 3MLYL 4JFZL 4R3SA 3JV4A 5EC1A 2BSSA 5L2KB 3V4UL 2HT3C 5LAXA 4DCQA 3JTSA 4MAYD 3MRCB 4DVRL 3NCEB 4XVSL 1MHCA 5EIIA 3JTTA 4FQHA 2PW2A 5C0IA 4OLUH 4YHML 3TZVC 2ICWJ 2Z92A 3HCVB 5DHYA 4MX7B 4MWFB 3UPAA 3VFUA 2DQTL 1CICC 5DSCB 3VW3L 4AZ8A 3NZ8A 3HA0A 4FTVE 4LAJH 3ZDYE 1AFVL 4LBEA 3L6FA 4GW5B 2XRAH 1P4BH 3EIFA 3VE0B 4ONFL 4L8SB 4J3VA 4G8GB 4WEBH 4WFFE 4QYOA 4S1QH 4JLRA 4F9PC 3MFFB 1E4XL 4I5BA 5F7EL 3U2SB 1RUAL 2H1PH 1I9JH 3PF2A 3H7LA 3PL6D 4M93B 1MJJA 2DQFA 4XP6H 2PCPA 2CUIA 4JFDB 2ZSWB 4Q6IB 5A2FA 5CCKL 1KCRH 2R4RH 3LDBB 4NSKB 4P46C 4XCFL 4JRXD 5C9JB 5FGCE 3I50L 4KRPC 5I1HH 1ZLVK 4NT6B 4HAFA 3OBAA 4OKVA 3T0DA 4Y4HA 6CGTA 4HJJH 1T6WA 4Q0XH 4P23A 4K3JL 3QQ4B 3IU3A 2FB4L 1U8QA 5D8JH 1RJYB 3LHPH 1JHTA 5BXFB 5HVFB 3BP7B 2GYSA 1RIVL 4I1NB 1PYWA 3ZMRA 3SEPA 3UPRA 3VMPA 4LSPL 5MP6H 3RTQD 3VJ6A 2J8UF 3VD7A 1DBKL 2Q7YB 3FRPA 5MEQA 4MB4A 2ICEB 3GNMH 5F1NA 5HYJE 1HINL 4PJEA 4UOW1 5ICXB 3P4NB 3VXSA 2ZUXA 1G7HA 1LK3H 3D9AH 1U8MB 4HK3N 2GK0A 5GSRA 3TA3D 4RGNC 3LQAL 3KYKH 1U91B 1MI5B 1TCMA 4JO3L 3DXAA 3UO1H 2B8OT 4JR9L 2NMSA 2G75B 4NQCB 5FEBA 1HZHH 4HQQH 2ITCB 4XNZC 1VGEH 3C5ZD 3ESVF 3CFIC 4LKCA 2AABH 2YD6A 4NNYA 4WWKB 4FXGA 4PRHB 2X40A 1TJGH 4JVUA 5E03A 1BX2A 1FZKB 5TE7L 8CGTA 3I9GL 3P11H 4OV5A 3X13A 2FWOB 5ISZB 3WIIH 4PJCA 2JCCA 1FFNA 1TVBB 3PDOA 5TPWL 2W0FB 4QTIH 3OL2A 4UQ2B 3TYGL 5EA0L 1DP0A 4PJ5A 4XP4H 5EN2A 5TFSL 4NQDE 1F6AA 3SKUD 3MBED 4DOHB 2PXYB 3ZKNC 3GKWL 2IFGA 4LVOB 4PP2B 1ZS8B 1QD0A 3OKLB 4HMDA 1TMCB 2D4DA 3HNSL 3DSFL 4TOYL 3VA2C 5F7KC 2W65B 4WW1B 4D0CB 5IJVA 4YQXL 4HZLA 1RUKL 4GRLD 4OLWL 3I6GA 2IADA 2MJWA 3DJ9A 5DD1L 4Z7VF 4DAGH 2DQHH 4ZUTB 5F6IB 1Z6JT 1E4KA 2MHAB 4HD9A 2QADD 3MPCA 1YJDC 3CPLA 4KY1L 1BZQK 2YPLB 4X6CA 3FQWB 3MV7B 3QUZC 5L6YL 4LIQL 4MD4A 3TO4B 2BP3A 3G9VA 3TBSA 3IFNL 2NYYD 4I77L 4OI8A 3TT3L 3K81A 4FXKA 2AI0H 4HHAA 4LPXA 2B5IB 3RNKA 1MEXL 1PD6A 4OTXH 3RWHB 3O11A 3M17B 1K8DA 3V0VA 1WT5A 4RRPA 2O93L 2UYLB 1C7SA 4XBEH 4NWTH 2FJGA 5DURB 3WS3B 2YD1A 2X70A 1I7RA 2HT2D 1IAKB 4JDZB 3VXRD 1YZZA 5EFIA 5LJYH 1RUQH 3S5LA 3DWTA 3BIBX 1EXUA 5AYUH 3TZVA 2UVFA 3VD3A 5HVHC 4Y8AA 5K9KA 5HHPB 1PEWA 3HHRB 1QFUL 4CL7A 3LQZB 3O3DB 1CICA 1AHWC 4ORZC 4HV8A 4KTEL 1Z0MA 2G5RA 1RUML 1FNSH 5BRZD 4J4PC 4V2CB 3NCJH 1G7PB 1J8HB 5K59E 5EOCH 4YXKH 1L7IL 4JJ5B 3O8XD 3ULSA 1NJ9A 1QACA 3GUTA 1AGBB 3CDYA 3M8OH 5CZKA 2OL3B 4HXBH 1YEDB 1T1YB 5GS2H 3RWDB 4UT9H 3B9KC 5CINL 4XAWH 4YO0B 4P46A 1AC0A 4NHCL 1UYWH 4DGIH 4YXHH 3KWWA 4OZIB 1R3KA 3DX7A 3PNWA 2UUDH 4HWEH 1FV1A 5D1XB 4U1MA 4EOWH 4UU9A 4XX1G 2DJUA 3AU1A 4OZFA 3WBDA 1NBQA 1RHHB 1YY9C 2Z93A 4MXVE 2PYEA 3NIGF 1J0KA 5HHVH 3UEZA 1NL0H 2BY0A 2DL9A 3PDDA 3TH4T 4NNXA 1R3LB 1A6UL 4UDTA 1CD0A 1BQHG 1I1YA 4N8PA 5EZIL 3G5XB 2EKSB 5E4IA 1NBYB 3VGHA 3TIDA 1ADQL 1GC1H 4JO1H 1B4JL 1BBDL 2YS4A 1XF3B 4WI4A 1IT9L 1FZJA 1T04B 3OAYH 5K9JH 2YWYA 3AY4C 5D7SL 3MLYH 4R96B 2CSPA 3QHTC 3T2OA 5DFVC 4M48L 3OHXB 1WBXB 1CXFA 3QNYA 3PWLB 4HUWA 1GGYA 4G3YH 3MROB 4G6FB 3QDJB 1CT8B 5B39A 1WJ3A 2JLLA 4PJEE 1EEZB 4XVSH 3VXSE 4WIQA 3S3SA 3F7YB 1YEIL 2FIKB 3GBNH 1TITA 2IH1B 1K5NB 3DXAE 2P5WA 4YHMH 1CXLA 1QPPA 5GRJL 1FRGL 4GUPA 4PRBB 2X6MA 3QG7L 5C9KA 1E4JA 3RDTB 1M7XA 3IDYB 1JGVL 2DQTH 1Q9LB 3QPQC 3VW3H 2RIKA 4ZOBA 3V6FA 3BZDA 1AFVH 2SEBA 4JFFA 3DURA 5ESAB 3KYOB 4FFVC 2BNQA 1F00I 1HDMA 1VFBA 3RGVB 2CIKA 3PV7A 2NTSP 5T1LA 4ONFH 2VDLL 5E1HB 3KLAB 4XNYH 2RCSL 2A6IA 4E0RA 3QHZH 3SE9L 1LQSR 1S3KH 4DKFL 4PV9B 4QNPF 1OARL 5F7EH 3L3DA 4OF5A 4LPVA 4PJCE 4TUOA 1RJCA 1KB5L 4PG9A 1IGML 2J6EL 2HKFL 4I13B 1MJ7L 4FQQA 4PJ5E 4ZUUA 4Y19D 1P84J 5IF0A 3LKNB 3I50H 4IRJD 3MJ7B 3V4VH 3F12B 3P4MB 3MMEA 5IV2B 3WFCL 4LPYA 3AAZB 3EJZC 1NMCC 3DV6B 3P73A 4NUJB 3IJSB 1A1MA 3MGOB 4O9HL 4U1HB 4XPTL 3LMJH 3QUZA 4LVNC 1U3HA 1OP5H 4JFXB 4LSRH 4PLNC 3OKEA 5T1DH 1OAQH 3EO9L 1QA9B 5FKAB 2AJZA 3PJSA 4QOKA 4K9EH 3SGDI 4YZFE 5KVDH 5JQ6L 4GKOA 1VEMA 1K9TA 4X6CE 2Z31C 3VFVB 5DRNB 5F97E 2VH5L 4Q9RL 1U42A 2Z91A 4P2RB 4PJDB 2R0WL 4JN2B 5TQ2L 1AGFA 3RIFF 1MWAB 2Q1EA 3FB8A 3GMPA 4I2XE 4JR9H 3MRKB 4K8RD 4Y2DC 3D69A 4RMRA 4NBZB 2XA8H 1NEZG 5DJ2B 1CZ8L 3MLZL 2QSQA 4HPOH 2EDOA 1QFPA 2XT1B 4HUNB 4XNMA 3BX7C 4ZTPH 3FO0L 1JPFA 1AQDB 1BFVL 1GZQA 1UJ3C 2AJVL 4NRYA 4H20L 3I9GH 5T1MA 3H42L 4DGVH 1AHWA 3QEGL 1G7JB 2FCBA 4OT1L 4R0LC 3SE4C 2J8UA 4G9FD 5E8NA 4D8PA 3LRSA 4J4PA 1S9XB 1FVCA 1MCQA 4UB0L 5TPWH 3VFNB 5C0AD 4MJ4A 2QQQA 4LLUA 4GQ9L 5C0CD 4Y16B 5IMLA 5IB2A 4IS6A 3KPMB 1KT2A 3U6RA 4QHKJ 2A6DA 2NXZB 3NH7H 2ZG3A 3GKWH 5DRZB 1PVHA 4HK0A 3B9KA 4JHWL 1TZIB 2IAMD 1EEQA 1JGLL 3OKOA 1RZ8B 5E5RB 1S7TB 3SKMA 1JE6A 2FECL 4YQXH 4ZNEA 1RUKH 2H26B 3L7FA 4OLWH 1ORQA 2Z31D 4C54A 3X17A 1JGUL 3RWCB 3MCKA 2FDBP 5E7FA 2C3HA 3QFJA 4HUVA 4O00A 1U8NB 1KYOJ 2BERA 3JBG7 4KY1H 4JQIL 3SKNA 4MJ6B 2LVEA 1IM3B 1J10A 4JFYB 1WFOA 2J3SA 3HE6C 3UZEA 4LIQH 2X9XA 4YNYA 3RP1A 3IVKA 3IFNH 3VXNA 3AY4A 3L1OL 3EYVB 4WTZG 5CGMA 2PYEE 4HDIB 2C4XA 5KSUA 3F7RA 3IFLL 4RMVA 3W0WB 5HYSB 4LCWD 1RD6A 5HHQB 5I1LB 2P5EA 1U41A 1MHHA 4F7MA 5D1QD 5FO7A 4I48A 5ITFA 3FONA 4D3CH 1IGCL 3WN5B 5KS9F 3RHWK 3D2UD 5JDSB 4MLIA 1F11B 4F80A 1GGCH 4H5SA 1MCIA 2CLVB 4U1LA 3SPVB 4TUJA 3FL7A 4QTHB 5GHWH 1AIFB 4XH2B 4E41D 1QNZL 2X4SB 4W6YB 4Z7VA 2QQKH 4ZAKC 1YEFH 1TJIL 1OSZB 5D5MF 4J12A 4MJID 4QXUH 4N90E 4K7PY 1X5HA 1ZLVH 2B4CH 3O6KL 1A1OA 1QFUH 3GSWA 5BW7C 4M7ZC 5MEPA 4XWOC 3MOQA 3VI4F 3MO1A 4KTEH 4TNWF 2IH3B 2A1WL 4CNIA 1EO5A 5AEAA 1RUMH 3GFUA 2OJEB 5D70L 1F3DJ 3C87A 4FP8L 4PRPB 5HTSA 2DLHA 3KR3H 3V52L 1FL6B 3VXMB 1JWSA 5MEND 3MRNA 3BRGC 2DYPB 4KVNL 2P5WE 5D93C 1L7IH 3GMMA 4YX2L 4M61B 5ELIA 5A16B 4MNGA 5E4EB 4OV6F 4EN3C 3QZWA 3HR5B 1YMMA 1AJ7L 4X4XA 2I25N 1NLDH 1S7XB 3LAFA 3A67H 4JFFE 2DQJL 2BNQE 4H0HB 5CINH 3L95A 4DJMA 4NHCH 5CILH 1WWCA 3C2SA 3SDAC 1HQRB 5I8EA 2YRLA 2Q87A 5IW1A 2CRYA 3D85D 1JL8A 1U95B 5E6IA 5DK2A 2P43B 2HP4A 3OXSA 1D9KC 3JV6A 2X09A 5EOTB 3L3JB 3BDBA 3LPGA 4K8RL 3VFRB 4ZUVA 3EYFA 3QRFM 3MA7B 4H1LB 5ESQA 3ARVA 4LLDA 2RFXA 4XP1L 1IGYA 5HGBA 3P4OA 1RURL 5E2UL 1FVDA 2AV1A 3BT2L 1IT9H 1T1ZB 1YNLH 4OM0H 3C5SB 4I0PB 1GGTA 1WZKA 2FATL 3H8NA 4WUUB 1Q0YL 3O4OB 4RFEB 5H8DA 4YEEA 4RIRA 4B7LA 4MSWB 3BRDA 3EO1B 1SJEB 4LLYB 4KKLD 5F7DB 3L3GB 5DJDA 5GGUB 4Y4KD 2GT9A 4I3SL 1EJOH 4WFGE 1IVLA 4ZOCA 5IMMA 1NC2B 2BSRA 3ZE2F 4F15C 4Y2DA 4QOKE 3LEXA 1KJMB 4M02A 3QEQD 1LO3H 4Z7OF 3MV9B 3TBTA 2D03L 1YEIH 4O51B 4HCRA 3V7AE 1UJ3A 4LHJB 3L5XL 5CEYB 3DV4A 2ESVA 1I1AB 2Y36L 4G42A 2EDYA 4JFPB 4RMWA 1S7UB 2EDRA 3OX8B 3HZKB 2EE6A 3ZKXC 3C60D 5GRJH 5E8OA 4O5LL 2C4FU 5CMAB 4R0LA 3SE4A 4LLWA 2Z8VC 4HKZB 4QHMA 3BZFA 2X4TA 4K94H 1I7TA 1QVOB 5IIEB 4U1SA 4JFOA 3CU7A 2OQJA 4RAVA 5DO2D 5TQ0H 2P8PA 3ILPB 1OGTA 2JELH 2IBBA 2R2EA 2GJ6B 4NM4L 5JTWA 3OR6A 1EHLH 3SE9H 4KROC 5EOQL 3PP4L 3HMXL 2F58L 1OARH 3M1BB 5KN5A 3O3BB 1W72L 4ZODA 1HHKB 4OSUH 1O0VA 2E7HA 4PGDA 2GQHA 1IGMH 5SWZB 1MJ7H 4KMLB 3H9YA 2ZCLL 2J8HA 4UIMA 2GY7B 1QG3A 1A6WL 1X5FA 1NGXB 4Y88A 5DHVH 4X80L 1ZHNA 4PV8A 3MACL 3QH3A 3WFCH 3B2UC 4Z76A 4F7PB 4NYLB 1HHHB 1IFHH 4U6HA 4G5ZH 2V2TB 4TULH 2CDGB 1BIIA 1S9YA 3QXVA 3HE6A 4JFEA 1V3JA 4ZNEE 4XCNA 2HJFA 3S7GA 4GMSL 4TTDC 2DM4A 3V8OA 2BHYA 1TVHA 3QFJE 2Z8WC 1FP5A 3HPLA 3HRPA 5LGJA 5E8PB 4ELKA 1I3RA 2VH5H 5ACZB 3UTTA 3THMH 5ILTL 2WLYA 4JZOB 5TQ2H 3BSZH 4GKZA 2IQAA 1F13A 5TDNB 3LKPB 4OCWH 3JV5A 3RIAF 3HZYA 3U4EA 4NKMB 1ZT4B 3FOMA 2DI7A 3IF1B 3P40A 1EBAA 1UKSA 2CRZA 1S7RA 3OZ9L 4PLJC 2P5EE 4ZAKA 2P1YA 4P3WA 4MMZC 4KK5C 2LU4A 3FO0H 2AERT 4XBPB 1BFVH 4H26B 4UV4L 2IALB 5CIPH 2UWEB 2AJVH 1N2RA 1HH9A 4H20H 4OF8A 3QEGH 1JUFB 3WFZA 4OT1H 2XYCA 3X11B 4GMTL 1FFQA 3EJJX 4Z7VE 3KJ6L 1A3RL 2VZOA 3B2UD 3VXUA 1W8NA 4GQ9H 4CN4A 3L3IB 1G1YA 3WMSA 3VFGL 4EN3A 1BFOA 1KOAA 3EJYC 2ARJB 5IVZB 3ZYZA 2V9RA 2QSVA 4ETYA 5GIRB 4RGMB 4LLQA 1J0HA 1DANT 4F33A 3NCMA 3QEHA 1R24A 5DMKA 43CAB 1KTLA 3NAAL 1JGLH 3SDAA 1I4FB 2A9MH 4XCCL 1QSEB 4JFHD 5FK9B 3HZVB 4IRSD 5EU6D 4MNGE 3L9RA 4GAFB 1JN6A 1YMME 4OUUA 2XOTA 4LSUL 3MOAL 1UM4L 2X42A 3SCMB 4PJAB 1IAMA 5IFJA 1D9KA 3K8MA 7FABL 4GS7C 3BHBA 4R2GD 5I1GL 4ZPTA 2V9TA 5FDWA 2NLJA 3ES6A 5DQJA 1S8DB 3GMOB 3O81A 2Z0BA 1PG7W 4MB5A 4QRQB 3SDCD 3QISA 2AXJA 4M8QB 1LVEA 3LVEA 5F70A 3KXFA 2OM5A 3L1OH 5D1ZC 3BO8A 1JNLH 3TPKA 4NDMA 2WNGA 3MLUL 2OSLA 3E2HB 5F1SA 3R8BB 3B2VL 1BPVA 2Y5TA 3DO7A 4HIXL 4NO0D 3W2DL 2KPNA 3VGAC 1J5OL 3G6AB 3MRFA 4JRYA 3QO0B 4P4KB 4ONGH 3MUHL 3O4LA 1JYNA 3K4AA 3A6CL 3MA9L 1E4XI 3T4AB 1LEKB 5JORA 3H3KA 3OKNB 4AIZB 4CDHA 1QNZH 1J1OH 1WC7B 4N0CD 1KJ2A 4XC3H 5BV7C 4FN0A 4C4KO 4HWBH 3QHFH 1QQDA 2C26A 3C6LB 3MOBL 3O6KH 3DTXA 2H9GB 4RZCA 5MERB 1XGUB 4ZFFB 3ILQD 4OZHB 2E9BA 3V6OC 3K2MC 1N4XH 1RZGB 5D70H 3ZYIA 3UTQB 3NIGE 1NCUA 4GBXB 2ESVE 4KVNH 2ADJA 1Y6NR 3GMLB 2H6PA 4YX2H 1JZ2A 4E42B 4HBCL 5E6YA 3QIWC 1NMAL 2B1AH 5DVOA 2Z35B 3BD4A 4KJPD 2DQIH 5DUML 4F7TB 5F3BB 2D4FA 1RJZA 5KS9A 3H9SA 2NY1C 2DQJH 5DJAA 3H0TA 3WHXB 2P47B 3CFDB 4XT1C 4OD2B 1DQJA 3WD5L 3BGMA 1R6VA 5K9OA 5GRWA 5D5MA 1CDYA 5IVXF 1DVFD 1QO3A 2OMBA 4LU5L 1BD2D 1LDSA 1MCHA 4HWNA 2CMRL 2NY0B 3RVTC 5FOJA 3NCCB 2APVA 4U1IA 5C0FB 4OCLC 3K74B 4XP1H 2Z9TA 4LCCC 1LD9A 5E2UH 4GG6B 1JV5A 1DBJL 1PQZA 2FATH 3T1FB 3KPQA 5IQ9A 1GRWA 3UJJH 5DJCA 1BEYH 1AY1L 5IROC 4JFEE 1NBZA 3W39A 5D9SB 1GGBH 1F4WL 3GBLA 4WTWA 2IWGA 2DBLL 2H2SC 3ROOA 3MBXH 4AYFA 3WIFA 4KI5F 1EAPA 4O2CA 1L6XA 4J8RA 4L3AA 2XWBB 2K1MA 3KPLB 4L8CB 4BKLA 4I18B 5JOEA 2D03H 3FFCA 4QNPE 4A6YL 4KQ4H 2Y9RT 4YDLB 5DRWA 4F7EA 4U3HA 3IDGA 3L5XH 4OI9A 4YBHA 2Y36H 1INQB 3S4SG 5EU4B 4C83A 1YN6B 4X5LA 5HI3D 4O5LH 3GSUA 4JY5L 3CD4A 2EC9U 2F53B 3RQ3A 2DS4A 1EAJA 4RMUA 2VO5A 5L88L 2F54D 1G6RA 5EC2A 4JG0L 5EWIL 4QRRA 4NM4H 4DW2H 2MCG1 5TF1H 2DM2A 5J6GA 4C59B 2CK0L 1W8OA 4R9HA 3PP4H 3DVGB 2F58H 3QUML 1TETL 1W72H 1XGRB 1P7QD 3BPLB 1QRKA 4KKAC 4M6MH 4YHYC 3VXUE 4QRPB 3BQUB 4JDTL 1MLBA 2XTJC 5ENWB 1MJUH 2V7NB 2ZCLH 5M7QA 5I76B 4P2OD 2CDFB 1A6WH 2NTFA 1AGEA 5C07A 4YBQC 1JF1A 3GO1H 1WV7T 3V5DA 1SM3L 3ARFB 3HAEA 4FQJH 4FQXC 4YUEH 3S35X 2BK8A 3BXNA 2PR4L 3ZKMD 1I9EA 1G9NL 1FNGB 4JPKH 2Y25A 1HSAA 2Y06L 2J5LC 3BH8A 2BCKA 3CCHA 1FO0L 1MFCL 5D7KD 1QFWL 5D1ZA 3STZB 2VL5A 1GIGL 3QIBC 2YK1L 3B43A 4HGKC 4NO2B 5CEZE 1ETZB 2EIDA 2V2XA 1T21A 2WK2A 2CJUL 3BUYB 4EI5B 2RHEA 1OSPL 2F5AL 3C5JA 3MNWB 2MMXA 4ZXBD 4UDUA 1SHMA 4GW1B 4OBSA 3UZQA 2CIIA 3FT4A 4P9ML 3KXFE 4KAQL 3MRRB 4LF3B 4WNQB 1FG9C 5I15L 3OZ9H 2JTDA 3F8UB 2NY2B 2OZ4H 1URLA 3AMLA 1BMGA 1N8ZA 1AKJD 1JWMA 3Q3GA 4G9DA 4JRYE 2BNRD 5ID0B 4PRDB 4UV4H 1R3IL 5I2IB 3O4LE 5JIPA 4BQ6A 1KC5H 3T0AA 2QJDA 3G6JB 4NWUL 4JZNB 3LN4B 3V6OA 1PLGL 5I18L 1I7ZA 3KPPA 4XVJL 5DJZA 1TTUA 5ESVA 3KJ6H 1A3RH 5L0QB 5CJ8A 3B6SB 1I9RL 4KUZH 3KPSD 4MS8C 3FB5B 4FQXD 1ZHBA 1AR1D 3QIWA 4MAYB 5EBWA 1O7SA 1OTUD 4RFOL 2E6PA 3FMGH 3D3VD 5KANI 1OCWH 4DN4H 3DRQA 3QB7C 3L3OA 5T3XD 2R1YB 1A14H 3ZTJH 1H5BB 4KI5C 1EZVY 5BO1L 4CVZA 1IQWH 2APTA 4XRCB 2E7MA 2OS7A 2YMXL 4NQEA 3IKCB 1D6EB 1NGYB 4OB5L 3GEWB 4ZFOA 2YA0A 4CU6A 5A2IH 4GKSA 5A2KH 1UM4H 5KS9E 5E95B 4YPGB 3H9SE 2BVTA 1U8OB 1A7BA 3F58H 7FABH 1ONQA 1UWGL 3IKKA 3BKJL 5BOZG 4NIKB 4X4ME 4O4YL 4PJXB 3C8KA 5F9WB 3CFEA 5D5ME 5HYSG 4KGJA 4RBPK 2EH8L 3KYMA 5I8OH 2CLRA 4LNRB 5J1AA 4BQ8A 5F44A 1AH1A 5B4MC 3G5YB 1HOCB 4WWID 4GXUN 3CFJB 3VI4E 4JRXB 4HIXH 2ICCA 2DOCA 1E6JL 4RGOL 2BVOA 3EOTL 2GTZB 4YHNB 3TT1H 2BSTA 4CMHC 3WXVH 5HD8D 4P57B 1OAYL 4AJ0A 3G5ZB 2HLFC 4M7LT 1MY7A 5F3HB 1K4DB 4R90L 1WWAX 2OTWB 2IBZY 4GW4A 4XPHL 1N3NA 1MCJA 1TTGA 2YPVH 1AXSA 1D5IL 3MX0A 4DFIA 3GIVA 3RTQB 3MRBB 3ZL4L 1J0YA 2O5XH 2BY2A 4BSWA 3OB8A 3WL9A 2PO6C 3I6KB 5HI5D 1NLBL 5EORH 3FT3B 1QRNA 2WWMD 3ULVL 5EZJB 5FF6A 1E27B 5D7JB 4P5TD 1JPSL 3TA3B 3G08A 4MNQD 3FFCE 3QXAA 2VDRH 1XF2B 2X5PA 4KKCC 4WV1A 4OFIA 3O2DL 4ZO7A 1A9BA 3SJVA 5FO8B 1BZ9A 4HBCH 3FQRB 2E9WA 3OMZA 1NMAH 2P4AB 4ZPVA 3ZZ1A 3SO3C 3C5ZB 2QL1A 4FG6D 3D0LA 2ZOLA 3KHQA 1A47A 4LDLB 5CAYB 4PRIA 3P77B 4QRRE 1W0VA 3BYTA 3V0WH 3MYJB 1X4XA 2XZCL 3WD5H 3GMRB 3RUGA 3WEXA 5F9JB 5DJ0B 2IF7A 4JQVC 2VZ3A 3ZE2E 2Y23A 4ODBD 4PJ7B 4K3DL 3UC0H 4H1LG 5DA0B 3AFLA 2XPGB 4X7TA 4PJ9B 5LKNA 2CMRH 3G6DH 3FB6A 4TSBL 4PBVC 3MBEB 4M4RA 4XC1L 1ORSA 3QJHB 3OQ3B 4FQ2L 2FZ3A 5H35B 5IBUG 4PJGE 1AD0B 2W9EL 1JZ8A 3QIBA 1HYSC 1DBJH 5CKGA 3K1KC 2Q76A 2OTUB 2IQ9L 2XXCB 5HDBE 5GS1B 2ID5A 4LEXL 3MLWL 1ZLSH 3LKOA 3ALWA 4FQCH 1I75A 2NY6C 3MJ9L 1FQ9C 3HC0A 1F4WH 4JPIA 5DZLA 1KELL 2DBLH 3U9UA 3DROB 3NGBB 4ZO9A 1XF4B 5T1KA 4Y5YC 3JXAA 4Y4FD 5DEFB 5ABDE 2QR0A 4HH8A 2M1KA 2VLJA 2VDQH 2HTKD 5IVXA 4IOFD 4LCYB 5JW4R 1KB5B 2CR3A 5T3XL 2EDJA 1IRAY 1QYGL 1UM5L 3SKOA 1J0ZA 1NPUA 2VABB 3O3AA 1B2WH 3VA6A 2YZ1A 3UTSD 4WI9A 4R4ND 5KZCD 4UINL 5D2LB 4JY5H 1G7MA 5F9OL 4U6VH 5D7IB 5DHVB 2DWDA 4EDXB 5ADOL 3HZMA 1U3HD 2FGZA 2Y7QA 5L88H 4FABL 5JW5B 5AAMA 2VLMD 3IXAB 3GHBL 4X6BB 4MQSB 5EWIH 1IARB 5GRXG 2CK2A 2D31B 4UT7H 3S3PA 1ZA6A 2DF3A 3HE7C 5ETUA 2AJUH 7CGTA 4EEEA 3VXRB 2CK0H 4OD3H 3V6OE 1A64A 4QGTA 3QUMH 2AS5M 1SYVA 1N7ML 4HKJB 1CR9H 2QTEA 4RX4D 1M7DA 2AP2A 1MCPL 1RPQA 1ZHLB 4JDTH 3G04B 4ZO8A 2CKBA 5HHXL 5KJRH 1JHKH 2G9HB 5TGBA 3O6FD 3U36B 1LEGB 2NXYD 5BRZB 2AJ3A 3GHEL 4JZJC 3BP6B 2DLFL 5J9PA 5CD5D 1A7OL 4WFED 5H37H 1WWWX 4NM8L 1OTTC 1S9VA 2PR4H 2R23B 4U05A 2IANA 1T5WB 1BQHA 4IJ3C 1FO0H 3LOWA 4NP4L 1BVKA 1G7IA 3KDMA 1ZVSA 3E6HA 3IDMA 5CIPB 3CIQA 2YK1H 4PB9H 4ZYKA 4GFTB 4N9OB 1FGVL 3CAFA 3NZHL 3ARGD 1P2CB 5J12C 2W60A 3S37L 3L3HA 3QDMD 1FFPB 1ZLWK 4BFIB 4P9MH 1KIQA 3O0RL 4JE4B 1ZWIA 5L2JB 4EIZC 1M7IB 3RZCC 4QRUA 3QXTA 3ZT5A 2PO6A 1N6UA 1R3IH 1ZEAH 3TPUA 3OF6A 1YEHL 1ZT1B 3RY4A 3ARZA 3T8XB 4CUCA 4IDJH 4Z18A 3RWIA 3PHQA 2A74B 2DWEB 1ACZA 4XVJH 1ES0B 1IC1A 1LK2A 4QHLB 1T66C 4DKAA 5C8JA 4MAUL 5C08D 3STLA 3MRPB 3WNKA 5E2JA 4FNLH 3SDXB 4RFOH 1QRNE 2D3VA 3MV8A 2CLZB 1XT5A 4TSCL 4MHHI 1IGJB 2FX8L 5H94B 1Z9MA 5JR1H 1FFOB 3DECA 4LGRB 3VFOA 3E1F1 2HFEB 3CK0L 1D5ZA 4P2CG 5BO1H 1CFSA 2G60L 5FYJD 2P8MB 2EXWC 2GITB 4ODTL 3VFMB 3SJVE 3P9LA 4E5XA 5C0EB 4M1CC 4P3CL 3L5IA 3RZWA 3W81A 1U3JA 3I3EA 3UJTL 4JQVA 1P4LB 1IMHC 3MLTB 2C9AA 2GUOB 2BNRE 2R2CA 4NKOA 4WW2B 1NGWA 5DJYA 2Y1VA 1T0MA 5CBAB 5CP3A 2OTPA 2HJLA 4I0CC 2VDOL 5JA8B 5DEZA 3LKSB 3WE6B 5FYKU 1DQMH 4O4YH 3ULUD 4M43L 3A6BL 4H25B 1JFQL 2XFXA 3LD8B 5I74B 1BLNA 3WFBL 4HUKB 5BQ7B 5IBTH 2CRMA 3W9EA 4RGOH 3D0VA 4IRJB 1NC4B 2PTTA 1HQ4A 4HPYH 5DDHB 3PG2A 2VITA 2VLLA 3C09B 3HMWL 1BVLA 3IFPB 1VFAB 4GG8B 4ESKA 3CH8A 1KCLA 4Y5YA 4FFZL 1AO7B 1RZJL 2XACC 3QI9D 3UPCA 1D5XB 1NEZA 4D2NA 1WAAF 2R1WA 5C0JB 2W91A 4P9HC 4JM4H 3RVWD 4ETQB 4XPFL 5JPNA 5C71A 2EEBA 4WTXA 3MV11 5F8RC 3TN0D 2C1PB 3VG9B 3ULVH 4WU5B 2NX5D 4IMLA 5EPMB 1T1WB 3ROLA 1WCBA 2JIXA 2PNDA 1MRCL 2AEPL 3ALXA 4V1DA 5IVXE 4MJ5A 2BDNH 1JMZA 3O2DH 4OLEA 4KRLB 8FABA 1QOKA 4L8SC 3HE7A 4NFCA 5BJTA 2X2YA 1AC6A 2CRIA 2I60L 3QJFB 3RAJH 1DQTA 1CFTA 5C6WH 5MEOB 4FQIL 1EFXD 5GRVK 5JHDA 5IMKB 3T3PF 4XWGL 4M93C 3MCG1 4PJBE 4Q6IC 3T04D 3FQUB 2JJSC 2XZQL 3LDBC 4K55A 4YR6B 5EIVA 2D7NA 3DOSA 1A2YA 4DZBA 3T2NL 3LH2H 2XZCH 3GJFA 3MUGB 1RZKH 3JWDH 5E2WL 5INDA 5IEKA 2E3VA 4G9FB 5DRXA 2EDXA 1J86A 4EIGB 5C0AB 2VERN 4KI5E 2DRUA 5DEGA 5GGRY 2AKRA 2ZKHH 2W9DL 3BKML 5C0CB 1AI1L 4Y5VA 3ZDXF 3DX9B 4NOFA 4XCEB 4FQ2H 4D0BA 4K7PX 4OIIL 1FBIL 1YUHB 2W9EH 4JKWA 2X41A 4FS0A 4XX1E 2IQ9H 2IAMB 3KPNA 2F74A 2VXUL 3QCTL 4LEXH 1KB9J 1MHPH 1IGTA 1U8JB 3EZ8A 5GRUL 3I85A 2V5TA 3ECBA 1K4CA 4QHUB 5ALBL 1KELH 3SOBL 3SGKA 2YXMA 2VLRB 2HVJB 5DS8A 4XMPH 4ODUB 3RZCA 1A6AB 2MKWA 4OLZL 3RBGA 2QSCL 2R15A 4WWKC 1W72B 1X7QB 3U0TA 5T3XH 1H0DB 3SGEI 1RZ7H 1YNTA 5B21A 3Q6FA 4JFDD 5IEHA 2IG2H 5FYJL 1UZ8B 3T4YA 5F9OH 4LCWB 3P0YL 4FZ8L 1HI6A 1OB1B 1NAMA 5ADOH 2W07A 4EBQL 2YSSB 5D1QB 1OWWA 5C86A 4MA8L 4DKDC 3GHBH 3D2UB 3QPXH 3C2AH 4RNRA 1R5IB 4LQFL 4OFDA 1SYSB 3Q0HA 2BVYA 2PXYC 3EDEA 5D96B 4QT5A 4P5MA 4E41B 4NZUL 2EIBA 4RBPH 2X4UB 3LEYL 4XP9H 2ERJB 3QUXD 3O2VH 1MOEA 3ULUL 3PGFL 3L3KA 1RMFL 1ROWA 2P24B 1NAKL 4MJIB 1MCPH 4X5XB 3O45B 5DMYA 4HIJB 1VSCA 1F3DH 1D5MA 2VR4A 1CLOL 5HHXH 3MV8E 4O2EA 1QSFB 4YC2B 3BIKB 3PGCB 1NCBL 2VXTL 1MI5D 1OF2A 5F6IC 4BK5A 3GHEH 1N0XH 1C5DA 1CLCA 5MENB 2DLFH 4L8BB 2WBKA 4XHJC 5DQ9B 4APQD 1A7OH 1E28A 3F62A 3BEVB 5TDOB 2ADIB 5FB8B 4NQCD 2NW3A 2XKNA 1IL1A 1IC4H 3TO4C 5ANMA 1OAUL 1F4AA 1T6VN 2QKIB 4U1JB 1KTDB 4WWKD 4A2LA 3BGFB 1OVZA 32C2A 2B5IC 5FO9B 1T5XA 4OZFH 2YUWA 1FGVH 3MGTB 3H7BB 1CXIA 5L2KA 5KTEH 2QHRL 2FLBT 5F6HI 3ZKQD 1JP5A 1A9EB 3PABB 3D85B 4NO5B 3MRCA 3B5HA 4HFUL 1K2DB 5HGGS 3DMMA 5HSFA 4AH2B 5GRVL 5C09A 1S9WB 4YK4B 2WANA 4LVHB 3WNMA 3RIFK 4K71B 4JKMA 2WWKO 4MX7A 4WFEE 4AM0B 2BMKB 4CVXB 4QXTB 1HHJA 1B9ZA 4M00A 4I4WB 5DSCA 1YEHH 3S98A 3DUSA 1LO0H 3DX8B 3RVUD 3U79A 4X6DB 3CGTA 4Y4KB 1I8IB 3VE0A 4RCAA 3NCFB 4L8SA 4G8GA 1FJ1B 3LZFL 2X4QA 3DETD 4KGLA 1I1RA 3MRQB 2YPLD 2CGRL 5D4QA 2ADFL 1XGPB 3V5HA 3QEQB 4DVBB 1LDPH 4BQ9A 4PJDF 4P99A 5LXGL 1X5YA 5HGHB 3W11C 1WF5A 4V1DE 4Q6IA 1MCBA 2ZSWA 1EO8L 2YWZA 2JJSA 5I66A 4NSKA 3VDAA 4PBWD 3QWRD 2AJSL 5C9JA 3HUJF 1X5JA 1OQXA 1YEGL 3EOAA 3C60B 1TJHH 1EGJA 3BWAB 4JKLA 3KNBB 5D1XC 5KSAC 4AG4H 2EYSB 2R2BB 1AGCB 4UOJA 5DA4A 2PW1B 3FO2B 3IFOB 1RJYA 3MNZA 5BXFA 4JM2B 4ALAL 1CFVL 4Z8FL 5DURD 3WFDL 1B0RB 3FQTA 2EEDA 5SV4A 5T5FL 2NY5C 4KMTL 1SEBA 4QLRA 1P5UA 5ERWB 1EK3A 3IDNB 2XG5A 3BVNA 4M43H 5CGYD 2X89A 2NQCA 1FC1A 2R29L 1UVQA 1NUGA 2DBJA 1JFQH 3QDGA 5ICXA 5HVWA 3EZJB 2X44D 3BPOC 1U8MA 1F6FB 3MJ8B 4HULB 3QNXB 4POUB 5GJSH 1DQLL 1K85A 1YJDH 1U91A 3VWJD 4KPHL 4JY4B 4L5FL 4XVUC 1Q9WB 2BJMH 2X10A 3HMWH 2DD8L 4WEUD 2V7HA 2Y6SC 1EVUA 1XIWD 1D3CA 2ITCA 4YHZL 1KLUA 4B5EA 4FFZH 3PGDB 1T0NA 4JG1L 4PGJA 4GSDL 4TVPD 4PRHA 4G43B 2WLZA 3Q6GH 4WHYH 1V05A 1AXTH 3CLEL 3GMNB 4XPFH 1NGPL 4UQ3A 3RY5A 4YPJA 3QUYA 5ISZA 1L0XA 3IDYC 4TRPH 3PQYD 5GSVB 3VXQA 3EFDH 2W0FA 3GGWB 3LB6C 5FUZL 5C0NC 3DRTB 1C16B 3ET9F 2HVKA 3RGVC 3UAJC 1S7WB 3IB4A 3QWQB 5KANG 1YMHA 1EUUA 2BFVL 2PXYA 4RA0C 3OXRB 1KF9B 1ZS8A 4PP2A 4J6RL 1YPZB 3OKLA 3QUKB 2VNCA 1HHGB 1QFWI 2DB8A 2NW2B 4OFKA 5E5MB 5FA4B 4N8CH 3SDDC 2W65A 4WW1A 4OBRA 5AZ2H 5E0QA 4LFHD 4X9FA 4TPRL 4X4ZA 3PWJB 4BFGA 1YEKL 3T2NH 5T33L 3SDYL 2X1PA 1WAAA 1ZLWH 4ZUTA 1ZT7A 1SJHB 4P59L 4M6OL 1FAIH 4G6FD 3MV7A 1CF8L 5DQDH 4D9RE 2UY6A 3ZDZF 3TO4A 1FC2D 1WTLA 4U7KA 1JI2A 3VD5A 3O3EB 4MQ7B 1XCQB 2C5DC 4RFNB 4OIIH 1EMTH 4A6YB 4LRNH 4WUKH 1R0AH 1D5BB 1ED3B 3G9AB 3OB0K 2OP4H 3GSVB 3VXTB 3RWHA 2NR6D 2A0LD 3M17A 4ONHB 1YYML 3QCTH 2Z4QB 3RDTD 4IRSB 4WDIB 5EU6B 5E6ZA 3DIFB 4MB3A 5CD3B 2FR4B 5E5UB 2VISB 5IB5A 2J4WL 3SOBH 3O41A 1OLZA 2DKUA 1IAKA 3OKYA 1EUTA 4R2GB 5D2NB 2EXYC 4Z5RB 3FN0L 5L2KE 2DQDL 2QSCH 3QUMB 1KEMH 5EZLB 3TIEB 5HHPA 3SDCB 2H3NB 4AIXA 5C07D 1OD7A 2O5ZL 3I6LE 3LQZA 3O3DA 4OAWB 5HI4D 4L29A 1AP2B 1SVZA 2FSEB 4NQUA 5DWUH 5F7WC 2ED9A 5FYJH 3T3MF 4MA7H 3WUWB 3P0YH 4DQOH 4NO0B 5LBSH 2APFA 2C7UB 1LNUB 1MCNA 3BN9C 3HTLX 4FXLA 4YBLB 3MREB 4MVBC 4JJ5A 4MA8H 4Y16C 1D6VL 5HHMD 3S34L 3LQMA 1AGBA 2V5MA 4LQFH 1HSBB 1OY3B 2I9TB 1NSNH 2HN7B 1FVEB 4HFWB 2VE6B 3S36L 1Q94B 2ATKB 4ZS6C 3UCRA 2V5RA 3LEYH 4HF5H 4BZ1L 1KG0A 1FO0B 4YHPB 4R7NB 3C08L 5FGBC 1NAKH 3MXWH 4G8GE 4FA8A 3BDYH 5DR5L 3BEWA 2R56L 5D1XA 5KSAA 2V17H 1HEZA 1JRHL 1YQVH 1RHHA 1NCBH 2VXTH 4JAMA 4R8WL 1U36A 2WUCL 5EO9A 3G5XA 5C0BD 5IESL 1NBYA 4HKBA 1L0QA 4I0KA 4ODXB 1OAUH 5TH2B 2BVUA 2OL3L 1T04A 4YDJB 2CO7B 3OKMA 1OTSD 5J7CC 4R3SB 4R96A 1XF5A 2AJXL 5HGDA 5EUOB 5LAXB 3OHXA 3PWNA 3JTSB 2QHRH 3FQNA 3MROA 1WZMA 3QDJA 1MHCB 1HWHB 1CT8A 1DVFB 1BD2B 1JYVA 1N6QH 5JNYB 1DLFL 4M3JA 2X4PB 4PJFB 3JWOC 4FQHB 3F7YA 5SX4H 2FIKA 2NXZD 5DHYB 1XGTB 1MI5E 1T22B 4U3CA 4N68A 2IH1A 1K5NA 2D7QA 3NACH 2PKDA 5TDPB 3RIAK 1ZSDA 1WTGT 4NCDA 4NJ9H 4PGCB 1EIBA 1U6AL 4M03A 3L6FB 4MGXA 1Q9LA 2JB5L 3MLXL 3S4SA 5A1AA 3KYOA 2CPCA 2MCPL 4ZSOA 3GM8A 1CCZA 1B0WA 3RGVA 4PRHE 3HI5L 1XZ0B 3FTGB 3KLAA 3T0ED 3LZFH 1QZ1A 4HG4K 3S37X 4ZS7L 5I8CB 1MFAL 5FOBB 5E4EC 2CGRH 4PV9A 5ISZE 2VAAB 1JNHB 3EO0A 3PP3K 2DQFB 2EDWA 1NCAH 3WJJC 4PP1C 43C9B 4L3ED 1MFNA 1T83C 5IB3B 3O6ML 3SDDA 5DVMA 1KXVC 4X4YB 3CXDL 1EO8H 4LHUA 4OGAC 3WSQL 1KBGH 4OKVB 3LKNA 4Y4HB 1JPGB 1IC7L 4DOHE 1PW3A 4B41A 3MJ7A 3F12A 3IU3B 1G6RL 3IAQA 1U8QB 4U1NB 2IPTH 1CLYH 1JHTB 3AAZA 3GSOB 3ZDYF 3DV6A 1PYWB 3IJSA 4U1HA 1X5IA 2UWEF 2F54B 4NO3B 2YD9A 3VJ6B 1A6TA 2FBJH 3ARBD 3LN9A 5T5FH 4KMTH 3UZVB 5IGXH 4FQLH 5FKAA 5F1NB 1G9MC 4HAGA 2H2PD 3RA7L 4M3KB 1XMWA 3EYOB 2R29H 1G7HB 4I0PC 2P48B 2GK0B 2NNAB 5GSRB 3O4OC 2YPLE 3EGSA 4EUPB 1KN4L 3MV7E 1CIDA 1DQLH 4P2OB 1HE7A 5FXCH 4P2RA 2OXHA 4PJDA 3OPZL 2XY2A 3FT2A 1T7XA 1EEYB 1M6OB 2DD8H 4LSVL 3HUJA 5HYEA 2DYPD 2GSIB 5CKAA 3GRWA 4L4VA 4NGHL 4NNYB 4N0UB 4JG1H 1JK8B 1BX2B 1FG2B 4LCUB 1EZVX 4XVTL 1AQDA 3QIUD 4OZGB 3T3PE 1RZIA 4PJAF 4DN3L 4PP1D 3RVXC 1I1AC 3UBXG 3BE1H 5FHAH 1NGPH 5IHZB 1MVUB 4CN1A 1G7JA 3L5HA 2JCCB 4PJCB 1CGSL 4ODHH 3EOYG 5INCB 5CZXD 5EN2B 3RJDA 5FUZH 1NMBL 4HSQA 2GTWA 4IOSD 1RIHH 1GCFA 4NOBA 3ARED 1XR8B 4Y16A 4OIAA 5JZ7C 4ZXBB 4HLZH 4X5WA 1UH4A 3HKFA 1MWAL 4MHHG 4AQ1B 5B3JF 3ZDXE 1S5IH 4J6RH 4MXQD 5KBNC 1DBBL 4PUBH 5GGTL 3U0WH 1TZIA 2Y72A 4F57L 4J7RA 3TH3T 1J8HE 5FGBA 1RZ8A 1S7TA 4HZLB 1FGNH 1PFCA 3GI9H 1AKJB 4JN1L 2E7LC 1J8KA 3I6GB 2H26A 1GH7A 4KZEL 4TVPE 2YN3A 2ZWLT 2VDPH 1YEKH 3WO4C 3RWCA 4JO2H 2QBWA 1O7VA 3N9GL 2YR3A 1GOGA 3QSKB 4J3TA 1NC2D 4R4BA 4P59H 3VFSB 4MD4B 4M6OH 4U1KB 3VMOA 4ZUSA 1IM3A 4OZIE 1CF8H 4P5KA 3TBSB 4ELMB 2DQEH 3MV9D 4OZHF 4CJ0A 4LL9A 1A6VL 4EVNA 3BIAX 2IC2A 1FH5L 3IXTB 3MLPA 3EYVA 4G6AD 1CDGA 1YC7A 1NQBA 1K8DB 5HYSA 3W0WA 5DGRA 3HPJB 1BOGB 2DQUH 4D0DB 4O2FA 1YYMH 4ZQKB 2C4FT 1MRDH 2NY4D 4UBDD 5CEZH 1I7RB 3IJYB 5JDSA 2J4WH 1HCVA 1F11A 5FECB 5DI8B 4Z7WB 5JZ7D 3QAZB 4QTHA 3AUVA 1AIFA 2ZUWA 3DI3B 1X5KA 3CVIH 2YPKB 5JQHC 5K9KB 3HG1D 2IBGA 2VDMH 5JLZA 4TYUA 1OAKL 1DCLA 1A3QA 3QDJE 4PR5B 3X3FL 5SWZD 4J2XA 2QQNL 2EZ0C 4K7PH 4C4KT 4W6WB 1RZFL 4NN5B 5TJWK 2BHZA 3WIHA 4PRPA 1H3GA 1FL6A 3VXMA 3ULSB 3S96B 4LLMA 3GUTB 4GG6F 5DT1L 2OR9L 3ZT6A 3LS5L 1D6VH 5A16A 4XI5C 2IPKB 5IB1A 5C70A 4XTRC 2LVCA 3WJJA 4D9QD 3S36H 3PWPD 1T83A 3UTZA 5D7LA 4M7JL 4ZSOE 4BZ1H 2FEEL 3C08H 3PNWB 4ISVA 4U1MB 1KJVB 5CEXA 1HQRA 3AU1B 3LV3A 4OZFB 5DK3A 4F3FB 3U0PA 1GOFA 5E8EA 5IKCA 2Z93B 1JRHH 4HJGB 1A8JH 3QEUB 1Y18B 3CMOL 4NNXB 4HJ0D 4MNQB 5B38B 3GSQA 3QYCA 4UDTB 5MI0B 5IQ7L 1LO4L 1I1YB 1CD1A 1PG7X 5EOTA 3L3JA 2WUCH 2YC1B 3EUUA 4H1LA 3W5NA 3NA4A 5IESH 3W9DB 1FDLL 2VZVA 3MRGB 2VC2L 4I0PA 4WJ5B 4WUUA 4UV7L 4RGNB 4M1DH 5LQBL 3E2HC 2B39A 4LLYA 3EKCA 5F7DA 3ZSSA 4HUWB 3L3GA 2YD3A 5F7NC 2XI9A 4ZO6A 1ZK9A 2DMCA 4RAHA 2LAAA 4P4KC 4QRTB 1IEAA 4HS3A 1T3FB 3LS4H 1F42A 4HUUA 3D39D 4M6NH 4UZGA 1UWXK 1KJMA 2A2QT 5DD6A 4U3XA 2EE2A 4O51A 2Y07H 4PBXA 2P5WB 4XMLL 4CKVX 4D94A 4P2RE 4XTRD 4LLVA 4PJDE 2VRAA 2ZCKL 1I1AA 4MCZA 4JFPA 3WUZA 5GS0D 5B22A 3U9PL 4PLOB 3C6LC 3HUJE 2XY1A 3NFNA 5CMAA 1MUJB 4JFFB 3DURB 4HKZA 3MLXH 1ZVYA 1QSED 2BNQB 1QVOA 1HDMB 1TPXB 1VFBB 4G8FA 2CIKB 5JIKA 1OAXH 2MCPH 5FA3A 1X3DA 5MHSE 1UXSA 2A6IB 4E0RB 3SCMD 2GJ6A 3HI5H 4GBXC 2AK4D 2VQ1B 3LKQA 4NRXB 3KG5A 2LFGA 3LKRB 1MFAH 4WEBL 2DLGA 4S1QL 2IGFH 3M1BA 1XR9B 5DZOA 1CQKA 3OB0H 3U1SL 1HHKA 5DK0B 3RWFB 3SHSA 4RMSA 4WI7A 1I9JL 3CXDH 2E7LA 5L8LB 5IM7B 4MQXD 2F9BT 2NZIA 3MGAA 1NGXA 4HWZB 1IC7H 2W9LA 5CHNB 3MMEB 1KCRL 1CXKA 4R4FH 2R4RL 5I1HL 1CVRA 1G6RH 4J1UB 4PRNB 4LASL 3N50A 4DUXA 4NYLA 3HC4L 1DBAL 1U3HB 1JGDB 2IPUG 2FRGP 4Q0XL 3ARYA 2V2TA 2AEQL 5F1IA 4OFYA 4GH7B 2Q8BL 2NY0C 1S78C 2EEAA 5D8JL 4M9PA 1PDKA 1PKQA 3LHPL 3G6JF 4Y89A 2AJZB 3MZTA 3PJSB 2ZJSH 2AGJL 3RA7H 3DUUA 1CFNA 1ERNA 5GS2D 5I1DB 5E8PA 2Z91B 4H0GA 1JCKA 5ACZA 3HAEH 2VZTA 2YD8A 3D9AL 2VSCA 3LKPA 3O6FB 1R3HA 5C3LD 4NKMA 1ZT4A 2NXYB 2HFGL 1RJLB 4LSVH 3UO1L 3VRIB 2N56A 3IF1A 4B53A 3CFBB 5J0BA 4GBXD 4OF0A 5DJ6A 3W0WE 1CFQA 4NGHH 4G7VL 1JPFB 4I18C 1HZHL 2V5YA 3BKCL 4XVTH 1BJ8A 4XB8A 4FTVA 1NFIA 1UKTA 4H26A 1AHWB 1FNEB 3QQ3A 5T1MB 3UJIH 2AABL 5FCUL 4KDTC 1TJGL 1OGAD 3FCTA 2J8UB 5E8NB 2DKMA 3LRSB 5A2LH 4D8PB 1FVCB 5I1AA 2ZUQC 3GJFK 4N0RA 4YZFF 3X11A 5I71B 1EH9A 3P11L 4PJXF 1UZ6E 4P49A 1PY9A 3ARGB 1NMBH 4L9DA 5IMLB 5JOPD 5K9QG 4IS6B 4X83A 1LEIB 2A6DB 3L3IA 3QDMB 4GXUM 4QTIL 4XMKL 4HIEA 3BDXA 1TENA 4HK0B 4JVWA 2ARJA 4FRWA 3AVEA 3ZDZE 5GIRA 3OKOB 1DBBH 3SKMB 4PRPE 2EDFA 4UIKL 3BPLC 3VXME 5FYKE 1BJ1H 1I4FA 2MWCA 2CXKA 4JN1H 3TVMD 3HZVA 1ORQB 5IUSA 3S3JA 2XKUA 4HS8H 3LQAC 3QFJB 4HUVB 1M71A 4PJAA 4PYGA 1QHOA 5CSZA 3ARFC 4DAGL 2DQHL 4RA3A 1SY6A 4HK3J 4OF7A 5HYJA 1P6FA 1VHPA 5C08B 1S8DA 3RNQB 3IVKB 1S9KC 3GMOA 4MA3B 4RSVA 4HC1L 3FQXB 3V5KA 4BQBA 4G6MH 4A2MA 5KSUB 1CTOA 3WKNA 1FH5H 1N5YL 1G7QA 5GS0L 1CDHA 1J1XH 1MHHB 5HDLA 4HGWB 4F7MB 5FO7B 4I48B 1IZKA 2NY3C 5DD0L 4EI5C 3T3ME 4OTXL 3OKDB 5K33A 2EC9T 4H5SB 4P4KA 2WV3A 4U1LB 3OJVC 2BX5A 3MRHB 5DC4B 4WUUE 3FZUC 5EBGA 3HC3L 4XBEL 2V9QA 1LEKA 5D6CA 2AK1L 3OKNA 3PP3H 2M26A 4LGPB 4AIZA 5E94B 2I26N 1WC7A 5T3ZD 1BAFL 2NY2C 2X1QA 1CVSC 1QBLH 3QQ9C 1DDHA 1RUQL 5MEPB 1OAKH 2IEPA 4PJ7F 3C6LA 1IEHA 5AYUL 1OP5K 4NUGL 25C8H 3EHBD 3WUWG 2X9WA 3X3FH 3BQUD 2H9GA 4CNIB 3OJDB 2FBOJ 2QQNH 3ORJA 4H8WL 4NQDA 3TNMA 5MERA 2EDNA 1RZFH 4OZHA 1KCKA 1RI8A 3U7YH 4QF1B 5H37G 5C6PB 3IS0X 5F7MC 3UTQA 5L0QC 5GGSB 2ZP0T 3UROR 5DT1H 5CZVH 2OR9H 1P5VA 3LS5H 2FX9L 3LEVH 4E42A 3NCJL 1YMMB 1DBML 4MAYC 5EOCL 4YXKL 4EDWH 1RULL 1VEOA 1X5LA 4F7TA 4LSSH 3QI9B 3L95B 3Q1SH 4M7JH 4AIOA 4CN6A 4HXBL 1JBJA 5E1AB 3RKPA 4UT9L 3CFDA 1K3IA 2GJ6E 4Q97A 3RBSA 4OD2A 1I