4L3EE

The complex between high affinity tcr dmf5(alpha-d26y,beta-l98w) and human class i mhc hla-a2 with the bound mart-1(26-35)(a27l) peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
242
structure length
242
Chain Sequence
IAGITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSWSFGTEAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of the affinity and specificity of a therapeutic T cell receptor.
pubmed doi rcsb
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 54
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l3eE02
1F90L 4Z7NE 3F6IA 4PB9L 4QHKJ 5F6HJ 4R96A 3HE6A 4YHOL 2EC9T 2MCG1 2FH8A 4PJ8A 4U7SA 3TBWB 1T4KB 4CVZA 3ZYIA 4DUXA 5ISZE 4YGAB 3MLRH 2YD6A 2BDNL 4JFED 1T22B 4N1CA 3O8XA 5EOTA 4LVNC 2XKNA 1JWMB 3KYOB 2A9NL 1N5YL 1JF5A 4WI4A 4UDUB 4F7EB 4P49A 5C09A 4ZUUB 3PABB 5TDPB 4OZIF 1YEKL 3SE3A 4X7TB 5EWIH 5IUSA 5I1AA 3CFBB 3HNVL 3O0RL 4IHOB 4N9GA 3P4NA 3RGVB 2Y36H 4OFDA 3RL1B 4GBXD 3MJ9L 3ZL4H 2IQ9L 5F9JB 4APQD 3GZKA 4Q2ZB 1V05A 3T3PE 5DQ9A 4QXGH 5MENE 5F72S 3MLTB 3MRLB 3DXAE 3V52H 1IQDA 1HNFA 3IDUA 1P4BH 4JHWL 3SEPA 3DX9A 1EXUB 1RMFH 5D93C 2IADB 2DL2A 3GSUA 3HZYA 5CBAA 3SN6N 3RIFF 1QNZL 5L0QB 1OB1B 2CDFA 5LWYH 1TVDA 1XGUB 2IANA 5KW9H 2RGSA 4YGVB 3IDXH 4KWUA 4QNPE 3BPOB 1WZMA 3AS3A 4M5ZH 3GK8H 1A4JB 2GY5A 4Q74A 5J9PB 2XXCB 3VXOA 1X7QA 4NO5A 2X42A 5EO1A 1KTDB 4PR5A 5FGBC 4KJYA 1OAKH 5M94B 1NMAH 4WUUE 2Y72A 2CLZA 3MROB 4HIJA 3MUHL 5IFHL 4K9EH 2VAAB 2Q87A 3UTOA 2SEBA 4AT6A 2L7UA 5IROA 4X7SL 2ATPA 1B90A 3KPSE 3WFEL 4U1NB 1VGEH 1YNTA 3RVUC 4MA1B 1FG2A 2WBWB 2YOCA 3QIBB 5FUOL 2V2TA 4L9LC 1FNSL 2DQUL 1KCRL 4HUNB 3WKMH 3G5XB 4J4PC 5DVLA 1E4WL 4G7YH 5FFLA 3X12B 2JLLA 4Z7VF 1A6UL 1AKJA 4LGPB 1MI5D 1A7RL 1IM9D 1CL7I 2FJHB 3OKLA 4S1QH 1XCQA 2QQNL 1G7PB 3HFMH 1OP5K 3QAZC 2IPTH 1IGYA 2IALA 3U30B 7FABH 3VFNA 3F7YB 3U6RA 4NQVB 4GFTB 3VU2A 2FD6H 3FQUB 5BJTA 4UAOC 3UZEA 3WS6C 5IOPB 1GVIA 3MBED 4P3CL 3SE9H 3LN4A 2V2XA 2BZDA 1KG0B 1U91A 5IQ9B 4R97B 3RIFK 2VABB 3E2HB 5E6ID 3K3QA 3VFSA 2FX8H 4PJFA 4Y2DA 2EDRA 3L5WA 4R0LB 5C7XL 3V5KB 4YDIL 1NAKL 1PGRB 3CC5A 3QIWB 2CDEA 3O6LL 4H1LH 3EHBD 5EC2B 3BP6B 4A2LA 2EKSA 1ACYH 4GKZA 2Q20A 1GGIH 2ZWLT 4GQ9H 3DARA 4DKFH 4FQ2H 1W0VB 2IGFL 5B3JF 4JO3L 4GBXA 2AVGA 4PGBA 5IF0A 4KZEH 3OGCA 2BY1A 3BP4B 3ILQC 4XC3L 5JW4R 5BZDB 5T33L 2ARJB 3FFDA 5K93A 1I7TB 3MRIA 3HG1A 4I1NB 5MEND 4RSVA 1ZVYA 3LCYA 3BQUB 4Y5YA 1XF3A 2ZJSL 1QRNA 3KPMB 5EZLA 4ESKA 1QZ1A 2CDGA 4BH7B 2IMNA 2UY7A 4LPWA 3JUZA 3K7UA 3QUYB 1INDL 5D2LB 5KG9B 4V2BA 4NNXB 4OZHA 2EC9U 5CD5C 4QHNA 3BJLA 1XGQA 1G9MC 2BX5A 4JVPA 5GS0C 5K9KA 2J7LA 4M93B 4L3EE 4RMVA 4A6YA 4OI7A 1K8IB 3MRHA 3MRQB 1G7JB 3DV4B 5BXFA 1E6JH 5HHMD 2AP2A 4WDIA 4RZCA 2QADB 4ZO9A 5D1QA 3HRZA 4OCXL 4XVUD 4NM8L 2C4FT 3P30H 3CFJB 4Y19E 5I2IB 5GXBB 4X7FC 4R7NB 1K2DA 5AEAA 5E8DL 5L88L 2PO6A 3D0LB 3GRWH 3L5XH 1KCVH 1HEZB 2F8VA 3GJFB 1Z6JT 2BXYA 2YWYA 2G5BA 3B8YA 3KPSD 4I4WB 2R4RL 4E0RB 2G60H 1PJ9A 1A64A 2J2ZA 3IFOA 5ACZB 5I8KH 1YECL 2CR3A 2FEEI 1KB5A 4GAGL 3O2VL 4AQ1B 3KPPB 4TUKL 1FAKT 3SGJC 5EPMB 5H35B 2Y06L 4WW1A 4X6CF 1D6VL 5HDQL 3B9KD 3S34H 3BE1L 3AY4C 3QFJA 4PJEE 2P47B 3BZEA 3CMGA 4PJ7B 1JZ2A 5DJ0A 4ZFFB 3BUTA 5HGBA 5HJ3B 3SY0A 5DJ2B 1U3HB 1JNLH 1U8MB 3WFHB 4IDJH 3PL6D 4JFPA 1OVZA 1SYSB 2PW2A 5F9OH 1JHKH 3L1OL 3ULVC 2P7TA 4ZQKA 1RAMA 1WICA 1CD1A 1WZ1H 3W5MA 4GW5A 3FFCE 1R3IH 3HC3H 3VGFA 4ZPVA 4Z7UF 1YQVL 2BSED 1Y18A 4JZNA 4NKOA 1R5VB 2O5ZH 2ZCLL 3GMPB 1DUZB 4QHMA 3QUXA 4XCYA 4GLRI 4WU7A 2FGWH 3ULUH 5J13B 2BJMH 1OCWL 3HZKB 4QOKB 3QCVH 3BSZL 2NY0C 4JDVB 4ORGB 1KFAL 2UV3A 4UBDC 2EIBA 4PRPB 4A6YL 5DT1L 1QSEA 1NLDH 4KMLB 3QDJE 2E8YA 3C09C 4UT6L 4WO4B 3IKCA 2BCKA 4JQXC 1C5DA 1A6ZB 2A83B 3GNML 4LSQL 3D87B 4I0CC 1UB6A 1YY9D 5CAYB 5LGKA 5DRNB 5A16A 1SMAA 1MELA 1RIUL 3OXSB 4ODHL 3KYMB 4JR9H 2XZCH 3EFDH 4Y4HC 2ZUSA 2WMPA 3JWOL 2VR5A 4RX4D 5DHVB 3ARDC 5DUMH 3NCFB 2R0KL 4PG9B 5L2KA 5TFSL 3MA7A 4PRBA 3RIAF 1T66D 2MQ3A 1KB5L 4XCFH 4HUWA 5F8QC 4RCAA 1A7OL 4QKXB 3L3KA 1IGML 3MUJA 3O6KH 3P11H 4L3ED 1AHWC 1HWGB 2QEJA 3MLUH 2ICWJ 1CGSL 1KEGL 1P5VA 4GKSA 3NH7H 5IB4A 1CIUA 2VC2H 3ARBD 3BFOA 3VI4F 3VXMB 4LF3A 4PD4K 3DBXA 5IB2B 4YDKL 4HT1H 5LVEA 1NCCH 3MLXL 4Y19D 4DAGL 2IWGA 1I85C 3CH8A 4RGNC 3O81A 4MJ4A 5LBSL 4ETYA 2EECA 2VQUA 3M17A 5DQDH 5IHUH 2NY7L 4JJ5A 3FB6A 1CLCA 3ZDZF 3FN9A 1SBSL 2A9ML 3HCVB 2VL5B 1OTUC 4UOW0 3DGGA 3ZE2F 4X7EC 1G7HA 5GJSH 5E2UL 5KS9A 4YHYB 4OFYD 3MREB 3DI3B 4NC1C 4TRPL 4MJ6B 3RWHA 2EDQA 3HMXH 1Q9LB 3LOWA 3W9EB 1KLGA 2DI9A 4XXDB 5TH2A 1TCRB 3O6FA 1ZVSA 1MAMH 2PYEA 3GKWH 1RZFH 2DTML 3OR7B 3BKYH 4OCYL 3TV3H 2DF3A 4WFHE 1MIEH 4RFOL 2DD8L 2EDEA 4IRZL 5FHBH 3QG7L 1UWEH 1R6VA 5D9SB 2VQ1B 4U33A 4M3JA 4MXVE 1AFVH 4HH9A 4U6YB 1JNJA 3DUUA 1G1YA 4BQ8A 3SDXF 2YS4A 3WHXB 2AK4D 3RBSA 3ULSB 3RP1A 4PY8I 2VOTA 3V5DB 5MEOA 3WJLC 3GIZL 5I73B 1S8DA 1S7UB 1OSPH 2EXWD 3KPQB 1KTLB 2C4FU 4GS7B 3HNSL 5K9OB 4UDTB 5IEHB 1T1WA 3SJVB 4PJBA 1JI2A 2ZOLA 3MO1B 4MWFA 4ZOEA 3QCTH 4FQHA 4OGYL 5DMGD 3IJYB 2YC1A 4PJXA 5J1TC 3S97C 2QQLL 4OLZL 2C3XA 2PXYC 3QA3A 5HDOA 1WTLA 4JZJB 2CJUH 4LHUA 4NFCA 2F9BT 3NFPB 3VWJD 2MMXA 4U49A 5HYQA 3VFMA 4MQ7B 1P5UA 1CBVH 1UZ6F 3BZ4B 5F6IC 2DYPD 3EYUH 1RJCA 2GAZB 3QDJD 3IVKA 1DBJL 3EYQD 4RAUA 5C9JA 5D70H 4LP5A 3UTSE 1KOAA 4TPRL 4RMUA 1YY8A 3H9SB 3H6JA 5T5FL 4CU6A 3RTQD 4GJTB 4XPHH 1HHJA 1UEMA 5DJZB 2P8LA 4QXTB 4WV1A 4D9LH 2BVQA 5FYJH 4L4TB 4ZXBC 5B8CB 5C1MB 4EN3A 4JPVH 1AI1H 4IMKA 5IR1A 3S98A 3MNZA 4L8DA 5FUZH 5DWUL 5BV7C 5HGGS 1MREH 3R06A 4Z8FH 1WISA 4QRRB 3SGKA 3PJSA 1QYGL 3B5HA 5DJ8B 5EBLA 2C5DC 3E6FA 5GS2D 4HCRH 1XF4B 3VFOA 2BMKB 4X5LA 3ARWA 4ENEC 2VLRB 5F1NB 3VGAC 3ZKQD 5C0BE 4NGHL 4FTVB 2ZUQB 5GISL 4J6RL 4JE4B 5SWSE 1JK8B 3CGTA 4D0DA 4LNRA 2CXGA 3VD3A 2IAMC 2V5SA 5DDHB 4MB5A 4MDJB 4MA7L 3D18B 3GHEH 2ORBH 32C2A 4NQCE 4P46B 3MTRA 1NGQL 1FL5B 5GGRB 3R8BB 1S9VA 3FQTA 3RUGF 4B5EA 4KAQH 5T5NG 4APQC 3TIEB 1E4XI 1A4KA 3C60A 5CEZD 4ODSH 1A6WL 2VXUH 1TZIB 5C92A 5J56B 4QGTA 5TGBB 3WXVL 1BJ1J 1U8LA 1JPFA 5DUBA 1D5ZB 2WBJC 3DTXB 3FN3A 3L7FB 1ZGLA 3GMLB 1RUPL 5IVXE 1HSBB 3OJDB 1VACA 3L3IA 4UV4H 2J8UF 2DQIH 3A0OA 4JG1H 1YEGL 3GBNL 3T0EC 1PLGL 3I02A 4M6AA 4ODXA 1F3JB 3C6SA 3TO4C 1NGYA 5E5MA 4U6XB 2NNAA 4JHBA 4Q97A 1FZKA 1X5JA 3QG6A 3H0TA 3U4EB 4U6TA 1EFQA 2L4OA 3UBXA 2VDPH 4DVBB 3NACH 3M1BA 1JNNL 3KNBA 3GSRB 4OIAA 1T03L 3S5LA 1Q0YH 2VQTA 3CVIH 3T77A 4XPAL 5D7SL 1MQKL 1INQB 1UCTA 2VKXA 1S7XA 3MCKA 1AGEB 5DJ6A 5E8PA 3CXHK 3HNTH 4ZSOB 2XZZA 5DRZA 4NUJB 3VE0A 1L6XA 4P23C 2ADJB 5EORH 4DZBA 3U0TB 2Q7YB 5EA0L 4X99B 4NZTL 4IOFC 1KJ2A 3DETD 1CG9B 3D25B 1HH9A 2EXYD 1CTNA 4GXUM 1CXLA 4LP4A 2FJFB 4GRWF 5EBMB 4K3JH 3U4BL 2A74B 5I19H 5ID0B 3NIGF 3RPIB 1I1YB 4P5TD 5D96B 5IIEA 5K59F 1BF2A 4HUVB 1SJVA 5C86A 1UKSA 3FT4B 5EUOE 2CK0L 3P9MB 4K3EH 3GEWB 4BUGA 1JHTA 2B1AH 3QJFB 3EYOB 1S9YA 1F4AA 4ZS7L 5DJCA 2HJLB 5C0EB 1MCOL 1QLFB 2ZSWB 1MIMH 1U8QA 5E6IC 1A9EB 1DBAL 1A6AA 1FH5L 2NTFB 2XWTB 5JPMB 1N0XL 4KHTL 1A6TB 2JJUA 3HPJB 1G7LA 2H9GB 3NPZB 4K3GA 4BSVA 3EHBC 1AGBA 4XP6L 1NL0L 5SWSD 2VIRB 2ZOKA 4L9DA 4LDLB 1HHKA 3INUH 1DN2A 3GMQB 4NQCD 5E56A 3WD5L 1BX2B 1U8HB 1YMHB 4PRNB 4EI6B 1Z5LA 2JIXB 3IS0X 3WIIL 3MRMA 2P1YA 3JWDH 3ROLA 1FGNL 2FIKB 2CRMA 2HA1A 4I0PB 5B39A 1HDMB 3UTPE 2KZ1B 2PKDA 1FFQA 5CSGA 5CJQH 1OAUH 1T21B 1CFQB 3C5JB 4HKBB 4LHUG 4LPVA 4YXKH 4F33A 3L3JA 4UV7H 5IB3A 1GGBH 1KELL 3KHQA 3OXRB 3BMVA 2X2YA 3ARVA 3NABL 2CQVA 4P2QD 5I75C 2G75B 2D9CA 2QSCL 5L8KB 3EOYG 3S9DB 4LPTA 2P24A 3L6FA 1CFVH 2R2BA 2DQCL 1AGCB 1HQ4B 4I2XB 3DX8A 3X3FL 3EOAB 3CX2A 2DOCA 4XAWL 3RU8H 4I9WE 4UU9A 1AGFA 3BGMA 2LAAA 4HAGA 4XVUC 1AQKL 3V5HB 3OHXB 1PYWB 3BAEL 2CLRA 2D03H 4RFEB 4KXZI 4L4VB 4NIKB 3AS2A 4K94H 2ICWA 3ZKND 4HIIA 4R26H 2Q1EA 4KRPB 4LIQE 1T2QL 5E2WL 1BF8A 1OAZL 1KXVC 2HMIC 3RHWF 2EICA 3OQ3B 1F58L 1E27B 1HNGA 1PQZB 1WC7A 5ADPL 1E4JA 2W65B 3LIZH 3HC0A 4N5ED 3P0VL 3MFGB 3GMMB 3B9AA 2Q7NA 2DQTH 4TVPH 5DJYB 5IVZB 5B38A 4JFQB 3FRUB 4ZUSA 3VXTB 2R4SH 4HX1B 1OP5H 4M48H 2WP3O 1T5WB 1A1MA 2JCCF 3B9KC 4G6JL 4JRYB 1GGCL 4ODTL 4O9HL 3P4LA 1VEMA 3I50L 1GPOH 3MODL 3RGVD 5DS8A 3LD8C 3CPLB 4OZHF 5TE7L 3QWRD 5CEZL 4LVHB 5KOMC 2PTTA 4HF5L 2DQFB 1NC2B 4QXWA 5JZ7D 3S35X 3O4LA 4H1LB 4HFUH 4YHLL 3O3EB 4MD4A 4U1SA 1CDBA 1LDSA 4M8QA 2E6PA 1NBQA 2RHEA 1MNUH 1JRHH 5D2LE 3K1DA 5HI3C 2UWEA 4CN1A 2VNCA 3SBWA 1AE6L 1EDQA 2XWBA 4X9IA 4D94A 1OWWA 1E28B 4L5FH 2A6KA 5FIEA 4YR6A 4G5ZL 1DQJB 3V95A 3RWJB 4GLRH 1J5OH 3TN0A 3O9WB 1IFHL 3DUSA 4X6EB 4OCSH 1A7PL 2HVKA 3S5LG 1JE6A 5C6WH 2X44D 3GMNA 3V6ZA 4Y1AB 3UTPD 3CX5J 3HUJB 1FIGH 3RHWK 1TLKA 3QEUB 5T1KA 1AGDB 3L95B 5IG7B 5LCVH 1ACZA 4XHQA 2R0ZH 4X4XA 5ENWB 1YN7B 4R2GC 4OUOA 2XNAA 3QQNA 1LEKA 1U0QA 2VXQH 3EYSH 3LEYL 5GGQH 4HMCA 3AUVA 3K2MC 4XI5C 3CLEH 5E2JA 3QIBD 1T66C 3LPGA 1SY6H 2Y07L 3FO2B 1YPZF 5JNYA 4H26B 1G7IB 2DQDH 4I9WD 4MNGA 2X9WA 3ARBC 4LEOB 1SEBA 1S7TA 5LXGH 3TYGH 3V4VL 1VA9A 1NDGA 4OD2A 2MQ0A 4BZ1L 3TF7C 2XTJB 1F13A 5IM7B 2BRQA 3TCXA 5E2VL 4JFZL 3FB5B 2Z31D 3F62A 5DK2B 5F7LB 1KXQE 3P2TA 1JFQL 3KVQA 1H3GA 2CRYA 4Y4FB 5D1ZB 5DA4A 1JGEB 1AC6A 4D9QD 2HRLA 3KYOA 4NRYB 3FJTA 5I8OL 4KY1L 5HI4D 1QBMH 4LQFH 5ETUA 4F7EA 5EO0A 4ZUUA 3K8LA 5KJRL 4M6OL 3IXAB 4NO2B 2WQRA 4QOKE 3V7AG 1OL0A 4ZFGL 1FSKC 4H25A 2WIIB 1I9JL 5K9JH 4PRPE 1C5BH 2M26A 2O61B 2FYYB 1RZJH 1P9MC 4EUPG 5I8EB 1ONQB 1N6VA 2GUOB 2XTLA 4Q6IB 4HHAB 1QQDB 2H26B 5DA0B 5T3XH 2HLAB 1EMTH 3H7BB 5AWNL 3HA0A 3UTQA 3ZT7A 2IADA 3QDMB 1UGNA 5DMGC 1RK1A 1BFOB 2FECL 2HVJB 4HEPG 2V17L 5CZXD 4S1DD 4Z76A 5ILTH 1NUNB 4JHAH 4OZGA 3D2UA 3RA7L 1A3QA 2R29L 2DQJL 1BZ7A 5GGVL 1DL7H 1DZBA 1NBVL 4F2MB 4U0RB 2HFGL 1I4FB 1NUDA 1IAIL 3QHFL 2AEPL 3WNKA 3WUWB 5L2JB 3H9HA 2D7OA 2VDQL 5E1HB 5FYKL 5LQBL 5EB9A 3HS0B 1RZGA 2QADD 2HYMA 3VXME 1XR9A 4KROC 4MX7B 5CFHA 4U2ZA 4HGKC 4QCIA 3P4MA 4QRQA 3RVVD 3O2WL 4JREC 1YYLL 4JFFB 5F7EL 4UINH 3Q48A 4FFYH 4WUKL 1MFCH 5HVGB 1JPSL 1I3RA 3QNYA 4AEIL 3IETA 2RCSH 5ELIA 4NKDB 2WUBH 2AK1H 4NHUB 1CFBA 1BJMA 2H3NA 3QIBA 1CU4H 5EIIA 2FATH 4S2SB 5KSVA 3TZVB 2GK0B 2X4RA 1EFXA 1NCBL 4NZRH 2EYTA 4M1GL 2EDNA 2K1MA 3EO0B 5DMKB 1JPTH 1MRCH 3S7GA 4NP4L 1G7PA 1L0XA 4LL9A 1ULVA 2RR3A 3N1PC 3Q0HA 1QRNE 2JKXA 3FQWA 4NPYB 3GO1L 2HFEA 4PJXF 4JQIL 3HLAB 3FQUA 3V9FA 4HIXH 4V1DB 5D7LB 3D0VA 5IOPA 4W6WB 5DYOA 2C1OA 4XX1G 1CLOL 4HJ0D 1ZAGA 4K71B 4F8TA 4K8RD 4PJGA 5D1XA 2WAHA 4NM4H 3G6AA 3SJVE 3TBSA 5CJ5A 5KTEL 3CLFL 3C87A 3BEWB 4P4KC 4AMKH 1IGCL 3TCLB 5SX4H 3IS1X 3QIWA 1AO7B 1E4KC 1QKZH 5EOQL 5ICYB 3V4UL 3CK0H 4MSWA 4ZPTB 2YZ1A 2YPLB 5SX5K 4GG8B 4JFDA 4JG0H 4QOKD 1P7QB 4PBXA 3F6LA 4QRPB 2X7LB 3UDWA 1QSFA 2VDKL 4QGYA 4PRPD 1W0VA 1FL6A 1HYSD 5TPWH 2NQCA 5JDSA 4OUUB 4HS6B 3ZKXB 3AM8C 4E5XB 5AZEH 1D5IH 1EEYB 5BZDA 3IFNH 1DE4A 1WCBA 5K33A 5L9DH 3SQOL 2BHZA 3A6CH 3BQUA 1Z2KA 1TPXC 4XNYH 4PGEB 3DROB 4XC1L 4U1JB 2N7AA 3TJEH 1YC7A 5HYJE 4JGMA 3MLZL 4L4TE 3VRJA 3QUYA 1UXWB 3JV6A 5DVMA 4X6DB 4LLDA 2Q86B 3N1GC 1HH6B 5DZLA 3MRCB 1JL8A 4PP1D 1G6VK 2XKUA 4PUBH 4KHXH 4HWEH 1NKRA 3MRQA 2L7JA 3C5ZA 3VRLF 4H88L 3GMOA 2H8PB 2Y25A 5C0CE 2EDWA 3G6JB 4TULL 2WWKT 3NPSB 2R1XA 2DM7A 2FR4B 4PJ5E 3JWNC 4YHKL 3N85H 3VXMD 5DD0L 1LEGB 4MZ2A 4FTVE 4X5WB 3MV11 12E8H 3BOVA 2H6PA 3SDYH 2YMXH 1IGIH 4XVTH 3BPNB 2LU3A 3PDGA 3SOBH 1ZK9A 5JQ6H 4U1GB 2G5RA 5HHXL 3E8UH 3BN3B 2VZSA 1D5XB 3MZGB 1QSEE 4JRXE 2IH3A 3NIDF 2WUCL 1FVDB 4EDXA 3NIFE 4RIRB 1EJOL 3KPPA 5CP3A 3EDEA 1QHPA 1FGVL 4AY0A 3BISA 1I8IB 1QFPA 1U8IA 2X4NB 4I77L 3U9PH 3QHZL 1CVRA 4PGZA 1XZ0B 1XT5A 1I1AB 1U3HA 1JV5A 2YK1L 3UO1H 2OSLA 4PGCB 4BZYA 2W1NA 1CLYH 1NBYB 1BVZA 4I3GA 1O5DT 3GJEB 1HOCB 5JW5B 3TO2B 3PV6A 3QEHA 3MCG1 4M7JL 5I1CL 5IV2B 3MJGX 4XZUB 3MPCA 3BUYB 3UPCA 4GAYB 4XPBL 1MUJA 2CKBH 4QRTA 4LSTH 3SJVD 5CHNA 4WI3A 2X10A 1F00I 4IIQB 5AD0B 1ZLSH 2F8OA 4JFOB 1WT5C 1EZVX 1G7QA 4ETQB 3FONB 4JO2L 4DQOL 4WU5A 5IBTL 4Y8DC 1Z9SA 5E1AA 2NPLX 2R2EB 2VISB 4ZSOE 1J10A 1E6OL 3TT3H 1MHHB 1F4YH 3EOBA 4WO4A 4DKEH 4OD1L 1QFWI 3MYJA 2KQNA 3MGTA 3NAAH 3FB8A 5HHOB 4UUJB 5KS9E 1HXMA 3BD5A 4LASH 5JPNA 3H9SD 3ZYOA 2M1KA 5FCUL 2F54B 4HUXA 5DMIH 3WXWH 4V2CB 1KCUL 2RBLA 1T2XA 3ULVH 1UZ8A 1M7IB 5CZKA 1NFDB 3LHPL 4XNUH 5HYJD 2LVCA 4L4TD 2OQJA 2PYFA 1AJ7L 3NA9L 2GIYA 3WE6A 4Y5VB 3RL2A 4XPTH 1KJMA 3IGAB 4HKZA 4QRRD 3DPBA 5CZVH 1GOFA 2QL1A 4QYOB 5AUMA 3LPFA 2F8XC 1L7IH 2BSTB 2DMBA 2CGRH 5CJOH 5KSUB 1H8NA 1BGXL 5E08L 5C0CD 4N5EC 2VLRD 5IB2A 2KQMA 2OL3A 4JQVC 2DLTA 3TBYA 3L3HA 1UA6H 1CE6A 3ZHLA 35C8L 1YEDA 3F8UB 5KSBB 2NMSA 4FTVD 4PJBE 2I07A 1OM3L 5ANMA 1DJSA 3RVWC 2CMRL 4MAYB 1T83C 5F96L 3DGCR 5ACMA 4DCQB 1IC1A 3MUGB 3LN5B 1RJYB 3G9AB 4P46D 5H94B 4EQ3A 4L8BA 5E8EB 1Q9LA 1KCSL 4K3HA 4UZGA 1KTRL 3ES6A 2AGJH 5FYKU 1DP0A 4R8WL 3VFVB 1J0JA 43C9A 1TDQA 4P9MH 3FT3B 3QZWG 3I84A 2PR4H 3V0VA 1T80A 2XKSA 1QA9B 4U6YA 4M62H 1CLZL 4WW2C 1HQRB 2W0PA 4EJ1C 5I76A 2A73B 3ULSA 1PY4A 1AH1A 2VDOH 2FX7H 3QXDB 2VLJE 4ZOAA 3V5DA 4IRSB 1JUFA 4I2XE 2H2PD 3F7QA 3T4AB 3MXVH 4LGRB 2EDBA 4QXUH 2WANA 4URTB 4XVJH 4BFGA 2VLLB 4LCYB 2FX9L 1RFDH 4RGOH 3B6SB 2AERT 4GH7B 4FQIL 1ED3A 1U8NB 2Z91B 4D8PA 4OZFA 1K8DB 4AG4L 3NFPA 3Q5YA 2E7LC 1LGVA 4WI6A 3AFLA 4KDTC 4BSWA 2XQBH 3EZJB 3K8MA 5DEGA 1M71A 1Q1JL 5F1IA 4YHNA 3X14A 1JHLH 5EU3A 4OCWH 3ARUA 1I75A 1FNGA 3Q2CA 5C3LD 2R9HD 1X5LA 2F58H 4PYHA 4OZ4B 2E27L 1D9KC 2AJZB 1TQBB 4C4KO 2F53A 4LMQE 4ZFOB 4ONHA 5IHLB 1CF8H 3CDCA 3OG4B 4G9FA 1A14L 2K7QA 4QXTA 2ESVB 4FFZH 1QLEL 3MOAH 2MQCA 5ADOL 4EIZC 2FBJH 1UM6L 3IJHB 1MJ8L 4M6MH 2UWEF 1WEJH 2XQYK 4LCCA 5DJ8A 4RFNB 1LILA 3TYFB 4U7KA 9CGTA 4TQEL 2Z31C 1T0MA 1DLFL 3LQAC 3GSVA 5FGCB 1DVFB 4PJIF 1YEHH 5J7CC 1IZKA 3I9GL 3AGVA 3G5ZA 4X6FB 3PWJA 5DZNA 1KENH 3KLDA 1LMKA 4MA3A 2DM4A 5KANI 4R0LC 4YDVA 3KG5A 3VFRA 5EZOL 4DK6A 3OG6B 4CKVX 3RAJH 4NC0B 5IVNA 4PRHA 4ZNCD 3D5OF 5F7KC 2ERJC 3UZQA 4C56A 1J11A 3ESVF 3IT8D 4G8IA 3VH8A 3HZVA 3KWWB 1S9KC 1J0HA 1NGPL 4OLWL 3QR2A 4XCCL 1T3FA 3RVTD 4O02H 1ZTXH 1DUYA 1W2KT 2FO4A 1HZHL 5GGRA 3OAYK 3G9VA 1IC4H 2R0LH 5HHQA 1FYTB 3AMLA 4F9PA 1WIOA 4I0PD 5TGBA 4I3RH 4EIGB 3N1FC 4MCYB 4LLWB 5J3HC 3HUJE 5BV7H 1W0YT 5BVPH 2FH6A 3PGFH 5BW7A 4NQUA 1N26A 3OSKA 4MJ5B 1LE9B 5JORB 2DMCA 1Q72H 5CZXC 3W5NA 3RWIB 4S1DC 1H5BB 1TETL 2PCPB 1F3JA 3W39A 2X89A 5IW1A 1MFEL 1G6RA 3LEVH 4KKLD 1TZGL 5E94A 1GZQB 2VLJD 3RNQB 3NBNA 3GSNH 4M93C 4LOUD 2PW1A 1YNKL 2HWZH 3SDAA 5FF6B 3CMOL 3HE6C 1T1ZA 5LGJA 3JTSA 3Q6GL 1FQ9C 4PJ8C 2EE6A 4TUJB 2EO1A 4L8CA 1MY7A 1F11A 2W0LA 5DXWA 1EV2E 1C16B 1CDCA 3RVVC 4PTUA 3O8XC 1K5NA 1U8JB 2XTJE 5E7BA 4L4VD 1OAYL 1HI6B 4XP1H 5GRYA 5FOBB 1INQA 4JANA 3T2QA 2AJSH 4KRPD 1JWSB 4AQOA 1T7YA 3V7AE 4NUJA 1KV3A 3SE3C 2QKIA 1ETZA 3SPVB 1TJHL 2OX5A 4FQQA 3HR5A 3BPCA 4F9LA 2R0WL 4D0BB 3UTTA 1CG9A 2C1PB 4H5SA 1MH5B 3F5WB 1BBDH 4PLJD 3KPTA 4XT1C 4UIKH 1RURH 5EBMA 1IT9L 4JRYD 1C7TA 2B4CL 1OAXL 3RPIA 1M7DA 3MLWH 4XWGL 1NMCB 1HCFX 5GGSA 1A2YB 3FT4A 4OZGF 4PRIB 3MR9A 4UNUA 4N0UB 3TFKD 3FRPA 1ZA3A 3S8WA 2IQAA 3QWOB 4P5KB 5CJXA 5FO7A 5DD1L 1EZVY 3K74B 1NC2D 3NCMA 5F1SA 2HJLA 5C0EA 4K8RC 2ZSWA 4J8RB 1UCBL 3QDME 4LLQB 4MMXC 3L9RB 4LBEA 4DGYH 2H9GA 3BN9D 5GRVL 4ALAH 5LGHH 3RI5K 4PREB 4YBHA 1G6RL 3R0NA 3QPXH 4I18A 2YRLA 2GTWA 1HYSC 3UX9B 4RWYL 3AVEA 1UB5A 5IROC 2IPKA 2JIXA 3OKKB 1FZMB 4HH8A 3O9WD 5D7JB 1OGAA 2GT9B 3LZFH 4PV9A 5DD6B 4DUVA 5F88B 1S9XA 3PQYB 1NUFA 4Z5RB 1HDMA 2AV1A 4U31A 2QSVA 4JFFE 3QO0B 1CFQA 1Z0NA 4OZFG 4HKBA 3C6LB 1QOKA 1CT8B 2NZ9D 2AJVH 5DJXB 2HFFB 2A0LD 2J88H 4ZS6C 1FVEB 3VXNA 4X9FA 4D3CH 5B21A 4B53A 1BECA 2E8ZA 4LCWE 4XTRC 4OIIH 4YHPB 3ARGA 3MRNB 5EC1B 3MNVA 1JMXA 1AGCA 4NWUH 1R5IB 2V9QA 4GMTH 1NCDH 4IOIB 3ARZA 3UJIH 4Z9KB 4XX1E 1A5FH 1W8OA 3EDKA 5D7KE 1WAAE 2YD1A 5TE6H 3IU4L 3TPKA 2YD2A 3MLRL 4QRUA 3ROOB 2Y9RT 3Q6FA 4X4YA 2XTJD 1T7XA 4Y2DC 4P2RB 1RZ8B 4DUWA 5FYLE 5D1ZD 4Y4FD 5GIRA 1P2CB 2XWJA 2Y36L 4YDJB 5JW4Q 4JFQA 5EU6A 4N1EA 3ZL4L 1MEXH 5HXMA 2ITCB 3FT2B 1U3YA 2ZCKL 1C08B 4KTYA 2EEAA 1U58B 4NDMB 4YZFE 4JRYA 4QXGL 2V7HA 4XNQB 5C08B 3V52L 5ICZA 4F8QA 5D2LF 1P4BL 3MRGA 1RMFL 1CGWA 3H9ZA 5JIIA 1KCLA 4KU1A 1R3JA 5LWYL 4H1LA 4XCEB 5KW9L 3IDXL 2VZVA 4L9LB 3O3DA 3QDMD 4M5ZL 3GK8L 5SX5H 1IVLA 5FYKE 3TIDA 5D1QC 1TTFA 3RZCA 1PX4A 3ARQA 2NY5H 5C0AA 1HINH 4KJPC 1OAKL 3UPAA 3D39B 2GITB 1NMAL 3QAZB 3RWCB 4KK6D 4K9EL 4ZO6A 4N0YH 1KJVA 1NC4A 2Y6SD 3DIFB 4UAOB 4YNYB 3SE4C 4DGVH 4NCC2 2PO6C 1I3VA 4YIQA 5GGTH 4PG2A 1FV1B 1VGEL 5J12B 1F42A 4Y1AA 1AIFA 3VFPA 4HDIB 1AQDA 1V7MH 1KN2L 4JFFD 1P53A 5AZ2H 3QEQB 2W0KA 3D69A 1IEAB 3WKML 1MFAH 4YO0A 3RRQA 1YN7A 5D5MA 4PJ7F 3SDDA 4G7YL 4F58L 2YKLL 3RDTA 2HT3C 1N59B 1YJDC 4U6HB 3HFML 2BSRA 2ZCHH 5JQHC 2Z0BA 1OP3K 4TSBH 4Z78B 7FABL 5J8OA 3AREA 3LRSB 3ZHDA 5I17B 1UEYA 2FD6L 3TNNB 2OLDA 5C0DB 4W4OC 3ME0A 3ARFA 4QHUB 3SE9L 1JJUA 2V2WA 3G5VB 5H37H 3GRWA 4QLRA 4XHJD 2E9WA 4OJFH 2FX8L 3ZLQC 3QUXC 1IGFH 4V1DD 4HZLB 1J8KA 1XF2A 4M6NH 3BEVB 4KRLB 3VGDA 5FYLD 1NAMH 1ZT1B 5T1LA 4NBYB 6FABH 3VW3H 1FYHB 1ACYL 5FOJA 4NRYA 4GQ9L 1GGIL 4JDZB 1SJEA 1BVLB 4DKFL 4FQ2L 5IMKA 3MQIA 4PJCA 3ILPB 1A3RH 1H3PH 4JDTH 4BELD 4OB5H 2Q8BH 3VG0H 4KZEL 3IXAA 1AO7D 4X4ZA 4IDLA 4L1DA 3C08H 3GJFK 2YPLD 1UJ3A 4EBQH 1P7QD 4HWZA 4POUB 2O61A 2XZAH 2YWZA 4AZ8A 1QBAA 3LPWA 3TT1H 3ESUF 5HY9A 2A1WH 2FEDD 1FZOA 2P8MA 5IMMA 3C8KA 5I8EA 1NEZB 2CKBB 3P4OB 2GUOA 5ESQB 4E41A 1HHIA 5MHSE 2F54E 2BP3A 1MLCB 1DQQA 3KPRE 3H7BA 2R2HB 3ZZ1A 1S9WB 3WIFB 4Z7WB 1GXEA 1NFDE 1WJ3A 1NEZG 3NTCH 5HPOA 2HVJA 1E6JL 1T5XB 2AI0H 4K7FA 4LKXA 1CDYA 2Z93A 2YHGA 4LVOC 4J23A 3IKKA 3IU3B 4AEHH 3DX6B 3P30L 4S0TD 5CIPB 3PWUB 4WI8A 3NZHL 4P2OD 5F9WB 3BXNA 2IH1B 3OR6B 1CE1H 1GRWA 3WUWA 4KK8D 1YEIH 1CFSA 2HKFH 4AH2B 3QFDB 3UTZA 4EOWH 3GRWL 5GHWH 3L5XL 5J6GB 1KCVL 4N8VG 1HWHB 2IC2A 3DVGA 5D72H 3OPZH 3TC9A 2APTA 3S37X 2G60L 5KSBE 2F5AL 2MHAB 1B4JH 4ZDHB 4ISVA 5I8KL 2OJEB 3CFKA 3CJJA 3M07A 1U9KA 3F7VB 4W81A 2BNUB 3O6FC 1V3MA 1A1OA 4JFYB 1KJ3L 1D6EA 4JFDE 3L5HA 1QSFE 4KV5F 1KLUA 4KVCH 4LU5H 3S34L 2Y23A 4QY8B 4EKXA 4ZNEA 3I75A 5BS0A 4S2SA 3TZVA 5CEYB 3C09B 3ABZA 3Q3GB 4AENA 1JNLL 4IDJL 2GFBA 5F9OL 1CDUA 1JHKL 4J3UA 1FZJA 1JGVH 1WZ1L 3FOLB 4FXKA 3VDBA 4OKVA 1R3IL 3HC3L 1I1AD 5K9QG 4KJWC 3DRTA 2APBA 5I30H 1ZHNB 2NX5B 2O5ZL 3RY5A 5D7LA 1MSPA 3O45A 3HMXA 3TLRA 3FCTA 1S5HB 3K0WA 4Y4HB 2A6JA 3ULUL 2FGWL 3HAEH 4WNQA 2BJML 3GSXA 4FS0A 2Z4QA 3RVTC 2ZKHH 4HV8A 3QCVL 1F4HA 4HPOH 3SKNA 4IRJB 1WQVT 3MJ8A 1KPRA 3GB7B 4LAJH 4X0KB 3TCLA 1NLDL 2E7CA 3WFBH 3LB6C 4I0PC 3KYNB 1DSFH 4N5UA 3NN8A 2BVPB 4MLIA 15C8H 1W72H 4QRPA 4NO3A 4PJAB 1QVOB 3DVFA 3SDCA 4OLXH 3IDIA 5GS2H 5DK0B 2R69H 4RGNB 1G9EA 2EIZA 4POZC 4RDQG 5CEXB 1IGJB 3JTTB 5HD8D 4JR9L 2D7MA 2XZCL 3EFDL 5EUKB 4WV1C 4PJDB 5HHOD 1KN4H 3MJ7B 4KKLC 4IMKC 5DUML 2AV7A 4JCMA 5CGTA 3BIBX 4MD0A 5MHSD 2F54D 1XF5A 5LJYH 1N0LA 2EYSA 4JPIA 3SGKC 1B2WH 2CLVA 4EI5B 4XCFL 5TQ0H 4FQCH 4XNMB 5HHNB 3O6KL 3P11L 2UZYB 2AEQH 1MRFH 2ZUYA 4HIHB 3MLUL 1AP2B 2XN9A 2OCFD 1RIVH 4X6DA 3NH7L 2VC2L 3DRQB 4LSVH 1Q0XH 4KRPC 4HT1L 2YD8A 1NCCL 1WBYA 4ZAKA 5I66A 5DQDL 5IHUL 3RQ3A 5FGCE 2HJKA 5JW4N 2NCMA 3AU1B 2C4XA 3VJ6A 1JNHB 5GJSL 1LEIA 1ES0A 4HS8H 1MPAH 2RAMA 4PLJC 3S3SA 3HI1B 3HMXL 5IFAH 3MV7B 5INCA 3BP5B 4FP8H 3EFFA 4MAYD 4NWTH 3U7YH 5D71H 1MAML 1E0OB 3GKWL 3TNMB 3MRKA 1RZFL 2ZPKH 3TV3L 3BKYL 3ZSSA 2PXYB 1J8HB 5BZWA 1ITBB 4QHLA 1TJIH 1MIEL 1ZHLB 5FHBL 4LSPH 1UWEL 1PX3A 3TFKC 1FYTE 5F6IB 2PUQT 1AFVL 2FL5A 2GTZA 2MKLC 5JLZA 1MHEA 3FHAA 4ODVH 1NMBH 5IBUG 2WNGA 5IEKA 2R1YB 3U7WH 5T1MA 1OSPL 1JPGB 2W38A 3BN9C 4LARH 3MNWB 1U42A 3IF1A 3QXVA 4MHHI 2CO6B 1QG3A 2PETA 3QCTL 4GG6B 2Y5EA 4ZXBB 2GSGB 2P5EA 4C54A 5FDYA 4IRSD 4CN4A 3OAYH 3T0XA 3LKRB 5KVGH 4PLNC 4PBVC 5BV7B 3LKSB 5I8CA 2CJUL 2XT1B 1J0IA 1ZHBB 3QUZA 4MNHA 3LKQB 4K3DH 3W9DA 3FMGH 1CBVL 4BFEA 3MFFA 3EYUL 4ZD3H 2HTLC 3VXPA 3LVEA 4OLYL 4UQ2A 1HKFA 4NSKA 3UAJD 5D70L 2FB4H 2R2EA 3OTTA 1LO3H 1N4XL 5ICXA 2NZ9C 3WIHH 5FDWA 5ANME 2A0LC 2W91A 2HG5B 4YBQD 4G3YH 4XPHL 1AXTH 1U8PB 1XGPB 2IAMB 1FO0H 4YPJA 1N5AB 4R9HA 5DI8A 4D9LL 5FYJL 4HLJA 1J86A 4YHZH 1FNHA 3V0AC 4JPVL 3RZWA 1AI1L 4NFBA 3BWUC 4K23H 1U92A 5FUZL 1MHCA 3MBXH 1MREL 4Z8FL 4APQB 1P7KA 2J12B 5DQJB 5J1AB 4F3FB 3ZKMC 3HE7A 4HGMA 2ESVD 3PWLA 4HCRL 4KK9D 3W0WB 5EZIH 3NMEA 4DGIH 2WBJB 3BH9A 4WEMB 2YUWA 5EO9B 2DQGH 3CDYA 4Q9QH 1OTTD 5CCKH 4I13B 3U36B 3IGAA 4N0UE 5C0JA 4TVPD 4G8GB 4JY4B 3T0EB 1BQSA 2MCPH 2EYRB 3TO4B 3UPRB 1DVFD 1BLNA 1MRDH 3GHEL 1HKLH 4O51B 3VFTB 1M05B 2ORBL 4FZ8H 4OQTA 1CGTA 1LO5B 3EDJA 4YAQB 2ADIB 4PD4J 4JZOA 2VO5A 2UVEA 4JKMA 4ELKA 4KAQL 3GFUA 1BM3H 1S78C 5D6DA 3SCMB 4F7TA 5INDA 1DCLA 2HN7A 4DCQA 2VXUL 4O5LH 2DWEB 1GOHA 4O2FA 4X4MA 3FOMA 3BJ91 2EC8A 4Q9BA 4NQEB 3PQYE 1FYTD 4QTHB 4UV4L 3VXSB 3QXTA 4JG1L 1PAMA 2YSSA 4P23B 1PKQB 1QO3B 3SHSA 3CFDA 5IMLB 3WYRA 1K4CB 4PRAB 4XRCA 4ZUWA 3KJ4C 4RMSA 5F3HA 2BNQB 2F53E 3HI6H 4OV5A 3I6KA 1JBJA 5C07A 2YXFA 3IFPA 2LU7A 4FXGB 2DWDA 4PV8A 2VDPL 3NACL 5DMYA 2A73A 1IM9B 2O5XH 4QT5A 1YMMB 1BIHA 1F97A 1FAIH 3PGDA 3GSQB 3CVIL 2LU4A 1T1XB 3QH3A 3AROA 5DD5H 3OKNB 1MCDA 1UJTA 1Q9OB 4FZEH 2PTUA 4P4RA 4Y16A 4KKBD 3HNTL 4OLUH 2ICCA 5ISZB 4CBPA 3DO3A 4HIEB 2NW3A 4HC1H 1U8NA 5E6IB 5IK3B 4Y4KA 4P2RE 2IEPA 5EN2B 1KIPB 1D5MB 3MRBB 4NZJA 5GSRA 4C56E 2RFXB 1PZUB 1YDPA 4XBEH 2CUHA 4K3JL 3BDBA 4OZ4A 5I19L 3CSGA 3STZA 2VXVH 4YC2C 3BIKA 4B50A 3ZE1E 3LMJH 4TOYH 2VB5A 4FMFA 4K3EL 2X4QB 4QHKI 3HPLA 2NY4C 2B1AL 2ZSVA 1ZHKB 4OI9A 4CW1A 1EH9A 1L0YA 5C08E 1RULH 1VGKA 2VITB 4DTGH 1S7VA 5MENB 1CR9H 5FA4B 4Q0XH 5C70A 5IB1B 2R56H 3DXAB 4OZIA 1MIML 1T6VN 5D2NA 4PRID 1DDHA 3TBTB 4HKJB 4D0CB 3LKOA 1X3DA 1YZZA 3L3DA 4RNRB 3INUL 4KI5E 4OGXH 1G7MB 4U1IB 3ZTNH 2JJSA 2B0SH 3KXFA 4P3DB 4YPGA 1CD0A 4JVWA 4L3AA 5TDNA 1ZT7B 3JWDL 4DN3H 4O2CB 2AABH 5F71A 4G80A 4WUUB 1TJGH 1PSKH 5CJQL 2FEDC 1OAUL 5CKGA 5T3XD 3ZKXC 4U1LA 4LRIA 5F7DB 4YXKL 1ERNA 4UV7L 1GGBL 5D7JD 3T3ME 3GSOB 1T7ZA 3K2UH 3JBG7 1QPPA 3PQYD 4MB4A 4GKNB 3BT2H 4Z7QE 1JMZA 1FFNB 4Z0BH 4H0GA 1KNOA 4MXWH 1RJLB 1AD0B 2A9NH 1N5YH 2KBGA 2X4UA 5E8NA 1CFVL 4LIQH 2OZ4H 4YEFA 3C6LD 1FFPB 3LQAH 2G9HB 4Z95H 4PPTA 4JM2A 2ATKB 1QBLH 3RU8L 4HS3B 3RWIA 1H5BA 4AIZB 3B9KB 2YZ8A 2XZQH 3JUYA 1Q9KA 4B7IA 1UXSB 1TTUA 1BZ9B 1H3UA 2D03L 3CU7A 4P2OC 4D9RD 5ALCH 4K94L 2GJ6B 3LD8B 3MV8A 5SWZA 4XBGA 1TMCB 3MGOB 4X6BB 1RD6A 2VUOA 4XB8A 2Q6WB 2H1PH 4R26L 1QR1B 2XPGB 1T0NA 4KDWA 2BSSA 2CUMA 2J3SA 4MCZB 3NPSC 2OI9C 3WDHA 4N0FB 4C57C 1K6QH 5GSVA 4Z7VA 1I7UA 1QLRA 1YC8A 2WV3A 3LIZL 3MRPA 5I18H 1UC6A 4Z77A 1CQKA 4NZDA 3TJHD 4P2RD 3ZE0E 2DQTL 2B8OT 4TVPL 1SY6A 4FRWA 4FN0A 5ITBH 1NKOA 1CDGA 2R4SL 4LKCA 5HHPB 1XGYH 4M48L 3SPVA 3CXHJ 1OP3H 1RJZB 3DWTA 2W60A 5FO9B 4I48B 2P5WB 1RIHH 1GPOL 3RBGA 1JTTA 4GXVH 2XICA 4P57B 1FNFA 4LQ1A 1OW0C 3PWPA 2PN5A 5C08D 2KL6A 3KLAA 3BRGC 4ELMB 1DLHB 4PFEA 4HFUL 1MCWM 1T1YA 4C58B 1NAMB 4ODWB 4WHTA 4Y8AA 1OF2A 4TNWK 3I6GB 1BIIA 2OTUB 4PJHE 4P59H 4NQDA 4R2GB 1MNUL 1JRHL 4P5KA 1R5WB 4NN7C 3SGDH 2HAZA 3TBVB 1F2QA 1U8KB 5FYJU 3RVUD 4WGWB 1FNSH 4LEXH 3GUTB 5C0GB 3HR6A 4BQ6A 4L5FL 2GQHA 5IWLC 3QDGE 3VCLA 1MCSA 3U46A 3GJFH 3JV4B 1IAOB 3NA4A 3RWEA 2NYYD 5GJTH 1BQUA 3GDBA 1F6FB 1J5OL 4TTDC 1WBXB 2RJMA 4OCSL 4OT1H 4KQ4L 3EYFA 3D39D 2LABA 3RWGB 1TNMA 1FIGL 2JB5H 4C83A 3OKKA 5LCVL 2OP4H 1FZMA 2R0ZL 2UUDK 1FJ1B 5ITFB 5C3TA 3EYSL 4WY7L 4OF8A 5GGQL 5ESAB 2MOVA 4GRMA 3RWFB 3CLEL 3PHQA 4LCIL 3UBXI 2VN7A 1CVSC 1LNUA 1SY6L 1UQSA 4HJGB 3QEQD 5EU6E 2X70B 2VXSH 3F12A 2BC4B 3KPLA 1P1ZA 1FN4A 2P4AB 1FVEA 4K8RH 5E00B 3QI9A 4F7CA 1SJHB 4R4BA 2DQDL 1FSKB 3QUKB 4N8CH 1X4ZA 2X6MA 5LXGL 3TYGL 4PJEB 4WHCA 1JZ5A 1AXSB 4N8PA 1HHGB 1N64H 3CSYA 1QFHA 1J87A 2MWCA 5BMFH 3TA3B 7CGTA 2V7NA 3PIQA 3J8F7 3D3VA 3MRFA 3DO7A 2GHWB 5C8JB 4NNYB 3CIQA 2CIKB 5D1XC 4KQ3H 3VXUA 4LLMA 3FFCB 1Y6KR 2NLJA 1X4YA 3EO1B 4G42A 3E6HB 2NX5E 4LLVB 1TFHA 3S96A 3ZO0A 1QBML 2YR3A 4LQFL 1F4WL 4MAYC 4XVSH 3EOTH 4M3KB 4NO0A 1CS6A 4Z0XB 2V5MA 5C0AE 5CD5D 3EJZC 5IGXH 1W0WA 3UDWC 2VDMH 5D7IB 5K9JL 3GM8A 3OWEA 1EJ6A 1QEWA 1C5BL 5JIKA 3S4SB 5GS0D 3PP3K 1OSZA 1RZJL 4JAMB 1IQWH 4Z7UA 1FVCA 2VZ1A 4NM8H 3FT2A 3C9NB 4AM0A 8FABB 4PJAE 4KROB 5FGBA 1BJ8A 3CDGB 3VFUA 1VPOH 2YBRB 2BVOB 4RGNE 5T3XL 3S4SG 4JREB 3T2PA 1UWGH 5CKAA 2I9TB 5I1LA 1EMTL 1Q9WA 3B9EA 4X6DF 5D5ME 2JB6A 1ZGLM 1I8KA 5EULV 1KIQB 4JPKH 3S36H 2E9IA 4IRSC 4J7RA 1GIGH 4MA8L 5ILTL 4W6YB 4JHAL 4ZMAT 2BVYA 4H0IA 3GI8H 1M6OA 1W72B 2FWOB 4L9LA 3WL9A 3DMMA 3G6JF 3FB7A 4GUPA 3O2VH 1ZT4A 4J4PA 4WIQA 3C5ZC 5KANG 1PG7H 3QDGD 3KLHD 1I1CA 3ALWA 5EOCH 4MZ3A 1ODAA 3EDDA 3WO4C 2E7HA 4M7LT 2NY6C 4CL7A 1R3LB 2F19H 2GITA 5GRWA 5LG1A 4WWKB 2K9UA 3DIFA 4UINL 3WS6A 1HYRC 2KZWA 4LLUB 1LDPH 4FFYL 1MFCL 5EU5B 4ZTPH 4J1UB 3U83A 2WZPD 2RCSL 2BHUA 2WUBL 2AK1L 3QULB 4Y89A 1OPGL 3DURB 3FTGB 5DHYB 1CU4L 4XH2B 2FATL 4PJCE 5JHDA 4P4KB 4TN9A 3ORJA 3MV9B 2FRGP 1KF9B 4JFXA 5DRWB 4NZRL 4DW2H 2FSEB 4DWHA 2ICWI 1JPTL 1MRCL 3IDYC 1OTTC 3LH2H 3UZVB 2OYPA 5E8OA 2BOCB 1YN6B 5JOPE 4RFNC 1X5YA 4ZO8A 4HIXL 2M8XA 4UQ3A 1LK2A 3P9LA 1DVFC 4E41E 3GNMH 4X98B 3OJMB 2Q3AA 2EDFA 3PWVA 5E24E 1OY3B 4X7DC 1FFOB 3VWKB 1TPXB 1ZE3C 1OGTA 4OD3H 3IAPA 4I5BB 4NM4L 1G9NC 1J05A 4EDWH 1JP5A 2NX5D 4OM0H 4AMKL 4GG6E 3LRGA 3V6FB 4EVNA 5C2BH 4Y4HD 5FK9A 1J9CT 4WJ5B 1QKZL 4LSRH 3WFZA 5TFSH 3CK0L 1V3KA 2BNRA 4JG0L 4IRJD 1I8MB 1BVLA 1OARH 3O41B 1BFVL 5TPWL 4YUEH 5HGAA 3X3GH 1PFCA 5AZEL 1YJDH 1D5IL 3ZDXF 1YUHA 3IFNL 4ONFH 3UTSB 2P44B 5L9DL 2FZ3A 5TDOA 2G2RA 1NFDF 2VYRE 3A6CL 5C71A 5HYSB 2Z9TA 4RGND 4CMMB 3WLWD 4QWWD 4XNYL 3EYVB 1SBSH 4S0SD 3TJEL 3P4OA 4MS8C 5E2UH 2K3TA 3O3BA 1OLLA 4LCUB 1S5IH 3BO8A 1XMWA 1FLTX 4KZDH 2C7UA 5BS0E 3AXLB 2JELH 1HHHB 4EI5D 3WJJC 4NT6B 5F7WC 4PUBL 4HWEL 4KHXL 3VXRA 2X4TB 2H32B 1WZKA 1VFAB 4HKXB 2R1WA 5C9KA 4L29A 3AMKA 3NCYP 5KSBF 4UOJA 1FO0B 1C12A 3AY4A 3V6BR 5IW6B 3KPNB 5HGDB 3N85L 4YHIB 5C0BB 4OSUH 4MD5A 1KIRB 12E8L 1IARB 2FECI 3T0EE 2UVFA 3SDYL 2YMXL 4TUOB 1IGIL 4XVTL 1QPXA 3SOBL 1PZ5A 1MVUA 1I1FA 5ABDE 3GIZH 4PP2B 5FA3A 5JQ6L 3MMEA 2VWEE 2DIBA 3E8UL 5ACLA 4NQCB 1ORSA 4KK5C 2R8SH 1K85A 1GC1C 1ADQH 4K7PY 1IAII 3WLBB 2KPNA 3O3AB 1GGTA 2I9LB 4HK3J 1REIA 4IOSD 1JWUB 1NDMB 4OLZH 2JK5B 2C3VB 4I8DA 3U9PL 1H15A 1J8HD 2PXYD 3DI2B 1NMCC 4B41A 4GRLA 3AAZB 3QT2A 5IVXB 1KBGH 3EGSA 2FJGB 3UO1L 2R2CA 5JOPD 2OTWB 1YEFH 3OX8B 1N7MH 2ED7A 4GMSH 2AKRB 1CLYL 5FV2A 5HDBF 4Y7MA 3OF6D 3RUGA 2ZG1A 4G8EB 3CH1B 2W92A 3PP4H 2BNQE 2W59A 3RWDB 4F7MA 4OCRH 1ZHNA 2CKBL 4LSTL 5CP7A 4PJ9A 3DV6A 4ZFZA 2XN9E 1YMME 4RAVA 1MCWW 3ARDA 4ZXBD 1ZLSL 2J8UA 1HSAA 1W8NA 5FKAA 4HAFA 2NW2B 3KPOB 1S7SA 5IFJA 3KYKH 4ODUA 4E42B 2HRPH 4X0KA 4GO6B 5F7FA 5D7JC 1AHWA 3TT3L 5ID1B 1TITA 1F4YL 4DKEL 3OB0K 2C3HA 4ENED 5D8JH 1ZSDA 3WNMA 2E7MA 4MNQA 1D5BB 1LD9A 3NAAL 1S7WB 5E9DB 5DZOA 4LASL 1BBJA 2VLKA 4P9HC 3C6LC 1I85A 4LRNH 5E70A 5B22A 4IEFB 1HN1A 1RHHA 5DMIL 5EZJA 1TZHA 1FNEA 3WXWL 3NFNA 5JXAH 4XBPB 4PGDB 5EH1A 2UY6A 4BFIA 1RK0A 3ULVL 2IAMD 4JN1H 1SVCP 4X8JA 2MTPA 4WCYH 5IJKC 2WP3T 4XNUL 5ERWA 5IKCA 2A38A 2DL9A 1A7QH 1IKNA 3HN3A 3MCLH 1EVUA 2APXA 4LCCC 4XPTL 5EUOB 1MWAB 5FKPA 5F3BA 4WTZA 1J1XL 1JYXA 5HHNA 5A3IC 1WWCA 1EAPB 5BQ7B 1L7IL 3BZDA 3W0WD 1R3HB 3MA9H 3SO3B 1TQCC 2CGRL 5CJOL 3U9UA 2DBLL 2O5YH 2WBJD 1O0VA 1JZ7A 3DSFH 1T89A 3TJHC 3CFIC 1UA6L 2R23B 3MLPA 4WW2B 1EHLH 3TVMB 3SE8H 4G8GD 3T0ED 2P5EE 5DVKA 3TO4D 2AXGA 3WJLA 5JOFA 4CNIB 4OF0A 3S37H 1IM3A 5J6HB 1FCGA 4BKLB 5HGHA 2QSQA 3HI1A 1IL1B 1VFOA 4XNXH 3MV7A 1H3XA 1V5JA 3X13B 3CFEB 1IEHA 5CINH 2AGJL 3SCMD 1X5ZA 4BJLA 4PYGA 3L3OA 2A6IB 3L7EB 4P9ML 1XIWD 1BWWA 4JM2F 1G0XA 5BW7C 4LPYA 5EU4B 2HLFC 2PR4L 3IRPX 3L3GB 1XGTA 2CRZA 1TVHA 4LAQH 4NQED 4M62L 3VXSD 1JGLH 4P23D 1P4LB 4P2YA 2R1YA 3QNXB 3D85B 2BOBB 4IOFD 2VDOL 2FX7L 3NZ8A 1D9KB 4KI5C 3F58H 2BNQD 4OFIA 3MXVL 1EO8H 3SDAC 5IB5B 2D4DA 2NYYC 3LQMA 3MNWA 4QXUL 4XVJL 4U1KB 5FM5M 3U7AA 2X4PB 1A1NA 2A77H 3FQRB 1MLBB 1JN6B 2XY1A 4HFWB 4JO4H 1YMMD 1RFDL 3OAUH 3IB4A 2GJ6E 1AXIB 4S1RH 4ZUVA 2CK0H 2Q76A 3MRJB 3E3QE 4NJ9H 3TH4T 1FP5A 1MCJA 4XXCC 3LKPB 4FFWC 1VSCA 2XQBL 1PVHA 2Z31B 1IC5H 3SGEH 1MCOH 2VL4A 3H8NA 4JFEA 5J12C 5DTFA 5ISZD 5E6YA 2QV2A 1JHLL 4DZ8B 4OCWL 5DSCB 1U95A 4F9LC 4OAWB 2F58L 3QIUB 2LV4A 5KN5B 3D6GA 2HG5A 3GSNA 1XGPA 1LP9E 3MZTA 4BQ9A 1FRGH 4R3SA 1CF8L 3CX5K 5CD3A 2ERJB 1B9ZA 5DEFB 1N5AA 2A2QT 3ZT5A 2CIIA 2P5WE 4FFZL 2ARWA 3MOAL 3QQ4A 2FBJL 4FQXB 4M6ML 4G9DB 3WIIH 4NOBA 2W0FA 4ZTOH 4APQA 5DK3A 5FM5O 5CWSA 2D2OA 3OKOA 5CJXC 4R7DB 1NFIB 5KVDL 2CR6A 1EO5A 4HSQA 5F89B 4ELME 2VDLH 1BD2E 2VZTA 1YEHL 1T20A 3EZ8A 3DXAD 1JYWA 2JCCA 1KENL 4IS6B 3U36A 1KELH 4WI2A 5C07E 5HYEA 3KDMA 4G6MH 5CSZA 3X11B 1CFNB 3FKUS 1ZWIB 3QJHB 4Y5XC 1NCWH 3RAJL 1DN0B 3GGWA 2EYRA 1WUNT 3L5IA 4GKOA 3LV3B 1VDGA 1KJ2H 4I18C 3AC0A 2YD4A 3NCCB 5T3ZE 4HUUA 1LO5A 4O02L 1ZTXL 2ADIA 2EDLA 4R96B 3HE6B 4PJ8B 2R0LL 3WN5A 1CFTA 3BHBA 4GSDH 3BAEH 1FL3A 5DJDA 1NUGA 1N3NA 3WMSA 4I3RL 2OJZH 3O8XB 1H9VA 3MXWL 5HI5D 5EOTB 43CAA 4WUUD 1VFBA 4BM7A 2XKNB 1WFTA 1GOGA 5BVPL 3O11A 3PGFL 1PY9A 4P5MB 1OAZH 2OXHA 4M61A 2HMID 1PKQA 5I1AB 1N6QH 2I60H 3BP7A 1VESA 5TQ2L 2B1HH 4N9GB 3ARGC 1A7NH 3P4NB 3T65A 1DFBL 3LEVL 5FGSA 2Q3ZA 4BFBD 1NSNH 3VG9C 5F7HA 3GSNL 2NY2C 3KLHC 5FEBA 2HWZL 3LKNA 4S1SH 4FXGA 1MI5A 1IM9A 5DQ9B 4NNPH 4OZIE 1KPUA 3N0PB 4NJAH 4EUPH 2IBBA 4HBCH 3DX9B 5D2NE 5TJWK 5F9WC 2UUDH 1FCCA 4NRXA 2B5IB 3BH8A 1KC5H 1YEJL 2GJ6D 4XP1L 4O4YH 2AJSL 1Q9OA 4PS4H 3U82B 3GSUB 3HZYB 3OKEA 5CBAB 5I16B 3MBEA 2ENSA 4YQXH 1YPZA 5DR5H 2HKHH 4O00A 3VDCA 4N90E 2IANB 5IJVA 5E6IA 5IK3A 1BOGA 5I71C 3H3PH 4ONGH 1DEEA 3KXFE 3MRBA 2YPKA 3VXOB 1X7QB 1BBDL 4UIKL 5EO1B 3IDMA 2ICEA 5HI3D 1RURL 4KJYB 5D7IE 3LS4H 4HIJB 3FAXA 5A2FA 2YEZA 2P5WD 3MLWL 4JY6A 2SEBB 4AT6B 1UACH 2V5TA 1HILA 1GHFH 1NGWA 2X4QA 3DVNA 2ATPB 2XY2A 2P8PA 1YNTB 2VITA 5MENA 5SWQB 3WNNA 1FG2B 4LK4A 1MCLA 2V2TB 1BD2D 4Z7OF 5I1JH 2D31B 4XP9H 5ALBH 4PRDA 5GQBA 5JR1H 5MEQA 4NKMA 4DGYL 3CZFA 3IAGC 4R2GD 3PWNA 1H0DA 1I7RA 1AKJB 4ALAL 1OT2A 5LGHL 2AJ3A 3QXAA 3QEGH 3PP3H 4XI5D 1XCQB 3RVXD 2XOTA 2VE6A 4BQCA 5DRXA 4IRJC 3QPXL 3VFGH 1IGYB 2IALB 4U6VH 3MV8E 3VFNB 5SWZE 4F37F 3U6RB 4OI8A 1RQ5A 5T3ZD 5BJTB 4P3DA 1UKTA 1NH6A 4CJ1A 3LN4B 4Q9CA 2V2XB 3LZFL 1OLZA 1U91B 4Z7VE 4WUUA 4HUKB 3WLWC 1GL4B 3AB0C 3VFSB 4PJFB 4OCMC 4QWWC 4Y2DB 4GAFB 4Y0GA 1I9IH 1IGTB 3SDDC 2AJVL 3CC5B 3VFWB 2CDEB 2J88L 3RDTC 3KPSA 4NBZB 4D3CL 2LFGA 3RNKA 2JE8A 2EKSB 4OIIL 5JO5A 3ECBA 3BW9A 4EI5C 3C5SA 4PY7A 3MV9E 1CICD 4M03A 4NWUL 3AREC 4PGBB 4GMTL 1NCDL 4BH8A 5IF0B 5FYLH 4HS3A 5BRZE 2EIEA 3UJIL 1WSST 3GHBH 1I9JH 1A5FL 3O4OC 3FFDB 1WIPA 3PWPE 3B9KA 4MHHG 3ARFC 3MRIB 2EZ0D 2I25N 3FO0H 5TE6L 5GGTA 4WI5A 4N0CC 4Y5YB 1BQHA 4JVUA 3LSOA 1XF3B 1QRNB 4F57H 3WS3A 4U4BA 5EZLB 2X4OA 4CVWA 3PL6A 4XP4H 3WEXA 2EDHA 4LFHG 2CDGB 1DQLH 1H3TA 1VKXB 4LSSH 3TA3D 4NQDE 1INEH 1CZ8H 5GPRA 4OZHB 4QHNB 4N90D 1XGQB 3DOSA 3FFCD 1SYVA 3BYTA 5K9KB 2E9BA 4HUMB 4A6YB 1A02N 4NYLA 3OB8A 4F37K 3HRPA 5D1QB 1MEXL 3HRZB 5GGVH 1RJZA 2YA1A 3ZDYF 5FXCH 1M7XA 2V9RA 3CVHA 1A47A 3REVA 5EBWB 2NXZB 4JY5H 1GAFH 3G5YA 2ED8A 1K2DB 5FYKH 1AR1C 3GSWA 2PO6B 3IJSA 1QBBA 3UEZA 2GJZA 4KROD 2G5BB 2X4SA 4Z7WF 2I24N 1JGDA 2HJFB 5F7EH 1OTSD 1MCQA 4JPWH 3IFOB 1K4DA 1KB5B 2M2DA 2OTUA 1CGVA 3FQNA 2Z35A 4RX4A 5HYJB 3UC0H 5C0IA 3IDNA 2HT2C 3QFJB 4MJIE 5DJ0B 2QQKH 2NY5L 3TPUA 1HINL 3ZMRA 5HGBB 3SY0B 3ULVF 3T2NH 2FCBA 4L3EA 4JFPB 4N0YL 2PW2B 5F44A 3MACH 3KGRA 4DGVL 2P7TB 3ARBA 4ZQKB 5C0CB 5GGTL 4HK0A 4GW5B 3VXUE 4PJ5B 4Y19A 1Z3GH 4ZPVB 4FQ1H 4X6CE 5J1SC 1Y18B 3RWGA 3IDGA 3GIVA 4JZNB 4NKOB 3CU1A 4WWKD 1V7ML 2ADGA 4QHMB 3QUXB 4XCYB 5AZ2L 4WU7B 1CD8A 1MFAL 5JXEC 4OFYA 5GRZA 1JIBA 1A3LH 1QSEB 4JRXB 1P84J 1MCFA 2ZCHL 4P4KD 1XCTA 4TSBL 3MV9D 3WCYA 3RFZC 3IKCB 2B2XH 2BCKB 4KKAC 1C5DB 5BRZD 1IRAY 3CVHL 3EO9H 2GYSA 3EBAA 4WFHD 1ORQA 2E7BA 1TVBA 3PHSA 4OJFL 4M5YH 4NOFA 5D6CB 5A16B 3NVQA 4ZOCA 3OKMA 4KUZH 2XV6B 4CADA 5DJAA 1MJJB 1JGUH 1IGFL 2AK4A 4FG6C 3PUCA 3AS0A 1FHGA 3SKOA 5L2KB 2Z92A 2VWEC 3MA7B 4PRBB 3VWKD 4LLYA 4LLVA 1X5KA 6FABL 2YPVH 3VW3L 3QQ3B 3L3KB 1T7WA 1RUQH 4XMLH 1A3RL 1H3PL 3SCMC 4JDTL 4OB5L 2Q8BL 1EHAA 3UYPA 3VG0L 4GKSB 4LVOB 5I1KH 5IB4B 1NCNA 4CVUA 1XIWC 2WWMD 3C08L 4EBQL 3DBXB 1RSFA 3SDCC 1ZEAH 2VR4A 3VWJA 1DBKH 1JTPA 4HPYH 3HZMA 1PD6A 1MVFA 3Q1SH 5FO8A 2XZAL 3M17B 4PJDF 3T1FA 2DYPA 3TT1L 3QDJA 4JJ5B 4KI1A 2A1WL 3FB6B 4XPGH 5CGYC 4RA0C 3DGGB 5H2BA 1G7HB 5E9DE 5MI0C 4X80H 5KS9B 2OK0H 3UTSD 3HAEA 2VXTH 3RTQA 5SV4A 2AJUH 4K7PH 2F5BH 5JHDE 3VI4E 5DVNA 1KLGB 4PLKD 3PGCA 2A6DA 5HHVH 4C4KT 3P77A 5TH2B 3O6FB 4H8WC 3NTCL 1ZVSB 2PYEB 2AI0L 3ZDZE 4AEHL 3ZE2E 1ND0B 1W72A 1U41A 5MERA 2J4WH 4MJID 4HEME 5CMAA 4Y88A 1LWRA 2OR9H 4HH9B 4CN6A 3OB0H 3I6LE 5FCSH 3DUUB 1CE1L 4JN2A 2FIRT 3N50A 3QHZH 1L4IA 1CL7H 1YEIL 3W2DH 1UM5H 3H7LA 2HKFL 3DHMA 4UIMA 5MEOB 4EOWL 4R4ND 5GHWL 2KUTA 4F7PA 1S8DB 3MRRA 4FQJH 1BQHG 1S7QA 3OPZL 5D72L 5IBLD 2ILLA 4OGAC 5C0BD 3U2SA 1T1WB 1JZ8A 3VXQA 5GS1C 4PJBB 2ZOLB 1B4JL 3MLSH 4FQHB 2D0FA 5MP6H 2YC1B 3CCHA 1CTOA 2JJTC 3SDXE 2BNRE 5GS3A 5I1CH 3RX8A 3QA3B 5HPMA 3CDFA 4UMGA 4KVCL 4LHUB 4LU5L 4UTBH 3DURA 3QO1A 5HYQB 3STLA 1G0DA 1R3KB 5BVJB 3ZT6A 3HHRB 3IVKB 1NGZA 5IW3A 1CYGA 2Y5TA 5DRWA 1DQTA 4RAUB 4DEPC 1ZKAA 5C9JB 4YFLF 4MQXC 1JGVL 4GG6F 1B0RA 5H37G 1HHJB 2VDRL 1LK3H 4GW4A 3AM8A 5I30L 1SJXA 4XGZA 2P8LB 3CFCH 1L9MA 4WV1B 2BVQB 4QRSA 4EN3B 3N9GH 5L6YL 5IR1B 2VLJB 3MNZB 4L8DB 1EIBA 2ZKHL 3SKMB 4U3XA 3QDHA 4CGTA 3ZKSD 1CGUA 4JCLA 3KYAA 5KZCB 3R06B 4HPOL 3PJSB 4X8XA 5EBLB 3E6FB 1N2RB 3WFBL 1P6FA 2XFXA 4NRZA 1NLBH 3VFOB 3QISA 1V3LA 1DSFL 4WJ5A 2QHLA 2QR0A 5K9QI 3REWA 5HI5C 1W72L 3QPQC 3SO5A 4OLXL 3VA6A 1NJ9A 4X83A 5I1DA 1AD9A 2R69L 1CCZA 4D0DB 4O2EA 5DFVC 1BFSA 4NZUL 4JB9H 3C2SA 5LAXA 2WBKA 1KN4L 32C2B 5E9DD 4EXKA 1EVTC 3D9AH 5KSAC 1RUMH 1S9VB 3OV6A 3QHTC 1B2WL 4UT9L 4YK4C 1A4KB 5TQ0L 4FQCL 3RVWD 1FLRH 1Q38A 2Y7QA 2AEQL 1MRFL 1U8LB 1JPFB 5DUBB 4P5TA 1G9NH 1XF1A 1RIVL 3FAWA 3WHE1 1FC2D 5E4IA 1ZGLB 4LSVL 1QRKA 1Q0XL 1IC7H 1VACB 1A9BA 3E3QC 4U1MA 3L3IB 3NOIA 1QTYT 2QSTA 3I6LD 3U0PA 1I7ZA 3I02B 4HKXA 3C6SB 4M4PA 1NGYB 2BY2A 3QRGH 2GSIA 1KEMH 2YUZA 1FZKB 1BPVA 4P0DA 3QG6B 4RRPA 2VZ3A 3H0TB 4NN5B 4HS8L 3RGHA 4QO1A 1MPAL 4HG4K 1F3RB 3UBXB 5SWSA 3M1BB 3KNBB 3OJ2C 3TVMD 4LGSB 5DGRA 1F6AA 5IFAL 4WEUD 3R0MA 3S5LB 2J8UE 4FP8L 4DKDC 4NWTL 1Q94A 3T77B 3U7YL 3T8XA 2IG2H 5D71L 4RISH 2ZPKL 5GRUH 4NQCA 1R24A 4QTIH 4PJIA 1TJIL 5IHZA 1S7XB 1JF1B 3MCKB 5DJ6B 3UBXG 4LSPL 5E8PB 1LE5A 2VZUA 1LQSR 5DRZB 4GOSA 4FQIH 2C3VA 3PHOA 4ODVL 1NMBL 4DZBB 1CD9B 2AEIT 1DR9A 5I0DA 2VLKE 3IDJA 3AAZA 1KJ2B 3U7WL 1IEBA 4OIBA 4A2MA 4G7VL 1HH9B 3O6MH 5C09E 2D7NA 4P2QA 1J1OH 1IKFH 1B0GA 5GGUB 1Q1JH 4LARL 1OP9A 3OX8A 4RQQA 4Z7NF 2OL3H 4KKCC 1I9RH 3RVXC 2CSPA 2APVA 2X09A 1SEQH 4G8EA 3D85D 1LO2H 1ZA6A 2D0HA 5IIEB 1EHNA 1QFOA 1D9KD 3RWDA 4L3CA 2IFFH 2HH0H 5KVGL 4MLSA 2DAVA 1KT2A 1EEZA 1JHTB 2D7TL 3G04A 4JLRB 1FBIH 4K3DL 5J11C 3FMGL 1S9YB 5DJCB 4ZD3L 1UM6H 4FQPA 4GRWE 1GC1H 3WFDH 4N9OB 1U8QB 5GRJH 4Y4KC 3KPOA 2FB4L 1A6AB 1G7LB 3WIHL 3TBWA 1AGBB 1T4KA 4HXBH 4G3YL 1AXTL 2IANE 1FO0L 1T22A 1ZOXA 1HE7A 4KVNH 2MFNA 2VR9A 1A0QH 5C6TH 1JWMA 4Q9RH 4YHZL 1CICC 3WDJA 3QIUD 4JKKA 4UDUA 5EZOH 3T3PF 1Z9MA 4K23L 1Z5LB 4K94C 1EO7A 5EOCJ 4EUPB 3WO3B 3PABA 3MRMB 3MBXL 4PGDA 5TDPA 4X7TA 3ROLB 1T83A 2EZ0C 1NGPH 5B39B 3CFBA 1J7VR 4IHOA 5EZIL 3QB7C 3PXJA 3RGVA 4DGIL 2RIKA 3RL1A 4HWBH 4RGMB 4OFPA 4F33B 2DQGL 3QWRA 5D2NC 4FQXD 4HC1A 4NQTA 5CCKL 2Y4SA 3L3JB 4Q9QL 1FG9C 3TA3C 5F9JA 2YUVA 4Q2ZA 3V79C 1EAPA 4QNPF 5B39G 1DTUA 3MLTA 3MRLA 3ZTJG 4OZFH 5J3HD 2P24B 1MRDL 3L6FB 1UYWH 2R2BB 1EXUA 2I26N 1HKLL 3HC4H 3KJ4B 4OBRA 3DX8B 4FZ8L 3P3YA 3E0GA 4UU9B 1AGFB 1OB1A 3BGMB 1ZLUK 3G6DL 2AQ2A 3B2UC 5E03A 1BM3L 1WF5A 1XGUA 25C8H 4YGVA 4P9HH 4OGZA 2CLRB 4J3TA 4O5LL 1O7VA 2ICWB 5C0FB 5J6HA 4HIIB 2KKQA 1A4JA 5J9PA 2XQYG 3HE6D 4OCNC 1KTDA 4PJ8D 1KLFA 2B39A 5HVHB 1WC7B 2CRIA 3VRIB 1ZS8B 3MROA 3O8XD 4PJFE 1OTSC 3HC0B 1B88A 1JVKA 2VAAA 3QUMH 2E7LA 2MSPA 5E7FA 1IMHC 4N68A 5B38B 5C0NC 3HI6L 1KUMA 1GCFA 4L8SC 4ZUSB 1MCCA 4QF1B 4U1NA 1A1MB 5IESL 3BWAB 2O5XL 3QNXA 5CUSH 2ITDB 4LCWB 4OTXH 1FAIL 5DS8B 4GW1B 3G5XA 4JFHE 4YC2B 2NY1C 5B38G 5DD5L 3X12A 4MXQD 4XCNB 3BKCH 4FZEL 2PTTB 2NY4B 3BD4A 2ZP0T 3HG1E 1H8SA 4OLUL 2FJHA 2P43B 5EFIB 3JV0A 1FORH 3O4LB 1QD0A 2H2SD 2JCCE 3F7YA 2XRAH 4HC1L 4NQVA 4WWKC 4U1SB 1BREA 4M8QB 1CN4A 5E4EC 4OZHE 2Z31A 4HLZG 1KG0A 4WEBH 2UWEB 5IQ9A 2F74B 2IAND 1K3IA 2VABA 2XWBB 3T08A 2X5PA 4XBEL 4OAWA 4DOHE 3UXFA 1LVEA 4R0LA 2VXVL 2A6KB 4YR6B 2XIDA 2IPUG 3V5KA 5M7QA 5J4MA 4TSAL 4KDVA 4TOYL 3TN0B 1OAQH 3DUSB 1WVZA 3Q5OA 5EC2A 1WWBX 2HVKB 3BP6A 1X5AA 1RULL 4JEGB 3BRFA 3GMNB 3V6ZB 4DTGL 4YXLH 1MCNA 1CR9L 4Q0XL 3F7RA 2R56L 3FQXB 1HCVA 5T1KB 1E4XH 5JDJA 3A67H 3BP4A 4X4XB 3BGFB 5KVEH 4JKPL 2XNAB 1LEKB 2J8OA 2ARJA 1I7TA 1OHQA 1NCAH 1CGYA 3VWKC 3P9WB 3KPMA 2HT4D 5JNYB 2EDJA 4BH7A 4OGXL 3X11A 1CFNA 3ZTNL 2B0SL 1MI5E 2YD3A 4ZS6D 1RZJC 3QXUA 5D2LA 5KG9A 1AKJD 4NNXA 3QFJE 2WWMC 1SEBB 1S7TB 2JTDA 4XTRD 1NDGB 4OD2B 4DN3L 2AABL 2QLVB 1JPST 4P2OB 1TJGL 3HKFA 1PSKL 1K8IA 3DV4A 1G7JA 3TGXA 1CGXA 4OQ1A 2YA0A 1YPZE 3E1F1 3IU4H 1MAKA 6CGTA 2OI9B 3CFJA 3K2UL 5I2IA 3BT2L 3DX7B 4R7NA 4Z0BL 5JHLH 1M1SA 1BHGA 4MXWL 1A6PA 4PLKC 4Y2DD 5T1DH 3DJ9A 4LIQL 2OZ4L 5ETUB 4P5MA 1KB9K 1BQLH 2DICA 3LQAL 3D0LA 4PJEF 4Z95L 5EO0B 3QI9C 1HEZA 5EDXA 1QBLL 1C5CH 2W9DH 3GJFA 4OLVH 4H25B 4I4WA 4CDGC 4E0RA 2WW8A 2J1KA 2XZQL 1JZ6A 5ACZA 3FO1B 5ALCL 4JFHD 4LFHD 1CK0H 2H1PL 5F7YC 4FQLH 2ZCKH 1VCAA 5EPMA 5H35A 2X40A 1G9MH 5GS0H 4R4NC 3HG1D 4PJ7A 3PV7A 5IBLC 1SM3H 4ZFFA 4JM4L 1K6QL 5HJ3A 3SKJH 1QRND 5DJ2A 3WFHA 1U8MA 5I18L 3UTQB 1SYSA 5I16A 5D7IF 1RK1B 4AL8H 4NN7B 5ITBL 4Z76B 1FIEA 4OZGB 3D2UB 5L2KE 4YWGH 1C1EH 1PDKA 1XGYL 3BKMH 4G43B 1BZ7B 1DBBH 3U0WL 1R5VA 3GMPA 1DUZA 4R4FH 1RIHL 5HHME 4F15C 2I27N 4LHQB 3H9HB 1RZGB 4GXVL 3HZKA 4HGWB 4QOKA 5D1QD 1XR9B 4HQQH 4JDVA 4ORGA 4QRQB 4QCIB 3P4MB 1JZ3A 1RVFH 4KJPD 4HXAH 4PRPA 2NXZD 1PBYA 4M1CC 1RU9H 4O58H 3UYOD 4DKAA 5E5UB 2PO6D 1I3RB 2CH8A 3QNYB 5CIPH 3IETB 2CPCA 4P59L 1A6ZA 1P7HL 2A83A 5SWQA 5BO1H 3D48R 2H3NB 1KN2H 4NN6C 5KVFH 2YN5A 5EIIB 5DRNA 3BRDA 3DMMC 4LEXL 3OXSA 2D31A 3KPRB 5KSVB 2X4RB 3KYMA 1EFXB 4F58H 2PYEE 1QFUH 1RZIB 2YKLH 1LO0H 3NCBB 2EYTB 5DHVA 5GJTL 2BRRH 5AYUH 2HT3D 4PG9A 4OT1L 3QFJD 2GKIA 3FQWB 2HFEB 2IBZX 2JB5L 3D0VB 5DYOB 3KR3H 3H42H 4ERSH 2C1OB 2OP4L 3IYLW 3UCRA 3VXMA 4KXZH 4PJGB 4PJ5D 5D1XB 2VZOA 3G6AB 3TBSB 5I0ZA 1IGTA 3QUXD 1KYOK 5A43C 3ARPA 2VKWA 2VXSL 2C3WA 2VL5A 3HCVA 4PJXE 3VFWA 1EBAA 2EE2A 4K8RL 5IHBA 4MSWB 4JFDB 3QZWB 4MXVF 4NFDA 1P69B 4N8CL 1QSFB 3MREA 4MJ6A 4PTTB 3W9EA 4UTAH 1QSED 1FL6B 4JRXD 1N64L 5JDSB 4XXDA 1RZKC 2P45B 1TCRA 5BMFL 3SO3C 3OR7A 2Z8WC 1DE4B 1WCBB 4OF5A 4LSUH 5D9SA 2VQ1A 4KQ3L 1BEYL 1GYAA 3OMZA 1VKXA 3TVMC 3WSQH 5A2JH 3VRJB 3WHXA 3CSPA 1XEDA 1VADB 4XVSL 3EOTL 4ODBD 3JV6B 1S7UA 5CSBA 4NKIH 4LLDB 3KPQA 5L2KD 4EQ2A 5IGXL 1KTLA 2QHRH 2VDML 5K9OA 1QFWM 4UDTA 5IEHA 3SJVA 3QCUH 4M7KH 4MDIB 3MO1A 3C2AH 2YA2A 3C5ZB 4U7MA 4YBLC 3GMOB 3IJYA 3K80A 1IQWL 2MJWA 3WO4B 2R1XB 2NY6B 5I1HH 4JZJA 1VPOL 3NZHH 5EBWA 1LO4H 4MQ7A 3DVIA 2H6PB 1UWGL 3BZ4A 2GAZA 4R90H 3SE4A 1TNNA 3J7HA 1EUTA 4K2UH 2ZUUA 4JPKL 3VRLE 3CNKA 3S36L 3H9SA 3LAFA 3UJTL 2HJFA 1GIGL 2F5AH 3GI8L 5E2TH 2IH3B 3R4DA 3HB3D 3HI5H 1EUUA 5DJZA 3A6BH 4EDXB 4NQSB 2DTSA 1KJ3H 5E99H 3O6FD 1PG7L 5HYJA 4L4TA 5B8CA 1U8IB 2PYED 3MC0A 5EOCL 4P48A 4X9GA 3IDYB 2Z8SA 1MJ7H 3DHJA 2F19L 4FFVD 3WUZA 4QRRA 2O26U 2DI7A 1JV5B 2OSLB 4BZ2H 2AK4E 1F2XK 1JRHI 1XF4A 5JW3H 2BMKA 3THMH 3NIDE 1LDPL 4WI7A 4ZTPL 4W4OA 5C0CA 3I3BA 2VLRA 3PV6B 3QEHB 5F1NA 4PJ5A 5DVOA 5D4QA 3QIUC 4KJWD 1MUJB 4FTVA 3IFLH 4QRTB 1JK8A 4HMDA 5CHNB 2Y1VA 5DDHA 2NY3C 4MDJA 3D18A 1MHPH 1G7QB 2X9XA 5IVXF 5HYFA 4WU5B 4DW2L 4P46A 5E1AB 4GRLC 1FL5A 4OF3A 4FQXC 4LHUD 1WWWX 3LH2L 2DKMA 4JRXA 3TIEA 1L0QA 1DBML 3EOBB 1TZIA 3LB6D 2PNDA 3MYJB 3MGTB 3FB8B 1D5ZA 3DTXA 1HXMB 4DVRH 3L7FA 5JPNB 2FBOJ 3GMLA 2BY3A 5CBEB 1HSBA 4NKQB 4HUXB 5D6CA 4OD3L 3OJDA 4AIXA 1B3JA 3OZ9H 4POZD 3RY6A 1UZ8B 2Z8VC 4EDWL 1MJJA 5E95B 4PJ9C 1ADQA 1PKOA 4OM0L 4PLOB 3D1MC 4UILH 5C2BL 1FDLH 4JGUA 4U6XA 2OQJB 2PYFB 1EHXA 4EN3D 4LSRL 3RI5F 3A6OA 3WE6B 3RL2B 3U4EA 1KJMB 5KZCD 4HKZB 3BPLC 4DVBA 3QQ3A 3GSRA 5AUMB 3KJ6H 4XPFH 1OARL 4AEEA 4YUEL 3X3GL 1A7BA 3WBDA 5DD3H 1WBZB 1YJDL 2ZZUT 2DQEH 3STBA 2OL3B 4ONFL 3TBYB 3L3HB 1CE6B 1YEDB 1AGEA 4ZSOA 2I07B 2OM5A 3MX0A 5ANMB 1ZLWK 3QQ9C 3EUUA 1MFDL 2ADJA 3DYPA 3VGBA 3U0TA 2Q7YA 4X99A 4ZO7A 5EUOF 4DN4H 1S5IL 1IKNC 3D25A 4L8BB 4KZDL 5C0RH 4GXUN 2JELL 4MXQC 5CEZE 2FJFA 3ES6B 1VFUA 4KPHH 3C60D 43C9B 2A74A 4KGLA 5ID0A 3KAAA 2ZUXA 2H2SC 1I1YA 4WW2F 4HUVA 1ND0A 1T89C 3V0VB 4NQXB 2B5IC 5I15L 5HVFB 3P9MA 2VH5H 4XAKE 1MCPH 4OSUL 3QJFA 3EYOA 2UZIH 2H45A 5I76B 1UM4H 1FE8H 4B0MM 1U6AH 4FABH 1QLFA 1X9QA 1A9EA 1ZMYA 1JUFB 1V7NH 1YYMH 2NTFA 2XWTA 5JPMA 1A6TA 3HPJA 2R8SL 1ADQL 3T04D 3RIAK 2VIRA 1N6UA 3RKPA 1T04B 3GMQA 1ED3B 5IT2H 4J2XA 3JVGA 4D8PB 4OZFB 4B7LA 4P99A 1MCKA 1BX2A 1U8HA 1YMHA 4H8WH 4PRNA 4EI6A 1R3KA 4BSWB 5BVJA 1CXFA 5CGMA 1KBGL 4UOW1 2FIKA 4I0PA 5DEGB 1M71B 4OLYH 3I2CH 3I3EA 5F1IB 4YHNB 3X14B 2HTLD 3VD9A 1YEFL 5EU3B 3CXDH 1N7ML 4GMSL 1FNGB 1N4XH 1T21A 2AW2A