4L3HD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l3hD00
4FA4D 4IA9A 5JWZA 4FAND 5CXBA 1JOFA 1S4UX 1Q47A 3SXTD 4ERYA 4BH6A 2YNNA 4J84A 4GGCA 5EAPA 4X63B 1GOTB 5HE0B 3A0FA 3SMRA 4XYIA 2CE8A 5AJAA 5TF2A 3IJ1A 1GP2B 3EI3B 3FGBA 2QXVA 3IKOA 3I89A 4J0WA 3OKTA 4GQBB 5CYKB 4Y7RA 5FA5B 4A2LA 4MK0B 4PSXB 2H9MA 5C2VB 4E5ZB 3IIYA 1PBYB 4X61B 1TBGA 3OTTA 3EI2B 4G56B 3EI1A 4J8GA 4I79A 3I2NA 3PSCB 2HESX 4OZUA 4A0AB 4CY1A 5EAMA 3CIKB 3OW8A 5IT9g 5I5MA 3AFCA 4ESGA 3VA6A 4GQ1A 5GSAA 4O9DA 3FRXA 4PXWA 2HJ4A 5TEEA 1XKSA 2YMUA 3NVQA 2CNXA 2H6KA 2IAAA 4TZ4A 5A2Qg 3MZKA 3EMHA 5THAA 1B9YA 3C75H 3MZLA 1N6DA 3RRMC 3AL8A 5EMKB 2H6NA 1R5MA 2H9NA 3UKUC 5HYNB 2OK6A 3DWLC 1GXRA 1K32A 4E54A 4JSVC 3JRPA 5H1MA 3DSMA 4PNKB 3MKQA 1GG2B 2H68A 3IJCA 4A0BB 2IUVA 5K19A 4CZVA 4CY2A 4J8BA 4D6VA 3KRWB 2Z2OA 5C9ZB 5HE2B 3UVMA 3BG1A 2OVRB 2HJBA 2OJYA 4Z8LA 3I7KA 4ZOVA 3RFHA 4A7JA 2IUQA 4N14A 3AL9A 2YNOA 3K27A 4J73A 2CE9A 4GGDA 3JZNA 5CXCB 3JZHA 3UR4A 3ODTA 4FAVD 5C2WB 3J81g 2HXCA 4FWWA 4FA5D 2CO0A 4QT8A 4L3GD 3EU7A 2XL2A 1SQJA 3U4YA 2P9SC 4O3UB 4CI8A 3NVXA 2CO0C 2I3TA 5IC7A 5EM2B 3N0EA 3RN0D 4CI1A 4IMMA 2HYEA 4J81A 1P22A 3F3GA 3BWSA 4YVDA 4BL0A 3IIWA 4CY3A 2AQ5A 2I0TA 4GGAA 4NSXA 3C9CA 2IURA 2PBIB 4GQ2P 3I8EA 4UI9R 2OIZA 4LG9A 2H3XA 3EI3A 5EALA 2XL3A 2O9KA 3UKRC 1N6FA 3V5WB 5I5IA 4GZ8A 5FXYA 5FLXg 3RN1D 1MG3A 3I7NA 4AEZA 4A09B 4PBYA 4EWRA 3SFZA 1SQ9A 3MKSB 3RMZD 1L0QA 4A0AA 2UZYB 3C99A 4X60B 5IJ8E 3MMYA 4JSPC 4O1QD 2PM6B 4J82A 3EI4A 4J0XA 2QC5A 4ERQA 5EMMB 5EMJB 3SBPA 4CC9A 1JMXB 2GC7A 3GFCA 3PE7A 1RI6A 3OKWA 4FA9D 3JZGA 5GXIA 3EG6A 4KFMB 1PEVA 3UVLA 2B5MA 2PM9A 1PGUA 1TYQC 3VGZA 3K26A 2AGZA 4CI2A 4JT5C 2P9IC 3PXSD 3OL2B 4GM9A 3RSEC 4A11B 4J78A 2Z2NA 3JPXA 1NEXB 3SWSD 3ZWLB 3JAMg 4ZN4A 4AOWA 4PSWB 4E54B 1N6EA 3ORVD 4FHLA 4A0BA 2GNQA 3DXKC 4QRJA 4X3EA 3SLED 2PM7B 3UVOA 4A08A 4LGNA 4XEIC 5AMSA 3FM0A 4JXMA 3F3FA 2J55H 2BCJB 3DM0A 2AGLA 5IGOA 2I0RA 2AGXA 1OMWB 3OKYA 1A0RB 1OLZA 4R7AB 3RLMD 2B5LA 3RFGA 4XYHA 4HDJA 3AH8B 2CN2A 4QL1A 5AFU3 3CFVA 2H13A 2OVQB 2MTAH 4ZOYA 2HKMA 4LG8A 3NVNA 4QQEA 3F3PA 4CY5A 1FWXA 4JD2C 4O3TB 3EWEA 1QNIA 5EARA 4GM8A 5FKRA 5TEFA 4CZYA 5CXBB 5EM2A 3E0CA 2YB8B 4ZOXA 3I7HA 3MXXA 4FB1D 4H5JA 4GM3A 3N0DA 2GC4A 3DXMC 2P9LC 4GMBA 2H9LA 2CN3A 1JJUB 3SBQA 5FQDA 3C5MA 5CYKA 4A2MA 3JROA 5IGQA 3I7OA 5I5JA 1K8KC 5B4WA 4E5ZA 2I0SA 5K1CC 5IJ7E 3SVWD 3EI2A 3JB9L 3EI1B 2B4EA 4L3HD 3PSLA 3ULEC 2EBSA 3VH0A 2AGYA 4L1QD 4A09A 4JSNC 2HKRA 5SXMA 1JMZB 3P4FA 3HFQA 5HE1B 4J77A 1MG2A 2XYIA 3UVKA 1SHYB 5HE3B 3EI4B 5EMLB 3CFSB 4CI3A 1YFQA 5H14A 2Q7QA 3SJLD 1B9XA 4O45A 2AH0A 2UZXB 2P9KC 4D0KA 2H47A 2OK4A 2P9UC 3W15A 2AH1A 2H14A 1U2VC 5KDOB 2PM9B 3AL8B 5FKSA 3PVUB 1XHMA 2W18A 4FA1D 5HQGA 2J56H 2I3SA 3PVWB 3V7DB 4ES0A 4PC0A 1XIPA 3I8CA 3OL2A 4A11A 4L9OA 2J57G 5FKQA 3GREA 2P9PC 3BG0A 5TDHB 3B7FA 3L4OD 4K3JB 5H17A 4J86A 4ZOZA 1VYHC 3SBRA 2YBAA 4A08B 3L4MD 3PXWD 4J87A 2YNPA 4PBZA 4K3ID 3J80g 2P9NC 3SCYA 3V9FA 4BUJC 4OWRA 5GXHA 4U1EI 2IWFA 4ERZA 2AGWA 3OKYB 5CXCA 1ERJA 5FKTA 3SN6B 3UVNA 2G99A 3PXTD 1PI6A 1NR0A 4JT6C 4H5IA 4U7AA 2OVPB 3KRXB 4Y5RD 2IUPA 1U4CA 3I7PA 4J79A 2XU7A 4JSXC 2BBKH 2H6QA 4CZXA 2H9PA 2TRCB 2IWKA 3I7LA 3IJ0A 2Z2PA 1MDAH 3SHFA 2G9AA 2B5NA 5GMKn
chains in the Genus database with same CATH superfamily
4FA4D 4IA9A 5JWZA 4FAND 5CXBA 1JOFA 4G1MA 1S4UX 4DNWA 1C9LA 1K3IA 1Q47A 3MUNA 3SXTD 4ERYA 4BH6A 2VDRA 2YNNA 4J84A 4GGCA 5EAPA 4X63B 1GOTB 5HE0B 3A0FA 3SMRA 4XYIA 2CE8A 4NC4A 3K71A 2XZGA 5AJAA 5TF2A 3IJ1A 4QAMA 1GP2B 3EI3B 3FGBA 2QXVA 3IKOA 3I89A 4J0WA 5FFGA 3MVDK 3OKTA 4GQBB 5CYKB 4Y7RA 5FA5B 4A2LA 4MK0B 4PSXB 2H9MA 5C2VB 4E5ZB 3T3PA 3IIYA 1PBYB 4X61B 1TBGA 3OTTA 3EI2B 4G56B 3EI1A 4J8GA 2JKXA 4I79A 3I2NA 3PSCB 4WK4A 3ZDXA 4NAAA 2HESX 4OZUA 4A0AB 5M5UA 3IUQA 4CY1A 5C86A 5EAMA 3CIKB 3OW8A 5IT9g 5I5MA 2HU5A 3AFCA 3FCSA 4ESGA 1O6GA 3VA6A 4GQ1A 5GSAA 3K72A 4O9DA 3FRXA 4PXWA 2HJ4A 5TEEA 1A12A 3NIGA 4BCCA 3VI4A 1XKSA 2HU7A 2YMUA 3IUMA 1UTCA 3QI0A 4WJKA 3NVQA 2CNXA 2HU8A 2H6KA 2IAAA 4MMXA 4TZ4A 5A2Qg 3MZKA 3EMHA 5THAA 1B9YA 2VZ3A 3C75H 3MZLA 1N6DA 3RRMC 3AL8A 5EMKB 2H6NA 1UOQA 1R5MA 2H9NA 3IUJA 3UKUC 5HYNB 2OK6A 3DWLC 1GXRA 1K32A 4E54A 4JSVC 3JRPA 5H1MA 3DSMA 4O2WA 4UM9A 4PNKB 3MKQA 1GG2B 2H68A 3IJCA 4A0BB 2IUVA 4IRZA 5K19A 4CZVA 1E8MA 4CY2A 4J8BA 4D6VA 3KRWB 2Z2OA 5C9ZB 5HE2B 5M5TA 3UVMA 3BG1A 2OVRB 3O4JA 2HJBA 2OJYA 4Z8LA 3I7KA 4ZOVA 3RFHA 4A7JA 2VZ1A 2IUQA 4N14A 3AL9A 2YNOA 3K27A 4J73A 2CE9A 4GGDA 3JZNA 5CXCB 2XE4A 4RE5A 3JZHA 3UR4A 3ODTA 4FAVD 5E6UA 5C2WB 2VC2A 3J81g 2HXCA 4BCBA 4FWWA 4FA5D 2CO0A 1VZ2A 4QT8A 4L3GD 3EU7A 2XL2A 1SQJA 3U4YA 3GD1I 2P9SC 4BP9A 4O3UB 4RE6A 3NVXA 4CI8A 2CO0C 2I3TA 5IC7A 5EM2B 3N0EA 3RN0D 4CI1A 4IMMA 2HYEA 4J81A 1P22A 1I2MB 3F3GA 3BWSA 4YVDA 4BL0A 3IIWA 4CY3A 2AQ5A 3FCUA 2I0TA 4GGAA 4AX4A 2VDLA 4NSXA 3C9CA 2IURA 2PBIB 3MUOA 3V4PA 4G55A 4GQ2P 3I8EA 4UI9R 2OIZA 4LG9A 2H3XA 3EI3A 1JV2A 5EALA 2XL3A 3ZE2A 3VI3A 2O9KA 3UKRC 1N6FA 3V5WB 5I5IA 4GZ8A 3ZE1A 5E6SA 5FXYA 5FLXg 3RN1D 1MG3A 2VDMA 3I7NA 4AEZA 3O4HA 1C9IA 4A09B 4PBYA 4EWRA 3SFZA 1SQ9A 3MKSB 4MMYA 3RMZD 3ZDZA 1L0QA 2BKLA 4A0AA 2VDPA 2UZYB 3C99A 4X60B 5IJ8E 3MMYA 4JSPC 4O1QD 2PM6B 4J82A 3K6SA 3EI4A 3V4VA 4J0XA 2QC5A 4ERQA 5EMMB 5EMJB 3SBPA 4CC9A 3GC3B 1JMXB 2GC7A 1UOOA 3GFCA 3PE7A 1RI6A 1QFMA 3OKWA 4FA9D 4WK2A 3JZGA 4MMZA 1O6FA 5GXIA 3EG6A 4KFMB 1PEVA 2XDWA 3UVLA 2B5MA 2PM9A 1PGUA 1TYQC 3VGZA 1YR2A 3K26A 3EQ8A 2AGZA 4CI2A 4D9SA 4JT5C 2P9IC 3PXSD 3OL2B 4GM9A 3RSEC 4A11B 5M5SA 4J78A 2Z2NA 3JPXA 1H2YA 1NEXB 3SWSD 3ZDYA 3ZWLB 3JAMg 4ZN4A 4AOWA 4PSWB 4E54B 1N6EA 3ORVD 4FHLA 4A0BA 2GNQA 3DXKC 4NBMA 4QRJA 4X3EA 3SLED 2PM7B 3UVOA 4A08A 4LGNA 4XEIC 5AMSA 3FM0A 4JXMA 3F3FA 2J55H 2BCJB 3DM0A 3NIFA 2AGLA 5IGOA 2I0RA 2AGXA 1OMWB 3OKYA 2VDKA 1A0RB 1OLZA 4R7AB 3RLMD 2B5LA 3RFGA 4XYHA 4HDJA 3AH8B 1M1XA 2EIEA 2CN2A 4QL1A 5AFU3 3CFVA 2H13A 4WK0A 4DNUA 2OVQB 2MTAH 1UOPA 1GOGA 4ZOYA 2HKMA 4LG8A 3EQ7A 3NVNA 3F3PA 1H2WA 4QQEA 4CY5A 1FWXA 4JD2C 4O3TB 3EWEA 1QNIA 5EARA 4GM8A 3IVMA 5FKRA 4AMZA 4Z7QA 1VZ3A 5TEFA 4CZYA 4AMYA 1QFSA 5CXBB 2VDOA 2QZPA 5EM2A 4AN1A 3E0CA 4BP8A 2YB8B 4ZOXA 1JTDB 2QR5A 1E5TA 3I7HA 3MXXA 3NIDA 4H5JA 4FB1D 4GM3A 3N0DA 3EQ9A 2GC4A 3DXMC 2P9LC 3KCIA 4GMBA 2H9LA 2CN3A 4Z7NA 1JJUB 3SBQA 5FQDA 3C5MA 5CYKA 4A2MA 3T3MA 3JROA 5IGQA 3I7OA 5E6RA 2VDNA 3IURA 5I5JA 1K8KC 5B4WA 4E5ZA 2EIBA 2I0SA 5K1CC 4O02A 5IJ7E 3SVWD 3EI2A 3JB9L 3EI1B 1BPOA 2B4EA 4G1EA 3QHYB 3PSLA 4L3HD 3ULEC 2EICA 4Z7OA 2EBSA 3VH0A 2WQ8A 4JHPC 2AGYA 4L1QD 4A09A 4JSNC 2HKRA 5SXMA 1JMZB 1H2ZA 3P4FA 3HFQA 4L1MA 3IJEA 5HE1B 5M5RA 3OF7A 4J77A 1MG2A 2XYIA 3UVKA 1SHYB 5HE3B 3EI4B 1VE6A 1L5GA 5EMLB 5M61A 3CFSB 2VDQA 4CI3A 1YFQA 5H14A 2Q7QA 4NENA 3SJLD 3ZE0A 1B9XA 1VE7A 2AH0A 2UZXB 4O45A 5C92A 2P9KC 4D0KA 2H47A 2OK4A 2P9UC 3W15A 2AH1A 2H14A 1U2VC 5HDBA 5KDOB 2PM9B 3O4IA 3AL8B 5FKSA 4BCDA 3PVUB 1XHMA 2W18A 4FA1D 5HQGA 2J56H 2I3SA 3PVWB 3V7DB 3IUNA 4PC0A 4ES0A 1XIPA 3I8CA 3OL2A 4A11A 4L9OA 2J57G 5FKQA 3GREA 2P9PC 1GOHA 2EIDA 3BG0A 3B7FA 3O4GA 5TDHB 3L4OD 4K3JB 5H17A 4J86A 4ZOZA 1VYHC 3SBRA 4UM8A 2YBAA 4A08B 3L4MD 3PXWD 4J87A 2YNPA 4PBZA 4K3ID 1T2XA 3J80g 2P9NC 3SCYA 1TYEA 3V9FA 4BUJC 4OWRA 5GXHA 4U1EI 2IWFA 4JHNA 3DDUA 4DNVA 1GOFA 4ERZA 2AGWA 3OKYB 5CXCA 1ERJA 5FKTA 3SN6B 3UVNA 2G99A 3PXTD 5M5VA 3IULA 1H2XA 1PI6A 1NR0A 4JT6C 5FFOA 4H5IA 4U7AA 4AN0A 2OVPB 3KRXB 4Y5RD 2IUPA 1U4CA 3I7PA 4J79A 2XU7A 4JSXC 1U8CA 2BBKH 2H6QA 4CZXA 2H9PA 2TRCB 2IWKA 3I7LA 3IJ0A 2Z2PA 1MDAH 3SHFA 2G9AA 1E8NA 2B5NA 5GMKn
chains in the Genus database with same CATH topology
4FA4D 4IA9A 5JWZA 4FAND 5CXBA 1JOFA 1S4UX 1Q47A 3SXTD 4ERYA 4BH6A 2YNNA 4J84A 4GGCA 5EAPA 4X63B 1GOTB 5HE0B 3A0FA 3SMRA 4XYIA 2CE8A 5AJAA 5TF2A 3IJ1A 1GP2B 3EI3B 3FGBA 2QXVA 3IKOA 3I89A 4J0WA 3OKTA 4GQBB 5CYKB 4Y7RA 5FA5B 4A2LA 4MK0B 4PSXB 2H9MA 5C2VB 4E5ZB 3IIYA 1PBYB 4X61B 1TBGA 3OTTA 3EI2B 4G56B 3EI1A 4J8GA 4I79A 3I2NA 3PSCB 2HESX 4OZUA 4A0AB 4CY1A 5EAMA 3CIKB 3OW8A 5IT9g 5I5MA 3AFCA 4ESGA 3VA6A 4GQ1A 5GSAA 4O9DA 3FRXA 4PXWA 2HJ4A 5TEEA 1XKSA 2YMUA 3NVQA 2CNXA 2H6KA 2IAAA 4TZ4A 5A2Qg 3MZKA 3EMHA 5THAA 1B9YA 3C75H 3MZLA 1N6DA 3RRMC 3AL8A 5EMKB 2H6NA 1R5MA 2H9NA 3UKUC 5HYNB 2OK6A 3DWLC 1GXRA 1K32A 4E54A 4JSVC 3JRPA 5H1MA 3DSMA 4PNKB 3MKQA 1GG2B 2H68A 3IJCA 4A0BB 2IUVA 5K19A 4CZVA 4CY2A 4J8BA 4D6VA 3KRWB 2Z2OA 5C9ZB 5HE2B 3UVMA 3BG1A 2OVRB 2HJBA 2OJYA 4Z8LA 3I7KA 4ZOVA 3RFHA 4A7JA 2IUQA 4N14A 3AL9A 2YNOA 3K27A 4J73A 2CE9A 4GGDA 3JZNA 5CXCB 3JZHA 3UR4A 3ODTA 4FAVD 5C2WB 3J81g 2HXCA 4FWWA 4FA5D 2CO0A 4QT8A 4L3GD 3EU7A 2XL2A 1SQJA 3U4YA 2P9SC 4O3UB 4CI8A 3NVXA 2CO0C 2I3TA 5IC7A 5EM2B 3N0EA 3RN0D 4CI1A 4IMMA 2HYEA 4J81A 1P22A 3F3GA 3BWSA 4YVDA 4BL0A 3IIWA 4CY3A 2AQ5A 2I0TA 4GGAA 4NSXA 3C9CA 2IURA 2PBIB 4GQ2P 3I8EA 4UI9R 2OIZA 4LG9A 2H3XA 3EI3A 5EALA 2XL3A 2O9KA 3UKRC 1N6FA 3V5WB 5I5IA 4GZ8A 5FXYA 5FLXg 3RN1D 1MG3A 3I7NA 4AEZA 4A09B 4PBYA 4EWRA 3SFZA 1SQ9A 3MKSB 3RMZD 1L0QA 4A0AA 2UZYB 3C99A 4X60B 5IJ8E 3MMYA 4JSPC 4O1QD 2PM6B 4J82A 3EI4A 4J0XA 2QC5A 4ERQA 5EMMB 5EMJB 3SBPA 4CC9A 1JMXB 2GC7A 3GFCA 3PE7A 1RI6A 3OKWA 4FA9D 3JZGA 5GXIA 3EG6A 4KFMB 1PEVA 3UVLA 2B5MA 2PM9A 1PGUA 1TYQC 3VGZA 3K26A 2AGZA 4CI2A 4JT5C 2P9IC 3PXSD 3OL2B 4GM9A 3RSEC 4A11B 4J78A 2Z2NA 3JPXA 1NEXB 3SWSD 3ZWLB 3JAMg 4ZN4A 4AOWA 4PSWB 4E54B 1N6EA 3ORVD 4FHLA 4A0BA 2GNQA 3DXKC 4QRJA 4X3EA 3SLED 2PM7B 3UVOA 4A08A 4LGNA 4XEIC 5AMSA 3FM0A 4JXMA 3F3FA 2J55H 2BCJB 3DM0A 2AGLA 5IGOA 2I0RA 2AGXA 1OMWB 3OKYA 1A0RB 1OLZA 4R7AB 3RLMD 2B5LA 3RFGA 4XYHA 4HDJA 3AH8B 2CN2A 4QL1A 5AFU3 3CFVA 2H13A 2OVQB 2MTAH 4ZOYA 2HKMA 4LG8A 3NVNA 4QQEA 3F3PA 4CY5A 1FWXA 4JD2C 4O3TB 3EWEA 1QNIA 5EARA 4GM8A 5FKRA 5TEFA 4CZYA 5CXBB 5EM2A 3E0CA 2YB8B 4ZOXA 3I7HA 3MXXA 4FB1D 4H5JA 4GM3A 3N0DA 2GC4A 3DXMC 2P9LC 4GMBA 2H9LA 2CN3A 1JJUB 3SBQA 5FQDA 3C5MA 5CYKA 4A2MA 3JROA 5IGQA 3I7OA 5I5JA 1K8KC 5B4WA 4E5ZA 2I0SA 5K1CC 5IJ7E 3SVWD 3EI2A 3JB9L 3EI1B 2B4EA 4L3HD 3PSLA 3ULEC 2EBSA 3VH0A 2AGYA 4L1QD 4A09A 4JSNC 2HKRA 5SXMA 1JMZB 3P4FA 3HFQA 5HE1B 4J77A 1MG2A 2XYIA 3UVKA 1SHYB 5HE3B 3EI4B 5EMLB 3CFSB 4CI3A 1YFQA 5H14A 2Q7QA 3SJLD 1B9XA 4O45A 2AH0A 2UZXB 2P9KC 4D0KA 2H47A 2OK4A 2P9UC 3W15A 2AH1A 2H14A 1U2VC 5KDOB 2PM9B 3AL8B 5FKSA 3PVUB 1XHMA 2W18A 4FA1D 5HQGA 2J56H 2I3SA 3PVWB 3V7DB 4ES0A 4PC0A 1XIPA 3I8CA 3OL2A 4A11A 4L9OA 2J57G 5FKQA 3GREA 2P9PC 3BG0A 5TDHB 3B7FA 3L4OD 4K3JB 5H17A 4J86A 4ZOZA 1VYHC 3SBRA 2YBAA 4A08B 3L4MD 3PXWD 4J87A 2YNPA 4PBZA 4K3ID 3J80g 2P9NC 3SCYA 3V9FA 4BUJC 4OWRA 5GXHA 4U1EI 2IWFA 4ERZA 2AGWA 3OKYB 5CXCA 1ERJA 5FKTA 3SN6B 3UVNA 2G99A 3PXTD 1PI6A 1NR0A 4JT6C 4H5IA 4U7AA 2OVPB 3KRXB 4Y5RD 2IUPA 1U4CA 3I7PA 4J79A 2XU7A 4JSXC 2BBKH 2H6QA 4CZXA 2H9PA 2TRCB 2IWKA 3I7LA 3IJ0A 2Z2PA 1MDAH 3SHFA 2G9AA 2B5NA 5GMKn
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  4IA9 A;  5JWZ A;  4FAN D;  5CXB A;  1JOF A;  1S4U X;  1Q47 A;  3SXT D;  4ERY A;  4BH6 A;  2YNN A;  4J84 A;  4GGC A;  5EAP A;  4X63 B;  1GOT B;  5HE0 B;  3A0F A;  3SMR A;  4XYI A;  2CE8 A;  5AJA A;  5TF2 A;  3IJ1 A;  1GP2 B;  3EI3 B;  3FGB A;  2QXV A;  3IKO A;  3I89 A;  4J0W A;  3OKT A;  4GQB B;  5CYK B;  4Y7R A;  5FA5 B;  4A2L A;  4MK0 B;  4PSX B;  2H9M A;  5C2V B;  4E5Z B;  3IIY A;  1PBY B;  4X61 B;  1TBG A;  3OTT A;  3EI2 B;  4G56 B;  3EI1 A;  4J8G A;  4I79 A;  3I2N A;  3PSC B;  2HES X;  4OZU A;  4A0A B;  4CY1 A;  5EAM A;  3CIK B;  3OW8 A;  5IT9 g;  5I5M A;  3AFC A;  4ESG A;  3VA6 A;  4GQ1 A;  5GSA A;  4O9D A;  3FRX A;  4PXW A;  2HJ4 A;  5TEE A;  1XKS A;  2YMU A;  3NVQ A;  2CNX A;  2H6K A;  2IAA A;  4TZ4 A;  5A2Q g;  3MZK A;  3EMH A;  5THA A;  1B9Y A;  3C75 H;  3MZL A;  1N6D A;  3RRM C;  3AL8 A;  5EMK B;  2H6N A;  1R5M A;  2H9N A;  3UKU C;  5HYN B;  2OK6 A;  3DWL C;  1GXR A;  1K32 A;  4E54 A;  4JSV C;  3JRP A;  5H1M A;  3DSM A;  4PNK B;  3MKQ A;  1GG2 B;  2H68 A;  3IJC A;  4A0B B;  2IUV A;  5K19 A;  4CZV A;  4CY2 A;  4J8B A;  4D6V A;  3KRW B;  2Z2O A;  5C9Z B;  5HE2 B;  3UVM A;  3BG1 A;  2OVR B;  2HJB A;  2OJY A;  4Z8L A;  3I7K A;  4ZOV A;  3RFH A;  4A7J A;  2IUQ A;  4N14 A;  3AL9 A;  2YNO A;  3K27 A;  4J73 A;  2CE9 A;  4GGD A;  3JZN A;  5CXC B;  3JZH A;  3UR4 A;  3ODT A;  4FAV D;  5C2W B;  3J81 g;  2HXC A;  4FWW A;  4FA5 D;  2CO0 A;  4QT8 A;  4L3G D;  3EU7 A;  2XL2 A;  1SQJ A;  3U4Y A;  2P9S C;  4O3U B;  4CI8 A;  3NVX A;  2CO0 C;  2I3T A;  5IC7 A;  5EM2 B;  3N0E A;  3RN0 D;  4CI1 A;  4IMM A;  2HYE A;  4J81 A;  1P22 A;  3F3G A;  3BWS A;  4YVD A;  4BL0 A;  3IIW A;  4CY3 A;  2AQ5 A;  2I0T A;  4GGA A;  4NSX A;  3C9C A;  2IUR A;  2PBI B;  4GQ2 P;  3I8E A;  4UI9 R;  2OIZ A;  4LG9 A;  2H3X A;  3EI3 A;  5EAL A;  2XL3 A;  2O9K A;  3UKR C;  1N6F A;  3V5W B;  5I5I A;  4GZ8 A;  5FXY A;  5FLX g;  3RN1 D;  1MG3 A;  3I7N A;  4AEZ A;  4A09 B;  4PBY A;  4EWR A;  3SFZ A;  1SQ9 A;  3MKS B;  3RMZ D;  1L0Q A;  4A0A A;  2UZY B;  3C99 A;  4X60 B;  5IJ8 E;  3MMY A;  4JSP C;  4O1Q D;  2PM6 B;  4J82 A;  3EI4 A;  4J0X A;  2QC5 A;  4ERQ A;  5EMM B;  5EMJ B;  3SBP A;  4CC9 A;  1JMX B;  2GC7 A;  3GFC A;  3PE7 A;  1RI6 A;  3OKW A;  4FA9 D;  3JZG A;  5GXI A;  3EG6 A;  4KFM B;  1PEV A;  3UVL A;  2B5M A;  2PM9 A;  1PGU A;  1TYQ C;  3VGZ A;  3K26 A;  2AGZ A;  4CI2 A;  4JT5 C;  2P9I C;  3PXS D;  3OL2 B;  4GM9 A;  3RSE C;  4A11 B;  4J78 A;  2Z2N A;  3JPX A;  1NEX B;  3SWS D;  3ZWL B;  3JAM g;  4ZN4 A;  4AOW A;  4PSW B;  4E54 B;  1N6E A;  3ORV D;  4FHL A;  4A0B A;  2GNQ A;  3DXK C;  4QRJ A;  4X3E A;  3SLE D;  2PM7 B;  3UVO A;  4A08 A;  4LGN A;  4XEI C;  5AMS A;  3FM0 A;  4JXM A;  3F3F A;  2J55 H;  2BCJ B;  3DM0 A;  2AGL A;  5IGO A;  2I0R A;  2AGX A;  1OMW B;  3OKY A;  1A0R B;  1OLZ A;  4R7A B;  3RLM D;  2B5L A;  3RFG A;  4XYH A;  4HDJ A;  3AH8 B;  2CN2 A;  4QL1 A;  5AFU 3;  3CFV A;  2H13 A;  2OVQ B;  2MTA H;  4ZOY A;  2HKM A;  4LG8 A;  3NVN A;  4QQE A;  3F3P A;  4CY5 A;  1FWX A;  4JD2 C;  4O3T B;  3EWE A;  1QNI A;  5EAR A;  4GM8 A;  5FKR A;  5TEF A;  4CZY A;  5CXB B;  5EM2 A;  3E0C A;  2YB8 B;  4ZOX A;  3I7H A;  3MXX A;  4FB1 D;  4H5J A;  4GM3 A;  3N0D A;  2GC4 A;  3DXM C;  2P9L C;  4GMB A;  2H9L A;  2CN3 A;  1JJU B;  3SBQ A;  5FQD A;  3C5M A;  5CYK A;  4A2M A;  3JRO A;  5IGQ A;  3I7O A;  5I5J A;  1K8K C;  5B4W A;  4E5Z A;  2I0S A;  5K1C C;  5IJ7 E;  3SVW D;  3EI2 A;  3JB9 L;  3EI1 B;  2B4E A;  4L3H D;  3PSL A;  3ULE C;  2EBS A;  3VH0 A;  2AGY A;  4L1Q D;  4A09 A;  4JSN C;  2HKR A;  5SXM A;  1JMZ B;  3P4F A;  3HFQ A;  5HE1 B;  4J77 A;  1MG2 A;  2XYI A;  3UVK A;  1SHY B;  5HE3 B;  3EI4 B;  5EML B;  3CFS B;  4CI3 A;  1YFQ A;  5H14 A;  2Q7Q A;  3SJL D;  1B9X A;  4O45 A;  2AH0 A;  2UZX B;  2P9K C;  4D0K A;  2H47 A;  2OK4 A;  2P9U C;  3W15 A;  2AH1 A;  2H14 A;  1U2V C;  5KDO B;  2PM9 B;  3AL8 B;  5FKS A;  3PVU B;  1XHM A;  2W18 A;  4FA1 D;  5HQG A;  2J56 H;  2I3S A;  3PVW B;  3V7D B;  4ES0 A;  4PC0 A;  1XIP A;  3I8C A;  3OL2 A;  4A11 A;  4L9O A;  2J57 G;  5FKQ A;  3GRE A;  2P9P C;  3BG0 A;  5TDH B;  3B7F A;  3L4O D;  4K3J B;  5H17 A;  4J86 A;  4ZOZ A;  1VYH C;  3SBR A;  2YBA A;  4A08 B;  3L4M D;  3PXW D;  4J87 A;  2YNP A;  4PBZ A;  4K3I D;  3J80 g;  2P9N C;  3SCY A;  3V9F A;  4BUJ C;  4OWR A;  5GXH A;  4U1E I;  2IWF A;  4ERZ A;  2AGW A;  3OKY B;  5CXC A;  1ERJ A;  5FKT A;  3SN6 B;  3UVN A;  2G99 A;  3PXT D;  1PI6 A;  1NR0 A;  4JT6 C;  4H5I A;  4U7A A;  2OVP B;  3KRX B;  4Y5R D;  2IUP A;  1U4C A;  3I7P A;  4J79 A;  2XU7 A;  4JSX C;  2BBK H;  2H6Q A;  4CZX A;  2H9P A;  2TRC B;  2IWK A;  3I7L A;  3IJ0 A;  2Z2P A;  1MDA H;  3SHF A;  2G9A A;  2B5N A;  5GMK n; 
#chains in the Genus database with same CATH topology
 4FA4 D;  4IA9 A;  5JWZ A;  4FAN D;  5CXB A;  1JOF A;  4G1M A;  1S4U X;  4DNW A;  1C9L A;  1K3I A;  1Q47 A;  3MUN A;  3SXT D;  4ERY A;  4BH6 A;  2VDR A;  2YNN A;  4J84 A;  4GGC A;  5EAP A;  4X63 B;  1GOT B;  5HE0 B;  3A0F A;  3SMR A;  4XYI A;  2CE8 A;  4NC4 A;  3K71 A;  2XZG A;  5AJA A;  5TF2 A;  3IJ1 A;  4QAM A;  1GP2 B;  3EI3 B;  3FGB A;  2QXV A;  3IKO A;  3I89 A;  4J0W A;  5FFG A;  3MVD K;  3OKT A;  4GQB B;  5CYK B;  4Y7R A;  5FA5 B;  4A2L A;  4MK0 B;  4PSX B;  2H9M A;  5C2V B;  4E5Z B;  3T3P A;  3IIY A;  1PBY B;  4X61 B;  1TBG A;  3OTT A;  3EI2 B;  4G56 B;  3EI1 A;  4J8G A;  2JKX A;  4I79 A;  3I2N A;  3PSC B;  4WK4 A;  3ZDX A;  4NAA A;  2HES X;  4OZU A;  4A0A B;  5M5U A;  3IUQ A;  4CY1 A;  5C86 A;  5EAM A;  3CIK B;  3OW8 A;  5IT9 g;  5I5M A;  2HU5 A;  3AFC A;  3FCS A;  4ESG A;  1O6G A;  3VA6 A;  4GQ1 A;  5GSA A;  3K72 A;  4O9D A;  3FRX A;  4PXW A;  2HJ4 A;  5TEE A;  1A12 A;  3NIG A;  4BCC A;  3VI4 A;  1XKS A;  2HU7 A;  2YMU A;  3IUM A;  1UTC A;  3QI0 A;  4WJK A;  3NVQ A;  2CNX A;  2HU8 A;  2H6K A;  2IAA A;  4MMX A;  4TZ4 A;  5A2Q g;  3MZK A;  3EMH A;  5THA A;  1B9Y A;  2VZ3 A;  3C75 H;  3MZL A;  1N6D A;  3RRM C;  3AL8 A;  5EMK B;  2H6N A;  1UOQ A;  1R5M A;  2H9N A;  3IUJ A;  3UKU C;  5HYN B;  2OK6 A;  3DWL C;  1GXR A;  1K32 A;  4E54 A;  4JSV C;  3JRP A;  5H1M A;  3DSM A;  4O2W A;  4UM9 A;  4PNK B;  3MKQ A;  1GG2 B;  2H68 A;  3IJC A;  4A0B B;  2IUV A;  4IRZ A;  5K19 A;  4CZV A;  1E8M A;  4CY2 A;  4J8B A;  4D6V A;  3KRW B;  2Z2O A;  5C9Z B;  5HE2 B;  5M5T A;  3UVM A;  3BG1 A;  2OVR B;  3O4J A;  2HJB A;  2OJY A;  4Z8L A;  3I7K A;  4ZOV A;  3RFH A;  4A7J A;  2VZ1 A;  2IUQ A;  4N14 A;  3AL9 A;  2YNO A;  3K27 A;  4J73 A;  2CE9 A;  4GGD A;  3JZN A;  5CXC B;  2XE4 A;  4RE5 A;  3JZH A;  3UR4 A;  3ODT A;  4FAV D;  5E6U A;  5C2W B;  2VC2 A;  3J81 g;  2HXC A;  4BCB A;  4FWW A;  4FA5 D;  2CO0 A;  1VZ2 A;  4QT8 A;  4L3G D;  3EU7 A;  2XL2 A;  1SQJ A;  3U4Y A;  3GD1 I;  2P9S C;  4BP9 A;  4O3U B;  4RE6 A;  3NVX A;  4CI8 A;  2CO0 C;  2I3T A;  5IC7 A;  5EM2 B;  3N0E A;  3RN0 D;  4CI1 A;  4IMM A;  2HYE A;  4J81 A;  1P22 A;  1I2M B;  3F3G A;  3BWS A;  4YVD A;  4BL0 A;  3IIW A;  4CY3 A;  2AQ5 A;  3FCU A;  2I0T A;  4GGA A;  4AX4 A;  2VDL A;  4NSX A;  3C9C A;  2IUR A;  2PBI B;  3MUO A;  3V4P A;  4G55 A;  4GQ2 P;  3I8E A;  4UI9 R;  2OIZ A;  4LG9 A;  2H3X A;  3EI3 A;  1JV2 A;  5EAL A;  2XL3 A;  3ZE2 A;  3VI3 A;  2O9K A;  3UKR C;  1N6F A;  3V5W B;  5I5I A;  4GZ8 A;  3ZE1 A;  5E6S A;  5FXY A;  5FLX g;  3RN1 D;  1MG3 A;  2VDM A;  3I7N A;  4AEZ A;  3O4H A;  1C9I A;  4A09 B;  4PBY A;  4EWR A;  3SFZ A;  1SQ9 A;  3MKS B;  4MMY A;  3RMZ D;  3ZDZ A;  1L0Q A;  2BKL A;  4A0A A;  2VDP A;  2UZY B;  3C99 A;  4X60 B;  5IJ8 E;  3MMY A;  4JSP C;  4O1Q D;  2PM6 B;  4J82 A;  3K6S A;  3EI4 A;  3V4V A;  4J0X A;  2QC5 A;  4ERQ A;  5EMM B;  5EMJ B;  3SBP A;  4CC9 A;  3GC3 B;  1JMX B;  2GC7 A;  1UOO A;  3GFC A;  3PE7 A;  1RI6 A;  1QFM A;  3OKW A;  4FA9 D;  4WK2 A;  3JZG A;  4MMZ A;  1O6F A;  5GXI A;  3EG6 A;  4KFM B;  1PEV A;  2XDW A;  3UVL A;  2B5M A;  2PM9 A;  1PGU A;  1TYQ C;  3VGZ A;  1YR2 A;  3K26 A;  3EQ8 A;  2AGZ A;  4CI2 A;  4D9S A;  4JT5 C;  2P9I C;  3PXS D;  3OL2 B;  4GM9 A;  3RSE C;  4A11 B;  5M5S A;  4J78 A;  2Z2N A;  3JPX A;  1H2Y A;  1NEX B;  3SWS D;  3ZDY A;  3ZWL B;  3JAM g;  4ZN4 A;  4AOW A;  4PSW B;  4E54 B;  1N6E A;  3ORV D;  4FHL A;  4A0B A;  2GNQ A;  3DXK C;  4NBM A;  4QRJ A;  4X3E A;  3SLE D;  2PM7 B;  3UVO A;  4A08 A;  4LGN A;  4XEI C;  5AMS A;  3FM0 A;  4JXM A;  3F3F A;  2J55 H;  2BCJ B;  3DM0 A;  3NIF A;  2AGL A;  5IGO A;  2I0R A;  2AGX A;  1OMW B;  3OKY A;  2VDK A;  1A0R B;  1OLZ A;  4R7A B;  3RLM D;  2B5L A;  3RFG A;  4XYH A;  4HDJ A;  3AH8 B;  1M1X A;  2EIE A;  2CN2 A;  4QL1 A;  5AFU 3;  3CFV A;  2H13 A;  4WK0 A;  4DNU A;  2OVQ B;  2MTA H;  1UOP A;  1GOG A;  4ZOY A;  2HKM A;  4LG8 A;  3EQ7 A;  3NVN A;  3F3P A;  1H2W A;  4QQE A;  4CY5 A;  1FWX A;  4JD2 C;  4O3T B;  3EWE A;  1QNI A;  5EAR A;  4GM8 A;  3IVM A;  5FKR A;  4AMZ A;  4Z7Q A;  1VZ3 A;  5TEF A;  4CZY A;  4AMY A;  1QFS A;  5CXB B;  2VDO A;  2QZP A;  5EM2 A;  4AN1 A;  3E0C A;  4BP8 A;  2YB8 B;  4ZOX A;  1JTD B;  2QR5 A;  1E5T A;  3I7H A;  3MXX A;  3NID A;  4H5J A;  4FB1 D;  4GM3 A;  3N0D A;  3EQ9 A;  2GC4 A;  3DXM C;  2P9L C;  3KCI A;  4GMB A;  2H9L A;  2CN3 A;  4Z7N A;  1JJU B;  3SBQ A;  5FQD A;  3C5M A;  5CYK A;  4A2M A;  3T3M A;  3JRO A;  5IGQ A;  3I7O A;  5E6R A;  2VDN A;  3IUR A;  5I5J A;  1K8K C;  5B4W A;  4E5Z A;  2EIB A;  2I0S A;  5K1C C;  4O02 A;  5IJ7 E;  3SVW D;  3EI2 A;  3JB9 L;  3EI1 B;  1BPO A;  2B4E A;  4G1E A;  3QHY B;  3PSL A;  4L3H D;  3ULE C;  2EIC A;  4Z7O A;  2EBS A;  3VH0 A;  2WQ8 A;  4JHP C;  2AGY A;  4L1Q D;  4A09 A;  4JSN C;  2HKR A;  5SXM A;  1JMZ B;  1H2Z A;  3P4F A;  3HFQ A;  4L1M A;  3IJE A;  5HE1 B;  5M5R A;  3OF7 A;  4J77 A;  1MG2 A;  2XYI A;  3UVK A;  1SHY B;  5HE3 B;  3EI4 B;  1VE6 A;  1L5G A;  5EML B;  5M61 A;  3CFS B;  2VDQ A;  4CI3 A;  1YFQ A;  5H14 A;  2Q7Q A;  4NEN A;  3SJL D;  3ZE0 A;  1B9X A;  1VE7 A;  2AH0 A;  2UZX B;  4O45 A;  5C92 A;  2P9K C;  4D0K A;  2H47 A;  2OK4 A;  2P9U C;  3W15 A;  2AH1 A;  2H14 A;  1U2V C;  5HDB A;  5KDO B;  2PM9 B;  3O4I A;  3AL8 B;  5FKS A;  4BCD A;  3PVU B;  1XHM A;  2W18 A;  4FA1 D;  5HQG A;  2J56 H;  2I3S A;  3PVW B;  3V7D B;  3IUN A;  4PC0 A;  4ES0 A;  1XIP A;  3I8C A;  3OL2 A;  4A11 A;  4L9O A;  2J57 G;  5FKQ A;  3GRE A;  2P9P C;  1GOH A;  2EID A;  3BG0 A;  3B7F A;  3O4G A;  5TDH B;  3L4O D;  4K3J B;  5H17 A;  4J86 A;  4ZOZ A;  1VYH C;  3SBR A;  4UM8 A;  2YBA A;  4A08 B;  3L4M D;  3PXW D;  4J87 A;  2YNP A;  4PBZ A;  4K3I D;  1T2X A;  3J80 g;  2P9N C;  3SCY A;  1TYE A;  3V9F A;  4BUJ C;  4OWR A;  5GXH A;  4U1E I;  2IWF A;  4JHN A;  3DDU A;  4DNV A;  1GOF A;  4ERZ A;  2AGW A;  3OKY B;  5CXC A;  1ERJ A;  5FKT A;  3SN6 B;  3UVN A;  2G99 A;  3PXT D;  5M5V A;  3IUL A;  1H2X A;  1PI6 A;  1NR0 A;  4JT6 C;  5FFO A;  4H5I A;  4U7A A;  4AN0 A;  2OVP B;  3KRX B;  4Y5R D;  2IUP A;  1U4C A;  3I7P A;  4J79 A;  2XU7 A;  4JSX C;  1U8C A;  2BBK H;  2H6Q A;  4CZX A;  2H9P A;  2TRC B;  2IWK A;  3I7L A;  3IJ0 A;  2Z2P A;  1MDA H;  3SHF A;  2G9A A;  1E8N A;  2B5N A;  5GMK n; 
#chains in the Genus database with same CATH homology
 4FA4 D;  4IA9 A;  5JWZ A;  4FAN D;  5CXB A;  1JOF A;  1S4U X;  1Q47 A;  3SXT D;  4ERY A;  4BH6 A;  2YNN A;  4J84 A;  4GGC A;  5EAP A;  4X63 B;  1GOT B;  5HE0 B;  3A0F A;  3SMR A;  4XYI A;  2CE8 A;  5AJA A;  5TF2 A;  3IJ1 A;  1GP2 B;  3EI3 B;  3FGB A;  2QXV A;  3IKO A;  3I89 A;  4J0W A;  3OKT A;  4GQB B;  5CYK B;  4Y7R A;  5FA5 B;  4A2L A;  4MK0 B;  4PSX B;  2H9M A;  5C2V B;  4E5Z B;  3IIY A;  1PBY B;  4X61 B;  1TBG A;  3OTT A;  3EI2 B;  4G56 B;  3EI1 A;  4J8G A;  4I79 A;  3I2N A;  3PSC B;  2HES X;  4OZU A;  4A0A B;  4CY1 A;  5EAM A;  3CIK B;  3OW8 A;  5IT9 g;  5I5M A;  3AFC A;  4ESG A;  3VA6 A;  4GQ1 A;  5GSA A;  4O9D A;  3FRX A;  4PXW A;  2HJ4 A;  5TEE A;  1XKS A;  2YMU A;  3NVQ A;  2CNX A;  2H6K A;  2IAA A;  4TZ4 A;  5A2Q g;  3MZK A;  3EMH A;  5THA A;  1B9Y A;  3C75 H;  3MZL A;  1N6D A;  3RRM C;  3AL8 A;  5EMK B;  2H6N A;  1R5M A;  2H9N A;  3UKU C;  5HYN B;  2OK6 A;  3DWL C;  1GXR A;  1K32 A;  4E54 A;  4JSV C;  3JRP A;  5H1M A;  3DSM A;  4PNK B;  3MKQ A;  1GG2 B;  2H68 A;  3IJC A;  4A0B B;  2IUV A;  5K19 A;  4CZV A;  4CY2 A;  4J8B A;  4D6V A;  3KRW B;  2Z2O A;  5C9Z B;  5HE2 B;  3UVM A;  3BG1 A;  2OVR B;  2HJB A;  2OJY A;  4Z8L A;  3I7K A;  4ZOV A;  3RFH A;  4A7J A;  2IUQ A;  4N14 A;  3AL9 A;  2YNO A;  3K27 A;  4J73 A;  2CE9 A;  4GGD A;  3JZN A;  5CXC B;  3JZH A;  3UR4 A;  3ODT A;  4FAV D;  5C2W B;  3J81 g;  2HXC A;  4FWW A;  4FA5 D;  2CO0 A;  4QT8 A;  4L3G D;  3EU7 A;  2XL2 A;  1SQJ A;  3U4Y A;  2P9S C;  4O3U B;  4CI8 A;  3NVX A;  2CO0 C;  2I3T A;  5IC7 A;  5EM2 B;  3N0E A;  3RN0 D;  4CI1 A;  4IMM A;  2HYE A;  4J81 A;  1P22 A;  3F3G A;  3BWS A;  4YVD A;  4BL0 A;  3IIW A;  4CY3 A;  2AQ5 A;  2I0T A;  4GGA A;  4NSX A;  3C9C A;  2IUR A;  2PBI B;  4GQ2 P;  3I8E A;  4UI9 R;  2OIZ A;  4LG9 A;  2H3X A;  3EI3 A;  5EAL A;  2XL3 A;  2O9K A;  3UKR C;  1N6F A;  3V5W B;  5I5I A;  4GZ8 A;  5FXY A;  5FLX g;  3RN1 D;  1MG3 A;  3I7N A;  4AEZ A;  4A09 B;  4PBY A;  4EWR A;  3SFZ A;  1SQ9 A;  3MKS B;  3RMZ D;  1L0Q A;  4A0A A;  2UZY B;  3C99 A;  4X60 B;  5IJ8 E;  3MMY A;  4JSP C;  4O1Q D;  2PM6 B;  4J82 A;  3EI4 A;  4J0X A;  2QC5 A;  4ERQ A;  5EMM B;  5EMJ B;  3SBP A;  4CC9 A;  1JMX B;  2GC7 A;  3GFC A;  3PE7 A;  1RI6 A;  3OKW A;  4FA9 D;  3JZG A;  5GXI A;  3EG6 A;  4KFM B;  1PEV A;  3UVL A;  2B5M A;  2PM9 A;  1PGU A;  1TYQ C;  3VGZ A;  3K26 A;  2AGZ A;  4CI2 A;  4JT5 C;  2P9I C;  3PXS D;  3OL2 B;  4GM9 A;  3RSE C;  4A11 B;  4J78 A;  2Z2N A;  3JPX A;  1NEX B;  3SWS D;  3ZWL B;  3JAM g;  4ZN4 A;  4AOW A;  4PSW B;  4E54 B;  1N6E A;  3ORV D;  4FHL A;  4A0B A;  2GNQ A;  3DXK C;  4QRJ A;  4X3E A;  3SLE D;  2PM7 B;  3UVO A;  4A08 A;  4LGN A;  4XEI C;  5AMS A;  3FM0 A;  4JXM A;  3F3F A;  2J55 H;  2BCJ B;  3DM0 A;  2AGL A;  5IGO A;  2I0R A;  2AGX A;  1OMW B;  3OKY A;  1A0R B;  1OLZ A;  4R7A B;  3RLM D;  2B5L A;  3RFG A;  4XYH A;  4HDJ A;  3AH8 B;  2CN2 A;  4QL1 A;  5AFU 3;  3CFV A;  2H13 A;  2OVQ B;  2MTA H;  4ZOY A;  2HKM A;  4LG8 A;  3NVN A;  4QQE A;  3F3P A;  4CY5 A;  1FWX A;  4JD2 C;  4O3T B;  3EWE A;  1QNI A;  5EAR A;  4GM8 A;  5FKR A;  5TEF A;  4CZY A;  5CXB B;  5EM2 A;  3E0C A;  2YB8 B;  4ZOX A;  3I7H A;  3MXX A;  4FB1 D;  4H5J A;  4GM3 A;  3N0D A;  2GC4 A;  3DXM C;  2P9L C;  4GMB A;  2H9L A;  2CN3 A;  1JJU B;  3SBQ A;  5FQD A;  3C5M A;  5CYK A;  4A2M A;  3JRO A;  5IGQ A;  3I7O A;  5I5J A;  1K8K C;  5B4W A;  4E5Z A;  2I0S A;  5K1C C;  5IJ7 E;  3SVW D;  3EI2 A;  3JB9 L;  3EI1 B;  2B4E A;  4L3H D;  3PSL A;  3ULE C;  2EBS A;  3VH0 A;  2AGY A;  4L1Q D;  4A09 A;  4JSN C;  2HKR A;  5SXM A;  1JMZ B;  3P4F A;  3HFQ A;  5HE1 B;  4J77 A;  1MG2 A;  2XYI A;  3UVK A;  1SHY B;  5HE3 B;  3EI4 B;  5EML B;  3CFS B;  4CI3 A;  1YFQ A;  5H14 A;  2Q7Q A;  3SJL D;  1B9X A;  4O45 A;  2AH0 A;  2UZX B;  2P9K C;  4D0K A;  2H47 A;  2OK4 A;  2P9U C;  3W15 A;  2AH1 A;  2H14 A;  1U2V C;  5KDO B;  2PM9 B;  3AL8 B;  5FKS A;  3PVU B;  1XHM A;  2W18 A;  4FA1 D;  5HQG A;  2J56 H;  2I3S A;  3PVW B;  3V7D B;  4ES0 A;  4PC0 A;  1XIP A;  3I8C A;  3OL2 A;  4A11 A;  4L9O A;  2J57 G;  5FKQ A;  3GRE A;  2P9P C;  3BG0 A;  5TDH B;  3B7F A;  3L4O D;  4K3J B;  5H17 A;  4J86 A;  4ZOZ A;  1VYH C;  3SBR A;  2YBA A;  4A08 B;  3L4M D;  3PXW D;  4J87 A;  2YNP A;  4PBZ A;  4K3I D;  3J80 g;  2P9N C;  3SCY A;  3V9F A;  4BUJ C;  4OWR A;  5GXH A;  4U1E I;  2IWF A;  4ERZ A;  2AGW A;  3OKY B;  5CXC A;  1ERJ A;  5FKT A;  3SN6 B;  3UVN A;  2G99 A;  3PXT D;  1PI6 A;  1NR0 A;  4JT6 C;  4H5I A;  4U7A A;  2OVP B;  3KRX B;  4Y5R D;  2IUP A;  1U4C A;  3I7P A;  4J79 A;  2XU7 A;  4JSX C;  2BBK H;  2H6Q A;  4CZX A;  2H9P A;  2TRC B;  2IWK A;  3I7L A;  3IJ0 A;  2Z2P A;  1MDA H;  3SHF A;  2G9A A;  2B5N A;  5GMK n; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...