4L3HD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l3hD00
4QT8A 3EI3A 3OTTA 1YFQA 5TDHB 2UZYB 3DWLC 5C2WB 2I0SA 3AL9A 1ERJA 5CXCB 4A09A 2PM6B 5AMSA 2IWKA 3CFVA 3JZHA 3NVNA 5HE3B 3EMHA 4PSXB 3EI2B 4PXWA 2AGLA 5AJAA 1S4UX 5TF2A 4A09B 2H9NA 2H9MA 2BCJB 2OK6A 4J77A 3RRMC 4LG8A 2J56H 3PVWB 3DSMA 3I7KA 5CXBA 4J86A 3A0FA 5A2Qg 3MMYA 5I5IA 2CO0C 5CXBB 4J8BA 4FAND 2W18A 1VYHC 3EU7A 2HESX 4LG9A 2H14A 1QNIA 4A2LA 4A11A 4E5ZA 3AL8A 3IJCA 4FWWA 4TZ4A 4CZVA 3SN6B 3RSEC 4A0AA 1GP2B 3UKRC 3OKWA 3OL2A 3I2NA 5EM2B 4JT5C 3JRPA 3PSLA 2H6NA 5HE2B 2Z2OA 4XYIA 2CN3A 5IJ8E 2YNOA 5FKQA 3HFQA 2O9KA 2MTAH 4KFMB 2TRCB 4H5JA 1PI6A 2OIZA 2J57G 2I0RA 5TEEA 4EWRA 1MDAH 2BBKH 2G9AA 3GFCA 2AGXA 3JB9L 3N0EA 3W15A 5AFU3 3GREA 3C75H 4QRJA 5FLXg 3OKTA 3C99A 3F3PA 3DM0A 3F3FA 3EI1A 2B5MA 3NVXA 3OKYB 2P9UC 2OVRB 5HE1B 4AEZA 2XYIA 4CC9A 2Q7QA 4FA9D 3J81g 5KDOB 3VH0A 4J81A 4CI1A 2B5NA 2YBAA 4GQ2P 4CI2A 3SJLD 5GXHA 2CNXA 4J8GA 4A08B 5GXIA 3DXKC 4PC0A 3JZNA 2I3SA 4GM9A 1JMXB 2P9PC 3VA6A 4A11B 4A0BA 3I7NA 3RLMD 2PBIB 2P9NC 3I8CA 1TYQC 3RN0D 1NEXB 3SCYA 4CZYA 5IT9g 5IC7A 2QC5A 2OJYA 3JPXA 2OVQB 3VGZA 4A0BB 3FM0A 4GMBA 5C9ZB 3SVWD 5FA5B 5TEFA 3PXWD 3MXXA 4FA5D 2IURA 3SBQA 2CE8A 3KRXB 3EI4B 1MG3A 4CY1A 4OZUA 1RI6A 5EMJB 1NR0A 5CYKA 4ZN4A 3I7LA 2P9KC 2UZXB 3AFCA 3K27A 4J84A 4CY3A 2H6KA 2IUVA 1TBGA 3P4FA 4CY5A 3SFZA 4I79A 3RFGA 4R7AB 2H13A 2OVPB 4O3TB 2PM7B 3V9FA 4CI3A 1XKSA 1K32A 4JSNC 3PXSD 3SWSD 3F3GA 4ZOZA 5IJ7E 4A2MA 4J78A 3UVKA 1B9YA 4J87A 4JD2C 2PM9A 4XYHA 4ZOYA 3CIKB 5H14A 3BG1A 1FWXA 3I8EA 4E54A 2YNNA 2J55H 2AGZA 3B7FA 5EAMA 4ERZA 4BH6A 5FKSA 3MKSB 5GSAA 4PNKB 2HKMA 4MK0B 3JROA 4GM8A 3IIYA 3I7OA 5EAPA 3UR4A 3ZWLB 4PSWB 3BWSA 4QQEA 5EMKB 3DXMC 4GZ8A 2IAAA 2AH1A 4Y7RA 2HKRA 2QXVA 4O3UB 1K8KC 1SQ9A 2AH0A 4D6VA 1PBYB 4A0AB 3SBRA 4GM3A 3RN1D 4PBYA 3K26A 5EM2A 5HE0B 2AGYA 1R5MA 1OMWB 4K3ID 1SHYB 4XEIC 4BL0A 3N0DA 4J0XA 5FKRA 3KRWB 3MKQA 3EI3B 3C5MA 3BG0A 2HXCA 5SXMA 2H3XA 4H5IA 5HYNB 2CO0A 3NVQA 2IUQA 4J73A 5H1MA 4FA4D 3EI2A 5HQGA 3J80g 1JOFA 4ZOVA 4YVDA 4D0KA 4GQ1A 3RMZD 5IGQA 1MG2A 3IJ0A 3I7PA 4L9OA 2AGWA 4AOWA 3JZGA 1JMZB 4FB1D 4X63B 3UVNA 5C2VB 4O9DA 3IKOA 4HDJA 1A0RB 4IA9A 3SLED 3UVMA 4ERYA 2OK4A 4PBZA 4ES0A 5GMKn 3JAMg 4IMMA 1OLZA 1N6EA 2IUPA 3U4YA 3IJ1A 2YB8B 4FHLA 2B5LA 3PXTD 4X60B 2YNPA 3AL8B 3SXTD 3V5WB 2Z2NA 5I5JA 3RFHA 1P22A 2HJ4A 4X3EA 2I0TA 3L4OD 5JWZA 3OL2B 4N14A 4OWRA 2IWFA 5IGOA 2H9LA 4J82A 2EBSA 3IIWA 3I89A 3CFSB 5THAA 3UKUC 3OW8A 4QL1A 1B9XA 1N6DA 4ESGA 3PVUB 2GC7A 4A7JA 1PGUA 2P9SC 2XL2A 4U7AA 4CZXA 5CXCA 2XU7A 2GNQA 2CN2A 2P9LC 5CYKB 4L3HD 4UI9R 4BUJC 3I7HA 2AQ5A 2H6QA 1U2VC 3MZKA 2G99A 3C9CA 4L1QD 2YMUA 5B4WA 2B4EA 4Y5RD 4JSPC 4FA1D 3FRXA 3EWEA 5K19A 1GOTB 4GGAA 4L3GD 5EALA 3AH8B 2H9PA 3E0CA 3SBPA 3EI1B 3OKYA 4K3JB 2PM9B 4GQBB 4GGDA 4LGNA 3UVLA 4Z8LA 3UVOA 5K1CC 4G56B 4E54B 1GG2B 4J79A 2P9IC 4GGCA 3L4MD 5I5MA 4A08A 2GC4A 4CY2A 3ODTA 4E5ZB 2XL3A 5FQDA 3V7DB 4J0WA 1JJUB 2Z2PA 2I3TA 5FXYA 4FAVD 2H68A 4ERQA 1GXRA 2CE9A 1XIPA 4U1EI 4X61B 5FKTA 3EG6A 4NSXA 3ORVD 2H47A 5H17A 3SHFA 3PSCB 1PEVA 5EMLB 3SMRA 4ZOXA 2HYEA 4O45A 1N6FA 1U4CA 1Q47A 2HJBA 1SQJA 1L0QA 3EI4A 4JSXC 3ULEC 3PE7A 5EARA 4JSVC 4JT6C 4CI8A 3FGBA 4O1QD 3MZLA 1XHMA 5EMMB 4JXMA
chains in the Genus database with same CATH superfamily
4QT8A 3FCSA 1VZ3A 3EI3A 3OTTA 1YFQA 5TDHB 2UZYB 3DWLC 5C2WB 2I0SA 3AL9A 1ERJA 5CXCB 4A09A 2PM6B 5AMSA 2IWKA 4RE5A 3CFVA 3JZHA 3NVNA 5HE3B 3EMHA 4PSXB 3EI2B 4PXWA 2AGLA 5AJAA 1S4UX 3VI4A 5TF2A 2VZ1A 4A09B 2H9NA 2H9MA 2BCJB 2OK6A 1E5TA 4BCDA 4J77A 3RRMC 4LG8A 2J56H 1JTDB 1O6FA 3PVWB 2JKXA 2VC2A 3DSMA 4BP9A 3I7KA 3EQ8A 3EQ9A 5CXBA 2VDNA 4J86A 3A0FA 3IUJA 5A2Qg 3MMYA 3DDUA 5I5IA 2CO0C 5CXBB 4J8BA 4FAND 2W18A 1VYHC 3EU7A 2HESX 4LG9A 1QNIA 1K3IA 2H14A 4A2LA 4A11A 4E5ZA 1C9LA 3AL8A 3IJCA 4FWWA 4TZ4A 4CZVA 3K72A 3SN6B 3RSEC 4A0AA 1GP2B 3UKRC 3OKWA 3OL2A 1TYEA 3I2NA 5EM2B 4JT5C 3GC3B 3JRPA 3PSLA 2H6NA 2VDRA 2HU8A 5HE2B 2Z2OA 2VDOA 4XYIA 2CN3A 5IJ8E 4NENA 2YNOA 5FKQA 4G55A 1GOGA 3HFQA 2O9KA 2MTAH 4KFMB 2TRCB 4H5JA 3V4VA 1PI6A 2OIZA 2J57G 2I0RA 4AX4A 5TEEA 4EWRA 3GD1I 1MDAH 3O4JA 4Z7NA 2BBKH 5E6UA 2G9AA 4MMYA 3GFCA 2AGXA 2EIBA 3N0EA 3W15A 5AFU3 3JB9L 2EICA 3GREA 3C75H 1YR2A 2VZ3A 4QRJA 5FLXg 5E6SA 3OKTA 3C99A 3F3PA 3DM0A 3F3FA 3EI1A 2B5MA 3NVXA 3OKYB 3O4IA 1UOOA 2OVRB 2P9UC 4JHNA 5HE1B 2XYIA 4AEZA 4CC9A 5M5RA 2Q7QA 4FA9D 3J81g 5KDOB 3VH0A 4J81A 2VDLA 4CI1A 2B5NA 2VDQA 2YBAA 4GQ2P 5C86A 4CI2A 3SJLD 5GXHA 1O6GA 2CNXA 1BPOA 4J8GA 4A08B 5GXIA 3DXKC 2XDWA 4PC0A 5M5VA 3JZNA 2I3SA 4GM9A 1JMXB 2P9PC 3VA6A 5M5TA 4UM9A 4A11B 4A0BA 3I7NA 3RLMD 2PBIB 2P9NC 3I8CA 1TYQC 3RN0D 1NEXB 3SCYA 5FFOA 4CZYA 5IT9g 5IC7A 2QC5A 2OJYA 4NC4A 3JPXA 2OVQB 3VGZA 4A0BB 3FM0A 4GMBA 3ZDXA 5C9ZB 3SVWD 5FA5B 1VE6A 5TEFA 3PXWD 3MXXA 4FA5D 2IURA 3SBQA 2HU7A 1GOFA 2CE8A 3EI4B 3KRXB 1MG3A 4CY1A 4OZUA 3IUMA 4G1MA 1RI6A 1L5GA 5EMJB 1NR0A 5CYKA 3KCIA 4ZN4A 3I7LA 2P9KC 2UZXB 3AFCA 3K27A 4J84A 4CY3A 3IJEA 2H6KA 2IUVA 1TBGA 3P4FA 3ZE1A 4AMYA 4CY5A 3SFZA 4O02A 4I79A 3RFGA 4R7AB 2H13A 2OVPB 4O3TB 2PM7B 3V9FA 4CI3A 1XKSA 1K32A 4JSNC 3K71A 3PXSD 4O2WA 4UM8A 3NIFA 3SWSD 3F3GA 4ZOZA 3IVMA 5IJ7E 4A2MA 4J78A 3UVKA 1B9YA 4J87A 4BCCA 4JD2C 2PM9A 4XYHA 4ZOYA 3CIKB 5H14A 3BG1A 1FWXA 3I8EA 4E54A 2YNNA 2J55H 3IUNA 2AGZA 3B7FA 5EAMA 4ERZA 4BH6A 5FKSA 3MKSB 5GSAA 4PNKB 2HKMA 4MK0B 3JROA 4GM8A 2XZGA 3IIYA 3I7OA 5EAPA 3UR4A 3ZWLB 4PSWB 3BWSA 4QQEA 5EMKB 3DXMC 4GZ8A 2IAAA 2EIDA 2AH1A 4Y7RA 2HKRA 2QXVA 3V4PA 4O3UB 1K8KC 1SQ9A 2AH0A 4D6VA 1PBYB 5M5UA 4A0AB 3SBRA 4GM3A 3RN1D 4PBYA 3T3MA 3K26A 3ZE2A 5EM2A 5HE0B 1R5MA 2AGYA 1OMWB 1H2XA 4K3ID 1SHYB 4XEIC 3MUNA 4BL0A 3NIDA 1H2YA 5M5SA 3N0DA 1UOQA 4J0XA 3IUQA 4NAAA 5FKRA 4MMXA 1GOHA 3KRWB 3MKQA 3EI3B 3C5MA 3BG0A 2HXCA 4RE6A 2H3XA 5SXMA 4H5IA 5HYNB 2CO0A 3NVQA 2IUQA 1I2MB 3IULA 4J73A 5H1MA 4FA4D 3EI2A 5HQGA 3J80g 1JOFA 4Z7OA 4ZOVA 4YVDA 4D0KA 4GQ1A 3RMZD 5IGQA 1MG2A 3ZDZA 3IJ0A 3I7PA 1H2ZA 4L9OA 4D9SA 2AGWA 4AOWA 2EIEA 3JZGA 1E8NA 1JMZB 4IRZA 4FB1D 4X63B 3UVNA 1UOPA 5HDBA 5C2VB 4O9DA 2HU5A 4L1MA 4BCBA 3IKOA 4HDJA 1A0RB 4IA9A 3SLED 3UVMA 4AMZA 4DNVA 3O4GA 4ERYA 3MVDK 2OK4A 4PBZA 4ES0A 5GMKn 3JAMg 4IMMA 1OLZA 1N6EA 2IUPA 3U4YA 3IJ1A 2YB8B 4FHLA 2B5LA 3PXTD 4X60B 2YNPA 3AL8B 3SXTD 3V5WB 2Z2NA 5I5JA 4AN1A 1M1XA 3RFHA 1P22A 3K6SA 2HJ4A 4X3EA 2I0TA 3QI0A 3L4OD 3MUOA 5JWZA 1QFSA 4BP8A 3OL2B 2VDKA 4N14A 4OWRA 2IWFA 5IGOA 2H9LA 4WK0A 4J82A 2EBSA 5C92A 5E6RA 3IIWA 1E8MA 3I89A 5FFGA 3CFSB 1A12A 5THAA 1QFMA 3UKUC 4AN0A 3OW8A 4QL1A 1B9XA 1N6DA 4ESGA 3PVUB 4G1EA 2GC7A 1U8CA 3EQ7A 4A7JA 1VZ2A 5M61A 1PGUA 2P9SC 2XL2A 4U7AA 4CZXA 5CXCA 2XU7A 2GNQA 2CN2A 2P9LC 2XE4A 5CYKB 4WJKA 4L3HD 4UI9R 4BUJC 4QAMA 3I7HA 2AQ5A 3NIGA 1H2WA 2H6QA 1U2VC 3MZKA 2G99A 3C9CA 4L1QD 2YMUA 5B4WA 4DNUA 2B4EA 4Y5RD 1UTCA 4JSPC 4MMZA 4FA1D 3FRXA 2BKLA 3T3PA 3EWEA 5K19A 1GOTB 4GGAA 4L3GD 5EALA 3AH8B 2H9PA 3ZE0A 3E0CA 3SBPA 3EI1B 3OKYA 4K3JB 4JHPC 4WK4A 2PM9B 4GQBB 4GGDA 4LGNA 3UVLA 4Z8LA 3UVOA 5K1CC 4G56B 1VE7A 4E54B 1GG2B 4J79A 2P9IC 4GGCA 4NBMA 1C9IA 3L4MD 5I5MA 4A08A 2GC4A 4CY2A 3ODTA 4E5ZB 2XL3A 5FQDA 3V7DB 4WK2A 4J0WA 3IURA 1JJUB 2Z2PA 3ZDYA 2VDMA 2I3TA 2QR5A 5FXYA 4FAVD 3VI3A 2H68A 4ERQA 1GXRA 2CE9A 1XIPA 4U1EI 4X61B 5FKTA 1T2XA 3FCUA 3EG6A 4NSXA 3ORVD 2H47A 5H17A 3SHFA 1JV2A 1PEVA 3PSCB 3O4HA 5EMLB 4Z7QA 3SMRA 4DNWA 4ZOXA 2WQ8A 2HYEA 4O45A 1N6FA 1U4CA 1Q47A 2HJBA 3OF7A 1SQJA 1L0QA 3EI4A 3QHYB 4JSXC 3ULEC 3PE7A 5EARA 2QZPA 2VDPA 4JSVC 4JT6C 4CI8A 3FGBA 4O1QD 3MZLA 1XHMA 5EMMB 4JXMA
chains in the Genus database with same CATH topology
4QT8A 3EI3A 3OTTA 1YFQA 5TDHB 2UZYB 3DWLC 5C2WB 2I0SA 3AL9A 1ERJA 5CXCB 4A09A 2PM6B 5AMSA 2IWKA 3CFVA 3JZHA 3NVNA 5HE3B 3EMHA 4PSXB 3EI2B 4PXWA 2AGLA 5AJAA 1S4UX 5TF2A 4A09B 2H9NA 2H9MA 2BCJB 2OK6A 4J77A 3RRMC 4LG8A 2J56H 3PVWB 3DSMA 3I7KA 5CXBA 4J86A 3A0FA 5A2Qg 3MMYA 5I5IA 2CO0C 5CXBB 4J8BA 4FAND 2W18A 1VYHC 3EU7A 2HESX 4LG9A 2H14A 1QNIA 4A2LA 4A11A 4E5ZA 3AL8A 3IJCA 4FWWA 4TZ4A 4CZVA 3SN6B 3RSEC 4A0AA 1GP2B 3UKRC 3OKWA 3OL2A 3I2NA 5EM2B 4JT5C 3JRPA 3PSLA 2H6NA 5HE2B 2Z2OA 4XYIA 2CN3A 5IJ8E 2YNOA 5FKQA 3HFQA 2O9KA 2MTAH 4KFMB 2TRCB 4H5JA 1PI6A 2OIZA 2J57G 2I0RA 5TEEA 4EWRA 1MDAH 2BBKH 2G9AA 3GFCA 2AGXA 3JB9L 3N0EA 3W15A 5AFU3 3GREA 3C75H 4QRJA 5FLXg 3OKTA 3C99A 3F3PA 3DM0A 3F3FA 3EI1A 2B5MA 3NVXA 3OKYB 2P9UC 2OVRB 5HE1B 4AEZA 2XYIA 4CC9A 2Q7QA 4FA9D 3J81g 5KDOB 3VH0A 4J81A 4CI1A 2B5NA 2YBAA 4GQ2P 4CI2A 3SJLD 5GXHA 2CNXA 4J8GA 4A08B 5GXIA 3DXKC 4PC0A 3JZNA 2I3SA 4GM9A 1JMXB 2P9PC 3VA6A 4A11B 4A0BA 3I7NA 3RLMD 2PBIB 2P9NC 3I8CA 1TYQC 3RN0D 1NEXB 3SCYA 4CZYA 5IT9g 5IC7A 2QC5A 2OJYA 3JPXA 2OVQB 3VGZA 4A0BB 3FM0A 4GMBA 5C9ZB 3SVWD 5FA5B 5TEFA 3PXWD 3MXXA 4FA5D 2IURA 3SBQA 2CE8A 3KRXB 3EI4B 1MG3A 4CY1A 4OZUA 1RI6A 5EMJB 1NR0A 5CYKA 4ZN4A 3I7LA 2P9KC 2UZXB 3AFCA 3K27A 4J84A 4CY3A 2H6KA 2IUVA 1TBGA 3P4FA 4CY5A 3SFZA 4I79A 3RFGA 4R7AB 2H13A 2OVPB 4O3TB 2PM7B 3V9FA 4CI3A 1XKSA 1K32A 4JSNC 3PXSD 3SWSD 3F3GA 4ZOZA 5IJ7E 4A2MA 4J78A 3UVKA 1B9YA 4J87A 4JD2C 2PM9A 4XYHA 4ZOYA 3CIKB 5H14A 3BG1A 1FWXA 3I8EA 4E54A 2YNNA 2J55H 2AGZA 3B7FA 5EAMA 4ERZA 4BH6A 5FKSA 3MKSB 5GSAA 4PNKB 2HKMA 4MK0B 3JROA 4GM8A 3IIYA 3I7OA 5EAPA 3UR4A 3ZWLB 4PSWB 3BWSA 4QQEA 5EMKB 3DXMC 4GZ8A 2IAAA 2AH1A 4Y7RA 2HKRA 2QXVA 4O3UB 1K8KC 1SQ9A 2AH0A 4D6VA 1PBYB 4A0AB 3SBRA 4GM3A 3RN1D 4PBYA 3K26A 5EM2A 5HE0B 2AGYA 1R5MA 1OMWB 4K3ID 1SHYB 4XEIC 4BL0A 3N0DA 4J0XA 5FKRA 3KRWB 3MKQA 3EI3B 3C5MA 3BG0A 2HXCA 5SXMA 2H3XA 4H5IA 5HYNB 2CO0A 3NVQA 2IUQA 4J73A 5H1MA 4FA4D 3EI2A 5HQGA 3J80g 1JOFA 4ZOVA 4YVDA 4D0KA 4GQ1A 3RMZD 5IGQA 1MG2A 3IJ0A 3I7PA 4L9OA 2AGWA 4AOWA 3JZGA 1JMZB 4FB1D 4X63B 3UVNA 5C2VB 4O9DA 3IKOA 4HDJA 1A0RB 4IA9A 3SLED 3UVMA 4ERYA 2OK4A 4PBZA 4ES0A 5GMKn 3JAMg 4IMMA 1OLZA 1N6EA 2IUPA 3U4YA 3IJ1A 2YB8B 4FHLA 2B5LA 3PXTD 4X60B 2YNPA 3AL8B 3SXTD 3V5WB 2Z2NA 5I5JA 3RFHA 1P22A 2HJ4A 4X3EA 2I0TA 3L4OD 5JWZA 3OL2B 4N14A 4OWRA 2IWFA 5IGOA 2H9LA 4J82A 2EBSA 3IIWA 3I89A 3CFSB 5THAA 3UKUC 3OW8A 4QL1A 1B9XA 1N6DA 4ESGA 3PVUB 2GC7A 4A7JA 1PGUA 2P9SC 2XL2A 4U7AA 4CZXA 5CXCA 2XU7A 2GNQA 2CN2A 2P9LC 5CYKB 4L3HD 4UI9R 4BUJC 3I7HA 2AQ5A 2H6QA 1U2VC 3MZKA 2G99A 3C9CA 4L1QD 2YMUA 5B4WA 2B4EA 4Y5RD 4JSPC 4FA1D 3FRXA 3EWEA 5K19A 1GOTB 4GGAA 4L3GD 5EALA 3AH8B 2H9PA 3E0CA 3SBPA 3EI1B 3OKYA 4K3JB 2PM9B 4GQBB 4GGDA 4LGNA 3UVLA 4Z8LA 3UVOA 5K1CC 4G56B 4E54B 1GG2B 4J79A 2P9IC 4GGCA 3L4MD 5I5MA 4A08A 2GC4A 4CY2A 3ODTA 4E5ZB 2XL3A 5FQDA 3V7DB 4J0WA 1JJUB 2Z2PA 2I3TA 5FXYA 4FAVD 2H68A 4ERQA 1GXRA 2CE9A 1XIPA 4U1EI 4X61B 5FKTA 3EG6A 4NSXA 3ORVD 2H47A 5H17A 3SHFA 3PSCB 1PEVA 5EMLB 3SMRA 4ZOXA 2HYEA 4O45A 1N6FA 1U4CA 1Q47A 2HJBA 1SQJA 1L0QA 3EI4A 4JSXC 3ULEC 3PE7A 5EARA 4JSVC 4JT6C 4CI8A 3FGBA 4O1QD 3MZLA 1XHMA 5EMMB 4JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT8 A;  3EI3 A;  3OTT A;  1YFQ A;  5TDH B;  2UZY B;  3DWL C;  5C2W B;  2I0S A;  3AL9 A;  1ERJ A;  5CXC B;  4A09 A;  2PM6 B;  5AMS A;  2IWK A;  3CFV A;  3JZH A;  3NVN A;  5HE3 B;  3EMH A;  4PSX B;  3EI2 B;  4PXW A;  2AGL A;  5AJA A;  1S4U X;  5TF2 A;  4A09 B;  2H9N A;  2H9M A;  2BCJ B;  2OK6 A;  4J77 A;  3RRM C;  4LG8 A;  2J56 H;  3PVW B;  3DSM A;  3I7K A;  5CXB A;  4J86 A;  3A0F A;  5A2Q g;  3MMY A;  5I5I A;  2CO0 C;  5CXB B;  4J8B A;  4FAN D;  2W18 A;  1VYH C;  3EU7 A;  2HES X;  4LG9 A;  2H14 A;  1QNI A;  4A2L A;  4A11 A;  4E5Z A;  3AL8 A;  3IJC A;  4FWW A;  4TZ4 A;  4CZV A;  3SN6 B;  3RSE C;  4A0A A;  1GP2 B;  3UKR C;  3OKW A;  3OL2 A;  3I2N A;  5EM2 B;  4JT5 C;  3JRP A;  3PSL A;  2H6N A;  5HE2 B;  2Z2O A;  4XYI A;  2CN3 A;  5IJ8 E;  2YNO A;  5FKQ A;  3HFQ A;  2O9K A;  2MTA H;  4KFM B;  2TRC B;  4H5J A;  1PI6 A;  2OIZ A;  2J57 G;  2I0R A;  5TEE A;  4EWR A;  1MDA H;  2BBK H;  2G9A A;  3GFC A;  2AGX A;  3JB9 L;  3N0E A;  3W15 A;  5AFU 3;  3GRE A;  3C75 H;  4QRJ A;  5FLX g;  3OKT A;  3C99 A;  3F3P A;  3DM0 A;  3F3F A;  3EI1 A;  2B5M A;  3NVX A;  3OKY B;  2P9U C;  2OVR B;  5HE1 B;  4AEZ A;  2XYI A;  4CC9 A;  2Q7Q A;  4FA9 D;  3J81 g;  5KDO B;  3VH0 A;  4J81 A;  4CI1 A;  2B5N A;  2YBA A;  4GQ2 P;  4CI2 A;  3SJL D;  5GXH A;  2CNX A;  4J8G A;  4A08 B;  5GXI A;  3DXK C;  4PC0 A;  3JZN A;  2I3S A;  4GM9 A;  1JMX B;  2P9P C;  3VA6 A;  4A11 B;  4A0B A;  3I7N A;  3RLM D;  2PBI B;  2P9N C;  3I8C A;  1TYQ C;  3RN0 D;  1NEX B;  3SCY A;  4CZY A;  5IT9 g;  5IC7 A;  2QC5 A;  2OJY A;  3JPX A;  2OVQ B;  3VGZ A;  4A0B B;  3FM0 A;  4GMB A;  5C9Z B;  3SVW D;  5FA5 B;  5TEF A;  3PXW D;  3MXX A;  4FA5 D;  2IUR A;  3SBQ A;  2CE8 A;  3KRX B;  3EI4 B;  1MG3 A;  4CY1 A;  4OZU A;  1RI6 A;  5EMJ B;  1NR0 A;  5CYK A;  4ZN4 A;  3I7L A;  2P9K C;  2UZX B;  3AFC A;  3K27 A;  4J84 A;  4CY3 A;  2H6K A;  2IUV A;  1TBG A;  3P4F A;  4CY5 A;  3SFZ A;  4I79 A;  3RFG A;  4R7A B;  2H13 A;  2OVP B;  4O3T B;  2PM7 B;  3V9F A;  4CI3 A;  1XKS A;  1K32 A;  4JSN C;  3PXS D;  3SWS D;  3F3G A;  4ZOZ A;  5IJ7 E;  4A2M A;  4J78 A;  3UVK A;  1B9Y A;  4J87 A;  4JD2 C;  2PM9 A;  4XYH A;  4ZOY A;  3CIK B;  5H14 A;  3BG1 A;  1FWX A;  3I8E A;  4E54 A;  2YNN A;  2J55 H;  2AGZ A;  3B7F A;  5EAM A;  4ERZ A;  4BH6 A;  5FKS A;  3MKS B;  5GSA A;  4PNK B;  2HKM A;  4MK0 B;  3JRO A;  4GM8 A;  3IIY A;  3I7O A;  5EAP A;  3UR4 A;  3ZWL B;  4PSW B;  3BWS A;  4QQE A;  5EMK B;  3DXM C;  4GZ8 A;  2IAA A;  2AH1 A;  4Y7R A;  2HKR A;  2QXV A;  4O3U B;  1K8K C;  1SQ9 A;  2AH0 A;  4D6V A;  1PBY B;  4A0A B;  3SBR A;  4GM3 A;  3RN1 D;  4PBY A;  3K26 A;  5EM2 A;  5HE0 B;  2AGY A;  1R5M A;  1OMW B;  4K3I D;  1SHY B;  4XEI C;  4BL0 A;  3N0D A;  4J0X A;  5FKR A;  3KRW B;  3MKQ A;  3EI3 B;  3C5M A;  3BG0 A;  2HXC A;  5SXM A;  2H3X A;  4H5I A;  5HYN B;  2CO0 A;  3NVQ A;  2IUQ A;  4J73 A;  5H1M A;  4FA4 D;  3EI2 A;  5HQG A;  3J80 g;  1JOF A;  4ZOV A;  4YVD A;  4D0K A;  4GQ1 A;  3RMZ D;  5IGQ A;  1MG2 A;  3IJ0 A;  3I7P A;  4L9O A;  2AGW A;  4AOW A;  3JZG A;  1JMZ B;  4FB1 D;  4X63 B;  3UVN A;  5C2V B;  4O9D A;  3IKO A;  4HDJ A;  1A0R B;  4IA9 A;  3SLE D;  3UVM A;  4ERY A;  2OK4 A;  4PBZ A;  4ES0 A;  5GMK n;  3JAM g;  4IMM A;  1OLZ A;  1N6E A;  2IUP A;  3U4Y A;  3IJ1 A;  2YB8 B;  4FHL A;  2B5L A;  3PXT D;  4X60 B;  2YNP A;  3AL8 B;  3SXT D;  3V5W B;  2Z2N A;  5I5J A;  3RFH A;  1P22 A;  2HJ4 A;  4X3E A;  2I0T A;  3L4O D;  5JWZ A;  3OL2 B;  4N14 A;  4OWR A;  2IWF A;  5IGO A;  2H9L A;  4J82 A;  2EBS A;  3IIW A;  3I89 A;  3CFS B;  5THA A;  3UKU C;  3OW8 A;  4QL1 A;  1B9X A;  1N6D A;  4ESG A;  3PVU B;  2GC7 A;  4A7J A;  1PGU A;  2P9S C;  2XL2 A;  4U7A A;  4CZX A;  5CXC A;  2XU7 A;  2GNQ A;  2CN2 A;  2P9L C;  5CYK B;  4L3H D;  4UI9 R;  4BUJ C;  3I7H A;  2AQ5 A;  2H6Q A;  1U2V C;  3MZK A;  2G99 A;  3C9C A;  4L1Q D;  2YMU A;  5B4W A;  2B4E A;  4Y5R D;  4JSP C;  4FA1 D;  3FRX A;  3EWE A;  5K19 A;  1GOT B;  4GGA A;  4L3G D;  5EAL A;  3AH8 B;  2H9P A;  3E0C A;  3SBP A;  3EI1 B;  3OKY A;  4K3J B;  2PM9 B;  4GQB B;  4GGD A;  4LGN A;  3UVL A;  4Z8L A;  3UVO A;  5K1C C;  4G56 B;  4E54 B;  1GG2 B;  4J79 A;  2P9I C;  4GGC A;  3L4M D;  5I5M A;  4A08 A;  2GC4 A;  4CY2 A;  3ODT A;  4E5Z B;  2XL3 A;  5FQD A;  3V7D B;  4J0W A;  1JJU B;  2Z2P A;  2I3T A;  5FXY A;  4FAV D;  2H68 A;  4ERQ A;  1GXR A;  2CE9 A;  1XIP A;  4U1E I;  4X61 B;  5FKT A;  3EG6 A;  4NSX A;  3ORV D;  2H47 A;  5H17 A;  3SHF A;  3PSC B;  1PEV A;  5EML B;  3SMR A;  4ZOX A;  2HYE A;  4O45 A;  1N6F A;  1U4C A;  1Q47 A;  2HJB A;  1SQJ A;  1L0Q A;  3EI4 A;  4JSX C;  3ULE C;  3PE7 A;  5EAR A;  4JSV C;  4JT6 C;  4CI8 A;  3FGB A;  4O1Q D;  3MZL A;  1XHM A;  5EMM B;  4JXM A; 
#chains in the Genus database with same CATH topology
 4QT8 A;  3FCS A;  1VZ3 A;  3EI3 A;  3OTT A;  1YFQ A;  5TDH B;  2UZY B;  3DWL C;  5C2W B;  2I0S A;  3AL9 A;  1ERJ A;  5CXC B;  4A09 A;  2PM6 B;  5AMS A;  2IWK A;  4RE5 A;  3CFV A;  3JZH A;  3NVN A;  5HE3 B;  3EMH A;  4PSX B;  3EI2 B;  4PXW A;  2AGL A;  5AJA A;  1S4U X;  3VI4 A;  5TF2 A;  2VZ1 A;  4A09 B;  2H9N A;  2H9M A;  2BCJ B;  2OK6 A;  1E5T A;  4BCD A;  4J77 A;  3RRM C;  4LG8 A;  2J56 H;  1JTD B;  1O6F A;  3PVW B;  2JKX A;  2VC2 A;  3DSM A;  4BP9 A;  3I7K A;  3EQ8 A;  3EQ9 A;  5CXB A;  2VDN A;  4J86 A;  3A0F A;  3IUJ A;  5A2Q g;  3MMY A;  3DDU A;  5I5I A;  2CO0 C;  5CXB B;  4J8B A;  4FAN D;  2W18 A;  1VYH C;  3EU7 A;  2HES X;  4LG9 A;  1QNI A;  1K3I A;  2H14 A;  4A2L A;  4A11 A;  4E5Z A;  1C9L A;  3AL8 A;  3IJC A;  4FWW A;  4TZ4 A;  4CZV A;  3K72 A;  3SN6 B;  3RSE C;  4A0A A;  1GP2 B;  3UKR C;  3OKW A;  3OL2 A;  1TYE A;  3I2N A;  5EM2 B;  4JT5 C;  3GC3 B;  3JRP A;  3PSL A;  2H6N A;  2VDR A;  2HU8 A;  5HE2 B;  2Z2O A;  2VDO A;  4XYI A;  2CN3 A;  5IJ8 E;  4NEN A;  2YNO A;  5FKQ A;  4G55 A;  1GOG A;  3HFQ A;  2O9K A;  2MTA H;  4KFM B;  2TRC B;  4H5J A;  3V4V A;  1PI6 A;  2OIZ A;  2J57 G;  2I0R A;  4AX4 A;  5TEE A;  4EWR A;  3GD1 I;  1MDA H;  3O4J A;  4Z7N A;  2BBK H;  5E6U A;  2G9A A;  4MMY A;  3GFC A;  2AGX A;  2EIB A;  3N0E A;  3W15 A;  5AFU 3;  3JB9 L;  2EIC A;  3GRE A;  3C75 H;  1YR2 A;  2VZ3 A;  4QRJ A;  5FLX g;  5E6S A;  3OKT A;  3C99 A;  3F3P A;  3DM0 A;  3F3F A;  3EI1 A;  2B5M A;  3NVX A;  3OKY B;  3O4I A;  1UOO A;  2OVR B;  2P9U C;  4JHN A;  5HE1 B;  2XYI A;  4AEZ A;  4CC9 A;  5M5R A;  2Q7Q A;  4FA9 D;  3J81 g;  5KDO B;  3VH0 A;  4J81 A;  2VDL A;  4CI1 A;  2B5N A;  2VDQ A;  2YBA A;  4GQ2 P;  5C86 A;  4CI2 A;  3SJL D;  5GXH A;  1O6G A;  2CNX A;  1BPO A;  4J8G A;  4A08 B;  5GXI A;  3DXK C;  2XDW A;  4PC0 A;  5M5V A;  3JZN A;  2I3S A;  4GM9 A;  1JMX B;  2P9P C;  3VA6 A;  5M5T A;  4UM9 A;  4A11 B;  4A0B A;  3I7N A;  3RLM D;  2PBI B;  2P9N C;  3I8C A;  1TYQ C;  3RN0 D;  1NEX B;  3SCY A;  5FFO A;  4CZY A;  5IT9 g;  5IC7 A;  2QC5 A;  2OJY A;  4NC4 A;  3JPX A;  2OVQ B;  3VGZ A;  4A0B B;  3FM0 A;  4GMB A;  3ZDX A;  5C9Z B;  3SVW D;  5FA5 B;  1VE6 A;  5TEF A;  3PXW D;  3MXX A;  4FA5 D;  2IUR A;  3SBQ A;  2HU7 A;  1GOF A;  2CE8 A;  3EI4 B;  3KRX B;  1MG3 A;  4CY1 A;  4OZU A;  3IUM A;  4G1M A;  1RI6 A;  1L5G A;  5EMJ B;  1NR0 A;  5CYK A;  3KCI A;  4ZN4 A;  3I7L A;  2P9K C;  2UZX B;  3AFC A;  3K27 A;  4J84 A;  4CY3 A;  3IJE A;  2H6K A;  2IUV A;  1TBG A;  3P4F A;  3ZE1 A;  4AMY A;  4CY5 A;  3SFZ A;  4O02 A;  4I79 A;  3RFG A;  4R7A B;  2H13 A;  2OVP B;  4O3T B;  2PM7 B;  3V9F A;  4CI3 A;  1XKS A;  1K32 A;  4JSN C;  3K71 A;  3PXS D;  4O2W A;  4UM8 A;  3NIF A;  3SWS D;  3F3G A;  4ZOZ A;  3IVM A;  5IJ7 E;  4A2M A;  4J78 A;  3UVK A;  1B9Y A;  4J87 A;  4BCC A;  4JD2 C;  2PM9 A;  4XYH A;  4ZOY A;  3CIK B;  5H14 A;  3BG1 A;  1FWX A;  3I8E A;  4E54 A;  2YNN A;  2J55 H;  3IUN A;  2AGZ A;  3B7F A;  5EAM A;  4ERZ A;  4BH6 A;  5FKS A;  3MKS B;  5GSA A;  4PNK B;  2HKM A;  4MK0 B;  3JRO A;  4GM8 A;  2XZG A;  3IIY A;  3I7O A;  5EAP A;  3UR4 A;  3ZWL B;  4PSW B;  3BWS A;  4QQE A;  5EMK B;  3DXM C;  4GZ8 A;  2IAA A;  2EID A;  2AH1 A;  4Y7R A;  2HKR A;  2QXV A;  3V4P A;  4O3U B;  1K8K C;  1SQ9 A;  2AH0 A;  4D6V A;  1PBY B;  5M5U A;  4A0A B;  3SBR A;  4GM3 A;  3RN1 D;  4PBY A;  3T3M A;  3K26 A;  3ZE2 A;  5EM2 A;  5HE0 B;  1R5M A;  2AGY A;  1OMW B;  1H2X A;  4K3I D;  1SHY B;  4XEI C;  3MUN A;  4BL0 A;  3NID A;  1H2Y A;  5M5S A;  3N0D A;  1UOQ A;  4J0X A;  3IUQ A;  4NAA A;  5FKR A;  4MMX A;  1GOH A;  3KRW B;  3MKQ A;  3EI3 B;  3C5M A;  3BG0 A;  2HXC A;  4RE6 A;  2H3X A;  5SXM A;  4H5I A;  5HYN B;  2CO0 A;  3NVQ A;  2IUQ A;  1I2M B;  3IUL A;  4J73 A;  5H1M A;  4FA4 D;  3EI2 A;  5HQG A;  3J80 g;  1JOF A;  4Z7O A;  4ZOV A;  4YVD A;  4D0K A;  4GQ1 A;  3RMZ D;  5IGQ A;  1MG2 A;  3ZDZ A;  3IJ0 A;  3I7P A;  1H2Z A;  4L9O A;  4D9S A;  2AGW A;  4AOW A;  2EIE A;  3JZG A;  1E8N A;  1JMZ B;  4IRZ A;  4FB1 D;  4X63 B;  3UVN A;  1UOP A;  5HDB A;  5C2V B;  4O9D A;  2HU5 A;  4L1M A;  4BCB A;  3IKO A;  4HDJ A;  1A0R B;  4IA9 A;  3SLE D;  3UVM A;  4AMZ A;  4DNV A;  3O4G A;  4ERY A;  3MVD K;  2OK4 A;  4PBZ A;  4ES0 A;  5GMK n;  3JAM g;  4IMM A;  1OLZ A;  1N6E A;  2IUP A;  3U4Y A;  3IJ1 A;  2YB8 B;  4FHL A;  2B5L A;  3PXT D;  4X60 B;  2YNP A;  3AL8 B;  3SXT D;  3V5W B;  2Z2N A;  5I5J A;  4AN1 A;  1M1X A;  3RFH A;  1P22 A;  3K6S A;  2HJ4 A;  4X3E A;  2I0T A;  3QI0 A;  3L4O D;  3MUO A;  5JWZ A;  1QFS A;  4BP8 A;  3OL2 B;  2VDK A;  4N14 A;  4OWR A;  2IWF A;  5IGO A;  2H9L A;  4WK0 A;  4J82 A;  2EBS A;  5C92 A;  5E6R A;  3IIW A;  1E8M A;  3I89 A;  5FFG A;  3CFS B;  1A12 A;  5THA A;  1QFM A;  3UKU C;  4AN0 A;  3OW8 A;  4QL1 A;  1B9X A;  1N6D A;  4ESG A;  3PVU B;  4G1E A;  2GC7 A;  1U8C A;  3EQ7 A;  4A7J A;  1VZ2 A;  5M61 A;  1PGU A;  2P9S C;  2XL2 A;  4U7A A;  4CZX A;  5CXC A;  2XU7 A;  2GNQ A;  2CN2 A;  2P9L C;  2XE4 A;  5CYK B;  4WJK A;  4L3H D;  4UI9 R;  4BUJ C;  4QAM A;  3I7H A;  2AQ5 A;  3NIG A;  1H2W A;  2H6Q A;  1U2V C;  3MZK A;  2G99 A;  3C9C A;  4L1Q D;  2YMU A;  5B4W A;  4DNU A;  2B4E A;  4Y5R D;  1UTC A;  4JSP C;  4MMZ A;  4FA1 D;  3FRX A;  2BKL A;  3T3P A;  3EWE A;  5K19 A;  1GOT B;  4GGA A;  4L3G D;  5EAL A;  3AH8 B;  2H9P A;  3ZE0 A;  3E0C A;  3SBP A;  3EI1 B;  3OKY A;  4K3J B;  4JHP C;  4WK4 A;  2PM9 B;  4GQB B;  4GGD A;  4LGN A;  3UVL A;  4Z8L A;  3UVO A;  5K1C C;  4G56 B;  1VE7 A;  4E54 B;  1GG2 B;  4J79 A;  2P9I C;  4GGC A;  4NBM A;  1C9I A;  3L4M D;  5I5M A;  4A08 A;  2GC4 A;  4CY2 A;  3ODT A;  4E5Z B;  2XL3 A;  5FQD A;  3V7D B;  4WK2 A;  4J0W A;  3IUR A;  1JJU B;  2Z2P A;  3ZDY A;  2VDM A;  2I3T A;  2QR5 A;  5FXY A;  4FAV D;  3VI3 A;  2H68 A;  4ERQ A;  1GXR A;  2CE9 A;  1XIP A;  4U1E I;  4X61 B;  5FKT A;  1T2X A;  3FCU A;  3EG6 A;  4NSX A;  3ORV D;  2H47 A;  5H17 A;  3SHF A;  1JV2 A;  1PEV A;  3PSC B;  3O4H A;  5EML B;  4Z7Q A;  3SMR A;  4DNW A;  4ZOX A;  2WQ8 A;  2HYE A;  4O45 A;  1N6F A;  1U4C A;  1Q47 A;  2HJB A;  3OF7 A;  1SQJ A;  1L0Q A;  3EI4 A;  3QHY B;  4JSX C;  3ULE C;  3PE7 A;  5EAR A;  2QZP A;  2VDP A;  4JSV C;  4JT6 C;  4CI8 A;  3FGB A;  4O1Q D;  3MZL A;  1XHM A;  5EMM B;  4JXM A; 
#chains in the Genus database with same CATH homology
 4QT8 A;  3EI3 A;  3OTT A;  1YFQ A;  5TDH B;  2UZY B;  3DWL C;  5C2W B;  2I0S A;  3AL9 A;  1ERJ A;  5CXC B;  4A09 A;  2PM6 B;  5AMS A;  2IWK A;  3CFV A;  3JZH A;  3NVN A;  5HE3 B;  3EMH A;  4PSX B;  3EI2 B;  4PXW A;  2AGL A;  5AJA A;  1S4U X;  5TF2 A;  4A09 B;  2H9N A;  2H9M A;  2BCJ B;  2OK6 A;  4J77 A;  3RRM C;  4LG8 A;  2J56 H;  3PVW B;  3DSM A;  3I7K A;  5CXB A;  4J86 A;  3A0F A;  5A2Q g;  3MMY A;  5I5I A;  2CO0 C;  5CXB B;  4J8B A;  4FAN D;  2W18 A;  1VYH C;  3EU7 A;  2HES X;  4LG9 A;  2H14 A;  1QNI A;  4A2L A;  4A11 A;  4E5Z A;  3AL8 A;  3IJC A;  4FWW A;  4TZ4 A;  4CZV A;  3SN6 B;  3RSE C;  4A0A A;  1GP2 B;  3UKR C;  3OKW A;  3OL2 A;  3I2N A;  5EM2 B;  4JT5 C;  3JRP A;  3PSL A;  2H6N A;  5HE2 B;  2Z2O A;  4XYI A;  2CN3 A;  5IJ8 E;  2YNO A;  5FKQ A;  3HFQ A;  2O9K A;  2MTA H;  4KFM B;  2TRC B;  4H5J A;  1PI6 A;  2OIZ A;  2J57 G;  2I0R A;  5TEE A;  4EWR A;  1MDA H;  2BBK H;  2G9A A;  3GFC A;  2AGX A;  3JB9 L;  3N0E A;  3W15 A;  5AFU 3;  3GRE A;  3C75 H;  4QRJ A;  5FLX g;  3OKT A;  3C99 A;  3F3P A;  3DM0 A;  3F3F A;  3EI1 A;  2B5M A;  3NVX A;  3OKY B;  2P9U C;  2OVR B;  5HE1 B;  4AEZ A;  2XYI A;  4CC9 A;  2Q7Q A;  4FA9 D;  3J81 g;  5KDO B;  3VH0 A;  4J81 A;  4CI1 A;  2B5N A;  2YBA A;  4GQ2 P;  4CI2 A;  3SJL D;  5GXH A;  2CNX A;  4J8G A;  4A08 B;  5GXI A;  3DXK C;  4PC0 A;  3JZN A;  2I3S A;  4GM9 A;  1JMX B;  2P9P C;  3VA6 A;  4A11 B;  4A0B A;  3I7N A;  3RLM D;  2PBI B;  2P9N C;  3I8C A;  1TYQ C;  3RN0 D;  1NEX B;  3SCY A;  4CZY A;  5IT9 g;  5IC7 A;  2QC5 A;  2OJY A;  3JPX A;  2OVQ B;  3VGZ A;  4A0B B;  3FM0 A;  4GMB A;  5C9Z B;  3SVW D;  5FA5 B;  5TEF A;  3PXW D;  3MXX A;  4FA5 D;  2IUR A;  3SBQ A;  2CE8 A;  3KRX B;  3EI4 B;  1MG3 A;  4CY1 A;  4OZU A;  1RI6 A;  5EMJ B;  1NR0 A;  5CYK A;  4ZN4 A;  3I7L A;  2P9K C;  2UZX B;  3AFC A;  3K27 A;  4J84 A;  4CY3 A;  2H6K A;  2IUV A;  1TBG A;  3P4F A;  4CY5 A;  3SFZ A;  4I79 A;  3RFG A;  4R7A B;  2H13 A;  2OVP B;  4O3T B;  2PM7 B;  3V9F A;  4CI3 A;  1XKS A;  1K32 A;  4JSN C;  3PXS D;  3SWS D;  3F3G A;  4ZOZ A;  5IJ7 E;  4A2M A;  4J78 A;  3UVK A;  1B9Y A;  4J87 A;  4JD2 C;  2PM9 A;  4XYH A;  4ZOY A;  3CIK B;  5H14 A;  3BG1 A;  1FWX A;  3I8E A;  4E54 A;  2YNN A;  2J55 H;  2AGZ A;  3B7F A;  5EAM A;  4ERZ A;  4BH6 A;  5FKS A;  3MKS B;  5GSA A;  4PNK B;  2HKM A;  4MK0 B;  3JRO A;  4GM8 A;  3IIY A;  3I7O A;  5EAP A;  3UR4 A;  3ZWL B;  4PSW B;  3BWS A;  4QQE A;  5EMK B;  3DXM C;  4GZ8 A;  2IAA A;  2AH1 A;  4Y7R A;  2HKR A;  2QXV A;  4O3U B;  1K8K C;  1SQ9 A;  2AH0 A;  4D6V A;  1PBY B;  4A0A B;  3SBR A;  4GM3 A;  3RN1 D;  4PBY A;  3K26 A;  5EM2 A;  5HE0 B;  2AGY A;  1R5M A;  1OMW B;  4K3I D;  1SHY B;  4XEI C;  4BL0 A;  3N0D A;  4J0X A;  5FKR A;  3KRW B;  3MKQ A;  3EI3 B;  3C5M A;  3BG0 A;  2HXC A;  5SXM A;  2H3X A;  4H5I A;  5HYN B;  2CO0 A;  3NVQ A;  2IUQ A;  4J73 A;  5H1M A;  4FA4 D;  3EI2 A;  5HQG A;  3J80 g;  1JOF A;  4ZOV A;  4YVD A;  4D0K A;  4GQ1 A;  3RMZ D;  5IGQ A;  1MG2 A;  3IJ0 A;  3I7P A;  4L9O A;  2AGW A;  4AOW A;  3JZG A;  1JMZ B;  4FB1 D;  4X63 B;  3UVN A;  5C2V B;  4O9D A;  3IKO A;  4HDJ A;  1A0R B;  4IA9 A;  3SLE D;  3UVM A;  4ERY A;  2OK4 A;  4PBZ A;  4ES0 A;  5GMK n;  3JAM g;  4IMM A;  1OLZ A;  1N6E A;  2IUP A;  3U4Y A;  3IJ1 A;  2YB8 B;  4FHL A;  2B5L A;  3PXT D;  4X60 B;  2YNP A;  3AL8 B;  3SXT D;  3V5W B;  2Z2N A;  5I5J A;  3RFH A;  1P22 A;  2HJ4 A;  4X3E A;  2I0T A;  3L4O D;  5JWZ A;  3OL2 B;  4N14 A;  4OWR A;  2IWF A;  5IGO A;  2H9L A;  4J82 A;  2EBS A;  3IIW A;  3I89 A;  3CFS B;  5THA A;  3UKU C;  3OW8 A;  4QL1 A;  1B9X A;  1N6D A;  4ESG A;  3PVU B;  2GC7 A;  4A7J A;  1PGU A;  2P9S C;  2XL2 A;  4U7A A;  4CZX A;  5CXC A;  2XU7 A;  2GNQ A;  2CN2 A;  2P9L C;  5CYK B;  4L3H D;  4UI9 R;  4BUJ C;  3I7H A;  2AQ5 A;  2H6Q A;  1U2V C;  3MZK A;  2G99 A;  3C9C A;  4L1Q D;  2YMU A;  5B4W A;  2B4E A;  4Y5R D;  4JSP C;  4FA1 D;  3FRX A;  3EWE A;  5K19 A;  1GOT B;  4GGA A;  4L3G D;  5EAL A;  3AH8 B;  2H9P A;  3E0C A;  3SBP A;  3EI1 B;  3OKY A;  4K3J B;  2PM9 B;  4GQB B;  4GGD A;  4LGN A;  3UVL A;  4Z8L A;  3UVO A;  5K1C C;  4G56 B;  4E54 B;  1GG2 B;  4J79 A;  2P9I C;  4GGC A;  3L4M D;  5I5M A;  4A08 A;  2GC4 A;  4CY2 A;  3ODT A;  4E5Z B;  2XL3 A;  5FQD A;  3V7D B;  4J0W A;  1JJU B;  2Z2P A;  2I3T A;  5FXY A;  4FAV D;  2H68 A;  4ERQ A;  1GXR A;  2CE9 A;  1XIP A;  4U1E I;  4X61 B;  5FKT A;  3EG6 A;  4NSX A;  3ORV D;  2H47 A;  5H17 A;  3SHF A;  3PSC B;  1PEV A;  5EML B;  3SMR A;  4ZOX A;  2HYE A;  4O45 A;  1N6F A;  1U4C A;  1Q47 A;  2HJB A;  1SQJ A;  1L0Q A;  3EI4 A;  4JSX C;  3ULE C;  3PE7 A;  5EAR A;  4JSV C;  4JT6 C;  4CI8 A;  3FGB A;  4O1Q D;  3MZL A;  1XHM A;  5EMM B;  4JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...