4L3HD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l3hD00
3IIWA 4N14A 3SJLD 4J79A 4AEZA 1JOFA 3I8EA 2BBKH 4LG8A 4PSWB 3VA6A 2Z2OA 2EBSA 5HE1B 3OKYB 2B4EA 3ORVD 2I0TA 4E5ZA 1SHYB 3C5MA 3EI2A 2HJBA 4JSVC 2GC4A 2XL3A 5EM2A 2HXCA 2XU7A 1JJUB 2I0RA 4G56B 3EU7A 3I7PA 5AMSA 5FKTA 2P9LC 3BG1A 5B4WA 3EG6A 5CXBB 4PXWA 4K3JB 4D0KA 3UVKA 4ZOYA 3SBPA 4L9OA 3DM0A 5CXBA 4JD2C 5GSAA 2UZYB 4O1QD 3ODTA 5I5JA 3EI1B 5EAMA 3KRWB 4A7JA 1P22A 3J80g 3CFSB 2YNOA 4CI8A 3NVQA 2P9IC 4PSXB 1S4UX 1TBGA 4FA5D 4E5ZB 5AJAA 1PGUA 3C9CA 1N6FA 2J55H 5HE2B 3U4YA 1OLZA 3SBRA 2HKRA 4H5JA 4PC0A 3I7HA 3RLMD 4A0AA 4QQEA 3V5WB 4O9DA 5KDOB 2I3TA 4CI3A 4GM8A 4GQBB 2OJYA 1U4CA 5TF2A 3I2NA 5IT9g 4GGAA 1JMXB 2CN2A 3JZNA 3I8CA 3OKTA 3F3GA 4L3GD 3ZWLB 4CC9A 1JMZB 1K32A 4NSXA 3P4FA 5I5MA 3IJCA 3KRXB 3PSLA 4JT6C 2HESX 2IWFA 5FKRA 3SFZA 4A2MA 1XKSA 3EI3B 3EI1A 3IJ0A 4CY2A 2QC5A 4CY1A 3RN1D 2Q7QA 3E0CA 3JZHA 3DSMA 4R7AB 3SLED 2OK4A 4FWWA 3SHFA 3JPXA 3V7DB 3IIYA 4MK0B 3UVNA 2CE8A 4O45A 4QRJA 3PXTD 1U2VC 4ESGA 5GMKn 4ZOZA 3JAMg 3W15A 2B5NA 4JT5C 5EMLB 4A11A 3K27A 3I7OA 2OVRB 2W18A 4PNKB 4FA1D 3EI2B 5TEEA 2IAAA 3AL8A 2OIZA 5IGQA 4Y7RA 2PM7B 3MZLA 3EWEA 5HQGA 3JZGA 2XYIA 3C99A 4PBZA 5GXIA 2P9UC 4J8GA 1PEVA 4ZOXA 4LG9A 4A11B 3F3FA 4YVDA 2H13A 5HYNB 3JB9L 4ZN4A 3MMYA 3V9FA 4ZOVA 2YBAA 4A08B 1R5MA 3BWSA 5SXMA 3GFCA 5FA5B 3L4OD 2YNPA 2PM9A 4GQ1A 2AH0A 4XYIA 5EMJB 4JSPC 1B9YA 1NR0A 4A09B 2I0SA 4OZUA 2AGWA 1L0QA 4FAND 2AH1A 5GXHA 4QT8A 3EI3A 2AGXA 5IC7A 1GG2B 1TYQC 3SMRA 5K19A 2Z2NA 2AGZA 1N6EA 4JSNC 2J56H 2AGLA 5C9ZB 4I79A 4CY5A 3JROA 4GM9A 4O3TB 5C2VB 4TZ4A 3DWLC 4CZXA 5CXCB 3C75H 5EMMB 3MZKA 5FXYA 2H47A 2CO0A 1A0RB 2H6NA 5FKSA 4E54B 5EMKB 2IUVA 5AFU3 5CXCA 4X60B 2P9NC 3DXMC 1NEXB 3HFQA 3NVNA 5HE3B 3PSCB 2GC7A 4CI2A 3N0DA 2OK6A 2YB8B 3AL8B 3RMZD 1GP2B 4J81A 2IUPA 2H9PA 2PM6B 2MTAH 3MKSB 2YMUA 3CIKB 5FLXg 3BG0A 3K26A 3RN0D 3ULEC 4FA4D 2J57G 3F3PA 4GMBA 1K8KC 4A09A 5TEFA 2G99A 2XL2A 2H68A 3PVWB 3GREA 3OL2A 3SBQA 4CZVA 4GZ8A 5H14A 3DXKC 3OL2B 4GQ2P 4A08A 4CY3A 2G9AA 2P9PC 2I3SA 3CFVA 4PBYA 4LGNA 5K1CC 4ERYA 4J77A 2IUQA 2HYEA 3SN6B 4GGCA 4BUJC 5H17A 2UZXB 3RSEC 1XHMA 5IJ7E 2CN3A 3I7LA 3A0FA 4JSXC 4ERZA 4E54A 4J86A 3EI4A 4Z8LA 4X61B 5C2WB 3EMHA 3UVLA 4X3EA 4KFMB 1RI6A 2H9LA 3SXTD 3UVOA 5EARA 2HJ4A 4ERQA 3J81g 1Q47A 3PE7A 3RFGA 3FM0A 4HDJA 2AGYA 3MKQA 4CI1A 1MG3A 2CNXA 3UKUC 3UKRC 1MG2A 4J73A 1OMWB 4UI9R 3B7FA 2PM9B 1B9XA 1GXRA 4U1EI 4A2LA 1PBYB 2B5MA 4A0BA 1ERJA 3FRXA 2O9KA 4FAVD 4QL1A 4J0XA 4OWRA 3OKWA 3EI4B 3L4MD 3AH8B 3N0EA 3OW8A 4IMMA 3UR4A 5A2Qg 4FHLA 1N6DA 5CYKA 3NVXA 4A0AB 4O3UB 3FGBA 2IWKA 4L1QD 5HE0B 2Z2PA 1YFQA 2IURA 2P9SC 3UVMA 4FA9D 5FQDA 3PVUB 3OKYA 3SVWD 4J0WA 4GGDA 2TRCB 4J82A 3I7KA 3AFCA 2H14A 2HKMA 4J8BA 4U7AA 4BH6A 2CO0C 4J87A 5CYKB 5IJ8E 2CE9A 1VYHC 4Y5RD 3SCYA 2PBIB 4J84A 2H6KA 4XEIC 5EALA 1SQJA 5H1MA 4A0BB 4IA9A 4FB1D 1SQ9A 3PXSD 2QXVA 4H5IA 3RFHA 4ES0A 2B5LA 3IKOA 3RRMC 3I7NA 1PI6A 3OTTA 1QNIA 5JWZA 2AQ5A 1FWXA 2BCJB 4AOWA 3VGZA 2P9KC 4BL0A 3PXWD 3AL9A 2OVQB 4EWRA 4L3HD 4XYHA 5EM2B 2H9MA 3VH0A 2GNQA 4X63B 1XIPA 3I89A 2H9NA 2OVPB 4D6VA 1GOTB 5THAA 2H3XA 5FKQA 2YNNA 4K3ID 5EAPA 3JRPA 4JXMA 2H6QA 3SWSD 5TDHB 5I5IA 3MXXA 1MDAH 4CZYA 4GM3A 5IGOA 4J78A 3IJ1A
chains in the Genus database with same CATH superfamily
3IIWA 4N14A 3SJLD 4J79A 4AEZA 1JOFA 1VZ2A 3I8EA 4AX4A 2BBKH 4LG8A 4PSWB 3VA6A 4O02A 2Z2OA 2EBSA 5HE1B 3OKYB 2B4EA 3ORVD 4WJKA 2I0TA 4E5ZA 1SHYB 3C5MA 3ZDZA 3EI2A 2HJBA 2XDWA 4JSVC 2GC4A 2XL3A 2VDKA 2VDNA 1JV2A 5EM2A 1TYEA 4BCBA 2HXCA 2XU7A 1JJUB 4MMXA 2I0RA 5M5RA 4G56B 3EU7A 3I7PA 5AMSA 5FKTA 1VZ3A 2P9LC 3BG1A 5B4WA 3EG6A 5CXBB 4PXWA 4NAAA 4K3JB 4D0KA 3UVKA 4ZOYA 3SBPA 4L9OA 3DM0A 5CXBA 3DDUA 1UOQA 3IURA 4JD2C 5GSAA 2UZYB 4O1QD 3ODTA 3QHYB 4RE5A 5I5JA 3EI1B 4BP9A 2EIBA 5EAMA 3KRWB 4A7JA 1P22A 2EIEA 4Z7NA 3J80g 3CFSB 3O4GA 2YNOA 3FCUA 4CI8A 3NVQA 2P9IC 4PSXB 1S4UX 1TBGA 4FA5D 4E5ZB 5AJAA 1PGUA 3C9CA 1N6FA 3ZDXA 2J55H 5HE2B 3U4YA 1OLZA 3SBRA 2HKRA 4H5JA 4PC0A 5FFGA 3I7HA 3RLMD 4A0AA 4QQEA 3K71A 4WK4A 3V5WB 4O9DA 4BCDA 5KDOB 2I3TA 2VDMA 1E8NA 4CI3A 4GM8A 1E5TA 4GQBB 2OJYA 1U4CA 1GOGA 5TF2A 4Z7OA 4NC4A 1K3IA 3I2NA 4AMYA 4GGAA 5C92A 5IT9g 1JMXB 2CN2A 3EQ8A 3JZNA 5M5TA 3OKTA 3GC3B 3F3GA 3I8CA 4UM8A 4L3GD 3ZWLB 3T3PA 4CC9A 1JMZB 1K32A 4NSXA 3P4FA 5I5MA 2XZGA 3IJCA 3KRXB 3PSLA 1GOHA 4JT6C 2HESX 3IULA 2IWFA 5FKRA 3SFZA 4A2MA 1XKSA 3EI3B 3EI1A 1C9IA 3IJ0A 4CY2A 2QC5A 4CY1A 3RN1D 2Q7QA 3E0CA 3JZHA 3NIFA 3DSMA 4MMZA 4R7AB 3SLED 1C9LA 2OK4A 4FWWA 3SHFA 4O2WA 3JPXA 3V7DB 3IIYA 4MK0B 4DNVA 3O4HA 3UVNA 2CE8A 4O45A 5M61A 4QRJA 3PXTD 1U2VC 4ESGA 5GMKn 4ZOZA 3JAMg 4Z7QA 3W15A 3FCSA 2B5NA 2VDRA 4JT5C 4RE6A 5EMLB 4A11A 3K27A 4L1MA 2HU8A 3I7OA 2OVRB 2W18A 4PNKB 1U8CA 4FA1D 3EI2B 5TEEA 2IAAA 3AL8A 2OIZA 5IGQA 4Y7RA 2PM7B 3MZLA 3EWEA 3GD1I 5HQGA 3JZGA 2XYIA 3C99A 4PBZA 2HU7A 5GXIA 2P9UC 4J8GA 1PEVA 3IVMA 4ZOXA 4LG9A 4A11B 3F3FA 4YVDA 2H13A 5HYNB 3JB9L 1BPOA 4ZN4A 3MMYA 3V9FA 5E6UA 4ZOVA 2YBAA 4A08B 1R5MA 3BWSA 5SXMA 3GFCA 5FA5B 2HU5A 3L4OD 3VI4A 2YNPA 1A12A 2PM9A 4GQ1A 2AH0A 4XYIA 5EMJB 4JSPC 1B9YA 1NR0A 4A09B 2I0SA 4OZUA 2AGWA 1L0QA 3IJ1A 3NIDA 2AH1A 4FAND 5GXHA 4QT8A 3EI3A 2AGXA 5IC7A 1GG2B 1TYQC 3SMRA 1UTCA 5K19A 2Z2NA 2AGZA 1N6EA 2J56H 2AGLA 4JSNC 5C9ZB 4I79A 4CY5A 3JROA 4GM9A 4O3TB 5C2VB 2WQ8A 2VDQA 4TZ4A 3DWLC 4CZXA 5CXCB 3EQ7A 2EIDA 3C75H 5EMMB 3V4PA 3MZKA 5FXYA 2H47A 5FFOA 4DNUA 5E6RA 2CO0A 1A0RB 2H6NA 5FKSA 2VZ1A 4E54B 5EMKB 2IUVA 5AFU3 5CXCA 4X60B 2P9NC 1QFSA 3DXMC 1NEXB 3HFQA 3NVNA 4AMZA 3K72A 5HE3B 3PSCB 1H2WA 2GC7A 4CI2A 5C86A 5HDBA 3N0DA 2QZPA 2OK6A 2YB8B 3AL8B 3RMZD 1GP2B 4J81A 5M5SA 2IUPA 2H9PA 2PM6B 2MTAH 2VC2A 3MKSB 3ZE2A 2YMUA 3CIKB 5FLXg 3BG0A 4AN0A 2VZ3A 3K26A 3RN0D 3ULEC 4FA4D 2J57G 1H2YA 3F3PA 4GMBA 1K8KC 4A09A 5TEFA 1VE7A 2G99A 2XL2A 3IUNA 2H68A 3PVWB 3GREA 3OL2A 3SBQA 4CZVA 4GZ8A 1E8MA 4NENA 5H14A 2VDLA 3DXKC 3OL2B 4GQ2P 3KCIA 4A08A 4CY3A 2G9AA 3MUNA 2P9PC 2I3SA 3CFVA 4PBYA 4DNWA 4LGNA 2VDOA 5K1CC 3MUOA 4ERYA 5M5VA 4J77A 2IUQA 2HYEA 3SN6B 4GGCA 4BUJC 3NIGA 5H17A 4AN1A 2UZXB 3RSEC 1XHMA 5IJ7E 2CN3A 4QAMA 4IRZA 3I7LA 4G55A 3A0FA 4JSXC 4ERZA 4E54A 3IUQA 4J86A 3EI4A 4Z8LA 4BCCA 3T3MA 4X61B 5C2WB 3QI0A 3EMHA 3UVLA 4X3EA 4KFMB 4MMYA 1RI6A 1M1XA 2H9LA 2EICA 3SXTD 3UVOA 5EARA 2HJ4A 4ERQA 3J81g 1O6GA 1Q47A 3PE7A 3RFGA 3FM0A 4HDJA 2AGYA 3MKQA 4CI1A 4UM9A 1MG3A 3IUMA 2CNXA 3UKUC 1YR2A 3UKRC 1MG2A 1H2ZA 4J73A 1OMWB 4UI9R 3VI3A 3B7FA 2PM9B 1B9XA 2JKXA 4D9SA 1GXRA 1QFMA 4U1EI 4NBMA 4A2LA 1PBYB 1UOOA 2B5MA 1H2XA 1ERJA 4A0BA 3FRXA 1O6FA 2O9KA 4FAVD 4QL1A 2QR5A 5M5UA 4J0XA 4BP8A 4OWRA 3OKWA 3EI4B 3L4MD 3O4JA 3AH8B 3N0EA 4JHNA 3OW8A 4IMMA 3UR4A 5A2Qg 4FHLA 1N6DA 3EQ9A 4G1MA 3MVDK 5CYKA 3NVXA 4A0AB 4O3UB 3FGBA 2IWKA 4L1QD 5HE0B 1GOFA 3IJEA 2Z2PA 1YFQA 4JHPC 2IURA 2P9SC 3UVMA 4FA9D 1I2MB 4WK0A 3OF7A 5FQDA 3PVUB 3OKYA 3SVWD 4J0WA 4GGDA 2TRCB 2VDPA 3ZE1A 1VE6A 4G1EA 4J82A 3I7KA 3AFCA 2H14A 2HKMA 4J8BA 4U7AA 4BH6A 2CO0C 4J87A 1T2XA 5CYKB 5IJ8E 1VYHC 2CE9A 4Y5RD 3SCYA 2PBIB 3V4VA 5E6SA 4J84A 2H6KA 4XEIC 5EALA 1SQJA 5H1MA 4A0BB 4IA9A 4FB1D 1SQ9A 3PXSD 2QXVA 4H5IA 3RFHA 3IUJA 4ES0A 2B5LA 3IKOA 3RRMC 3I7NA 1PI6A 3OTTA 1QNIA 5JWZA 2AQ5A 1FWXA 2BCJB 4AOWA 3VGZA 2P9KC 4BL0A 3PXWD 3AL9A 1JTDB 2OVQB 3ZDYA 4EWRA 4L3HD 4XYHA 5EM2B 2H9MA 3VH0A 2GNQA 4X63B 1XIPA 3I89A 2H9NA 2OVPB 4D6VA 1GOTB 5THAA 2H3XA 5FKQA 2YNNA 4K3ID 5EAPA 3JRPA 4JXMA 1UOPA 1L5GA 2H6QA 3K6SA 3SWSD 4WK2A 3O4IA 5TDHB 5I5IA 2BKLA 3MXXA 1MDAH 4CZYA 4GM3A 3ZE0A 5IGOA 4J78A 2XE4A
chains in the Genus database with same CATH topology
3IIWA 4N14A 3SJLD 4J79A 4AEZA 1JOFA 3I8EA 2BBKH 4LG8A 4PSWB 3VA6A 2Z2OA 2EBSA 5HE1B 3OKYB 2B4EA 3ORVD 2I0TA 4E5ZA 1SHYB 3C5MA 3EI2A 2HJBA 4JSVC 2GC4A 2XL3A 5EM2A 2HXCA 2XU7A 1JJUB 2I0RA 4G56B 3EU7A 3I7PA 5AMSA 5FKTA 2P9LC 3BG1A 5B4WA 3EG6A 5CXBB 4PXWA 4K3JB 4D0KA 3UVKA 4ZOYA 3SBPA 4L9OA 3DM0A 5CXBA 4JD2C 5GSAA 2UZYB 4O1QD 3ODTA 5I5JA 3EI1B 5EAMA 3KRWB 4A7JA 1P22A 3J80g 3CFSB 2YNOA 4CI8A 3NVQA 2P9IC 4PSXB 1S4UX 1TBGA 4FA5D 4E5ZB 5AJAA 1PGUA 3C9CA 1N6FA 2J55H 5HE2B 3U4YA 1OLZA 3SBRA 2HKRA 4H5JA 4PC0A 3I7HA 3RLMD 4A0AA 4QQEA 3V5WB 4O9DA 5KDOB 2I3TA 4CI3A 4GM8A 4GQBB 2OJYA 1U4CA 5TF2A 3I2NA 5IT9g 4GGAA 1JMXB 2CN2A 3JZNA 3I8CA 3OKTA 3F3GA 4L3GD 3ZWLB 4CC9A 1JMZB 1K32A 4NSXA 3P4FA 5I5MA 3IJCA 3KRXB 3PSLA 4JT6C 2HESX 2IWFA 5FKRA 3SFZA 4A2MA 1XKSA 3EI3B 3EI1A 3IJ0A 4CY2A 2QC5A 4CY1A 3RN1D 2Q7QA 3E0CA 3JZHA 3DSMA 4R7AB 3SLED 2OK4A 4FWWA 3SHFA 3JPXA 3V7DB 3IIYA 4MK0B 3UVNA 2CE8A 4O45A 4QRJA 3PXTD 1U2VC 4ESGA 5GMKn 4ZOZA 3JAMg 3W15A 2B5NA 4JT5C 5EMLB 4A11A 3K27A 3I7OA 2OVRB 2W18A 4PNKB 4FA1D 3EI2B 5TEEA 2IAAA 3AL8A 2OIZA 5IGQA 4Y7RA 2PM7B 3MZLA 3EWEA 5HQGA 3JZGA 2XYIA 3C99A 4PBZA 5GXIA 2P9UC 4J8GA 1PEVA 4ZOXA 4LG9A 4A11B 3F3FA 4YVDA 2H13A 5HYNB 3JB9L 4ZN4A 3MMYA 3V9FA 4ZOVA 2YBAA 4A08B 1R5MA 3BWSA 5SXMA 3GFCA 5FA5B 3L4OD 2YNPA 2PM9A 4GQ1A 2AH0A 4XYIA 5EMJB 4JSPC 1B9YA 1NR0A 4A09B 2I0SA 4OZUA 2AGWA 1L0QA 4FAND 2AH1A 5GXHA 4QT8A 3EI3A 2AGXA 5IC7A 1GG2B 1TYQC 3SMRA 5K19A 2Z2NA 2AGZA 1N6EA 4JSNC 2J56H 2AGLA 5C9ZB 4I79A 4CY5A 3JROA 4GM9A 4O3TB 5C2VB 4TZ4A 3DWLC 4CZXA 5CXCB 3C75H 5EMMB 3MZKA 5FXYA 2H47A 2CO0A 1A0RB 2H6NA 5FKSA 4E54B 5EMKB 2IUVA 5AFU3 5CXCA 4X60B 2P9NC 3DXMC 1NEXB 3HFQA 3NVNA 5HE3B 3PSCB 2GC7A 4CI2A 3N0DA 2OK6A 2YB8B 3AL8B 3RMZD 1GP2B 4J81A 2IUPA 2H9PA 2PM6B 2MTAH 3MKSB 2YMUA 3CIKB 5FLXg 3BG0A 3K26A 3RN0D 3ULEC 4FA4D 2J57G 3F3PA 4GMBA 1K8KC 4A09A 5TEFA 2G99A 2XL2A 2H68A 3PVWB 3GREA 3OL2A 3SBQA 4CZVA 4GZ8A 5H14A 3DXKC 3OL2B 4GQ2P 4A08A 4CY3A 2G9AA 2P9PC 2I3SA 3CFVA 4PBYA 4LGNA 5K1CC 4ERYA 4J77A 2IUQA 2HYEA 3SN6B 4GGCA 4BUJC 5H17A 2UZXB 3RSEC 1XHMA 5IJ7E 2CN3A 3I7LA 3A0FA 4JSXC 4ERZA 4E54A 4J86A 3EI4A 4Z8LA 4X61B 5C2WB 3EMHA 3UVLA 4X3EA 4KFMB 1RI6A 2H9LA 3SXTD 3UVOA 5EARA 2HJ4A 4ERQA 3J81g 1Q47A 3PE7A 3RFGA 3FM0A 4HDJA 2AGYA 3MKQA 4CI1A 1MG3A 2CNXA 3UKUC 3UKRC 1MG2A 4J73A 1OMWB 4UI9R 3B7FA 2PM9B 1B9XA 1GXRA 4U1EI 4A2LA 1PBYB 2B5MA 4A0BA 1ERJA 3FRXA 2O9KA 4FAVD 4QL1A 4J0XA 4OWRA 3OKWA 3EI4B 3L4MD 3AH8B 3N0EA 3OW8A 4IMMA 3UR4A 5A2Qg 4FHLA 1N6DA 5CYKA 3NVXA 4A0AB 4O3UB 3FGBA 2IWKA 4L1QD 5HE0B 2Z2PA 1YFQA 2IURA 2P9SC 3UVMA 4FA9D 5FQDA 3PVUB 3OKYA 3SVWD 4J0WA 4GGDA 2TRCB 4J82A 3I7KA 3AFCA 2H14A 2HKMA 4J8BA 4U7AA 4BH6A 2CO0C 4J87A 5CYKB 5IJ8E 2CE9A 1VYHC 4Y5RD 3SCYA 2PBIB 4J84A 2H6KA 4XEIC 5EALA 1SQJA 5H1MA 4A0BB 4IA9A 4FB1D 1SQ9A 3PXSD 2QXVA 4H5IA 3RFHA 4ES0A 2B5LA 3IKOA 3RRMC 3I7NA 1PI6A 3OTTA 1QNIA 5JWZA 2AQ5A 1FWXA 2BCJB 4AOWA 3VGZA 2P9KC 4BL0A 3PXWD 3AL9A 2OVQB 4EWRA 4L3HD 4XYHA 5EM2B 2H9MA 3VH0A 2GNQA 4X63B 1XIPA 3I89A 2H9NA 2OVPB 4D6VA 1GOTB 5THAA 2H3XA 5FKQA 2YNNA 4K3ID 5EAPA 3JRPA 4JXMA 2H6QA 3SWSD 5TDHB 5I5IA 3MXXA 1MDAH 4CZYA 4GM3A 5IGOA 4J78A 3IJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIW A;  4N14 A;  3SJL D;  4J79 A;  4AEZ A;  1JOF A;  3I8E A;  2BBK H;  4LG8 A;  4PSW B;  3VA6 A;  2Z2O A;  2EBS A;  5HE1 B;  3OKY B;  2B4E A;  3ORV D;  2I0T A;  4E5Z A;  1SHY B;  3C5M A;  3EI2 A;  2HJB A;  4JSV C;  2GC4 A;  2XL3 A;  5EM2 A;  2HXC A;  2XU7 A;  1JJU B;  2I0R A;  4G56 B;  3EU7 A;  3I7P A;  5AMS A;  5FKT A;  2P9L C;  3BG1 A;  5B4W A;  3EG6 A;  5CXB B;  4PXW A;  4K3J B;  4D0K A;  3UVK A;  4ZOY A;  3SBP A;  4L9O A;  3DM0 A;  5CXB A;  4JD2 C;  5GSA A;  2UZY B;  4O1Q D;  3ODT A;  5I5J A;  3EI1 B;  5EAM A;  3KRW B;  4A7J A;  1P22 A;  3J80 g;  3CFS B;  2YNO A;  4CI8 A;  3NVQ A;  2P9I C;  4PSX B;  1S4U X;  1TBG A;  4FA5 D;  4E5Z B;  5AJA A;  1PGU A;  3C9C A;  1N6F A;  2J55 H;  5HE2 B;  3U4Y A;  1OLZ A;  3SBR A;  2HKR A;  4H5J A;  4PC0 A;  3I7H A;  3RLM D;  4A0A A;  4QQE A;  3V5W B;  4O9D A;  5KDO B;  2I3T A;  4CI3 A;  4GM8 A;  4GQB B;  2OJY A;  1U4C A;  5TF2 A;  3I2N A;  5IT9 g;  4GGA A;  1JMX B;  2CN2 A;  3JZN A;  3I8C A;  3OKT A;  3F3G A;  4L3G D;  3ZWL B;  4CC9 A;  1JMZ B;  1K32 A;  4NSX A;  3P4F A;  5I5M A;  3IJC A;  3KRX B;  3PSL A;  4JT6 C;  2HES X;  2IWF A;  5FKR A;  3SFZ A;  4A2M A;  1XKS A;  3EI3 B;  3EI1 A;  3IJ0 A;  4CY2 A;  2QC5 A;  4CY1 A;  3RN1 D;  2Q7Q A;  3E0C A;  3JZH A;  3DSM A;  4R7A B;  3SLE D;  2OK4 A;  4FWW A;  3SHF A;  3JPX A;  3V7D B;  3IIY A;  4MK0 B;  3UVN A;  2CE8 A;  4O45 A;  4QRJ A;  3PXT D;  1U2V C;  4ESG A;  5GMK n;  4ZOZ A;  3JAM g;  3W15 A;  2B5N A;  4JT5 C;  5EML B;  4A11 A;  3K27 A;  3I7O A;  2OVR B;  2W18 A;  4PNK B;  4FA1 D;  3EI2 B;  5TEE A;  2IAA A;  3AL8 A;  2OIZ A;  5IGQ A;  4Y7R A;  2PM7 B;  3MZL A;  3EWE A;  5HQG A;  3JZG A;  2XYI A;  3C99 A;  4PBZ A;  5GXI A;  2P9U C;  4J8G A;  1PEV A;  4ZOX A;  4LG9 A;  4A11 B;  3F3F A;  4YVD A;  2H13 A;  5HYN B;  3JB9 L;  4ZN4 A;  3MMY A;  3V9F A;  4ZOV A;  2YBA A;  4A08 B;  1R5M A;  3BWS A;  5SXM A;  3GFC A;  5FA5 B;  3L4O D;  2YNP A;  2PM9 A;  4GQ1 A;  2AH0 A;  4XYI A;  5EMJ B;  4JSP C;  1B9Y A;  1NR0 A;  4A09 B;  2I0S A;  4OZU A;  2AGW A;  1L0Q A;  4FAN D;  2AH1 A;  5GXH A;  4QT8 A;  3EI3 A;  2AGX A;  5IC7 A;  1GG2 B;  1TYQ C;  3SMR A;  5K19 A;  2Z2N A;  2AGZ A;  1N6E A;  4JSN C;  2J56 H;  2AGL A;  5C9Z B;  4I79 A;  4CY5 A;  3JRO A;  4GM9 A;  4O3T B;  5C2V B;  4TZ4 A;  3DWL C;  4CZX A;  5CXC B;  3C75 H;  5EMM B;  3MZK A;  5FXY A;  2H47 A;  2CO0 A;  1A0R B;  2H6N A;  5FKS A;  4E54 B;  5EMK B;  2IUV A;  5AFU 3;  5CXC A;  4X60 B;  2P9N C;  3DXM C;  1NEX B;  3HFQ A;  3NVN A;  5HE3 B;  3PSC B;  2GC7 A;  4CI2 A;  3N0D A;  2OK6 A;  2YB8 B;  3AL8 B;  3RMZ D;  1GP2 B;  4J81 A;  2IUP A;  2H9P A;  2PM6 B;  2MTA H;  3MKS B;  2YMU A;  3CIK B;  5FLX g;  3BG0 A;  3K26 A;  3RN0 D;  3ULE C;  4FA4 D;  2J57 G;  3F3P A;  4GMB A;  1K8K C;  4A09 A;  5TEF A;  2G99 A;  2XL2 A;  2H68 A;  3PVW B;  3GRE A;  3OL2 A;  3SBQ A;  4CZV A;  4GZ8 A;  5H14 A;  3DXK C;  3OL2 B;  4GQ2 P;  4A08 A;  4CY3 A;  2G9A A;  2P9P C;  2I3S A;  3CFV A;  4PBY A;  4LGN A;  5K1C C;  4ERY A;  4J77 A;  2IUQ A;  2HYE A;  3SN6 B;  4GGC A;  4BUJ C;  5H17 A;  2UZX B;  3RSE C;  1XHM A;  5IJ7 E;  2CN3 A;  3I7L A;  3A0F A;  4JSX C;  4ERZ A;  4E54 A;  4J86 A;  3EI4 A;  4Z8L A;  4X61 B;  5C2W B;  3EMH A;  3UVL A;  4X3E A;  4KFM B;  1RI6 A;  2H9L A;  3SXT D;  3UVO A;  5EAR A;  2HJ4 A;  4ERQ A;  3J81 g;  1Q47 A;  3PE7 A;  3RFG A;  3FM0 A;  4HDJ A;  2AGY A;  3MKQ A;  4CI1 A;  1MG3 A;  2CNX A;  3UKU C;  3UKR C;  1MG2 A;  4J73 A;  1OMW B;  4UI9 R;  3B7F A;  2PM9 B;  1B9X A;  1GXR A;  4U1E I;  4A2L A;  1PBY B;  2B5M A;  4A0B A;  1ERJ A;  3FRX A;  2O9K A;  4FAV D;  4QL1 A;  4J0X A;  4OWR A;  3OKW A;  3EI4 B;  3L4M D;  3AH8 B;  3N0E A;  3OW8 A;  4IMM A;  3UR4 A;  5A2Q g;  4FHL A;  1N6D A;  5CYK A;  3NVX A;  4A0A B;  4O3U B;  3FGB A;  2IWK A;  4L1Q D;  5HE0 B;  2Z2P A;  1YFQ A;  2IUR A;  2P9S C;  3UVM A;  4FA9 D;  5FQD A;  3PVU B;  3OKY A;  3SVW D;  4J0W A;  4GGD A;  2TRC B;  4J82 A;  3I7K A;  3AFC A;  2H14 A;  2HKM A;  4J8B A;  4U7A A;  4BH6 A;  2CO0 C;  4J87 A;  5CYK B;  5IJ8 E;  2CE9 A;  1VYH C;  4Y5R D;  3SCY A;  2PBI B;  4J84 A;  2H6K A;  4XEI C;  5EAL A;  1SQJ A;  5H1M A;  4A0B B;  4IA9 A;  4FB1 D;  1SQ9 A;  3PXS D;  2QXV A;  4H5I A;  3RFH A;  4ES0 A;  2B5L A;  3IKO A;  3RRM C;  3I7N A;  1PI6 A;  3OTT A;  1QNI A;  5JWZ A;  2AQ5 A;  1FWX A;  2BCJ B;  4AOW A;  3VGZ A;  2P9K C;  4BL0 A;  3PXW D;  3AL9 A;  2OVQ B;  4EWR A;  4L3H D;  4XYH A;  5EM2 B;  2H9M A;  3VH0 A;  2GNQ A;  4X63 B;  1XIP A;  3I89 A;  2H9N A;  2OVP B;  4D6V A;  1GOT B;  5THA A;  2H3X A;  5FKQ A;  2YNN A;  4K3I D;  5EAP A;  3JRP A;  4JXM A;  2H6Q A;  3SWS D;  5TDH B;  5I5I A;  3MXX A;  1MDA H;  4CZY A;  4GM3 A;  5IGO A;  4J78 A;  3IJ1 A; 
#chains in the Genus database with same CATH topology
 3IIW A;  4N14 A;  3SJL D;  4J79 A;  4AEZ A;  1JOF A;  1VZ2 A;  3I8E A;  4AX4 A;  2BBK H;  4LG8 A;  4PSW B;  3VA6 A;  4O02 A;  2Z2O A;  2EBS A;  5HE1 B;  3OKY B;  2B4E A;  3ORV D;  4WJK A;  2I0T A;  4E5Z A;  1SHY B;  3C5M A;  3ZDZ A;  3EI2 A;  2HJB A;  2XDW A;  4JSV C;  2GC4 A;  2XL3 A;  2VDK A;  2VDN A;  1JV2 A;  5EM2 A;  1TYE A;  4BCB A;  2HXC A;  2XU7 A;  1JJU B;  4MMX A;  2I0R A;  5M5R A;  4G56 B;  3EU7 A;  3I7P A;  5AMS A;  5FKT A;  1VZ3 A;  2P9L C;  3BG1 A;  5B4W A;  3EG6 A;  5CXB B;  4PXW A;  4NAA A;  4K3J B;  4D0K A;  3UVK A;  4ZOY A;  3SBP A;  4L9O A;  3DM0 A;  5CXB A;  3DDU A;  1UOQ A;  3IUR A;  4JD2 C;  5GSA A;  2UZY B;  4O1Q D;  3ODT A;  3QHY B;  4RE5 A;  5I5J A;  3EI1 B;  4BP9 A;  2EIB A;  5EAM A;  3KRW B;  4A7J A;  1P22 A;  2EIE A;  4Z7N A;  3J80 g;  3CFS B;  3O4G A;  2YNO A;  3FCU A;  4CI8 A;  3NVQ A;  2P9I C;  4PSX B;  1S4U X;  1TBG A;  4FA5 D;  4E5Z B;  5AJA A;  1PGU A;  3C9C A;  1N6F A;  3ZDX A;  2J55 H;  5HE2 B;  3U4Y A;  1OLZ A;  3SBR A;  2HKR A;  4H5J A;  4PC0 A;  5FFG A;  3I7H A;  3RLM D;  4A0A A;  4QQE A;  3K71 A;  4WK4 A;  3V5W B;  4O9D A;  4BCD A;  5KDO B;  2I3T A;  2VDM A;  1E8N A;  4CI3 A;  4GM8 A;  1E5T A;  4GQB B;  2OJY A;  1U4C A;  1GOG A;  5TF2 A;  4Z7O A;  4NC4 A;  1K3I A;  3I2N A;  4AMY A;  4GGA A;  5C92 A;  5IT9 g;  1JMX B;  2CN2 A;  3EQ8 A;  3JZN A;  5M5T A;  3OKT A;  3GC3 B;  3F3G A;  3I8C A;  4UM8 A;  4L3G D;  3ZWL B;  3T3P A;  4CC9 A;  1JMZ B;  1K32 A;  4NSX A;  3P4F A;  5I5M A;  2XZG A;  3IJC A;  3KRX B;  3PSL A;  1GOH A;  4JT6 C;  2HES X;  3IUL A;  2IWF A;  5FKR A;  3SFZ A;  4A2M A;  1XKS A;  3EI3 B;  3EI1 A;  1C9I A;  3IJ0 A;  4CY2 A;  2QC5 A;  4CY1 A;  3RN1 D;  2Q7Q A;  3E0C A;  3JZH A;  3NIF A;  3DSM A;  4MMZ A;  4R7A B;  3SLE D;  1C9L A;  2OK4 A;  4FWW A;  3SHF A;  4O2W A;  3JPX A;  3V7D B;  3IIY A;  4MK0 B;  4DNV A;  3O4H A;  3UVN A;  2CE8 A;  4O45 A;  5M61 A;  4QRJ A;  3PXT D;  1U2V C;  4ESG A;  5GMK n;  4ZOZ A;  3JAM g;  4Z7Q A;  3W15 A;  3FCS A;  2B5N A;  2VDR A;  4JT5 C;  4RE6 A;  5EML B;  4A11 A;  3K27 A;  4L1M A;  2HU8 A;  3I7O A;  2OVR B;  2W18 A;  4PNK B;  1U8C A;  4FA1 D;  3EI2 B;  5TEE A;  2IAA A;  3AL8 A;  2OIZ A;  5IGQ A;  4Y7R A;  2PM7 B;  3MZL A;  3EWE A;  3GD1 I;  5HQG A;  3JZG A;  2XYI A;  3C99 A;  4PBZ A;  2HU7 A;  5GXI A;  2P9U C;  4J8G A;  1PEV A;  3IVM A;  4ZOX A;  4LG9 A;  4A11 B;  3F3F A;  4YVD A;  2H13 A;  5HYN B;  3JB9 L;  1BPO A;  4ZN4 A;  3MMY A;  3V9F A;  5E6U A;  4ZOV A;  2YBA A;  4A08 B;  1R5M A;  3BWS A;  5SXM A;  3GFC A;  5FA5 B;  2HU5 A;  3L4O D;  3VI4 A;  2YNP A;  1A12 A;  2PM9 A;  4GQ1 A;  2AH0 A;  4XYI A;  5EMJ B;  4JSP C;  1B9Y A;  1NR0 A;  4A09 B;  2I0S A;  4OZU A;  2AGW A;  1L0Q A;  3IJ1 A;  3NID A;  2AH1 A;  4FAN D;  5GXH A;  4QT8 A;  3EI3 A;  2AGX A;  5IC7 A;  1GG2 B;  1TYQ C;  3SMR A;  1UTC A;  5K19 A;  2Z2N A;  2AGZ A;  1N6E A;  2J56 H;  2AGL A;  4JSN C;  5C9Z B;  4I79 A;  4CY5 A;  3JRO A;  4GM9 A;  4O3T B;  5C2V B;  2WQ8 A;  2VDQ A;  4TZ4 A;  3DWL C;  4CZX A;  5CXC B;  3EQ7 A;  2EID A;  3C75 H;  5EMM B;  3V4P A;  3MZK A;  5FXY A;  2H47 A;  5FFO A;  4DNU A;  5E6R A;  2CO0 A;  1A0R B;  2H6N A;  5FKS A;  2VZ1 A;  4E54 B;  5EMK B;  2IUV A;  5AFU 3;  5CXC A;  4X60 B;  2P9N C;  1QFS A;  3DXM C;  1NEX B;  3HFQ A;  3NVN A;  4AMZ A;  3K72 A;  5HE3 B;  3PSC B;  1H2W A;  2GC7 A;  4CI2 A;  5C86 A;  5HDB A;  3N0D A;  2QZP A;  2OK6 A;  2YB8 B;  3AL8 B;  3RMZ D;  1GP2 B;  4J81 A;  5M5S A;  2IUP A;  2H9P A;  2PM6 B;  2MTA H;  2VC2 A;  3MKS B;  3ZE2 A;  2YMU A;  3CIK B;  5FLX g;  3BG0 A;  4AN0 A;  2VZ3 A;  3K26 A;  3RN0 D;  3ULE C;  4FA4 D;  2J57 G;  1H2Y A;  3F3P A;  4GMB A;  1K8K C;  4A09 A;  5TEF A;  1VE7 A;  2G99 A;  2XL2 A;  3IUN A;  2H68 A;  3PVW B;  3GRE A;  3OL2 A;  3SBQ A;  4CZV A;  4GZ8 A;  1E8M A;  4NEN A;  5H14 A;  2VDL A;  3DXK C;  3OL2 B;  4GQ2 P;  3KCI A;  4A08 A;  4CY3 A;  2G9A A;  3MUN A;  2P9P C;  2I3S A;  3CFV A;  4PBY A;  4DNW A;  4LGN A;  2VDO A;  5K1C C;  3MUO A;  4ERY A;  5M5V A;  4J77 A;  2IUQ A;  2HYE A;  3SN6 B;  4GGC A;  4BUJ C;  3NIG A;  5H17 A;  4AN1 A;  2UZX B;  3RSE C;  1XHM A;  5IJ7 E;  2CN3 A;  4QAM A;  4IRZ A;  3I7L A;  4G55 A;  3A0F A;  4JSX C;  4ERZ A;  4E54 A;  3IUQ A;  4J86 A;  3EI4 A;  4Z8L A;  4BCC A;  3T3M A;  4X61 B;  5C2W B;  3QI0 A;  3EMH A;  3UVL A;  4X3E A;  4KFM B;  4MMY A;  1RI6 A;  1M1X A;  2H9L A;  2EIC A;  3SXT D;  3UVO A;  5EAR A;  2HJ4 A;  4ERQ A;  3J81 g;  1O6G A;  1Q47 A;  3PE7 A;  3RFG A;  3FM0 A;  4HDJ A;  2AGY A;  3MKQ A;  4CI1 A;  4UM9 A;  1MG3 A;  3IUM A;  2CNX A;  3UKU C;  1YR2 A;  3UKR C;  1MG2 A;  1H2Z A;  4J73 A;  1OMW B;  4UI9 R;  3VI3 A;  3B7F A;  2PM9 B;  1B9X A;  2JKX A;  4D9S A;  1GXR A;  1QFM A;  4U1E I;  4NBM A;  4A2L A;  1PBY B;  1UOO A;  2B5M A;  1H2X A;  1ERJ A;  4A0B A;  3FRX A;  1O6F A;  2O9K A;  4FAV D;  4QL1 A;  2QR5 A;  5M5U A;  4J0X A;  4BP8 A;  4OWR A;  3OKW A;  3EI4 B;  3L4M D;  3O4J A;  3AH8 B;  3N0E A;  4JHN A;  3OW8 A;  4IMM A;  3UR4 A;  5A2Q g;  4FHL A;  1N6D A;  3EQ9 A;  4G1M A;  3MVD K;  5CYK A;  3NVX A;  4A0A B;  4O3U B;  3FGB A;  2IWK A;  4L1Q D;  5HE0 B;  1GOF A;  3IJE A;  2Z2P A;  1YFQ A;  4JHP C;  2IUR A;  2P9S C;  3UVM A;  4FA9 D;  1I2M B;  4WK0 A;  3OF7 A;  5FQD A;  3PVU B;  3OKY A;  3SVW D;  4J0W A;  4GGD A;  2TRC B;  2VDP A;  3ZE1 A;  1VE6 A;  4G1E A;  4J82 A;  3I7K A;  3AFC A;  2H14 A;  2HKM A;  4J8B A;  4U7A A;  4BH6 A;  2CO0 C;  4J87 A;  1T2X A;  5CYK B;  5IJ8 E;  1VYH C;  2CE9 A;  4Y5R D;  3SCY A;  2PBI B;  3V4V A;  5E6S A;  4J84 A;  2H6K A;  4XEI C;  5EAL A;  1SQJ A;  5H1M A;  4A0B B;  4IA9 A;  4FB1 D;  1SQ9 A;  3PXS D;  2QXV A;  4H5I A;  3RFH A;  3IUJ A;  4ES0 A;  2B5L A;  3IKO A;  3RRM C;  3I7N A;  1PI6 A;  3OTT A;  1QNI A;  5JWZ A;  2AQ5 A;  1FWX A;  2BCJ B;  4AOW A;  3VGZ A;  2P9K C;  4BL0 A;  3PXW D;  3AL9 A;  1JTD B;  2OVQ B;  3ZDY A;  4EWR A;  4L3H D;  4XYH A;  5EM2 B;  2H9M A;  3VH0 A;  2GNQ A;  4X63 B;  1XIP A;  3I89 A;  2H9N A;  2OVP B;  4D6V A;  1GOT B;  5THA A;  2H3X A;  5FKQ A;  2YNN A;  4K3I D;  5EAP A;  3JRP A;  4JXM A;  1UOP A;  1L5G A;  2H6Q A;  3K6S A;  3SWS D;  4WK2 A;  3O4I A;  5TDH B;  5I5I A;  2BKL A;  3MXX A;  1MDA H;  4CZY A;  4GM3 A;  3ZE0 A;  5IGO A;  4J78 A;  2XE4 A; 
#chains in the Genus database with same CATH homology
 3IIW A;  4N14 A;  3SJL D;  4J79 A;  4AEZ A;  1JOF A;  3I8E A;  2BBK H;  4LG8 A;  4PSW B;  3VA6 A;  2Z2O A;  2EBS A;  5HE1 B;  3OKY B;  2B4E A;  3ORV D;  2I0T A;  4E5Z A;  1SHY B;  3C5M A;  3EI2 A;  2HJB A;  4JSV C;  2GC4 A;  2XL3 A;  5EM2 A;  2HXC A;  2XU7 A;  1JJU B;  2I0R A;  4G56 B;  3EU7 A;  3I7P A;  5AMS A;  5FKT A;  2P9L C;  3BG1 A;  5B4W A;  3EG6 A;  5CXB B;  4PXW A;  4K3J B;  4D0K A;  3UVK A;  4ZOY A;  3SBP A;  4L9O A;  3DM0 A;  5CXB A;  4JD2 C;  5GSA A;  2UZY B;  4O1Q D;  3ODT A;  5I5J A;  3EI1 B;  5EAM A;  3KRW B;  4A7J A;  1P22 A;  3J80 g;  3CFS B;  2YNO A;  4CI8 A;  3NVQ A;  2P9I C;  4PSX B;  1S4U X;  1TBG A;  4FA5 D;  4E5Z B;  5AJA A;  1PGU A;  3C9C A;  1N6F A;  2J55 H;  5HE2 B;  3U4Y A;  1OLZ A;  3SBR A;  2HKR A;  4H5J A;  4PC0 A;  3I7H A;  3RLM D;  4A0A A;  4QQE A;  3V5W B;  4O9D A;  5KDO B;  2I3T A;  4CI3 A;  4GM8 A;  4GQB B;  2OJY A;  1U4C A;  5TF2 A;  3I2N A;  5IT9 g;  4GGA A;  1JMX B;  2CN2 A;  3JZN A;  3I8C A;  3OKT A;  3F3G A;  4L3G D;  3ZWL B;  4CC9 A;  1JMZ B;  1K32 A;  4NSX A;  3P4F A;  5I5M A;  3IJC A;  3KRX B;  3PSL A;  4JT6 C;  2HES X;  2IWF A;  5FKR A;  3SFZ A;  4A2M A;  1XKS A;  3EI3 B;  3EI1 A;  3IJ0 A;  4CY2 A;  2QC5 A;  4CY1 A;  3RN1 D;  2Q7Q A;  3E0C A;  3JZH A;  3DSM A;  4R7A B;  3SLE D;  2OK4 A;  4FWW A;  3SHF A;  3JPX A;  3V7D B;  3IIY A;  4MK0 B;  3UVN A;  2CE8 A;  4O45 A;  4QRJ A;  3PXT D;  1U2V C;  4ESG A;  5GMK n;  4ZOZ A;  3JAM g;  3W15 A;  2B5N A;  4JT5 C;  5EML B;  4A11 A;  3K27 A;  3I7O A;  2OVR B;  2W18 A;  4PNK B;  4FA1 D;  3EI2 B;  5TEE A;  2IAA A;  3AL8 A;  2OIZ A;  5IGQ A;  4Y7R A;  2PM7 B;  3MZL A;  3EWE A;  5HQG A;  3JZG A;  2XYI A;  3C99 A;  4PBZ A;  5GXI A;  2P9U C;  4J8G A;  1PEV A;  4ZOX A;  4LG9 A;  4A11 B;  3F3F A;  4YVD A;  2H13 A;  5HYN B;  3JB9 L;  4ZN4 A;  3MMY A;  3V9F A;  4ZOV A;  2YBA A;  4A08 B;  1R5M A;  3BWS A;  5SXM A;  3GFC A;  5FA5 B;  3L4O D;  2YNP A;  2PM9 A;  4GQ1 A;  2AH0 A;  4XYI A;  5EMJ B;  4JSP C;  1B9Y A;  1NR0 A;  4A09 B;  2I0S A;  4OZU A;  2AGW A;  1L0Q A;  4FAN D;  2AH1 A;  5GXH A;  4QT8 A;  3EI3 A;  2AGX A;  5IC7 A;  1GG2 B;  1TYQ C;  3SMR A;  5K19 A;  2Z2N A;  2AGZ A;  1N6E A;  4JSN C;  2J56 H;  2AGL A;  5C9Z B;  4I79 A;  4CY5 A;  3JRO A;  4GM9 A;  4O3T B;  5C2V B;  4TZ4 A;  3DWL C;  4CZX A;  5CXC B;  3C75 H;  5EMM B;  3MZK A;  5FXY A;  2H47 A;  2CO0 A;  1A0R B;  2H6N A;  5FKS A;  4E54 B;  5EMK B;  2IUV A;  5AFU 3;  5CXC A;  4X60 B;  2P9N C;  3DXM C;  1NEX B;  3HFQ A;  3NVN A;  5HE3 B;  3PSC B;  2GC7 A;  4CI2 A;  3N0D A;  2OK6 A;  2YB8 B;  3AL8 B;  3RMZ D;  1GP2 B;  4J81 A;  2IUP A;  2H9P A;  2PM6 B;  2MTA H;  3MKS B;  2YMU A;  3CIK B;  5FLX g;  3BG0 A;  3K26 A;  3RN0 D;  3ULE C;  4FA4 D;  2J57 G;  3F3P A;  4GMB A;  1K8K C;  4A09 A;  5TEF A;  2G99 A;  2XL2 A;  2H68 A;  3PVW B;  3GRE A;  3OL2 A;  3SBQ A;  4CZV A;  4GZ8 A;  5H14 A;  3DXK C;  3OL2 B;  4GQ2 P;  4A08 A;  4CY3 A;  2G9A A;  2P9P C;  2I3S A;  3CFV A;  4PBY A;  4LGN A;  5K1C C;  4ERY A;  4J77 A;  2IUQ A;  2HYE A;  3SN6 B;  4GGC A;  4BUJ C;  5H17 A;  2UZX B;  3RSE C;  1XHM A;  5IJ7 E;  2CN3 A;  3I7L A;  3A0F A;  4JSX C;  4ERZ A;  4E54 A;  4J86 A;  3EI4 A;  4Z8L A;  4X61 B;  5C2W B;  3EMH A;  3UVL A;  4X3E A;  4KFM B;  1RI6 A;  2H9L A;  3SXT D;  3UVO A;  5EAR A;  2HJ4 A;  4ERQ A;  3J81 g;  1Q47 A;  3PE7 A;  3RFG A;  3FM0 A;  4HDJ A;  2AGY A;  3MKQ A;  4CI1 A;  1MG3 A;  2CNX A;  3UKU C;  3UKR C;  1MG2 A;  4J73 A;  1OMW B;  4UI9 R;  3B7F A;  2PM9 B;  1B9X A;  1GXR A;  4U1E I;  4A2L A;  1PBY B;  2B5M A;  4A0B A;  1ERJ A;  3FRX A;  2O9K A;  4FAV D;  4QL1 A;  4J0X A;  4OWR A;  3OKW A;  3EI4 B;  3L4M D;  3AH8 B;  3N0E A;  3OW8 A;  4IMM A;  3UR4 A;  5A2Q g;  4FHL A;  1N6D A;  5CYK A;  3NVX A;  4A0A B;  4O3U B;  3FGB A;  2IWK A;  4L1Q D;  5HE0 B;  2Z2P A;  1YFQ A;  2IUR A;  2P9S C;  3UVM A;  4FA9 D;  5FQD A;  3PVU B;  3OKY A;  3SVW D;  4J0W A;  4GGD A;  2TRC B;  4J82 A;  3I7K A;  3AFC A;  2H14 A;  2HKM A;  4J8B A;  4U7A A;  4BH6 A;  2CO0 C;  4J87 A;  5CYK B;  5IJ8 E;  2CE9 A;  1VYH C;  4Y5R D;  3SCY A;  2PBI B;  4J84 A;  2H6K A;  4XEI C;  5EAL A;  1SQJ A;  5H1M A;  4A0B B;  4IA9 A;  4FB1 D;  1SQ9 A;  3PXS D;  2QXV A;  4H5I A;  3RFH A;  4ES0 A;  2B5L A;  3IKO A;  3RRM C;  3I7N A;  1PI6 A;  3OTT A;  1QNI A;  5JWZ A;  2AQ5 A;  1FWX A;  2BCJ B;  4AOW A;  3VGZ A;  2P9K C;  4BL0 A;  3PXW D;  3AL9 A;  2OVQ B;  4EWR A;  4L3H D;  4XYH A;  5EM2 B;  2H9M A;  3VH0 A;  2GNQ A;  4X63 B;  1XIP A;  3I89 A;  2H9N A;  2OVP B;  4D6V A;  1GOT B;  5THA A;  2H3X A;  5FKQ A;  2YNN A;  4K3I D;  5EAP A;  3JRP A;  4JXM A;  2H6Q A;  3SWS D;  5TDH B;  5I5I A;  3MXX A;  1MDA H;  4CZY A;  4GM3 A;  5IGO A;  4J78 A;  3IJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...