4L3HD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l3hD00
4A09A 5FKTA 5FKRA 2YNNA 3F3PA 4E54A 3RN1D 4A08A 3I7HA 2HKMA 4GZ8A 5C2WB 5TEEA 3I7LA 4JXMA 4ERZA 3MZKA 1L0QA 3K27A 2QC5A 4PSWB 2AGXA 3AFCA 3I7KA 3PXTD 4QT8A 4FA1D 2IUPA 4J8BA 5H1MA 5IC7A 4E5ZB 3SCYA 4UI9R 2I0RA 3DM0A 1K8KC 1VYHC 1FWXA 2B5NA 2H6KA 3I89A 2UZYB 3PXWD 3AL9A 4E5ZA 4X63B 1N6FA 4PBZA 4ZN4A 3K26A 3MZLA 3L4MD 3MMYA 2YMUA 5FKSA 3F3GA 2P9NC 2B5MA 3CFSB 3EI1B 5CYKB 3I7NA 5EM2B 2B4EA 3ULEC 2TRCB 3SHFA 4J8GA 5B4WA 3JPXA 2CN3A 2H9PA 5CYKA 2H13A 4LG8A 1RI6A 4J77A 4BH6A 2H9MA 3DXKC 5CXBB 1U2VC 4GQ1A 4CI8A 4J86A 5EMJB 5I5IA 5FA5B 3OKYB 3UVKA 4R7AB 1R5MA 4U1EI 2W18A 5THAA 1XKSA 2J56H 3E0CA 2OVRB 3J80g 5A2Qg 3MKQA 2PM7B 3JZNA 4O9DA 4ZOVA 1JMZB 3NVXA 2OK6A 3DSMA 4GGAA 2P9SC 3AL8B 4IMMA 5HE3B 4X3EA 2IWKA 2I0TA 1ERJA 3OL2B 2HXCA 2CNXA 2H6QA 1GP2B 4CC9A 2J57G 4CZVA 4QL1A 2XU7A 4GMBA 5HE1B 4G56B 3W15A 4K3ID 5KDOB 3IJ0A 3OL2A 4PNKB 5AFU3 3RN0D 5TF2A 2CO0C 3RMZD 4JSNC 3UKRC 5IT9g 4CZYA 5JWZA 2XL2A 5EMLB 4E54B 3I2NA 4A08B 4O45A 5FLXg 4CI1A 4O3UB 3EI3A 4ERQA 3BG0A 3JROA 5K1CC 1PI6A 2GC7A 3OKTA 3N0EA 4D0KA 3JB9L 3SWSD 3RSEC 2OIZA 3UVNA 1B9XA 5GMKn 4J84A 4XEIC 4BUJC 4J81A 3SFZA 4O1QD 4L3GD 2IAAA 3V5WB 2IUQA 1SHYB 2GC4A 5IGOA 4O3TB 3VH0A 5SXMA 2MTAH 3IJCA 4FB1D 4ESGA 5GXIA 3FGBA 3EMHA 5H17A 2EBSA 3EU7A 1SQJA 4ERYA 4GGDA 3IIWA 4CI3A 2H9LA 4CY5A 3JZGA 3PVWB 5EMMB 3I8EA 4CI2A 3OTTA 4FA4D 2PM6B 1K32A 2G9AA 4J87A 4J78A 4X61B 3SBPA 3ORVD 4A0BB 5EALA 5IJ7E 2IUVA 4J73A 2AQ5A 3AH8B 2G99A 4JT5C 3UVMA 4GQBB 4CY2A 4GM8A 4J0WA 2I3TA 2HKRA 4A0BA 4ZOYA 2H14A 3OKWA 3C9CA 3C99A 4HDJA 2XYIA 2PM9A 4YVDA 2PBIB 3NVNA 5AJAA 1OMWB 4CZXA 3OW8A 3IIYA 4LGNA 3DWLC 3KRXB 2Q7QA 3UVLA 3C75H 4GM9A 4GGCA 3KRWB 5HE0B 5EMKB 2YNOA 1XHMA 5TEFA 1TBGA 3FRXA 4FAVD 4JSVC 2P9LC 2OK4A 1NEXB 4PSXB 3ODTA 5HE2B 3I7OA 4PXWA 3EI3B 1B9YA 2IWFA 3BG1A 5H14A 4CY1A 3IJ1A 5FQDA 3VA6A 4TZ4A 3UVOA 4XYHA 4A0AB 2BBKH 4I79A 3EWEA 4ES0A 2H68A 2P9KC 4FWWA 2P9PC 4QQEA 1SQ9A 2CE9A 4GM3A 4A2MA 2AH1A 3PSLA 3EI2A 3SXTD 4A0AA 5AMSA 3RFGA 3SN6B 2AGYA 3SVWD 4BL0A 4PBYA 4A11B 2GNQA 4H5IA 4X60B 1OLZA 1JMXB 4H5JA 5EAPA 1TYQC 5FKQA 2YBAA 3J81g 3VGZA 1N6EA 4A11A 4J82A 5GXHA 2IURA 2UZXB 4D6VA 4MK0B 3A0FA 4Y7RA 4Z8LA 2YNPA 5C2VB 4PC0A 1JOFA 3V9FA 2H47A 4CY3A 4U7AA 4JSPC 2CN2A 3CIKB 4OWRA 2P9IC 2OVPB 3CFVA 2J55H 4FHLA 2HYEA 3IKOA 2YB8B 4ZOXA 4JD2C 2AGLA 3I8CA 3MXXA 3PE7A 2XL3A 4AEZA 2H9NA 3JZHA 3RRMC 2AGWA 5FXYA 3UKUC 3EI4B 5I5MA 1MDAH 2P9UC 3GREA 2PM9B 4LG9A 3SJLD 1PBYB 3FM0A 3MKSB 2B5LA 5TDHB 3NVQA 1N6DA 3PVUB 4Y5RD 5IGQA 3L4OD 3SLED 3F3FA 2OJYA 1MG2A 1Q47A 3SMRA 3EI4A 3C5MA 4OZUA 1XIPA 5EAMA 3U4YA 3V7DB 3EI1A 5EM2A 2AH0A 3EG6A 1PGUA 4FA9D 1YFQA 4J79A 3HFQA 1GXRA 3SBRA 1MG3A 4A7JA 5HYNB 4NSXA 2OVQB 2Z2OA 2I0SA 4A2LA 2H6NA 1PEVA 3UR4A 5I5JA 5HQGA 4K3JB 5K19A 5CXBA 2BCJB 2HJBA 3GFCA 4AOWA 4FAND 4GQ2P 5IJ8E 2O9KA 2Z2NA 3OKYA 4JSXC 2HJ4A 2Z2PA 1S4UX 2HESX 2CO0A 1P22A 3I7PA 1GG2B 4EWRA 5CXCB 3EI2B 1GOTB 4ZOZA 4L1QD 4FA5D 3AL8A 4KFMB 4JT6C 4N14A 4XYIA 5GSAA 1A0RB 1JJUB 4L3HD 5CXCA 1U4CA 3B7FA 3SBQA 3PSCB 4L9OA 3DXMC 4IA9A 3N0DA 3P4FA 3RFHA 2QXVA 4A09B 4J0XA 3PXSD 4QRJA 3JRPA 2I3SA 3JAMg 3RLMD 1NR0A 3ZWLB 3BWSA 5EARA 2H3XA 2CE8A 2AGZA 1QNIA 5C9ZB
chains in the Genus database with same CATH superfamily
4A09A 2VDQA 5FKTA 5FKRA 2YNNA 3F3PA 4E54A 3RN1D 4A08A 3I7HA 2HKMA 4GZ8A 5C2WB 5TEEA 2QZPA 3I7LA 4JXMA 4ERZA 1QFMA 1L0QA 3MZKA 3GD1I 2QC5A 3K27A 2AGXA 3AFCA 3I7KA 3PXTD 4PSWB 4QT8A 4FA1D 2IUPA 4J8BA 5H1MA 2HU8A 5IC7A 2VDLA 4E5ZB 4JHPC 3SCYA 4Z7QA 4UI9R 2I0RA 3DM0A 1K8KC 3K72A 1C9LA 1O6GA 1VYHC 1FWXA 1H2YA 2B5NA 2H6KA 3I89A 2UZYB 4G1EA 3PXWD 3AL9A 4E5ZA 4X63B 1N6FA 4PBZA 4ZN4A 3K26A 4AX4A 3MZLA 3L4MD 4Z7NA 3MMYA 2YMUA 5FKSA 3F3GA 1H2XA 3IUJA 2P9NC 2B5MA 3CFSB 3EI1B 5CYKB 3I7NA 5EM2B 3IJEA 2B4EA 3ULEC 2TRCB 3SHFA 3O4GA 4J8GA 5B4WA 3JPXA 2CN3A 2H9PA 4WK0A 5CYKA 2VDRA 2H13A 4LG8A 1RI6A 2XDWA 4RE6A 4J77A 4BH6A 4UM9A 3O4HA 3K71A 2H9MA 3O4IA 3DXKC 5CXBB 3NIGA 1U2VC 4GQ1A 4CI8A 4J86A 5EMJB 3T3PA 5I5IA 5FA5B 5M5RA 5M5UA 3OKYB 3UVKA 4R7AB 1R5MA 4U1EI 2W18A 5THAA 1XKSA 3ZDXA 2J56H 3E0CA 2OVRB 3J80g 5A2Qg 3MKQA 2JKXA 2PM7B 3JZNA 1H2WA 4O9DA 4ZOVA 1JMZB 3NVXA 2OK6A 3DSMA 4GGAA 2P9SC 2EIBA 3AL8B 3MUOA 4IMMA 5HE3B 4X3EA 2IWKA 2I0TA 1ERJA 3OL2B 2HXCA 2CNXA 2H6QA 1GP2B 4CC9A 2J57G 4CZVA 4QL1A 2XU7A 4GMBA 4AMYA 5HE1B 4G56B 3W15A 4K3ID 3KCIA 5KDOB 1GOHA 3IJ0A 3OL2A 3QI0A 4PNKB 5AFU3 3RN0D 5TF2A 2CO0C 1H2ZA 4JSNC 3RMZD 3UKRC 5M5VA 5E6RA 5IT9g 4CZYA 5JWZA 2XL2A 5EMLB 4NBMA 4E54B 3I2NA 4A08B 4DNWA 4O45A 5FLXg 4CI1A 3NIDA 4O3UB 3EI3A 4ERQA 3FCSA 1UOPA 1VZ3A 3BG0A 1O6FA 3JROA 1E5TA 1UTCA 4QAMA 1GOFA 5K1CC 1PI6A 2GC7A 3OKTA 3N0EA 4D0KA 3JB9L 4O02A 3V4PA 3IVMA 3SWSD 1VE6A 1A12A 2OIZA 3RSEC 3UVNA 1B9XA 5M61A 5GMKn 4J84A 4XEIC 4BUJC 4J81A 3SFZA 2VDNA 4O1QD 4L3GD 4WK2A 2IAAA 4NENA 3V5WB 2IUQA 1SHYB 2GC4A 5IGOA 4O3TB 3VH0A 5C86A 5SXMA 1M1XA 5M5SA 2MTAH 3IJCA 4NC4A 4FB1D 3GC3B 4ESGA 5GXIA 3FGBA 1JTDB 3EMHA 5H17A 2EBSA 1L5GA 4L1MA 3EU7A 1SQJA 4BCDA 4ERYA 4GGDA 3IIWA 4CI3A 2H9LA 4CY5A 3JZGA 3PVWB 5EMMB 1UOQA 3I8EA 4CI2A 3OTTA 4FA4D 2PM6B 1K32A 3OF7A 2G9AA 3O4JA 4J87A 4J78A 4X61B 2EIDA 3SBPA 3ORVD 4A0BB 5EALA 5IJ7E 2IUVA 5FFOA 4J73A 2AQ5A 3AH8B 4MMZA 2G99A 3EQ9A 4JT5C 3UVMA 4GQBB 4CY2A 4GM8A 4J0WA 4NAAA 2I3TA 3ZE1A 4Z7OA 2HKRA 4A0BA 4ZOYA 2H14A 4BCCA 3OKWA 3C9CA 3C99A 4HDJA 2XYIA 2PM9A 4YVDA 2PBIB 3NVNA 5AJAA 1OMWB 4CZXA 3OW8A 2HU5A 3IIYA 4LGNA 4RE5A 3VI3A 3DWLC 3KRXB 2Q7QA 3UVLA 3C75H 4GM9A 4GGCA 3KRWB 5HE0B 2VDPA 5EMKB 2YNOA 1XHMA 3QHYB 2EICA 5TEFA 1TBGA 3FRXA 4FAVD 3MVDK 4JSVC 2P9LC 2OK4A 1NEXB 2QR5A 4PSXB 3ODTA 5HE2B 3I7OA 4PXWA 3EI3B 1B9YA 2IWFA 3BG1A 4DNUA 5H14A 4CY1A 3IJ1A 5FQDA 3VA6A 4TZ4A 3UVOA 1I2MB 4XYHA 3FCUA 4A0AB 2BBKH 4I79A 3EWEA 4ES0A 5FFGA 2H68A 2P9KC 4FWWA 2P9PC 1YR2A 4QQEA 1SQ9A 2CE9A 4GM3A 4A2MA 2AH1A 3PSLA 3EI2A 3SXTD 1QFSA 4A0AA 4O2WA 5AMSA 2BKLA 3RFGA 3SN6B 4BP8A 2AGYA 3SVWD 1K3IA 4BL0A 4PBYA 3VI4A 4A11B 2GNQA 4JHNA 4H5IA 4X60B 1UOOA 1U8CA 1OLZA 3IULA 1JMXB 4H5JA 3IUNA 5EAPA 1TYQC 5FKQA 2YBAA 4DNVA 3J81g 1VE7A 2VDOA 3VGZA 1N6EA 1JV2A 2XZGA 3EQ7A 5E6UA 4A11A 4J82A 5GXHA 2IURA 2UZXB 4D6VA 4MK0B 3A0FA 4Y7RA 5E6SA 4Z8LA 1BPOA 2YNPA 5C2VB 3IUQA 4PC0A 1JOFA 3V9FA 2H47A 4CY3A 4G1MA 4U7AA 4WJKA 4JSPC 2CN2A 3CIKB 4OWRA 2P9IC 2OVPB 3CFVA 2J55H 5HDBA 4AN0A 2VDKA 4FHLA 5M5TA 3IKOA 2HYEA 2VC2A 2YB8B 4ZOXA 4AMZA 3NIFA 4JD2C 2VDMA 2AGLA 1TYEA 3MXXA 2XL3A 3I8CA 3PE7A 4AEZA 2H9NA 1GOGA 3JZHA 2AGWA 4WK4A 3RRMC 5FXYA 4UM8A 3UKUC 3EI4B 5I5MA 1MDAH 2P9UC 3GREA 2PM9B 4LG9A 3SJLD 1PBYB 4AN1A 3FM0A 3MKSB 2B5LA 5TDHB 1C9IA 3NVQA 1N6DA 3PVUB 4Y5RD 5IGQA 3L4OD 2VZ3A 3SLED 3F3FA 2OJYA 1MG2A 1Q47A 3SMRA 3EI4A 3C5MA 2HU7A 4OZUA 1XIPA 5EAMA 5C92A 3U4YA 3V7DB 3EI1A 5EM2A 4BP9A 2AH0A 3EG6A 1PGUA 4FA9D 1YFQA 4J79A 3V4VA 3HFQA 1GXRA 3SBRA 1MG3A 4A7JA 1E8MA 5HYNB 4NSXA 2OVQB 2Z2OA 3ZDYA 2I0SA 3K6SA 4A2LA 2H6NA 1PEVA 3UR4A 4MMXA 3ZE0A 5I5JA 1T2XA 5HQGA 3IURA 4K3JB 5K19A 5CXBA 2BCJB 2HJBA 3GFCA 4AOWA 4FAND 4GQ2P 5IJ8E 2O9KA 2Z2NA 3OKYA 4JSXC 1VZ2A 1E8NA 2HJ4A 2Z2PA 1S4UX 2HESX 2CO0A 1P22A 3I7PA 1GG2B 4EWRA 2VZ1A 4G55A 5CXCB 3EI2B 1GOTB 4ZOZA 4L1QD 4IRZA 4FA5D 3ZDZA 3AL8A 4KFMB 4JT6C 4N14A 4XYIA 5GSAA 1A0RB 3ZE2A 3EQ8A 3MUNA 1JJUB 3IUMA 4L3HD 5CXCA 4D9SA 1U4CA 3B7FA 2WQ8A 4BCBA 3SBQA 3PSCB 4L9OA 4MMYA 3DXMC 2XE4A 4IA9A 3N0DA 3DDUA 3P4FA 3RFHA 2QXVA 3T3MA 4A09B 2EIEA 4J0XA 3PXSD 4QRJA 3JRPA 2I3SA 3JAMg 3RLMD 1NR0A 3ZWLB 3BWSA 5EARA 2H3XA 2CE8A 2AGZA 1QNIA 5C9ZB
chains in the Genus database with same CATH topology
4A09A 5FKTA 5FKRA 2YNNA 3F3PA 4E54A 3RN1D 4A08A 3I7HA 2HKMA 4GZ8A 5C2WB 5TEEA 3I7LA 4JXMA 4ERZA 3MZKA 1L0QA 3K27A 2QC5A 4PSWB 2AGXA 3AFCA 3I7KA 3PXTD 4QT8A 4FA1D 2IUPA 4J8BA 5H1MA 5IC7A 4E5ZB 3SCYA 4UI9R 2I0RA 3DM0A 1K8KC 1VYHC 1FWXA 2B5NA 2H6KA 3I89A 2UZYB 3PXWD 3AL9A 4E5ZA 4X63B 1N6FA 4PBZA 4ZN4A 3K26A 3MZLA 3L4MD 3MMYA 2YMUA 5FKSA 3F3GA 2P9NC 2B5MA 3CFSB 3EI1B 5CYKB 3I7NA 5EM2B 2B4EA 3ULEC 2TRCB 3SHFA 4J8GA 5B4WA 3JPXA 2CN3A 2H9PA 5CYKA 2H13A 4LG8A 1RI6A 4J77A 4BH6A 2H9MA 3DXKC 5CXBB 1U2VC 4GQ1A 4CI8A 4J86A 5EMJB 5I5IA 5FA5B 3OKYB 3UVKA 4R7AB 1R5MA 4U1EI 2W18A 5THAA 1XKSA 2J56H 3E0CA 2OVRB 3J80g 5A2Qg 3MKQA 2PM7B 3JZNA 4O9DA 4ZOVA 1JMZB 3NVXA 2OK6A 3DSMA 4GGAA 2P9SC 3AL8B 4IMMA 5HE3B 4X3EA 2IWKA 2I0TA 1ERJA 3OL2B 2HXCA 2CNXA 2H6QA 1GP2B 4CC9A 2J57G 4CZVA 4QL1A 2XU7A 4GMBA 5HE1B 4G56B 3W15A 4K3ID 5KDOB 3IJ0A 3OL2A 4PNKB 5AFU3 3RN0D 5TF2A 2CO0C 3RMZD 4JSNC 3UKRC 5IT9g 4CZYA 5JWZA 2XL2A 5EMLB 4E54B 3I2NA 4A08B 4O45A 5FLXg 4CI1A 4O3UB 3EI3A 4ERQA 3BG0A 3JROA 5K1CC 1PI6A 2GC7A 3OKTA 3N0EA 4D0KA 3JB9L 3SWSD 3RSEC 2OIZA 3UVNA 1B9XA 5GMKn 4J84A 4XEIC 4BUJC 4J81A 3SFZA 4O1QD 4L3GD 2IAAA 3V5WB 2IUQA 1SHYB 2GC4A 5IGOA 4O3TB 3VH0A 5SXMA 2MTAH 3IJCA 4FB1D 4ESGA 5GXIA 3FGBA 3EMHA 5H17A 2EBSA 3EU7A 1SQJA 4ERYA 4GGDA 3IIWA 4CI3A 2H9LA 4CY5A 3JZGA 3PVWB 5EMMB 3I8EA 4CI2A 3OTTA 4FA4D 2PM6B 1K32A 2G9AA 4J87A 4J78A 4X61B 3SBPA 3ORVD 4A0BB 5EALA 5IJ7E 2IUVA 4J73A 2AQ5A 3AH8B 2G99A 4JT5C 3UVMA 4GQBB 4CY2A 4GM8A 4J0WA 2I3TA 2HKRA 4A0BA 4ZOYA 2H14A 3OKWA 3C9CA 3C99A 4HDJA 2XYIA 2PM9A 4YVDA 2PBIB 3NVNA 5AJAA 1OMWB 4CZXA 3OW8A 3IIYA 4LGNA 3DWLC 3KRXB 2Q7QA 3UVLA 3C75H 4GM9A 4GGCA 3KRWB 5HE0B 5EMKB 2YNOA 1XHMA 5TEFA 1TBGA 3FRXA 4FAVD 4JSVC 2P9LC 2OK4A 1NEXB 4PSXB 3ODTA 5HE2B 3I7OA 4PXWA 3EI3B 1B9YA 2IWFA 3BG1A 5H14A 4CY1A 3IJ1A 5FQDA 3VA6A 4TZ4A 3UVOA 4XYHA 4A0AB 2BBKH 4I79A 3EWEA 4ES0A 2H68A 2P9KC 4FWWA 2P9PC 4QQEA 1SQ9A 2CE9A 4GM3A 4A2MA 2AH1A 3PSLA 3EI2A 3SXTD 4A0AA 5AMSA 3RFGA 3SN6B 2AGYA 3SVWD 4BL0A 4PBYA 4A11B 2GNQA 4H5IA 4X60B 1OLZA 1JMXB 4H5JA 5EAPA 1TYQC 5FKQA 2YBAA 3J81g 3VGZA 1N6EA 4A11A 4J82A 5GXHA 2IURA 2UZXB 4D6VA 4MK0B 3A0FA 4Y7RA 4Z8LA 2YNPA 5C2VB 4PC0A 1JOFA 3V9FA 2H47A 4CY3A 4U7AA 4JSPC 2CN2A 3CIKB 4OWRA 2P9IC 2OVPB 3CFVA 2J55H 4FHLA 2HYEA 3IKOA 2YB8B 4ZOXA 4JD2C 2AGLA 3I8CA 3MXXA 3PE7A 2XL3A 4AEZA 2H9NA 3JZHA 3RRMC 2AGWA 5FXYA 3UKUC 3EI4B 5I5MA 1MDAH 2P9UC 3GREA 2PM9B 4LG9A 3SJLD 1PBYB 3FM0A 3MKSB 2B5LA 5TDHB 3NVQA 1N6DA 3PVUB 4Y5RD 5IGQA 3L4OD 3SLED 3F3FA 2OJYA 1MG2A 1Q47A 3SMRA 3EI4A 3C5MA 4OZUA 1XIPA 5EAMA 3U4YA 3V7DB 3EI1A 5EM2A 2AH0A 3EG6A 1PGUA 4FA9D 1YFQA 4J79A 3HFQA 1GXRA 3SBRA 1MG3A 4A7JA 5HYNB 4NSXA 2OVQB 2Z2OA 2I0SA 4A2LA 2H6NA 1PEVA 3UR4A 5I5JA 5HQGA 4K3JB 5K19A 5CXBA 2BCJB 2HJBA 3GFCA 4AOWA 4FAND 4GQ2P 5IJ8E 2O9KA 2Z2NA 3OKYA 4JSXC 2HJ4A 2Z2PA 1S4UX 2HESX 2CO0A 1P22A 3I7PA 1GG2B 4EWRA 5CXCB 3EI2B 1GOTB 4ZOZA 4L1QD 4FA5D 3AL8A 4KFMB 4JT6C 4N14A 4XYIA 5GSAA 1A0RB 1JJUB 4L3HD 5CXCA 1U4CA 3B7FA 3SBQA 3PSCB 4L9OA 3DXMC 4IA9A 3N0DA 3P4FA 3RFHA 2QXVA 4A09B 4J0XA 3PXSD 4QRJA 3JRPA 2I3SA 3JAMg 3RLMD 1NR0A 3ZWLB 3BWSA 5EARA 2H3XA 2CE8A 2AGZA 1QNIA 5C9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A09 A;  5FKT A;  5FKR A;  2YNN A;  3F3P A;  4E54 A;  3RN1 D;  4A08 A;  3I7H A;  2HKM A;  4GZ8 A;  5C2W B;  5TEE A;  3I7L A;  4JXM A;  4ERZ A;  3MZK A;  1L0Q A;  3K27 A;  2QC5 A;  4PSW B;  2AGX A;  3AFC A;  3I7K A;  3PXT D;  4QT8 A;  4FA1 D;  2IUP A;  4J8B A;  5H1M A;  5IC7 A;  4E5Z B;  3SCY A;  4UI9 R;  2I0R A;  3DM0 A;  1K8K C;  1VYH C;  1FWX A;  2B5N A;  2H6K A;  3I89 A;  2UZY B;  3PXW D;  3AL9 A;  4E5Z A;  4X63 B;  1N6F A;  4PBZ A;  4ZN4 A;  3K26 A;  3MZL A;  3L4M D;  3MMY A;  2YMU A;  5FKS A;  3F3G A;  2P9N C;  2B5M A;  3CFS B;  3EI1 B;  5CYK B;  3I7N A;  5EM2 B;  2B4E A;  3ULE C;  2TRC B;  3SHF A;  4J8G A;  5B4W A;  3JPX A;  2CN3 A;  2H9P A;  5CYK A;  2H13 A;  4LG8 A;  1RI6 A;  4J77 A;  4BH6 A;  2H9M A;  3DXK C;  5CXB B;  1U2V C;  4GQ1 A;  4CI8 A;  4J86 A;  5EMJ B;  5I5I A;  5FA5 B;  3OKY B;  3UVK A;  4R7A B;  1R5M A;  4U1E I;  2W18 A;  5THA A;  1XKS A;  2J56 H;  3E0C A;  2OVR B;  3J80 g;  5A2Q g;  3MKQ A;  2PM7 B;  3JZN A;  4O9D A;  4ZOV A;  1JMZ B;  3NVX A;  2OK6 A;  3DSM A;  4GGA A;  2P9S C;  3AL8 B;  4IMM A;  5HE3 B;  4X3E A;  2IWK A;  2I0T A;  1ERJ A;  3OL2 B;  2HXC A;  2CNX A;  2H6Q A;  1GP2 B;  4CC9 A;  2J57 G;  4CZV A;  4QL1 A;  2XU7 A;  4GMB A;  5HE1 B;  4G56 B;  3W15 A;  4K3I D;  5KDO B;  3IJ0 A;  3OL2 A;  4PNK B;  5AFU 3;  3RN0 D;  5TF2 A;  2CO0 C;  3RMZ D;  4JSN C;  3UKR C;  5IT9 g;  4CZY A;  5JWZ A;  2XL2 A;  5EML B;  4E54 B;  3I2N A;  4A08 B;  4O45 A;  5FLX g;  4CI1 A;  4O3U B;  3EI3 A;  4ERQ A;  3BG0 A;  3JRO A;  5K1C C;  1PI6 A;  2GC7 A;  3OKT A;  3N0E A;  4D0K A;  3JB9 L;  3SWS D;  3RSE C;  2OIZ A;  3UVN A;  1B9X A;  5GMK n;  4J84 A;  4XEI C;  4BUJ C;  4J81 A;  3SFZ A;  4O1Q D;  4L3G D;  2IAA A;  3V5W B;  2IUQ A;  1SHY B;  2GC4 A;  5IGO A;  4O3T B;  3VH0 A;  5SXM A;  2MTA H;  3IJC A;  4FB1 D;  4ESG A;  5GXI A;  3FGB A;  3EMH A;  5H17 A;  2EBS A;  3EU7 A;  1SQJ A;  4ERY A;  4GGD A;  3IIW A;  4CI3 A;  2H9L A;  4CY5 A;  3JZG A;  3PVW B;  5EMM B;  3I8E A;  4CI2 A;  3OTT A;  4FA4 D;  2PM6 B;  1K32 A;  2G9A A;  4J87 A;  4J78 A;  4X61 B;  3SBP A;  3ORV D;  4A0B B;  5EAL A;  5IJ7 E;  2IUV A;  4J73 A;  2AQ5 A;  3AH8 B;  2G99 A;  4JT5 C;  3UVM A;  4GQB B;  4CY2 A;  4GM8 A;  4J0W A;  2I3T A;  2HKR A;  4A0B A;  4ZOY A;  2H14 A;  3OKW A;  3C9C A;  3C99 A;  4HDJ A;  2XYI A;  2PM9 A;  4YVD A;  2PBI B;  3NVN A;  5AJA A;  1OMW B;  4CZX A;  3OW8 A;  3IIY A;  4LGN A;  3DWL C;  3KRX B;  2Q7Q A;  3UVL A;  3C75 H;  4GM9 A;  4GGC A;  3KRW B;  5HE0 B;  5EMK B;  2YNO A;  1XHM A;  5TEF A;  1TBG A;  3FRX A;  4FAV D;  4JSV C;  2P9L C;  2OK4 A;  1NEX B;  4PSX B;  3ODT A;  5HE2 B;  3I7O A;  4PXW A;  3EI3 B;  1B9Y A;  2IWF A;  3BG1 A;  5H14 A;  4CY1 A;  3IJ1 A;  5FQD A;  3VA6 A;  4TZ4 A;  3UVO A;  4XYH A;  4A0A B;  2BBK H;  4I79 A;  3EWE A;  4ES0 A;  2H68 A;  2P9K C;  4FWW A;  2P9P C;  4QQE A;  1SQ9 A;  2CE9 A;  4GM3 A;  4A2M A;  2AH1 A;  3PSL A;  3EI2 A;  3SXT D;  4A0A A;  5AMS A;  3RFG A;  3SN6 B;  2AGY A;  3SVW D;  4BL0 A;  4PBY A;  4A11 B;  2GNQ A;  4H5I A;  4X60 B;  1OLZ A;  1JMX B;  4H5J A;  5EAP A;  1TYQ C;  5FKQ A;  2YBA A;  3J81 g;  3VGZ A;  1N6E A;  4A11 A;  4J82 A;  5GXH A;  2IUR A;  2UZX B;  4D6V A;  4MK0 B;  3A0F A;  4Y7R A;  4Z8L A;  2YNP A;  5C2V B;  4PC0 A;  1JOF A;  3V9F A;  2H47 A;  4CY3 A;  4U7A A;  4JSP C;  2CN2 A;  3CIK B;  4OWR A;  2P9I C;  2OVP B;  3CFV A;  2J55 H;  4FHL A;  2HYE A;  3IKO A;  2YB8 B;  4ZOX A;  4JD2 C;  2AGL A;  3I8C A;  3MXX A;  3PE7 A;  2XL3 A;  4AEZ A;  2H9N A;  3JZH A;  3RRM C;  2AGW A;  5FXY A;  3UKU C;  3EI4 B;  5I5M A;  1MDA H;  2P9U C;  3GRE A;  2PM9 B;  4LG9 A;  3SJL D;  1PBY B;  3FM0 A;  3MKS B;  2B5L A;  5TDH B;  3NVQ A;  1N6D A;  3PVU B;  4Y5R D;  5IGQ A;  3L4O D;  3SLE D;  3F3F A;  2OJY A;  1MG2 A;  1Q47 A;  3SMR A;  3EI4 A;  3C5M A;  4OZU A;  1XIP A;  5EAM A;  3U4Y A;  3V7D B;  3EI1 A;  5EM2 A;  2AH0 A;  3EG6 A;  1PGU A;  4FA9 D;  1YFQ A;  4J79 A;  3HFQ A;  1GXR A;  3SBR A;  1MG3 A;  4A7J A;  5HYN B;  4NSX A;  2OVQ B;  2Z2O A;  2I0S A;  4A2L A;  2H6N A;  1PEV A;  3UR4 A;  5I5J A;  5HQG A;  4K3J B;  5K19 A;  5CXB A;  2BCJ B;  2HJB A;  3GFC A;  4AOW A;  4FAN D;  4GQ2 P;  5IJ8 E;  2O9K A;  2Z2N A;  3OKY A;  4JSX C;  2HJ4 A;  2Z2P A;  1S4U X;  2HES X;  2CO0 A;  1P22 A;  3I7P A;  1GG2 B;  4EWR A;  5CXC B;  3EI2 B;  1GOT B;  4ZOZ A;  4L1Q D;  4FA5 D;  3AL8 A;  4KFM B;  4JT6 C;  4N14 A;  4XYI A;  5GSA A;  1A0R B;  1JJU B;  4L3H D;  5CXC A;  1U4C A;  3B7F A;  3SBQ A;  3PSC B;  4L9O A;  3DXM C;  4IA9 A;  3N0D A;  3P4F A;  3RFH A;  2QXV A;  4A09 B;  4J0X A;  3PXS D;  4QRJ A;  3JRP A;  2I3S A;  3JAM g;  3RLM D;  1NR0 A;  3ZWL B;  3BWS A;  5EAR A;  2H3X A;  2CE8 A;  2AGZ A;  1QNI A;  5C9Z B; 
#chains in the Genus database with same CATH topology
 4A09 A;  2VDQ A;  5FKT A;  5FKR A;  2YNN A;  3F3P A;  4E54 A;  3RN1 D;  4A08 A;  3I7H A;  2HKM A;  4GZ8 A;  5C2W B;  5TEE A;  2QZP A;  3I7L A;  4JXM A;  4ERZ A;  1QFM A;  1L0Q A;  3MZK A;  3GD1 I;  2QC5 A;  3K27 A;  2AGX A;  3AFC A;  3I7K A;  3PXT D;  4PSW B;  4QT8 A;  4FA1 D;  2IUP A;  4J8B A;  5H1M A;  2HU8 A;  5IC7 A;  2VDL A;  4E5Z B;  4JHP C;  3SCY A;  4Z7Q A;  4UI9 R;  2I0R A;  3DM0 A;  1K8K C;  3K72 A;  1C9L A;  1O6G A;  1VYH C;  1FWX A;  1H2Y A;  2B5N A;  2H6K A;  3I89 A;  2UZY B;  4G1E A;  3PXW D;  3AL9 A;  4E5Z A;  4X63 B;  1N6F A;  4PBZ A;  4ZN4 A;  3K26 A;  4AX4 A;  3MZL A;  3L4M D;  4Z7N A;  3MMY A;  2YMU A;  5FKS A;  3F3G A;  1H2X A;  3IUJ A;  2P9N C;  2B5M A;  3CFS B;  3EI1 B;  5CYK B;  3I7N A;  5EM2 B;  3IJE A;  2B4E A;  3ULE C;  2TRC B;  3SHF A;  3O4G A;  4J8G A;  5B4W A;  3JPX A;  2CN3 A;  2H9P A;  4WK0 A;  5CYK A;  2VDR A;  2H13 A;  4LG8 A;  1RI6 A;  2XDW A;  4RE6 A;  4J77 A;  4BH6 A;  4UM9 A;  3O4H A;  3K71 A;  2H9M A;  3O4I A;  3DXK C;  5CXB B;  3NIG A;  1U2V C;  4GQ1 A;  4CI8 A;  4J86 A;  5EMJ B;  3T3P A;  5I5I A;  5FA5 B;  5M5R A;  5M5U A;  3OKY B;  3UVK A;  4R7A B;  1R5M A;  4U1E I;  2W18 A;  5THA A;  1XKS A;  3ZDX A;  2J56 H;  3E0C A;  2OVR B;  3J80 g;  5A2Q g;  3MKQ A;  2JKX A;  2PM7 B;  3JZN A;  1H2W A;  4O9D A;  4ZOV A;  1JMZ B;  3NVX A;  2OK6 A;  3DSM A;  4GGA A;  2P9S C;  2EIB A;  3AL8 B;  3MUO A;  4IMM A;  5HE3 B;  4X3E A;  2IWK A;  2I0T A;  1ERJ A;  3OL2 B;  2HXC A;  2CNX A;  2H6Q A;  1GP2 B;  4CC9 A;  2J57 G;  4CZV A;  4QL1 A;  2XU7 A;  4GMB A;  4AMY A;  5HE1 B;  4G56 B;  3W15 A;  4K3I D;  3KCI A;  5KDO B;  1GOH A;  3IJ0 A;  3OL2 A;  3QI0 A;  4PNK B;  5AFU 3;  3RN0 D;  5TF2 A;  2CO0 C;  1H2Z A;  4JSN C;  3RMZ D;  3UKR C;  5M5V A;  5E6R A;  5IT9 g;  4CZY A;  5JWZ A;  2XL2 A;  5EML B;  4NBM A;  4E54 B;  3I2N A;  4A08 B;  4DNW A;  4O45 A;  5FLX g;  4CI1 A;  3NID A;  4O3U B;  3EI3 A;  4ERQ A;  3FCS A;  1UOP A;  1VZ3 A;  3BG0 A;  1O6F A;  3JRO A;  1E5T A;  1UTC A;  4QAM A;  1GOF A;  5K1C C;  1PI6 A;  2GC7 A;  3OKT A;  3N0E A;  4D0K A;  3JB9 L;  4O02 A;  3V4P A;  3IVM A;  3SWS D;  1VE6 A;  1A12 A;  2OIZ A;  3RSE C;  3UVN A;  1B9X A;  5M61 A;  5GMK n;  4J84 A;  4XEI C;  4BUJ C;  4J81 A;  3SFZ A;  2VDN A;  4O1Q D;  4L3G D;  4WK2 A;  2IAA A;  4NEN A;  3V5W B;  2IUQ A;  1SHY B;  2GC4 A;  5IGO A;  4O3T B;  3VH0 A;  5C86 A;  5SXM A;  1M1X A;  5M5S A;  2MTA H;  3IJC A;  4NC4 A;  4FB1 D;  3GC3 B;  4ESG A;  5GXI A;  3FGB A;  1JTD B;  3EMH A;  5H17 A;  2EBS A;  1L5G A;  4L1M A;  3EU7 A;  1SQJ A;  4BCD A;  4ERY A;  4GGD A;  3IIW A;  4CI3 A;  2H9L A;  4CY5 A;  3JZG A;  3PVW B;  5EMM B;  1UOQ A;  3I8E A;  4CI2 A;  3OTT A;  4FA4 D;  2PM6 B;  1K32 A;  3OF7 A;  2G9A A;  3O4J A;  4J87 A;  4J78 A;  4X61 B;  2EID A;  3SBP A;  3ORV D;  4A0B B;  5EAL A;  5IJ7 E;  2IUV A;  5FFO A;  4J73 A;  2AQ5 A;  3AH8 B;  4MMZ A;  2G99 A;  3EQ9 A;  4JT5 C;  3UVM A;  4GQB B;  4CY2 A;  4GM8 A;  4J0W A;  4NAA A;  2I3T A;  3ZE1 A;  4Z7O A;  2HKR A;  4A0B A;  4ZOY A;  2H14 A;  4BCC A;  3OKW A;  3C9C A;  3C99 A;  4HDJ A;  2XYI A;  2PM9 A;  4YVD A;  2PBI B;  3NVN A;  5AJA A;  1OMW B;  4CZX A;  3OW8 A;  2HU5 A;  3IIY A;  4LGN A;  4RE5 A;  3VI3 A;  3DWL C;  3KRX B;  2Q7Q A;  3UVL A;  3C75 H;  4GM9 A;  4GGC A;  3KRW B;  5HE0 B;  2VDP A;  5EMK B;  2YNO A;  1XHM A;  3QHY B;  2EIC A;  5TEF A;  1TBG A;  3FRX A;  4FAV D;  3MVD K;  4JSV C;  2P9L C;  2OK4 A;  1NEX B;  2QR5 A;  4PSX B;  3ODT A;  5HE2 B;  3I7O A;  4PXW A;  3EI3 B;  1B9Y A;  2IWF A;  3BG1 A;  4DNU A;  5H14 A;  4CY1 A;  3IJ1 A;  5FQD A;  3VA6 A;  4TZ4 A;  3UVO A;  1I2M B;  4XYH A;  3FCU A;  4A0A B;  2BBK H;  4I79 A;  3EWE A;  4ES0 A;  5FFG A;  2H68 A;  2P9K C;  4FWW A;  2P9P C;  1YR2 A;  4QQE A;  1SQ9 A;  2CE9 A;  4GM3 A;  4A2M A;  2AH1 A;  3PSL A;  3EI2 A;  3SXT D;  1QFS A;  4A0A A;  4O2W A;  5AMS A;  2BKL A;  3RFG A;  3SN6 B;  4BP8 A;  2AGY A;  3SVW D;  1K3I A;  4BL0 A;  4PBY A;  3VI4 A;  4A11 B;  2GNQ A;  4JHN A;  4H5I A;  4X60 B;  1UOO A;  1U8C A;  1OLZ A;  3IUL A;  1JMX B;  4H5J A;  3IUN A;  5EAP A;  1TYQ C;  5FKQ A;  2YBA A;  4DNV A;  3J81 g;  1VE7 A;  2VDO A;  3VGZ A;  1N6E A;  1JV2 A;  2XZG A;  3EQ7 A;  5E6U A;  4A11 A;  4J82 A;  5GXH A;  2IUR A;  2UZX B;  4D6V A;  4MK0 B;  3A0F A;  4Y7R A;  5E6S A;  4Z8L A;  1BPO A;  2YNP A;  5C2V B;  3IUQ A;  4PC0 A;  1JOF A;  3V9F A;  2H47 A;  4CY3 A;  4G1M A;  4U7A A;  4WJK A;  4JSP C;  2CN2 A;  3CIK B;  4OWR A;  2P9I C;  2OVP B;  3CFV A;  2J55 H;  5HDB A;  4AN0 A;  2VDK A;  4FHL A;  5M5T A;  3IKO A;  2HYE A;  2VC2 A;  2YB8 B;  4ZOX A;  4AMZ A;  3NIF A;  4JD2 C;  2VDM A;  2AGL A;  1TYE A;  3MXX A;  2XL3 A;  3I8C A;  3PE7 A;  4AEZ A;  2H9N A;  1GOG A;  3JZH A;  2AGW A;  4WK4 A;  3RRM C;  5FXY A;  4UM8 A;  3UKU C;  3EI4 B;  5I5M A;  1MDA H;  2P9U C;  3GRE A;  2PM9 B;  4LG9 A;  3SJL D;  1PBY B;  4AN1 A;  3FM0 A;  3MKS B;  2B5L A;  5TDH B;  1C9I A;  3NVQ A;  1N6D A;  3PVU B;  4Y5R D;  5IGQ A;  3L4O D;  2VZ3 A;  3SLE D;  3F3F A;  2OJY A;  1MG2 A;  1Q47 A;  3SMR A;  3EI4 A;  3C5M A;  2HU7 A;  4OZU A;  1XIP A;  5EAM A;  5C92 A;  3U4Y A;  3V7D B;  3EI1 A;  5EM2 A;  4BP9 A;  2AH0 A;  3EG6 A;  1PGU A;  4FA9 D;  1YFQ A;  4J79 A;  3V4V A;  3HFQ A;  1GXR A;  3SBR A;  1MG3 A;  4A7J A;  1E8M A;  5HYN B;  4NSX A;  2OVQ B;  2Z2O A;  3ZDY A;  2I0S A;  3K6S A;  4A2L A;  2H6N A;  1PEV A;  3UR4 A;  4MMX A;  3ZE0 A;  5I5J A;  1T2X A;  5HQG A;  3IUR A;  4K3J B;  5K19 A;  5CXB A;  2BCJ B;  2HJB A;  3GFC A;  4AOW A;  4FAN D;  4GQ2 P;  5IJ8 E;  2O9K A;  2Z2N A;  3OKY A;  4JSX C;  1VZ2 A;  1E8N A;  2HJ4 A;  2Z2P A;  1S4U X;  2HES X;  2CO0 A;  1P22 A;  3I7P A;  1GG2 B;  4EWR A;  2VZ1 A;  4G55 A;  5CXC B;  3EI2 B;  1GOT B;  4ZOZ A;  4L1Q D;  4IRZ A;  4FA5 D;  3ZDZ A;  3AL8 A;  4KFM B;  4JT6 C;  4N14 A;  4XYI A;  5GSA A;  1A0R B;  3ZE2 A;  3EQ8 A;  3MUN A;  1JJU B;  3IUM A;  4L3H D;  5CXC A;  4D9S A;  1U4C A;  3B7F A;  2WQ8 A;  4BCB A;  3SBQ A;  3PSC B;  4L9O A;  4MMY A;  3DXM C;  2XE4 A;  4IA9 A;  3N0D A;  3DDU A;  3P4F A;  3RFH A;  2QXV A;  3T3M A;  4A09 B;  2EIE A;  4J0X A;  3PXS D;  4QRJ A;  3JRP A;  2I3S A;  3JAM g;  3RLM D;  1NR0 A;  3ZWL B;  3BWS A;  5EAR A;  2H3X A;  2CE8 A;  2AGZ A;  1QNI A;  5C9Z B; 
#chains in the Genus database with same CATH homology
 4A09 A;  5FKT A;  5FKR A;  2YNN A;  3F3P A;  4E54 A;  3RN1 D;  4A08 A;  3I7H A;  2HKM A;  4GZ8 A;  5C2W B;  5TEE A;  3I7L A;  4JXM A;  4ERZ A;  3MZK A;  1L0Q A;  3K27 A;  2QC5 A;  4PSW B;  2AGX A;  3AFC A;  3I7K A;  3PXT D;  4QT8 A;  4FA1 D;  2IUP A;  4J8B A;  5H1M A;  5IC7 A;  4E5Z B;  3SCY A;  4UI9 R;  2I0R A;  3DM0 A;  1K8K C;  1VYH C;  1FWX A;  2B5N A;  2H6K A;  3I89 A;  2UZY B;  3PXW D;  3AL9 A;  4E5Z A;  4X63 B;  1N6F A;  4PBZ A;  4ZN4 A;  3K26 A;  3MZL A;  3L4M D;  3MMY A;  2YMU A;  5FKS A;  3F3G A;  2P9N C;  2B5M A;  3CFS B;  3EI1 B;  5CYK B;  3I7N A;  5EM2 B;  2B4E A;  3ULE C;  2TRC B;  3SHF A;  4J8G A;  5B4W A;  3JPX A;  2CN3 A;  2H9P A;  5CYK A;  2H13 A;  4LG8 A;  1RI6 A;  4J77 A;  4BH6 A;  2H9M A;  3DXK C;  5CXB B;  1U2V C;  4GQ1 A;  4CI8 A;  4J86 A;  5EMJ B;  5I5I A;  5FA5 B;  3OKY B;  3UVK A;  4R7A B;  1R5M A;  4U1E I;  2W18 A;  5THA A;  1XKS A;  2J56 H;  3E0C A;  2OVR B;  3J80 g;  5A2Q g;  3MKQ A;  2PM7 B;  3JZN A;  4O9D A;  4ZOV A;  1JMZ B;  3NVX A;  2OK6 A;  3DSM A;  4GGA A;  2P9S C;  3AL8 B;  4IMM A;  5HE3 B;  4X3E A;  2IWK A;  2I0T A;  1ERJ A;  3OL2 B;  2HXC A;  2CNX A;  2H6Q A;  1GP2 B;  4CC9 A;  2J57 G;  4CZV A;  4QL1 A;  2XU7 A;  4GMB A;  5HE1 B;  4G56 B;  3W15 A;  4K3I D;  5KDO B;  3IJ0 A;  3OL2 A;  4PNK B;  5AFU 3;  3RN0 D;  5TF2 A;  2CO0 C;  3RMZ D;  4JSN C;  3UKR C;  5IT9 g;  4CZY A;  5JWZ A;  2XL2 A;  5EML B;  4E54 B;  3I2N A;  4A08 B;  4O45 A;  5FLX g;  4CI1 A;  4O3U B;  3EI3 A;  4ERQ A;  3BG0 A;  3JRO A;  5K1C C;  1PI6 A;  2GC7 A;  3OKT A;  3N0E A;  4D0K A;  3JB9 L;  3SWS D;  3RSE C;  2OIZ A;  3UVN A;  1B9X A;  5GMK n;  4J84 A;  4XEI C;  4BUJ C;  4J81 A;  3SFZ A;  4O1Q D;  4L3G D;  2IAA A;  3V5W B;  2IUQ A;  1SHY B;  2GC4 A;  5IGO A;  4O3T B;  3VH0 A;  5SXM A;  2MTA H;  3IJC A;  4FB1 D;  4ESG A;  5GXI A;  3FGB A;  3EMH A;  5H17 A;  2EBS A;  3EU7 A;  1SQJ A;  4ERY A;  4GGD A;  3IIW A;  4CI3 A;  2H9L A;  4CY5 A;  3JZG A;  3PVW B;  5EMM B;  3I8E A;  4CI2 A;  3OTT A;  4FA4 D;  2PM6 B;  1K32 A;  2G9A A;  4J87 A;  4J78 A;  4X61 B;  3SBP A;  3ORV D;  4A0B B;  5EAL A;  5IJ7 E;  2IUV A;  4J73 A;  2AQ5 A;  3AH8 B;  2G99 A;  4JT5 C;  3UVM A;  4GQB B;  4CY2 A;  4GM8 A;  4J0W A;  2I3T A;  2HKR A;  4A0B A;  4ZOY A;  2H14 A;  3OKW A;  3C9C A;  3C99 A;  4HDJ A;  2XYI A;  2PM9 A;  4YVD A;  2PBI B;  3NVN A;  5AJA A;  1OMW B;  4CZX A;  3OW8 A;  3IIY A;  4LGN A;  3DWL C;  3KRX B;  2Q7Q A;  3UVL A;  3C75 H;  4GM9 A;  4GGC A;  3KRW B;  5HE0 B;  5EMK B;  2YNO A;  1XHM A;  5TEF A;  1TBG A;  3FRX A;  4FAV D;  4JSV C;  2P9L C;  2OK4 A;  1NEX B;  4PSX B;  3ODT A;  5HE2 B;  3I7O A;  4PXW A;  3EI3 B;  1B9Y A;  2IWF A;  3BG1 A;  5H14 A;  4CY1 A;  3IJ1 A;  5FQD A;  3VA6 A;  4TZ4 A;  3UVO A;  4XYH A;  4A0A B;  2BBK H;  4I79 A;  3EWE A;  4ES0 A;  2H68 A;  2P9K C;  4FWW A;  2P9P C;  4QQE A;  1SQ9 A;  2CE9 A;  4GM3 A;  4A2M A;  2AH1 A;  3PSL A;  3EI2 A;  3SXT D;  4A0A A;  5AMS A;  3RFG A;  3SN6 B;  2AGY A;  3SVW D;  4BL0 A;  4PBY A;  4A11 B;  2GNQ A;  4H5I A;  4X60 B;  1OLZ A;  1JMX B;  4H5J A;  5EAP A;  1TYQ C;  5FKQ A;  2YBA A;  3J81 g;  3VGZ A;  1N6E A;  4A11 A;  4J82 A;  5GXH A;  2IUR A;  2UZX B;  4D6V A;  4MK0 B;  3A0F A;  4Y7R A;  4Z8L A;  2YNP A;  5C2V B;  4PC0 A;  1JOF A;  3V9F A;  2H47 A;  4CY3 A;  4U7A A;  4JSP C;  2CN2 A;  3CIK B;  4OWR A;  2P9I C;  2OVP B;  3CFV A;  2J55 H;  4FHL A;  2HYE A;  3IKO A;  2YB8 B;  4ZOX A;  4JD2 C;  2AGL A;  3I8C A;  3MXX A;  3PE7 A;  2XL3 A;  4AEZ A;  2H9N A;  3JZH A;  3RRM C;  2AGW A;  5FXY A;  3UKU C;  3EI4 B;  5I5M A;  1MDA H;  2P9U C;  3GRE A;  2PM9 B;  4LG9 A;  3SJL D;  1PBY B;  3FM0 A;  3MKS B;  2B5L A;  5TDH B;  3NVQ A;  1N6D A;  3PVU B;  4Y5R D;  5IGQ A;  3L4O D;  3SLE D;  3F3F A;  2OJY A;  1MG2 A;  1Q47 A;  3SMR A;  3EI4 A;  3C5M A;  4OZU A;  1XIP A;  5EAM A;  3U4Y A;  3V7D B;  3EI1 A;  5EM2 A;  2AH0 A;  3EG6 A;  1PGU A;  4FA9 D;  1YFQ A;  4J79 A;  3HFQ A;  1GXR A;  3SBR A;  1MG3 A;  4A7J A;  5HYN B;  4NSX A;  2OVQ B;  2Z2O A;  2I0S A;  4A2L A;  2H6N A;  1PEV A;  3UR4 A;  5I5J A;  5HQG A;  4K3J B;  5K19 A;  5CXB A;  2BCJ B;  2HJB A;  3GFC A;  4AOW A;  4FAN D;  4GQ2 P;  5IJ8 E;  2O9K A;  2Z2N A;  3OKY A;  4JSX C;  2HJ4 A;  2Z2P A;  1S4U X;  2HES X;  2CO0 A;  1P22 A;  3I7P A;  1GG2 B;  4EWR A;  5CXC B;  3EI2 B;  1GOT B;  4ZOZ A;  4L1Q D;  4FA5 D;  3AL8 A;  4KFM B;  4JT6 C;  4N14 A;  4XYI A;  5GSA A;  1A0R B;  1JJU B;  4L3H D;  5CXC A;  1U4C A;  3B7F A;  3SBQ A;  3PSC B;  4L9O A;  3DXM C;  4IA9 A;  3N0D A;  3P4F A;  3RFH A;  2QXV A;  4A09 B;  4J0X A;  3PXS D;  4QRJ A;  3JRP A;  2I3S A;  3JAM g;  3RLM D;  1NR0 A;  3ZWL B;  3BWS A;  5EAR A;  2H3X A;  2CE8 A;  2AGZ A;  1QNI A;  5C9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...