4L3HD

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4l3hD00
3JAMg 5H14A 5CXBA 5EMLB 4O45A 1PBYB 2CNXA 3NVNA 4ESGA 5JWZA 2PM7B 4H5IA 3U4YA 2XYIA 5EM2B 3SJLD 3N0EA 4GQBB 5AFU3 4ZOXA 4U7AA 3SHFA 4K3JB 1GP2B 2HKMA 5AJAA 3UVKA 4BUJC 5H17A 3DXKC 4ERQA 4PBYA 4J82A 5HE0B 4A08B 4GGAA 2P9KC 3SWSD 1NEXB 1MG2A 1U2VC 1JJUB 3IKOA 2I0RA 2H9MA 4ES0A 4XEIC 4GGCA 3EI1A 3SMRA 2Z2PA 3BG0A 2CO0A 4GGDA 4FB1D 5C2VB 5FKSA 2H9PA 5EM2A 4GM9A 5FKQA 5B4WA 2AGLA 3I7OA 2AGXA 5FKRA 5EALA 2AGZA 2G9AA 3UKRC 2H14A 1RI6A 1JMXB 1OMWB 3RN1D 2H6QA 4Z8LA 4L1QD 3PXTD 4O1QD 4E5ZB 3I7LA 4A08A 1Q47A 3RFHA 2Z2NA 3JZHA 5EMJB 3JRPA 2AH0A 4D0KA 1PEVA 2HJBA 2EBSA 3PSCB 2P9PC 2CE8A 3IJCA 4JSNC 3K27A 4J77A 2PM6B 4FA4D 2YNNA 3SBQA 1N6DA 2YNOA 4PC0A 4CY1A 4GM8A 2PM9A 3MZKA 5IJ8E 4CY2A 3V5WB 2J56H 1SQ9A 4E5ZA 3MKSB 4X60B 1TBGA 5HE3B 4N14A 4D6VA 4J8GA 5IT9g 4ERZA 2YBAA 5TF2A 3JZNA 2H13A 2CE9A 4ERYA 3SN6B 4JT5C 4JSPC 2W18A 4A0BB 1K32A 3SBRA 2YB8B 2H6KA 3OKYA 4LG9A 3GREA 3PSLA 2QXVA 2H6NA 4PSXB 4JSXC 2H9LA 3FGBA 4GMBA 5EMMB 3DWLC 5IGOA 2CN3A 4JT6C 3E0CA 3SCYA 3UR4A 2UZYB 3MKQA 2HXCA 3OL2A 3IIYA 3KRXB 5TEEA 2QC5A 5IGQA 2P9LC 2G99A 1N6FA 4A0BA 3PXSD 4PNKB 2Q7QA 4J78A 1B9YA 3PXWD 3RFGA 3L4OD 3NVXA 5C9ZB 1R5MA 2P9NC 3MMYA 1N6EA 3AH8B 5THAA 4J81A 3UVNA 2P9UC 3VGZA 4EWRA 3I7PA 4JD2C 1U4CA 2XU7A 1B9XA 1VYHC 3I7NA 4A2LA 2HJ4A 2J57G 3DSMA 1PI6A 3F3FA 4R7AB 3F3GA 3I8EA 2IURA 3JPXA 4AOWA 1MG3A 2YMUA 4J79A 4J87A 1S4UX 3JZGA 3C75H 4A11B 1P22A 4XYIA 5I5MA 4A09B 2PBIB 3VA6A 1SHYB 4GQ2P 3IIWA 5FXYA 2H68A 2CN2A 3SBPA 5K19A 3A0FA 3OKWA 4CZVA 5A2Qg 4GM3A 4A7JA 5FQDA 4ZOVA 4FA5D 2OJYA 3N0DA 4U1EI 1MDAH 3RSEC 3C5MA 4IA9A 3SLED 4A11A 2BBKH 4J84A 4OZUA 3EWEA 5HQGA 4PSWB 3BWSA 1XHMA 3J80g 1ERJA 3IJ0A 2AGWA 5GMKn 3GFCA 4J8BA 3EI3B 3RLMD 1JMZB 2O9KA 2B4EA 4J73A 1OLZA 2B5MA 3EI4B 4CZYA 3ODTA 4A2MA 1XIPA 2IUVA 4KFMB 2YNPA 2I3SA 4O9DA 5H1MA 1A0RB 5TEFA 3PE7A 3EMHA 3J81g 5HE2B 2B5NA 4Y5RD 4AEZA 4CI2A 2I3TA 3I7HA 1XKSA 3CFSB 2P9IC 3B7FA 3EI3A 3OW8A 4FHLA 4CI3A 4LG8A 5CXCB 5AMSA 3UVMA 2H3XA 5HE1B 5FKTA 5CYKB 3EI4A 3VH0A 4GQ1A 2AQ5A 3L4MD 3I7KA 1L0QA 3OKTA 4QQEA 4HDJA 2GNQA 5GXIA 4JSVC 3C99A 2IUQA 3CIKB 3I8CA 4E54B 2H47A 1NR0A 4X61B 4FAND 3AL9A 2IWFA 3DM0A 3P4FA 3RMZD 3EI1B 5CXCA 3MXXA 3V9FA 3EI2B 4OWRA 3FRXA 4G56B 2AH1A 2AGYA 5CYKA 2I0SA 4ZN4A 4JXMA 3SXTD 5GSAA 4YVDA 3AFCA 4NSXA 4O3TB 5C2WB 2IUPA 1YFQA 2GC7A 3ULEC 4I79A 2CO0C 5I5JA 3ORVD 3PVUB 3SFZA 4L3GD 4E54A 5IJ7E 1GOTB 3UVLA 2BCJB 5SXMA 2I0TA 3EI2A 2OK6A 4CI1A 1QNIA 4PXWA 2OIZA 5GXHA 3K26A 3NVQA 4J86A 2MTAH 4IMMA 3OTTA 3HFQA 4BL0A 3BG1A 4X3EA 2UZXB 2PM9B 1GXRA 1TYQC 3MZLA 4PBZA 4FAVD 4QT8A 4TZ4A 5TDHB 3JB9L 3AL8B 4QRJA 2P9SC 1K8KC 4A09A 2OVQB 5EAMA 4ZOZA 3I89A 3CFVA 5I5IA 3UKUC 3EU7A 2TRCB 4L9OA 4MK0B 5EMKB 4FWWA 4FA1D 2HYEA 3FM0A 2Z2OA 4J0WA 1PGUA 2OVRB 4QL1A 5KDOB 3UVOA 1SQJA 3OKYB 1GG2B 4CC9A 3DXMC 4LGNA 2GC4A 3F3PA 4XYHA 4CY3A 4A0AB 3AL8A 4K3ID 3RN0D 2OK4A 5EARA 4GZ8A 4L3HD 2XL3A 3KRWB 2H9NA 2HKRA 2IWKA 3OL2B 2B5LA 3IJ1A 2J55H 4BH6A 4CY5A 3C9CA 5CXBB 3W15A 4ZOYA 4J0XA 2HESX 5FLXg 2OVPB 4FA9D 5EAPA 4CZXA 3SVWD 3PVWB 2IAAA 3EG6A 4O3UB 3V7DB 4CI8A 4UI9R 4A0AA 3RRMC 4X63B 1FWXA 3JROA 5FA5B 3I2NA 2XL2A 5HYNB 5IC7A 5K1CC 4H5JA 4Y7RA 3ZWLB 1JOFA
chains in the Genus database with same CATH superfamily
3JAMg 3EQ9A 5H14A 1YR2A 5CXBA 5EMLB 4O45A 1PBYB 4BCDA 2CNXA 3NIDA 3NVNA 4ESGA 5JWZA 2PM7B 4H5IA 3U4YA 2XYIA 5EM2B 3SJLD 3N0EA 1E5TA 1GOFA 4GQBB 5AFU3 4ZOXA 4U7AA 3SHFA 3OF7A 4K3JB 1E8MA 1GP2B 2HKMA 5AJAA 3UVKA 3MUNA 4Z7NA 4BUJC 5H17A 2QR5A 3DXKC 4ERQA 4PBYA 1JV2A 4J82A 5HE0B 4A08B 4GGAA 2P9KC 5C86A 3SWSD 1NEXB 1MG2A 1U2VC 1JJUB 3IKOA 2I0RA 2H9MA 4ES0A 4XEIC 4GGCA 3EI1A 3SMRA 2Z2PA 3BG0A 2CO0A 4GGDA 4FB1D 5C2VB 5FKSA 2H9PA 5EM2A 4GM9A 5FKQA 5B4WA 2AGLA 3I7OA 2AGXA 5FKRA 5EALA 3DDUA 3IUMA 2AGZA 4BCBA 2G9AA 3UKRC 2H14A 1RI6A 1JMXB 4DNVA 1OMWB 3RN1D 2H6QA 4Z8LA 1I2MB 4L1QD 3PXTD 4O1QD 4E5ZB 4AX4A 3I7LA 4A08A 1Q47A 3RFHA 2Z2NA 3JZHA 1O6FA 5EMJB 3JRPA 5M5SA 2AH0A 4D0KA 1PEVA 4BCCA 2HJBA 2EBSA 5FFOA 3PSCB 1JTDB 1UOPA 3IJCA 2P9PC 3IUJA 2CE8A 3K27A 4J77A 4JSNC 3QI0A 2PM6B 4FA4D 2YNNA 3SBQA 1N6DA 2YNOA 4PC0A 4CY1A 2HU5A 1K3IA 4GM8A 1L5GA 2PM9A 3MZKA 5IJ8E 4CY2A 3V5WB 2J56H 1SQ9A 4E5ZA 3MKSB 3ZE2A 4X60B 1TBGA 5HE3B 4N14A 4D6VA 4J8GA 5IT9g 4ERZA 4WK4A 2YBAA 5TF2A 3JZNA 2H13A 2CE9A 3ZDYA 1H2YA 4ERYA 3SN6B 4JT5C 4JSPC 2W18A 4A0BB 1K32A 3SBRA 1A12A 2YB8B 2H6KA 3OKYA 4LG9A 3GREA 3PSLA 4O2WA 2QXVA 1UOOA 2H6NA 4PSXB 4JSXC 5E6SA 4AMYA 2H9LA 3FGBA 4GMBA 4AMZA 5EMMB 3DWLC 5IGOA 2CN3A 4JT6C 1GOHA 3E0CA 3SCYA 3UR4A 2UZYB 3MKQA 2HXCA 3OL2A 3IIYA 3KRXB 5TEEA 2QC5A 5IGQA 2P9LC 2G99A 1N6FA 2QZPA 4A0BA 3PXSD 4PNKB 2Q7QA 4J78A 1B9YA 3PXWD 3RFGA 3T3MA 3L4OD 3NVXA 5C9ZB 1R5MA 2P9NC 3MMYA 1N6EA 3VI4A 3AH8B 5THAA 4MMXA 4O02A 4J81A 3IULA 2VZ1A 3UVNA 2P9UC 3VGZA 2VC2A 4EWRA 3I7PA 4JD2C 1H2WA 4NBMA 1VZ2A 1H2ZA 1U4CA 2XU7A 1B9XA 1VYHC 3I7NA 4A2LA 2HJ4A 5M5RA 2J57G 3DSMA 1PI6A 3F3FA 4R7AB 3F3GA 2XE4A 3I8EA 2IURA 3JPXA 4AOWA 1MG3A 2YMUA 1QFSA 4J79A 4J87A 1S4UX 3JZGA 3C75H 4A11B 1P22A 4XYIA 5I5MA 4A09B 2PBIB 4JHPC 3IUNA 3VA6A 1SHYB 4GQ2P 3IIWA 3ZDXA 5FXYA 2H68A 2CN2A 3SBPA 5K19A 3A0FA 3OKWA 2WQ8A 4CZVA 5A2Qg 4MMZA 4GM3A 4QAMA 4A7JA 2VDLA 5FQDA 4ZOVA 4FA5D 2OJYA 3N0DA 4U1EI 1MDAH 3ZE0A 3FCSA 3RSEC 4MMYA 3C5MA 4IA9A 3SLED 4A11A 2BBKH 4J84A 4OZUA 3EWEA 5HQGA 4PSWB 3BWSA 1XHMA 5M5TA 3J80g 3EQ8A 1ERJA 3IJ0A 2AGWA 2EIDA 4L1MA 5GMKn 3GFCA 4J8BA 3IJEA 3EI3B 4AN0A 2VDQA 5M61A 3RLMD 1JMZB 2O9KA 2B4EA 4J73A 1OLZA 2B5MA 4D9SA 4NC4A 4NAAA 1QFMA 3EI4B 4CZYA 5E6UA 4DNWA 3ODTA 3O4GA 4A2MA 1XIPA 2IUVA 4G55A 4KFMB 3NIFA 2YNPA 3ZE1A 2I3SA 4O9DA 3V4VA 5H1MA 1A0RB 5TEFA 3PE7A 3EMHA 3GD1I 2HU8A 3J81g 5HE2B 3NIGA 3O4JA 2B5NA 4Y5RD 4AEZA 4CI2A 1E8NA 2I3TA 3I7HA 1XKSA 3CFSB 2P9IC 3B7FA 3EI3A 3OW8A 4FHLA 4CI3A 4LG8A 5CXCB 5AMSA 3UVMA 1C9LA 2H3XA 5HE1B 5FKTA 3O4IA 1UOQA 5CYKB 3EI4A 3VH0A 4GQ1A 2AQ5A 3L4MD 3I7KA 1L0QA 2VZ3A 3OKTA 4QQEA 4HDJA 2GNQA 5GXIA 4JSVC 3C99A 2IUQA 2XDWA 3CIKB 2VDMA 3I8CA 4E54B 2H47A 2VDKA 1NR0A 4X61B 4FAND 3AL9A 2IWFA 3DM0A 3P4FA 3RMZD 4IRZA 4Z7OA 3EI1B 5CXCA 3FCUA 3MXXA 1O6GA 1M1XA 3V9FA 3EI2B 4OWRA 5C92A 3FRXA 4G56B 5M5UA 2AH1A 4WK0A 2AGYA 1GOGA 2I0SA 4NENA 4JXMA 5CYKA 3SXTD 4ZN4A 5GSAA 4YVDA 3T3PA 3AFCA 4NSXA 4O3TB 5C2WB 2IUPA 1YFQA 2GC7A 2EIBA 1BPOA 4WJKA 3ULEC 4I79A 2CO0C 4G1EA 5I5JA 3ORVD 3PVUB 2VDRA 4BP9A 3SFZA 4L3GD 2VDOA 4E54A 4RE6A 1GOTB 3UVLA 5IJ7E 2BCJB 3V4PA 5SXMA 2I0TA 3EI2A 2OK6A 1VE6A 4CI1A 4BP8A 1QNIA 4PXWA 2OIZA 2HU7A 5GXHA 3K26A 3NVQA 4J86A 2MTAH 4IMMA 3OTTA 3HFQA 4BL0A 3K72A 3BG1A 4X3EA 2UZXB 2PM9B 1GXRA 1TYQC 3MZLA 4PBZA 4FAVD 4JHNA 4QT8A 4TZ4A 1U8CA 5TDHB 3JB9L 3AL8B 4QRJA 4WK2A 2P9SC 1K8KC 4A09A 3IVMA 2OVQB 5EAMA 3IURA 2VDNA 4ZOZA 3EQ7A 3KCIA 2VDPA 3MUOA 3QHYB 3I89A 3CFVA 3IUQA 4UM9A 4G1MA 1T2XA 5I5IA 3UKUC 3EU7A 2TRCB 3GC3B 1UTCA 4L9OA 4MK0B 5EMKB 5FFGA 4FWWA 3VI3A 4FA1D 2HYEA 3FM0A 2Z2OA 4J0WA 3K71A 1PGUA 2OVRB 4QL1A 5M5VA 4UM8A 5KDOB 3UVOA 1SQJA 3OKYB 1GG2B 1C9IA 3DXMC 4LGNA 2GC4A 4CC9A 3F3PA 4XYHA 4CY3A 4A0AB 3AL8A 4K3ID 3RN0D 2OK4A 5EARA 1VE7A 2BKLA 4GZ8A 4L3HD 4DNUA 3MVDK 2XL3A 3KRWB 2H9NA 4AN1A 1H2XA 2XZGA 2HKRA 2IWKA 2JKXA 3OL2B 2B5LA 1TYEA 2EICA 2J55H 3IJ1A 4BH6A 4RE5A 4CY5A 3C9CA 5CXBB 3W15A 3K6SA 4ZOYA 4J0XA 2HESX 5HDBA 5FLXg 2OVPB 4FA9D 5EAPA 4CZXA 3SVWD 3PVWB 2IAAA 3EG6A 4O3UB 3V7DB 4CI8A 4UI9R 3O4HA 4A0AA 3RRMC 1VZ3A 4X63B 5E6RA 1FWXA 3JROA 5FA5B 3I2NA 2XL2A 5HYNB 4Z7QA 5IC7A 5K1CC 4H5JA 4Y7RA 3ZWLB 1JOFA 2EIEA 3ZDZA
chains in the Genus database with same CATH topology
3JAMg 5H14A 5CXBA 5EMLB 4O45A 1PBYB 2CNXA 3NVNA 4ESGA 5JWZA 2PM7B 4H5IA 3U4YA 2XYIA 5EM2B 3SJLD 3N0EA 4GQBB 5AFU3 4ZOXA 4U7AA 3SHFA 4K3JB 1GP2B 2HKMA 5AJAA 3UVKA 4BUJC 5H17A 3DXKC 4ERQA 4PBYA 4J82A 5HE0B 4A08B 4GGAA 2P9KC 3SWSD 1NEXB 1MG2A 1U2VC 1JJUB 3IKOA 2I0RA 2H9MA 4ES0A 4XEIC 4GGCA 3EI1A 3SMRA 2Z2PA 3BG0A 2CO0A 4GGDA 4FB1D 5C2VB 5FKSA 2H9PA 5EM2A 4GM9A 5FKQA 5B4WA 2AGLA 3I7OA 2AGXA 5FKRA 5EALA 2AGZA 2G9AA 3UKRC 2H14A 1RI6A 1JMXB 1OMWB 3RN1D 2H6QA 4Z8LA 4L1QD 3PXTD 4O1QD 4E5ZB 3I7LA 4A08A 1Q47A 3RFHA 2Z2NA 3JZHA 5EMJB 3JRPA 2AH0A 4D0KA 1PEVA 2HJBA 2EBSA 3PSCB 2P9PC 2CE8A 3IJCA 4JSNC 3K27A 4J77A 2PM6B 4FA4D 2YNNA 3SBQA 1N6DA 2YNOA 4PC0A 4CY1A 4GM8A 2PM9A 3MZKA 5IJ8E 4CY2A 3V5WB 2J56H 1SQ9A 4E5ZA 3MKSB 4X60B 1TBGA 5HE3B 4N14A 4D6VA 4J8GA 5IT9g 4ERZA 2YBAA 5TF2A 3JZNA 2H13A 2CE9A 4ERYA 3SN6B 4JT5C 4JSPC 2W18A 4A0BB 1K32A 3SBRA 2YB8B 2H6KA 3OKYA 4LG9A 3GREA 3PSLA 2QXVA 2H6NA 4PSXB 4JSXC 2H9LA 3FGBA 4GMBA 5EMMB 3DWLC 5IGOA 2CN3A 4JT6C 3E0CA 3SCYA 3UR4A 2UZYB 3MKQA 2HXCA 3OL2A 3IIYA 3KRXB 5TEEA 2QC5A 5IGQA 2P9LC 2G99A 1N6FA 4A0BA 3PXSD 4PNKB 2Q7QA 4J78A 1B9YA 3PXWD 3RFGA 3L4OD 3NVXA 5C9ZB 1R5MA 2P9NC 3MMYA 1N6EA 3AH8B 5THAA 4J81A 3UVNA 2P9UC 3VGZA 4EWRA 3I7PA 4JD2C 1U4CA 2XU7A 1B9XA 1VYHC 3I7NA 4A2LA 2HJ4A 2J57G 3DSMA 1PI6A 3F3FA 4R7AB 3F3GA 3I8EA 2IURA 3JPXA 4AOWA 1MG3A 2YMUA 4J79A 4J87A 1S4UX 3JZGA 3C75H 4A11B 1P22A 4XYIA 5I5MA 4A09B 2PBIB 3VA6A 1SHYB 4GQ2P 3IIWA 5FXYA 2H68A 2CN2A 3SBPA 5K19A 3A0FA 3OKWA 4CZVA 5A2Qg 4GM3A 4A7JA 5FQDA 4ZOVA 4FA5D 2OJYA 3N0DA 4U1EI 1MDAH 3RSEC 3C5MA 4IA9A 3SLED 4A11A 2BBKH 4J84A 4OZUA 3EWEA 5HQGA 4PSWB 3BWSA 1XHMA 3J80g 1ERJA 3IJ0A 2AGWA 5GMKn 3GFCA 4J8BA 3EI3B 3RLMD 1JMZB 2O9KA 2B4EA 4J73A 1OLZA 2B5MA 3EI4B 4CZYA 3ODTA 4A2MA 1XIPA 2IUVA 4KFMB 2YNPA 2I3SA 4O9DA 5H1MA 1A0RB 5TEFA 3PE7A 3EMHA 3J81g 5HE2B 2B5NA 4Y5RD 4AEZA 4CI2A 2I3TA 3I7HA 1XKSA 3CFSB 2P9IC 3B7FA 3EI3A 3OW8A 4FHLA 4CI3A 4LG8A 5CXCB 5AMSA 3UVMA 2H3XA 5HE1B 5FKTA 5CYKB 3EI4A 3VH0A 4GQ1A 2AQ5A 3L4MD 3I7KA 1L0QA 3OKTA 4QQEA 4HDJA 2GNQA 5GXIA 4JSVC 3C99A 2IUQA 3CIKB 3I8CA 4E54B 2H47A 1NR0A 4X61B 4FAND 3AL9A 2IWFA 3DM0A 3P4FA 3RMZD 3EI1B 5CXCA 3MXXA 3V9FA 3EI2B 4OWRA 3FRXA 4G56B 2AH1A 2AGYA 5CYKA 2I0SA 4ZN4A 4JXMA 3SXTD 5GSAA 4YVDA 3AFCA 4NSXA 4O3TB 5C2WB 2IUPA 1YFQA 2GC7A 3ULEC 4I79A 2CO0C 5I5JA 3ORVD 3PVUB 3SFZA 4L3GD 4E54A 5IJ7E 1GOTB 3UVLA 2BCJB 5SXMA 2I0TA 3EI2A 2OK6A 4CI1A 1QNIA 4PXWA 2OIZA 5GXHA 3K26A 3NVQA 4J86A 2MTAH 4IMMA 3OTTA 3HFQA 4BL0A 3BG1A 4X3EA 2UZXB 2PM9B 1GXRA 1TYQC 3MZLA 4PBZA 4FAVD 4QT8A 4TZ4A 5TDHB 3JB9L 3AL8B 4QRJA 2P9SC 1K8KC 4A09A 2OVQB 5EAMA 4ZOZA 3I89A 3CFVA 5I5IA 3UKUC 3EU7A 2TRCB 4L9OA 4MK0B 5EMKB 4FWWA 4FA1D 2HYEA 3FM0A 2Z2OA 4J0WA 1PGUA 2OVRB 4QL1A 5KDOB 3UVOA 1SQJA 3OKYB 1GG2B 4CC9A 3DXMC 4LGNA 2GC4A 3F3PA 4XYHA 4CY3A 4A0AB 3AL8A 4K3ID 3RN0D 2OK4A 5EARA 4GZ8A 4L3HD 2XL3A 3KRWB 2H9NA 2HKRA 2IWKA 3OL2B 2B5LA 3IJ1A 2J55H 4BH6A 4CY5A 3C9CA 5CXBB 3W15A 4ZOYA 4J0XA 2HESX 5FLXg 2OVPB 4FA9D 5EAPA 4CZXA 3SVWD 3PVWB 2IAAA 3EG6A 4O3UB 3V7DB 4CI8A 4UI9R 4A0AA 3RRMC 4X63B 1FWXA 3JROA 5FA5B 3I2NA 2XL2A 5HYNB 5IC7A 5K1CC 4H5JA 4Y7RA 3ZWLB 1JOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM g;  5H14 A;  5CXB A;  5EML B;  4O45 A;  1PBY B;  2CNX A;  3NVN A;  4ESG A;  5JWZ A;  2PM7 B;  4H5I A;  3U4Y A;  2XYI A;  5EM2 B;  3SJL D;  3N0E A;  4GQB B;  5AFU 3;  4ZOX A;  4U7A A;  3SHF A;  4K3J B;  1GP2 B;  2HKM A;  5AJA A;  3UVK A;  4BUJ C;  5H17 A;  3DXK C;  4ERQ A;  4PBY A;  4J82 A;  5HE0 B;  4A08 B;  4GGA A;  2P9K C;  3SWS D;  1NEX B;  1MG2 A;  1U2V C;  1JJU B;  3IKO A;  2I0R A;  2H9M A;  4ES0 A;  4XEI C;  4GGC A;  3EI1 A;  3SMR A;  2Z2P A;  3BG0 A;  2CO0 A;  4GGD A;  4FB1 D;  5C2V B;  5FKS A;  2H9P A;  5EM2 A;  4GM9 A;  5FKQ A;  5B4W A;  2AGL A;  3I7O A;  2AGX A;  5FKR A;  5EAL A;  2AGZ A;  2G9A A;  3UKR C;  2H14 A;  1RI6 A;  1JMX B;  1OMW B;  3RN1 D;  2H6Q A;  4Z8L A;  4L1Q D;  3PXT D;  4O1Q D;  4E5Z B;  3I7L A;  4A08 A;  1Q47 A;  3RFH A;  2Z2N A;  3JZH A;  5EMJ B;  3JRP A;  2AH0 A;  4D0K A;  1PEV A;  2HJB A;  2EBS A;  3PSC B;  2P9P C;  2CE8 A;  3IJC A;  4JSN C;  3K27 A;  4J77 A;  2PM6 B;  4FA4 D;  2YNN A;  3SBQ A;  1N6D A;  2YNO A;  4PC0 A;  4CY1 A;  4GM8 A;  2PM9 A;  3MZK A;  5IJ8 E;  4CY2 A;  3V5W B;  2J56 H;  1SQ9 A;  4E5Z A;  3MKS B;  4X60 B;  1TBG A;  5HE3 B;  4N14 A;  4D6V A;  4J8G A;  5IT9 g;  4ERZ A;  2YBA A;  5TF2 A;  3JZN A;  2H13 A;  2CE9 A;  4ERY A;  3SN6 B;  4JT5 C;  4JSP C;  2W18 A;  4A0B B;  1K32 A;  3SBR A;  2YB8 B;  2H6K A;  3OKY A;  4LG9 A;  3GRE A;  3PSL A;  2QXV A;  2H6N A;  4PSX B;  4JSX C;  2H9L A;  3FGB A;  4GMB A;  5EMM B;  3DWL C;  5IGO A;  2CN3 A;  4JT6 C;  3E0C A;  3SCY A;  3UR4 A;  2UZY B;  3MKQ A;  2HXC A;  3OL2 A;  3IIY A;  3KRX B;  5TEE A;  2QC5 A;  5IGQ A;  2P9L C;  2G99 A;  1N6F A;  4A0B A;  3PXS D;  4PNK B;  2Q7Q A;  4J78 A;  1B9Y A;  3PXW D;  3RFG A;  3L4O D;  3NVX A;  5C9Z B;  1R5M A;  2P9N C;  3MMY A;  1N6E A;  3AH8 B;  5THA A;  4J81 A;  3UVN A;  2P9U C;  3VGZ A;  4EWR A;  3I7P A;  4JD2 C;  1U4C A;  2XU7 A;  1B9X A;  1VYH C;  3I7N A;  4A2L A;  2HJ4 A;  2J57 G;  3DSM A;  1PI6 A;  3F3F A;  4R7A B;  3F3G A;  3I8E A;  2IUR A;  3JPX A;  4AOW A;  1MG3 A;  2YMU A;  4J79 A;  4J87 A;  1S4U X;  3JZG A;  3C75 H;  4A11 B;  1P22 A;  4XYI A;  5I5M A;  4A09 B;  2PBI B;  3VA6 A;  1SHY B;  4GQ2 P;  3IIW A;  5FXY A;  2H68 A;  2CN2 A;  3SBP A;  5K19 A;  3A0F A;  3OKW A;  4CZV A;  5A2Q g;  4GM3 A;  4A7J A;  5FQD A;  4ZOV A;  4FA5 D;  2OJY A;  3N0D A;  4U1E I;  1MDA H;  3RSE C;  3C5M A;  4IA9 A;  3SLE D;  4A11 A;  2BBK H;  4J84 A;  4OZU A;  3EWE A;  5HQG A;  4PSW B;  3BWS A;  1XHM A;  3J80 g;  1ERJ A;  3IJ0 A;  2AGW A;  5GMK n;  3GFC A;  4J8B A;  3EI3 B;  3RLM D;  1JMZ B;  2O9K A;  2B4E A;  4J73 A;  1OLZ A;  2B5M A;  3EI4 B;  4CZY A;  3ODT A;  4A2M A;  1XIP A;  2IUV A;  4KFM B;  2YNP A;  2I3S A;  4O9D A;  5H1M A;  1A0R B;  5TEF A;  3PE7 A;  3EMH A;  3J81 g;  5HE2 B;  2B5N A;  4Y5R D;  4AEZ A;  4CI2 A;  2I3T A;  3I7H A;  1XKS A;  3CFS B;  2P9I C;  3B7F A;  3EI3 A;  3OW8 A;  4FHL A;  4CI3 A;  4LG8 A;  5CXC B;  5AMS A;  3UVM A;  2H3X A;  5HE1 B;  5FKT A;  5CYK B;  3EI4 A;  3VH0 A;  4GQ1 A;  2AQ5 A;  3L4M D;  3I7K A;  1L0Q A;  3OKT A;  4QQE A;  4HDJ A;  2GNQ A;  5GXI A;  4JSV C;  3C99 A;  2IUQ A;  3CIK B;  3I8C A;  4E54 B;  2H47 A;  1NR0 A;  4X61 B;  4FAN D;  3AL9 A;  2IWF A;  3DM0 A;  3P4F A;  3RMZ D;  3EI1 B;  5CXC A;  3MXX A;  3V9F A;  3EI2 B;  4OWR A;  3FRX A;  4G56 B;  2AH1 A;  2AGY A;  5CYK A;  2I0S A;  4ZN4 A;  4JXM A;  3SXT D;  5GSA A;  4YVD A;  3AFC A;  4NSX A;  4O3T B;  5C2W B;  2IUP A;  1YFQ A;  2GC7 A;  3ULE C;  4I79 A;  2CO0 C;  5I5J A;  3ORV D;  3PVU B;  3SFZ A;  4L3G D;  4E54 A;  5IJ7 E;  1GOT B;  3UVL A;  2BCJ B;  5SXM A;  2I0T A;  3EI2 A;  2OK6 A;  4CI1 A;  1QNI A;  4PXW A;  2OIZ A;  5GXH A;  3K26 A;  3NVQ A;  4J86 A;  2MTA H;  4IMM A;  3OTT A;  3HFQ A;  4BL0 A;  3BG1 A;  4X3E A;  2UZX B;  2PM9 B;  1GXR A;  1TYQ C;  3MZL A;  4PBZ A;  4FAV D;  4QT8 A;  4TZ4 A;  5TDH B;  3JB9 L;  3AL8 B;  4QRJ A;  2P9S C;  1K8K C;  4A09 A;  2OVQ B;  5EAM A;  4ZOZ A;  3I89 A;  3CFV A;  5I5I A;  3UKU C;  3EU7 A;  2TRC B;  4L9O A;  4MK0 B;  5EMK B;  4FWW A;  4FA1 D;  2HYE A;  3FM0 A;  2Z2O A;  4J0W A;  1PGU A;  2OVR B;  4QL1 A;  5KDO B;  3UVO A;  1SQJ A;  3OKY B;  1GG2 B;  4CC9 A;  3DXM C;  4LGN A;  2GC4 A;  3F3P A;  4XYH A;  4CY3 A;  4A0A B;  3AL8 A;  4K3I D;  3RN0 D;  2OK4 A;  5EAR A;  4GZ8 A;  4L3H D;  2XL3 A;  3KRW B;  2H9N A;  2HKR A;  2IWK A;  3OL2 B;  2B5L A;  3IJ1 A;  2J55 H;  4BH6 A;  4CY5 A;  3C9C A;  5CXB B;  3W15 A;  4ZOY A;  4J0X A;  2HES X;  5FLX g;  2OVP B;  4FA9 D;  5EAP A;  4CZX A;  3SVW D;  3PVW B;  2IAA A;  3EG6 A;  4O3U B;  3V7D B;  4CI8 A;  4UI9 R;  4A0A A;  3RRM C;  4X63 B;  1FWX A;  3JRO A;  5FA5 B;  3I2N A;  2XL2 A;  5HYN B;  5IC7 A;  5K1C C;  4H5J A;  4Y7R A;  3ZWL B;  1JOF A; 
#chains in the Genus database with same CATH topology
 3JAM g;  3EQ9 A;  5H14 A;  1YR2 A;  5CXB A;  5EML B;  4O45 A;  1PBY B;  4BCD A;  2CNX A;  3NID A;  3NVN A;  4ESG A;  5JWZ A;  2PM7 B;  4H5I A;  3U4Y A;  2XYI A;  5EM2 B;  3SJL D;  3N0E A;  1E5T A;  1GOF A;  4GQB B;  5AFU 3;  4ZOX A;  4U7A A;  3SHF A;  3OF7 A;  4K3J B;  1E8M A;  1GP2 B;  2HKM A;  5AJA A;  3UVK A;  3MUN A;  4Z7N A;  4BUJ C;  5H17 A;  2QR5 A;  3DXK C;  4ERQ A;  4PBY A;  1JV2 A;  4J82 A;  5HE0 B;  4A08 B;  4GGA A;  2P9K C;  5C86 A;  3SWS D;  1NEX B;  1MG2 A;  1U2V C;  1JJU B;  3IKO A;  2I0R A;  2H9M A;  4ES0 A;  4XEI C;  4GGC A;  3EI1 A;  3SMR A;  2Z2P A;  3BG0 A;  2CO0 A;  4GGD A;  4FB1 D;  5C2V B;  5FKS A;  2H9P A;  5EM2 A;  4GM9 A;  5FKQ A;  5B4W A;  2AGL A;  3I7O A;  2AGX A;  5FKR A;  5EAL A;  3DDU A;  3IUM A;  2AGZ A;  4BCB A;  2G9A A;  3UKR C;  2H14 A;  1RI6 A;  1JMX B;  4DNV A;  1OMW B;  3RN1 D;  2H6Q A;  4Z8L A;  1I2M B;  4L1Q D;  3PXT D;  4O1Q D;  4E5Z B;  4AX4 A;  3I7L A;  4A08 A;  1Q47 A;  3RFH A;  2Z2N A;  3JZH A;  1O6F A;  5EMJ B;  3JRP A;  5M5S A;  2AH0 A;  4D0K A;  1PEV A;  4BCC A;  2HJB A;  2EBS A;  5FFO A;  3PSC B;  1JTD B;  1UOP A;  3IJC A;  2P9P C;  3IUJ A;  2CE8 A;  3K27 A;  4J77 A;  4JSN C;  3QI0 A;  2PM6 B;  4FA4 D;  2YNN A;  3SBQ A;  1N6D A;  2YNO A;  4PC0 A;  4CY1 A;  2HU5 A;  1K3I A;  4GM8 A;  1L5G A;  2PM9 A;  3MZK A;  5IJ8 E;  4CY2 A;  3V5W B;  2J56 H;  1SQ9 A;  4E5Z A;  3MKS B;  3ZE2 A;  4X60 B;  1TBG A;  5HE3 B;  4N14 A;  4D6V A;  4J8G A;  5IT9 g;  4ERZ A;  4WK4 A;  2YBA A;  5TF2 A;  3JZN A;  2H13 A;  2CE9 A;  3ZDY A;  1H2Y A;  4ERY A;  3SN6 B;  4JT5 C;  4JSP C;  2W18 A;  4A0B B;  1K32 A;  3SBR A;  1A12 A;  2YB8 B;  2H6K A;  3OKY A;  4LG9 A;  3GRE A;  3PSL A;  4O2W A;  2QXV A;  1UOO A;  2H6N A;  4PSX B;  4JSX C;  5E6S A;  4AMY A;  2H9L A;  3FGB A;  4GMB A;  4AMZ A;  5EMM B;  3DWL C;  5IGO A;  2CN3 A;  4JT6 C;  1GOH A;  3E0C A;  3SCY A;  3UR4 A;  2UZY B;  3MKQ A;  2HXC A;  3OL2 A;  3IIY A;  3KRX B;  5TEE A;  2QC5 A;  5IGQ A;  2P9L C;  2G99 A;  1N6F A;  2QZP A;  4A0B A;  3PXS D;  4PNK B;  2Q7Q A;  4J78 A;  1B9Y A;  3PXW D;  3RFG A;  3T3M A;  3L4O D;  3NVX A;  5C9Z B;  1R5M A;  2P9N C;  3MMY A;  1N6E A;  3VI4 A;  3AH8 B;  5THA A;  4MMX A;  4O02 A;  4J81 A;  3IUL A;  2VZ1 A;  3UVN A;  2P9U C;  3VGZ A;  2VC2 A;  4EWR A;  3I7P A;  4JD2 C;  1H2W A;  4NBM A;  1VZ2 A;  1H2Z A;  1U4C A;  2XU7 A;  1B9X A;  1VYH C;  3I7N A;  4A2L A;  2HJ4 A;  5M5R A;  2J57 G;  3DSM A;  1PI6 A;  3F3F A;  4R7A B;  3F3G A;  2XE4 A;  3I8E A;  2IUR A;  3JPX A;  4AOW A;  1MG3 A;  2YMU A;  1QFS A;  4J79 A;  4J87 A;  1S4U X;  3JZG A;  3C75 H;  4A11 B;  1P22 A;  4XYI A;  5I5M A;  4A09 B;  2PBI B;  4JHP C;  3IUN A;  3VA6 A;  1SHY B;  4GQ2 P;  3IIW A;  3ZDX A;  5FXY A;  2H68 A;  2CN2 A;  3SBP A;  5K19 A;  3A0F A;  3OKW A;  2WQ8 A;  4CZV A;  5A2Q g;  4MMZ A;  4GM3 A;  4QAM A;  4A7J A;  2VDL A;  5FQD A;  4ZOV A;  4FA5 D;  2OJY A;  3N0D A;  4U1E I;  1MDA H;  3ZE0 A;  3FCS A;  3RSE C;  4MMY A;  3C5M A;  4IA9 A;  3SLE D;  4A11 A;  2BBK H;  4J84 A;  4OZU A;  3EWE A;  5HQG A;  4PSW B;  3BWS A;  1XHM A;  5M5T A;  3J80 g;  3EQ8 A;  1ERJ A;  3IJ0 A;  2AGW A;  2EID A;  4L1M A;  5GMK n;  3GFC A;  4J8B A;  3IJE A;  3EI3 B;  4AN0 A;  2VDQ A;  5M61 A;  3RLM D;  1JMZ B;  2O9K A;  2B4E A;  4J73 A;  1OLZ A;  2B5M A;  4D9S A;  4NC4 A;  4NAA A;  1QFM A;  3EI4 B;  4CZY A;  5E6U A;  4DNW A;  3ODT A;  3O4G A;  4A2M A;  1XIP A;  2IUV A;  4G55 A;  4KFM B;  3NIF A;  2YNP A;  3ZE1 A;  2I3S A;  4O9D A;  3V4V A;  5H1M A;  1A0R B;  5TEF A;  3PE7 A;  3EMH A;  3GD1 I;  2HU8 A;  3J81 g;  5HE2 B;  3NIG A;  3O4J A;  2B5N A;  4Y5R D;  4AEZ A;  4CI2 A;  1E8N A;  2I3T A;  3I7H A;  1XKS A;  3CFS B;  2P9I C;  3B7F A;  3EI3 A;  3OW8 A;  4FHL A;  4CI3 A;  4LG8 A;  5CXC B;  5AMS A;  3UVM A;  1C9L A;  2H3X A;  5HE1 B;  5FKT A;  3O4I A;  1UOQ A;  5CYK B;  3EI4 A;  3VH0 A;  4GQ1 A;  2AQ5 A;  3L4M D;  3I7K A;  1L0Q A;  2VZ3 A;  3OKT A;  4QQE A;  4HDJ A;  2GNQ A;  5GXI A;  4JSV C;  3C99 A;  2IUQ A;  2XDW A;  3CIK B;  2VDM A;  3I8C A;  4E54 B;  2H47 A;  2VDK A;  1NR0 A;  4X61 B;  4FAN D;  3AL9 A;  2IWF A;  3DM0 A;  3P4F A;  3RMZ D;  4IRZ A;  4Z7O A;  3EI1 B;  5CXC A;  3FCU A;  3MXX A;  1O6G A;  1M1X A;  3V9F A;  3EI2 B;  4OWR A;  5C92 A;  3FRX A;  4G56 B;  5M5U A;  2AH1 A;  4WK0 A;  2AGY A;  1GOG A;  2I0S A;  4NEN A;  4JXM A;  5CYK A;  3SXT D;  4ZN4 A;  5GSA A;  4YVD A;  3T3P A;  3AFC A;  4NSX A;  4O3T B;  5C2W B;  2IUP A;  1YFQ A;  2GC7 A;  2EIB A;  1BPO A;  4WJK A;  3ULE C;  4I79 A;  2CO0 C;  4G1E A;  5I5J A;  3ORV D;  3PVU B;  2VDR A;  4BP9 A;  3SFZ A;  4L3G D;  2VDO A;  4E54 A;  4RE6 A;  1GOT B;  3UVL A;  5IJ7 E;  2BCJ B;  3V4P A;  5SXM A;  2I0T A;  3EI2 A;  2OK6 A;  1VE6 A;  4CI1 A;  4BP8 A;  1QNI A;  4PXW A;  2OIZ A;  2HU7 A;  5GXH A;  3K26 A;  3NVQ A;  4J86 A;  2MTA H;  4IMM A;  3OTT A;  3HFQ A;  4BL0 A;  3K72 A;  3BG1 A;  4X3E A;  2UZX B;  2PM9 B;  1GXR A;  1TYQ C;  3MZL A;  4PBZ A;  4FAV D;  4JHN A;  4QT8 A;  4TZ4 A;  1U8C A;  5TDH B;  3JB9 L;  3AL8 B;  4QRJ A;  4WK2 A;  2P9S C;  1K8K C;  4A09 A;  3IVM A;  2OVQ B;  5EAM A;  3IUR A;  2VDN A;  4ZOZ A;  3EQ7 A;  3KCI A;  2VDP A;  3MUO A;  3QHY B;  3I89 A;  3CFV A;  3IUQ A;  4UM9 A;  4G1M A;  1T2X A;  5I5I A;  3UKU C;  3EU7 A;  2TRC B;  3GC3 B;  1UTC A;  4L9O A;  4MK0 B;  5EMK B;  5FFG A;  4FWW A;  3VI3 A;  4FA1 D;  2HYE A;  3FM0 A;  2Z2O A;  4J0W A;  3K71 A;  1PGU A;  2OVR B;  4QL1 A;  5M5V A;  4UM8 A;  5KDO B;  3UVO A;  1SQJ A;  3OKY B;  1GG2 B;  1C9I A;  3DXM C;  4LGN A;  2GC4 A;  4CC9 A;  3F3P A;  4XYH A;  4CY3 A;  4A0A B;  3AL8 A;  4K3I D;  3RN0 D;  2OK4 A;  5EAR A;  1VE7 A;  2BKL A;  4GZ8 A;  4L3H D;  4DNU A;  3MVD K;  2XL3 A;  3KRW B;  2H9N A;  4AN1 A;  1H2X A;  2XZG A;  2HKR A;  2IWK A;  2JKX A;  3OL2 B;  2B5L A;  1TYE A;  2EIC A;  2J55 H;  3IJ1 A;  4BH6 A;  4RE5 A;  4CY5 A;  3C9C A;  5CXB B;  3W15 A;  3K6S A;  4ZOY A;  4J0X A;  2HES X;  5HDB A;  5FLX g;  2OVP B;  4FA9 D;  5EAP A;  4CZX A;  3SVW D;  3PVW B;  2IAA A;  3EG6 A;  4O3U B;  3V7D B;  4CI8 A;  4UI9 R;  3O4H A;  4A0A A;  3RRM C;  1VZ3 A;  4X63 B;  5E6R A;  1FWX A;  3JRO A;  5FA5 B;  3I2N A;  2XL2 A;  5HYN B;  4Z7Q A;  5IC7 A;  5K1C C;  4H5J A;  4Y7R A;  3ZWL B;  1JOF A;  2EIE A;  3ZDZ A; 
#chains in the Genus database with same CATH homology
 3JAM g;  5H14 A;  5CXB A;  5EML B;  4O45 A;  1PBY B;  2CNX A;  3NVN A;  4ESG A;  5JWZ A;  2PM7 B;  4H5I A;  3U4Y A;  2XYI A;  5EM2 B;  3SJL D;  3N0E A;  4GQB B;  5AFU 3;  4ZOX A;  4U7A A;  3SHF A;  4K3J B;  1GP2 B;  2HKM A;  5AJA A;  3UVK A;  4BUJ C;  5H17 A;  3DXK C;  4ERQ A;  4PBY A;  4J82 A;  5HE0 B;  4A08 B;  4GGA A;  2P9K C;  3SWS D;  1NEX B;  1MG2 A;  1U2V C;  1JJU B;  3IKO A;  2I0R A;  2H9M A;  4ES0 A;  4XEI C;  4GGC A;  3EI1 A;  3SMR A;  2Z2P A;  3BG0 A;  2CO0 A;  4GGD A;  4FB1 D;  5C2V B;  5FKS A;  2H9P A;  5EM2 A;  4GM9 A;  5FKQ A;  5B4W A;  2AGL A;  3I7O A;  2AGX A;  5FKR A;  5EAL A;  2AGZ A;  2G9A A;  3UKR C;  2H14 A;  1RI6 A;  1JMX B;  1OMW B;  3RN1 D;  2H6Q A;  4Z8L A;  4L1Q D;  3PXT D;  4O1Q D;  4E5Z B;  3I7L A;  4A08 A;  1Q47 A;  3RFH A;  2Z2N A;  3JZH A;  5EMJ B;  3JRP A;  2AH0 A;  4D0K A;  1PEV A;  2HJB A;  2EBS A;  3PSC B;  2P9P C;  2CE8 A;  3IJC A;  4JSN C;  3K27 A;  4J77 A;  2PM6 B;  4FA4 D;  2YNN A;  3SBQ A;  1N6D A;  2YNO A;  4PC0 A;  4CY1 A;  4GM8 A;  2PM9 A;  3MZK A;  5IJ8 E;  4CY2 A;  3V5W B;  2J56 H;  1SQ9 A;  4E5Z A;  3MKS B;  4X60 B;  1TBG A;  5HE3 B;  4N14 A;  4D6V A;  4J8G A;  5IT9 g;  4ERZ A;  2YBA A;  5TF2 A;  3JZN A;  2H13 A;  2CE9 A;  4ERY A;  3SN6 B;  4JT5 C;  4JSP C;  2W18 A;  4A0B B;  1K32 A;  3SBR A;  2YB8 B;  2H6K A;  3OKY A;  4LG9 A;  3GRE A;  3PSL A;  2QXV A;  2H6N A;  4PSX B;  4JSX C;  2H9L A;  3FGB A;  4GMB A;  5EMM B;  3DWL C;  5IGO A;  2CN3 A;  4JT6 C;  3E0C A;  3SCY A;  3UR4 A;  2UZY B;  3MKQ A;  2HXC A;  3OL2 A;  3IIY A;  3KRX B;  5TEE A;  2QC5 A;  5IGQ A;  2P9L C;  2G99 A;  1N6F A;  4A0B A;  3PXS D;  4PNK B;  2Q7Q A;  4J78 A;  1B9Y A;  3PXW D;  3RFG A;  3L4O D;  3NVX A;  5C9Z B;  1R5M A;  2P9N C;  3MMY A;  1N6E A;  3AH8 B;  5THA A;  4J81 A;  3UVN A;  2P9U C;  3VGZ A;  4EWR A;  3I7P A;  4JD2 C;  1U4C A;  2XU7 A;  1B9X A;  1VYH C;  3I7N A;  4A2L A;  2HJ4 A;  2J57 G;  3DSM A;  1PI6 A;  3F3F A;  4R7A B;  3F3G A;  3I8E A;  2IUR A;  3JPX A;  4AOW A;  1MG3 A;  2YMU A;  4J79 A;  4J87 A;  1S4U X;  3JZG A;  3C75 H;  4A11 B;  1P22 A;  4XYI A;  5I5M A;  4A09 B;  2PBI B;  3VA6 A;  1SHY B;  4GQ2 P;  3IIW A;  5FXY A;  2H68 A;  2CN2 A;  3SBP A;  5K19 A;  3A0F A;  3OKW A;  4CZV A;  5A2Q g;  4GM3 A;  4A7J A;  5FQD A;  4ZOV A;  4FA5 D;  2OJY A;  3N0D A;  4U1E I;  1MDA H;  3RSE C;  3C5M A;  4IA9 A;  3SLE D;  4A11 A;  2BBK H;  4J84 A;  4OZU A;  3EWE A;  5HQG A;  4PSW B;  3BWS A;  1XHM A;  3J80 g;  1ERJ A;  3IJ0 A;  2AGW A;  5GMK n;  3GFC A;  4J8B A;  3EI3 B;  3RLM D;  1JMZ B;  2O9K A;  2B4E A;  4J73 A;  1OLZ A;  2B5M A;  3EI4 B;  4CZY A;  3ODT A;  4A2M A;  1XIP A;  2IUV A;  4KFM B;  2YNP A;  2I3S A;  4O9D A;  5H1M A;  1A0R B;  5TEF A;  3PE7 A;  3EMH A;  3J81 g;  5HE2 B;  2B5N A;  4Y5R D;  4AEZ A;  4CI2 A;  2I3T A;  3I7H A;  1XKS A;  3CFS B;  2P9I C;  3B7F A;  3EI3 A;  3OW8 A;  4FHL A;  4CI3 A;  4LG8 A;  5CXC B;  5AMS A;  3UVM A;  2H3X A;  5HE1 B;  5FKT A;  5CYK B;  3EI4 A;  3VH0 A;  4GQ1 A;  2AQ5 A;  3L4M D;  3I7K A;  1L0Q A;  3OKT A;  4QQE A;  4HDJ A;  2GNQ A;  5GXI A;  4JSV C;  3C99 A;  2IUQ A;  3CIK B;  3I8C A;  4E54 B;  2H47 A;  1NR0 A;  4X61 B;  4FAN D;  3AL9 A;  2IWF A;  3DM0 A;  3P4F A;  3RMZ D;  3EI1 B;  5CXC A;  3MXX A;  3V9F A;  3EI2 B;  4OWR A;  3FRX A;  4G56 B;  2AH1 A;  2AGY A;  5CYK A;  2I0S A;  4ZN4 A;  4JXM A;  3SXT D;  5GSA A;  4YVD A;  3AFC A;  4NSX A;  4O3T B;  5C2W B;  2IUP A;  1YFQ A;  2GC7 A;  3ULE C;  4I79 A;  2CO0 C;  5I5J A;  3ORV D;  3PVU B;  3SFZ A;  4L3G D;  4E54 A;  5IJ7 E;  1GOT B;  3UVL A;  2BCJ B;  5SXM A;  2I0T A;  3EI2 A;  2OK6 A;  4CI1 A;  1QNI A;  4PXW A;  2OIZ A;  5GXH A;  3K26 A;  3NVQ A;  4J86 A;  2MTA H;  4IMM A;  3OTT A;  3HFQ A;  4BL0 A;  3BG1 A;  4X3E A;  2UZX B;  2PM9 B;  1GXR A;  1TYQ C;  3MZL A;  4PBZ A;  4FAV D;  4QT8 A;  4TZ4 A;  5TDH B;  3JB9 L;  3AL8 B;  4QRJ A;  2P9S C;  1K8K C;  4A09 A;  2OVQ B;  5EAM A;  4ZOZ A;  3I89 A;  3CFV A;  5I5I A;  3UKU C;  3EU7 A;  2TRC B;  4L9O A;  4MK0 B;  5EMK B;  4FWW A;  4FA1 D;  2HYE A;  3FM0 A;  2Z2O A;  4J0W A;  1PGU A;  2OVR B;  4QL1 A;  5KDO B;  3UVO A;  1SQJ A;  3OKY B;  1GG2 B;  4CC9 A;  3DXM C;  4LGN A;  2GC4 A;  3F3P A;  4XYH A;  4CY3 A;  4A0A B;  3AL8 A;  4K3I D;  3RN0 D;  2OK4 A;  5EAR A;  4GZ8 A;  4L3H D;  2XL3 A;  3KRW B;  2H9N A;  2HKR A;  2IWK A;  3OL2 B;  2B5L A;  3IJ1 A;  2J55 H;  4BH6 A;  4CY5 A;  3C9C A;  5CXB B;  3W15 A;  4ZOY A;  4J0X A;  2HES X;  5FLX g;  2OVP B;  4FA9 D;  5EAP A;  4CZX A;  3SVW D;  3PVW B;  2IAA A;  3EG6 A;  4O3U B;  3V7D B;  4CI8 A;  4UI9 R;  4A0A A;  3RRM C;  4X63 B;  1FWX A;  3JRO A;  5FA5 B;  3I2N A;  2XL2 A;  5HYN B;  5IC7 A;  5K1C C;  4H5J A;  4Y7R A;  3ZWL B;  1JOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...