4L4JA

Crystal structure of fc-fragment of human igg2-sigma antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
ASSVFLFPPKPKDTLMISRTPEVTCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-2 chain C region
publication title An engineered Fc variant of an IgG eliminates all immune effector functions via structural perturbations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA01
1ONQA 4ENEC 1NJ9B 3VXQA 2VZTA 5JMRA 2NY0C 4ODTL 3WFDH 1NCBL 1FV1A 3SDXF 2E9IA 4P23A 4MA1C 4CL7A 3ZT5A 3BZDA 2L7JA 2X4PB 3E6FA 3KPRD 1U8KA 4XH2B 3CFIC 1NLDL 1UJTA 4X7FC 3U83A 5D7LA 4NDMA 5DD5L 4DVRL 2DWEA 3FB8A 2VXTH 5B3JF 1DEEA 4IRJA 5FGCE 1LGVA 2CH8A 3GJFA 3FMGL 3KPQB 5B3NA 5JDSA 4F15C 5FECB 3O9WB 5KS9F 1PGRB 3BDBA 4XVTL 4HCRA 4M3JA 4ZPTA 3RWCA 3DOSA 1INDL 4QTHB 1E6JH 1MHCA 2W9EH 3K2MC 4QRRA 1OM3H 4Z7VE 4WU5B 4Q2ZA 3NACH 4YEEA 1UM6H 3B9KA 4NM8H 1AGBA 1YY9D 1Z0NA 3ARFA 4TOYL 4XNYL 4KK6D 3D85A 3KG5A 3MRNB 3RZWA 2BDNH 5B3JE 1GGBL 4X6DE 4XCCL 6FABL 5EU4A 4AJ0A 3GMNA 3W2DL 2DLEA 5TPWL 1OARH 3DX7B 4JO3H 5CZXC 2G9HB 3FQTA 5KS9E 1QKZH 3MROB 3VFNB 2X09A 4F8TA 5I71C 1FC1A 4PRHD 3QHZH 3CVIL 3S3PA 2EDJA 5LG1A 4PJEA 4FQ2L 3AROA 2X4TB 4J4PC 1DSFH 4OGXL 5JW4Q 2IQ9L 1UH3A 2Q6WB 1TJHH 1SY6A 1TQBB 4Q6IB 4ZDHB 5I1LA 2AXGB 2ITCB 4NNXA 4RRPA 3PGCA 4U1SA 3QHFL 3S35H 1J8HA 3WS6A 4HLZG 1CDJA 3G6AA 4HV8A 3OKNA 1L4IA 4LVOB 2CJUH 5C0CB 1OVZA 1LDSA 4RQQA 3JTTB 5K59F 1EO5A 1BQHG 3BPNB 4GAFB 3X11A 5D5MA 3S5LA 1W2KT 2FDBP 5E6YA 1M71B 5I75B 4DJMA 4YHLL 2B2XH 1R3JB 4R6UA 4LVNB 4DGIL 3RGHA 5E4EB 1KSRA 1YPZA 4K7PH 5HVFB 3ARDB 1RJCA 1KB5B 3H3PL 3S36H 3NFNA 2VR5A 4R4BA 5IVXE 3MV7A 5T1KA 1QLRB 4XPBH 1MCPH 4HUVB 1Q94B 1D5IH 1CE6B 1L7IH 1S9XA 4L1DA 4F9LC 3NPSB 4S10A 1NMAL 2XFXA 3EO9H 3QAZB 4R2GB 2OCFD 4DZ8A 1YPZF 1J8HE 5J6GB 1I1AA 3DGCR 1LEKA 1MRFL 1FAKT 3HC4H 4PV8B 4LPYA 1MJUH 1FFNB 4MAYA 2NW2A 3BN3B 5IEHA 4RAVB 2ED8A 4LL9A 3CU1A 2VLLA 4KJWD 4OFIA 3BPLC 3VXTA 2NY0D 3WEXA 2OP4L 3T65B 3IF1B 2DMKA 4IRZH 5JR1L 2YSSA 3O8XB 5JW4N 2DRUA 5GISL 3OMZA 4P3CL 3PHQA 2EXWC 1RY7B 5IB1A 1J0HA 2IH1B 3TT3L 2J5LB 1OGAB 5MENE 1EFXD 5JOFB 3VMPA 1RZJH 4O2FB 5T3XH 4Z76A 3RY6C 1J5OH 1U3YA 3H3BC 2BHYA 2C3VB 4XP1H 3BN9C 4IRJD 1S8DB 1HQRA 4PLJC 3FCTB 4O2CA 3SE9L 3UTTE 2DBLL 1ZGLP 3LAFA 3FB5B 4KQ3H 5HVHB 4XPTL 5E94B 5JHLL 2AJSH 5KSAC 4YC2C 5FYKH 4FQXC 1ZHKA 3LKSA 2FCBA 3QEQB 5K93A 2WZPD 2H2SC 2P5EB 5L2JA 1KJ2H 1U9KA 2A74A 5D72L 1UJ3B 2E7MA 5FO8A 43CAA 2X9WA 1C08A 3MBXH 1MFCL 2IG2L 1A7NL 1Y0LA 1INEH 1YYLL 1TQCB 3BVNB 3D85D 3KYKL 4L4TA 4LIQL 4P59L 3DYMA 4XNXL 4GMSH 3G6DH 4QHKI 1I7UB 5CZXD 3OJ2C 5DXWA 1AY1H 1XF1A 4JQIH 4LSVL 1IEBB 2P5WE 3BEVA 5EO9A 1I3RB 3TYFB 1T1YB 5TDPA 4J4PD 1OP5H 2YA0A 5ITFA 2UVFA 3DO3A 4JM4H 1MFNA 3KJ6H 2VXVH 3LIZH 3BGFC 4JDVB 1F6AA 3MRRB 3B8YA 4GG6A 1A7OL 1NGYB 1J8HD 3FT4A 4LSUL 3MCLH 5EA0H 2EYRB 3R0MA 3QIUA 1YEHL 4PG2C 5HHMB 1QR4A 1J1XH 1NLDH 4M6OL 2C5DC 3K8MA 2WP3O 5GRVK 3W39A 5IQ9B 3T0EA 2DQDL 1J1PL 4JFZL 4LCWE 2HT4C 4NUJB 4LEXH 5I1KH 2P42B 4Y4KB 5HYIA 4LRNL 2J2ZA 4GG6F 3G08B 1LVEA 4XVTH 2B4CC 2XNAA 2Q76B 5BZWA 3TO2B 3ROLB 2XTLA 3PP3H 4QOKA 2EDHA 2W59A 3HHRB 4QRQA 5MEND 4LLUA 3WYRA 4NN5B 3HE6C 4Y1AB 5CD3B 3S98A 4NFBA 1CICA 4X5WB 2KBGA 2Y25A 2ZUWA 4PREA 2B5IB 4JZNA 3UTTD 4UB0L 1KEML 5ETUA 1P2CA 4NFCA 3MSPA 5GRUH 5C3LD 4CGTA 1KLGA 5E1AA 4KI1A 1JTTA 4JY4B 4ZUWA 4YHIB 1QPXA 3K4ZA 5HHXL 1MJJA 3FO2A 1TTFA 2QTEA 4BKLB 3GMMA 4NQVA 1IQWL 4JPKH 1AH1A 1XGUB 4HPYL 2K1MA 1S7RA 2GSGA 3TFKD 5FYJU 2VSDA 1SYSB 2F8VA 3E6HA 1T2JA 2IC2A 4GW1A 4L3CA 2DLHA 1A3RL 3M45A 5J56B 5F6IB 4N0YL 4Y4HC 2UWEE 1WFNA 5DJDA 2VDML 4PRPB 4LLAA 1UB5A 2CLZA 2WINA 3BN9D 5C0ND 5K9OB 3DXAA 4PLJD 1IMHC 3LKNB 4IMKA 5KG9A 5CGMA 3UJTL 3DX6A 1TZIB 3CDFA 1Q9WB 4Q9RL 5K9QI 4LGPB 1JK8A 5C0BB 5IHUL 1W8OA 4DGIH 3THMH 1UZ6F 2IALA 4PS4L 3U0TA 2H2SD 3RY5A 2A1WH 3M07A 5D8JL 4LPCA 3TJHD 1IGTB 2QKIB 5IGXH 2BMKB 1BPVA 1F4YL 4YX2L 1NC4B 4OCYH 2GCYA 1HYSC 1JZ2A 1FCCA 4QKXB 1YJDC 4FQIH 5MEQB 1NMAH 1VKXB 3UTSE 3BXNA 2HWZL 1T83C 4X6BB 5EU7C 3CH1B 1U3HB 2NXZB 4MLSA 3KJ4B 4PGDA 1RZIA 3WJLC 3I75B 2PYFA 5A2KH 3OR7A 4PTTB 5C1MB 2BCKB 5GS1A 5A16A 1EVTC 5E00B 1ZA6A 1GOFA 4IDLA 2A9ML 1JBJA 1I3GL 3U7WL 3HI6L 4UOJA 4P5MB 1MFAH 4FQ1H 3TJEL 4NRXB 5GISH 1E4JA 4JO4L 3CGTA 4JREB 1D5BB 2F9BT 4GLRI 4FTVA 3TT3H 1P4LA 4C58B 1HSAA 1OAKL 2XACC 2FJGA 4EVNB 2HVJB 4HIJB 2B39A 4WI7A 1AI1H 2LU7A 5IB3A 3D3VB 4P5TA 2HT4D 3IYLW 5CZVH 5ELIA 4NSKB 2DBLH 4ZUSA 4S1QL 2EXYC 1MNUL 3RUGB 4XPTH 5EU7E 3AXLA 3BIBX 2VAAB 3MFFA 2OQJA 4C56B 3C09C 1KJ2A 1GZQA 2W60B 2CO6B 4HUWA 3AY4A 5TDNB 1NMBH 4I3RL 4WRLA 1T0PB 1TJGH 4HS3B 1U58A 4WTXA 5KN5A 2IG2H 2YD6A 4XT1C 1O7SA 4LSSH 1E6OH 3BKMH 5F70A 5AUMA 4LLYB 2MTPA 4LIQH 1QNZH 5JIPA 4D0CA 2ED7A 3DVIA 2HVKA 4OV5A 1EA9C 12E8H 4LSVH 3WKML 4WY7H 3QQ4A 4JHWL 4XPFL 1LE9B 3GBLA 2BHZA 1T22A 4QCIB 1SEQH 3VFMA 5C8JA 4WUKH 1U8JB 3LEVL 3TH4T 1UKQA 3L5WA 1FCGA 1JRHH 5CP7A 3QUYC 1C16B 4QRPB 3TBSB 3K74B 1X7QA 4KDTA 3CMOL 3GRWH 1BFTA 1KXQE 4OF0A 3I9GL 5D2LE 1HYRC 5IHZA 5EU3B 3UTSD 3PJSB 5FYLL 5JXEA 5I74C 4Y4HD 4U7KA 4LSUH 1O0VA 1T4KB 4NZRL 4M6OH 4ODVL 5B8CA 5BW7A 2BOCB 1DQTA 4Z6AT 3EUUA 3IXTA 4JRXA 1B4RA 4E41E 2YD4A 2WQRA 3EFFB 4FQQB 1ZGLM 1J1PH 2FR4B 4ZUVA 3OL2A 4YAQA 5E7BA 1F8TH 2AJYL 1AR2A 4CU8A 1JJUA 5BVPH 4ZFZB 2VISA 3VFTA 1WAAF 4MJ4A 4KKBC 5DYOA 1KEGL 1A2YA 5HYSG 2YEZA 4KJYA 5DD0H 4PGJA 4Z95L 1FQ9C 1I7TB 1TXKA 5KZCD 2VKXA 5E8PB 3SKJH 1S7TA 2GYSA 2H6PB 3QNZB 2RIKA 3UO1H 2KKQA 2W1NA 3CD4A 1HEZA 5B38G 2FEDC 2NY5L 4K3GA 4P0DA 2ZJSL 3I6GB 4FQJL 3OKKB 1D6VH 3JTSB 4ORGB 3WMSA 4K3JL 1KEMH 1KT2A 4S1SH 4RX4A 1RAMA 4JG0H 4HLZH 3GMRA 4H25A 4HIXL 4V1DE 5DMKA 2YWZA 1WAAE 2AK4E 5EZOL 2B7DT 1EIBA 5HHXH 1IGYA 4HW6A 4UDUA 5F1SA 5TDOA 4UUJB 2O61A 5GS0L 2FEEI 3CDCA 1IQWH 2BVQB 5IK3A 5D1XA 1OF2A 4XRCB 1YEEL 1FL6B 5IFJA 3JWNC 2YPLA 4F37F 4JFXA 5IB4B 1DUYB 2BRQA 3UDWA 4QEGA 5I1AA 2XPGB 2CQVA 1RPQA 4RGOH 2A73A 4XWGL 1GCFA 4LEOA 1A3RH 3QB7C 3AFLA 1YNTA 5C0GB 1D9KC 4KPHH 2WQ8A 3GMOA 4M7JL 3BT2H 4GRWH 4QRSA 4G8EA 1KPRB 4OB5L 4P5TD 4D0DA 4JPIA 5EOTB 4EDWL 4LBEB 1E0OB 4M02A 4L3EA 4N0UE 2EXYD 2PW2A 5FK9A 4YNYA 1BIHA 1CFVH 2QQKH 5DJYB 1AGDB 5D6DA 2GW5A 4J3XA 1JGLH 4GAJL 1PYWB 1HXMA 4PS4H 4X7CC 4Y19E 3P3YA 4E41D 3T3MF 4S0TD 3VGAC 4A6YB 1Z3GH 3KWWA 5C0IA 3V5KA 2ADFL 1OWWA 2XI9A 3ZDZF 2OK0L 4ZUTB 3C6SB 4KVNL 3X12A 2H45A 1IQDB 4XP5H 3CFBA 1YQVL 4NN6C 4UILL 5T1LD 4ZNEE 1AQKH 1RK1B 4MCZA 3DYPA 3PWNB 4JPVL 1U8MA 3LS5H 1A8JH 3N1PC 1JNHB 2GAZB 3QUYD 5EO0B 1VFMA 3KXFE 4LPXA 3T3ME 4AZ8A 2A9MH 1I3GH 1NGWA 2H26A 3NZHL 3CC5A 4GRMA 4V1DD 5TE6L 2ARJQ 4JJ5A 5SV3A 3TJEH 2AK4D 3OKLA 4ZSOA 5E99L 1IGJA 3ZDZE 4NQEE 5JXED 5HYQB 3W5MA 3O0RL 4LPWA 4ZFOB 5A2LH 5CMAA 3FFDA 3S3SA 3MXVL 4K94C 3W0WE 2DBJA 4YHYC 4GXVL 4ZO7A 3TNMB 1YN7B 2WM0A 4GUPA 2O5XH 5I1HH 5I18L 1A6UL 2CLVB 1N6QL 1P53A 2C1PB 1N3NA 1WFUA 2C9AA 5CJQL 5BVJA 2J6EL 2R4RH 1N5YH 5CBEA 4FFYL 1J05A 1TMCB 3WHXA 2BC4A 3QFDA 1KN2L 4NO3B 1H5BC 4CKVX 4G7YH 1ETZA 2E9WA 2FIKA 3PL6C 5C0DB 5EU6E 4RIRB 2ADGB 4TUJB 4U1MA 3C60A 4OF3A 5DD1H 3PHOA 1WBYB 5AYUL 1KIQA 4DN4L 4I3RH 4NQDB 3TC9A 3RDTC 1KACB 2QADC 3HR6A 3VG0L 2APVA 1KPVA 3WFCH 2DB8A 3Q3GB 1R5VA 1EUTA 1M6OA 1MLCB 2VITB 4RA0C 4M5ZH 3RA7L 1TPXC 4IOFC 3TA3B 4J12A 1NCDL 4YXLL 4Y19D 3QDJB 1N59A 1MWAH 4W4NA 3VXRE 4EUPG 1A9BA 3C2AH 3MNWA 3WUWA 4YQXH 5KSVA 3AAZB 4JFDA 1B0RB 5D1XD 1N6VA 3IJHB 5IBTL 3DUUB 1KENH 3CMOH 5L8JB 3GRWA 3VDCA 5TF0A 1S7QB 2AQ3A 4RMTA 3MZGB 3L3IA 3K3QA 5AZEL 1I1FB 1T03L 1IILE 3QEHB 4YPGA 1FFPA 1YEJL 5HHOE 4YE4L 1KYOJ 3IGAA 3CFKA 1QO3B 4G43B 1IC1A 4ODVH 4HS6A 2Y06L 5ESVA 1ZT7B 3QXDB 4ZFFA 1IC7L 1CLYL 2VC2L 3KXFD 4P9HL 3C6LC 5J6HB 4LRIA 4PJAF 2AJYH 3KYOB 4JFEB 4U6HB 2YPKA 4P2RE 4MNQB 3O4LB 4NQED 3S34H 3G5XA 4U05A 2NZIA 2F5AH 3W0WD 4X4XA 2VE6A 2R23A 2JJVA 1GXEA 1W0WA 4TNVF 4WNQB 3B3IA 4HGWA 5GGQL 1PLGH 2CRZA 4J1UA 5ESQB 5I8EB 2V17L 4W4OA 1WK0A 4R90H 1CS6A 4LDEB 5DA0B 2CGRH 5F7DB 1JHKL 3VH8B 2IEPA 1KXVC 1XEDA 2RR3A 4WI3A 3TCLA 3UYPA 1QSFA 2BNUA 4PJAE 4JN2A 3SGJA 4X99A 3VG9B 4S2SA 3QWRA 5EU6D 4D0BB 2BY0A 3EOBA 3GSNB 4ZUUA 4NNPH 3H7BA 2I25N 3HMXH 2VLRE 4H1LG 3WIFA 1BQHA 1C12B 4LK4A 4LMQI 5L88L 2XZAL 2O93L 2EH8H 4TNWF 3MJ6A 2FHFA 4IOIA 1MCQA 4U1NA 3TVMD 2EECA 5CWSB 5EO1B 3DMMC 3RPKA 5EC1B 1XF5A 4JFYB 5DRWA 1ONQB 3B2UC 3P2TA 1FORL 4JRYA 3VXQB 2OMNA 5DT1L 1FV1B 4MA8L 3VXRD 4P23B 4PRIA 3P4MB 2VDPL 1J12A 5KS9B 5IMKA 3E6FB 2QLVB 4Z0BH 1U8KB 4CN4A 4XBPB 3VXUA 5CEZE 1C8PA 4QHKJ 4X4YA 2LV4A 5D7LB 3MMEA 3QI9A 2BVPA 2DWEB 2XXCB 3FB8B 5I8KL 1I9EA 2Q3ZA 4DKFL 5I1CH 3QQ3A 4IRJB 4OI8A 3LD8C 4FFVC 1DANU 2FSEA 2VL4A 5HHOD 5JDSB 4ZS7L 3PL6D 4LSPL 3ME0A 4LVHB 2X1QA 1FG9C 3QUXC 4ZPTB 3RWCB 5I1IH 1IE5A 3QIBD 5EBLB 4GRWF 1GZPA 5A3IC 4G6ML 2X4OA 1IL1A 1MHCB 5C3TA 1QFOA 4QRRB 1NQBA 3K80A 4KRPC 3SHSA 1FGNH 4UQ2B 4KHXH 4Q2ZB 4LCIL 2ADFH 4P2RD 3B9KB 2OK0H 5HXMA 1I1YB 2FX9L 4IOFD 1AGBB 5CBAB 3TIEA 5E6IA 4LU5L 4QO1A 5H37G 4G6FB 3D85B 2W92A 3HC0A 4KI5C 1CK0L 3GI9L 4YZFE 5E8DL 3HI5H 5EU4B 4UILH 1QOKA 3GSVA 4MJIA 2HMIC 2V6HA 4HEME 3FQTB 5F8RC 1OLZA 5EOQH 3F5WA 4D9LH 5C09E 3MCG1 4M61A 1CXEA 5KSBA 3VGBA 3ZSSA 3WFEL 3GMLB 2OTPA 3NZHH 2VDKL 3I2CH 1QR1A 3L3KA 1F58H 3IETA 5I1LB 4PTUA 5F9DC 4NNXB 5I0DA 1B3JA 3UP1A 3PGCB 3P73A 3N06B 4U1SB 2XZCL 4HWEL 1J8HB 4ZO8A 3MXVH 1FPTH 3DECA 4GXVH 2UZIL 5KSBF 3MODH 3G6AB 3IAQA 3C6LD 3MOBL 2PO6C 4HV8B 3FO9A 2VKWA 3LPFA 2F58L 4I0PA 4RQQB 2J6EH 3CUPA 4I9WE 4JKLA 3VFPB 2NMSA 1QACA 3S5LB 3LPWA 4APQC 1UM4L 2JJSA 1T7WA 2Q20A 5FGBC 1YA5A 3VGGA 1JNNL 4KI5E 5C71A 1ZAGA 3CVHL 3NIGE 4CN6A 5CEZD 2A77L 2DQFA 1T5XA 4Y2DA 4FG6C 4MQXC 4ZQKB 1YPZB 5CHNA 3NFNB 3QUKA 4UAOC 5E5UB 5FYJE 4R4BB 5KSBE 4UT7L 3VG0H 4EEEA 3EFDL 3MV7B 5EC2A 1GGTA 2FL5B 4MS8C 4PJGE 3PIQA 3HRZA 3W9DA 3RA7H 3L9RA 1S9XB 4XMKL 1NCWL 1NCDH 3PGDA 1QBBA 1YDPA 1MWAA 3TV3H 3LRHA 3OKMA 3O6ML 2XFXB 3MOAL 4DZ8B 3OJDA 1JGUL 1LEKB 5DJZA 2XN9E 2C4XA 4YHPB 3QWOB 4MAYB 3D0VA 2NW2B 5IEHB 3IJYA 3BPLB 5IBTH 1B4JL 2DYPA 2VLLB 1ZMYA 3VXTB 3D9AH 2F53A 1QTYT 1SHMA 1RJYA 4PJDA 4Y4FA 3H9SE 3MO1B 4GS7C 1NUDA 1YEJH 2AXFA 4YE4H 1G7QA 3PHQB 5IFHH 3ZSTA 1XMWA 5C09D 1BVLA 5ACMA 5IB1B 4RAUA 2Y06H 4X6CA 4Q6YA 4JJHA 2VC2H 2RQ8A 3TN0C 2DI7A 1BEYH 3MV8E 4Y5XA 2E7LC 2E6PA 5LXGH 4Z76B 2PW1A 3RI5F 3QI9D 1UWEL 2DD8L 1PZUB 4YHOL 1XZ0A 2HH0L 2PXYC 4FFVD 4M1DH 4HIEA 4X0KA 1HQRB 1V3JA 4O2CB 3A6BL 5DFVC 3BX7C 4PD4J 2V9TA 3OAZH 3V7AE 4X6CF 1ZHKB 2ZUYA 2UZYB 4HKBA 5L2JB 2VB5A 4I9WD 3PF2A 2AV7B 3OZ9L 3QCUL 2BERA 5FO8B 3RIAK 1C08B 3BHBA 1ZT1B 2ZWLT 3KR3H 1IKNC 5IMLA 4UT6H 4H0IA 2C4FT 4KI5D 2ED9A 4PJIE 1Y0LB 1B2WL 1PKQA 5IT2L 1L9NA 4L4TB 3QEUB 5L2KA 2HMID 3LQZB 4R9HA 1DCLA 1K2DA 3ZKQD 4IDJL 3HMXA 5TF1L 1RURL 3CJJA 2G75A 2XZAH 3BEVB 1JPGB 5FYJD 1JZ5A 3HS0A 2DKSA 2L0DA 1NH6A 4K8RC 3U4BH 5TDPB 1UXSA 5IW1A 5ICXB 3QRGH 2NX5E 5GXBB 3BGFB 4JEGB 3VMNA 4MMXC 3RIFK 4XNUH 3B83A 3PGFL 3RPIA 4ESKA 3BWUC 2WIIB 3WDIA 4GG6B 4OD1L 1MCWM 4WEMB 1IAKA 4RA3A 3FT4B 4OM1L 4QHNB 3S9DB 3BISA 2PO6D 3QIUB 4ZOEA 5I0ZA 2AGJH 3DTXA 5DJ8A 3QDGE 2EIEA 5ERWA 3HZKA 3W39B 1Q9KA 3K4DA 4WW2A 1C1EL 4TVPL 4APQD 4NM4L 4DCQA 1FFRA 3QUML 3B5GA 1Z5LA 2ERJC 1MJ8L 4UV7H 4JVPA 4M93C 4LSPH 4XCNA 5IB2A 2OX5A 2JJTC 1GGIL 4WU7A 2YD1A 5BZWB 1F90L 4JGUA 1R0AL 3MLYL 4MQXD 2PTVA 4QOKB 4G6MH 5IV2A 4QRQB 2VR4A 4Y2DD 5FHBL 4LLUB 1EEZA 3GKWH 3LSOA 3MV8D 4WW2F 1RZGB 1NGQH 2JK5B 1KTLA 4NHUB 2P47B 1CICB 1NFKA 4M62L 4G80A 1H8NA 5F96H 4PREB 1RD6A 2FX9H 4JZNB 3HI1A 5ETUB 5F7MC 1P2CB 1E4KA 1CK0H 4KDVA 5HGDA 1KLGB 4HULB 5E1AB 2EIZA 5D70L 4QXWA 2EEBA 3GHEL 4ZUWB 1MJJB 3LMJH 3FO2B 3QO0A 4JFQA 4NQVB 1MI5A 1MIML 1R3KA 3WFEH 3WDJA 2VDKH 5F21B 1S7RB 1IGCH 3RNQA 1MRDL 2F53D 5D96C 2G60H 4RDQG 4YHZH 2FB4H 4L9LC 3E6HB 4Y4FD 3NZ8A 5EWIL 3UTSB 1QFUH 4GW1B 4ODHH 4ODUB 4Y0GA 2UZIH 4HT1L 3MLUL 3TH2T 2BOBA 1QG3A 3O81A 4H8WL 3TN0D 3OXRB 2DIBA 4IRSC 4OLUL 5BQ7A 2YZ8A 3V6OC 3IKKA 1UB5B 5KSUA 2CLZB 2PXYD 2EO1A 2WINB 5DTFA 3DXAB 1ZEAH 2RFXA 3UAJD 4D9QE 4E42A 3S37L 3VRLF 2OR7A 3MACH 3QPXH 5KG9B 4EUPH 3DX6B 2H8PB 5IM7A 1JK8B 1T7ZA 2RCSL 4Q9QH 2YOCA 4F8QA 3SDCC 2IALB 5KZCB 3QDGD 2DWDA 5ID1A 3UTZB 3ARGC 1OB1A 5GRVL 3X3GL 4X5LA 2APWA 5GRZA 1MFDL 5DVKA 3EFDH 3PQYE 4PJFA 2AAVA 2ATPA 3SDAA 1KTKE 4OZIA 4XMKH 2EKSA 1DBBL 4ONFL 4CADA 5C0JA 3WNKA 3VRLE 5J3HC 2D0FA 4IOSD 3BXNB 1EH9A 1VGEL 2D2OA 4K8RD 4PGDB 2X1OA 2OZ4H 3PP4H 1X4XA 2PCPA 1RZIB 15C8H 2PYFB 3WXWL 4GW4A 5LCVL 5GS1B 5HYSA 3RX5A 5A16B 4PJFF 1ZA6B 4OZIF 3UPCA 4K55A 2XT1B 5IROA 2WUBH 5LGJA 3S4SG 1JVKA 4S0SD 2HTLD 1MAJA 2HAZA 4MXVE 4KV5F 5B38A 2BNRE 5DEFA 3RGVA 2AJZB 4FTVB 1BOGA 2LVEA 4MNGA 1P4LB 1HSAB 3ZTNL 2VLKA 1CR9L 4NWUL 2FJGB 4N90E 4DTGH 1WT5A 5E2TL 3BUYA 3BP7A 5IB3B 2DD8H 2XIDA 4P5TB 2HH0H 4Q97A 2VNCA 4PR5A 5ADOL 4FQLH 5ACZA 1UZ8A 4HG4K 1D7FA 1QBLH 4H1LH 5IW6B 3HCVA 1JPTH 2HFFA 1QP1A 3FJTA 1R3LA 3H42L 4N0RA 3AXLB 1TNMA 3MFFB 4KV5E 3NCFB 4E41B 1A9EA 2OQJB 2X4SB 2W9DH 3HNTL 2XG5A 1KJ2B 4UINH 5ANME 1CFBA 3V0WH 1P9MA 4HUWB 1Q1JH 3RWDA 5KN5B 1U58B 3VD3A 2WBJC 1EO7A 5AUMB 1B2WH 4GRLA 2Y6SC 4NCC1 4D0CB 1D5ZA 4OCLC 2HVKB 2FEEL 4HFUL 4OV5B 2A0LC 1Y6MR 3E0GA 4NKDA 3QQ4B 4R7DA 3CH8A 1CDUA 4X9FA 3VFMB 5C8JB 2AEPL 3PQYD 1UKTA 3NFSL 3NFPA 3L5WB 4HEPG 5CP7B 1G9NH 1D5MA 3JUYA 1X7QB 4MB3A 3PGFH 5D7JC 5IHZB 2AK4B 4OD1H 4ZPVA 4OM1H 2AW2A 4M8QB 4IRSD 3FL7A 4JQXA 4WEBL 5B8CB 1T20A 3IXTB 1GC1H 4JRXB 4PBWD 4U1JA 2CRYA 3RHWF 5I15L 5E2JA 4OCMC 5BOZG 3T0EC 3T1FA 2D0HA 3AU1A 4NM4H 1BAFL 4YAQB 5D93B 2Y4SA 4KDWA 2EE9A 2VISB 3VFTB 5DYOB 1MJ8H 3ARVA 4P5KA 1A2YB 4M8VA 4I8DA 5CUSH 2YEZB 3GSWA 3WO4C 4Z78A 1QQDB 4U1KA 4OI7A 2NY2C 4N90D 3KYNA 3JBG7 32C2B 4M1CD 4M1GL 1S7TB 3B5TA 4OCNC 2WBKA 5SWZA 2IF7A 3BRFA 4M6AA 1DQJA 2HT3C 4N0UB 3NCEB 2R29L 1M05B 1KT2B 1WITA 4I13B 3TBVA 4XP4H 2X42A 5J3HD 4LHUG 2CUIA 1HKLH 3OX8B 5D70H 2MSPA 1BD2A 5T3ZL 3U7YL 2R2CA 1TCRA 4XWOC 1IGYB 4LPUA 5HI3D 4C83A 4UDUB 3GNMH 5TQ0H 3SKNA 5TDOB 4NQUA 2O61B 4NC0B 2Y07L 4U7MA 5D7KE 5IK3B 5D1XB 4ONGH 5IFJB 4JFXB 5ISZE 5I1AB 3GMQA 5IEKB 5EWIH 1JZ7A 2A73B 4LEOB 4ZO9A 2YBRB 4KZDL 4HT1H 3ZT7A 1YNTB 1BQUA 3IFPB 4H8WH 4U0RC 3QWQB 4HWBL 2YKLH 1ES0A 3V4UL 3KXFB 4G8EB 4NRZA 1HXYA 1RMFL 4Y7MA 4D0DB 3MCKA 1PG7L 1KTDA 4XNMA 5E8NB 3KPSA 2QHRL 4M7ZB 3QDAA 5AD0A 3NTCL 4L3EB 3MBEC 2PW2B 3SDDA 4EUPA 5FK9B 4NQEB 4YNYB 1X5ZA 1I9RL 3DBXA 4L4VA 1W0VA 4G8GE 1U92A 3W0WB 1HXMB 1MPAH 1W0YT 3UJIH 2G5BA 3ECBA 1A1NB 3BYYA 3X3GH 4NKIL 1IEHA 3LB6C 5FA3B 3MA9L 1MFDH 2JB6A 5CSZA 2WBJD 2ESVE 5C0IB 3V5KB 4IM8A 4XPAH 4GSDL 1UENA 4X9IA 2Y6SD 3X12B 5GRYA 4ONFH 1ZLVH 5EORL 2A0LD 3CFBB 4MD5A 3U36A 1ED3A 1AXTH 4XBEL 4DK3A 1U2CA 1QEWA 4MCZB 4ETQA 4XTRC 5E8EA 2ZSWA 2OZ4A 1U8MB 2EYSA 4PGCA 3LDBB 2DQUL 4HK0A 3B9AA 3TVMB 4HWZA 2BRRL 1FRGL 4GRMB 3CFEA 4JJ5B 3OKLB 4WWID 4ZSOB 1RIHL 1IGJB 5I17A 4O5LL 3OKYA 3VXRB 2A6DA 1JGVH 4W6WB 4K9EH 5C86A 5CMAB 4MCYA 3FFDB 5F1IA 4FZ8L 1EAPA 3NAAH 2J1KA 4I18A 3ZKMD 2VABA 1RZFL 4NZJA 5D7KD 4GUPB 5GSVA 5J11B 3BGMA 1PX3A 4TSCH 2CO7B 4I4WA 1N3NB 5BVJB 5ISZD 3P0YH 1TZHA 3GB7A 3VXSE 1S9WB 2J8HA 3O6FC 3TLRA 5CBEB 1J05B 3WHXB 2F5BL 1WEJL 2BC4B 2O26U 4H1LA 5FCUH 3QFDB 3HE7A 1NGPL 2NY2D 5HHOB 4DOHE 4NCDA 1ETZB 1QA9A 2FIKB 3ROOA 1HHKA 3H42H 1KB5L 1ZANH 2CKBB 4LSTH 1T80A 3QIBB 3LHPL 3QNYA 1NANH 4U1MB 3C60B 3HNSL 4LLQA 3PHOB 2C3XA 5CSBA 2XTJB 1KIQB 2HT3D 4YXHH 3RWIB 2LABA 3U48A 1JV5A 1KPVB 5IJKC 1R5VB 4GAYA 1SVCP 1I8LA 5HGAA 1AXSB 3RWHA 1OTSC 4G8GD 4EIZC 3WLBA 3KAAA 4GG8A 1DQLH 3WIHL 1BD2D 1K5NA 2IBZX 1N59B 4XWOD 5DJXA 3QZWG 3VFVA 1AHWA 3MNWB 1NMCB 3A0OA 2ZPKL 4ODBD 3H6JA 1DVFC 5T3XE 2MOVA 4EXPX 1T0MA 5KSVB 2GTWA 1KC5L 2AXJA 1OPGL 1JTPA 2OR9H 4X7TA 4PJAB 2Y36L 5C2BH 3L3IB 2X4UB 1UYWL 4YPGB 5M7QA 1N0XL 2HKFL 2H32H 3IGAB 3CFKB 5BW7C 3WFBH 4ZFFB 2OTWA 3K46A 5FO7A 1CBVL 4RWYH 3WJJC 1U8QA 3MBED 4XCFL 4KAQH 1OLLA 5CIPH 2YPKB 4OZGE 4HS8H 4Z8FL 1BFVL 3SDDD 4CDGC 3IDJA 3IDNB 3G5XB 3ARRA 4PBXA 4KRLB 2VE6B 2P7TA 2R23B 1XGRA 1W0WB 3QQ9D 3B3IB 2ICWI 3LB6D 4J1UB 2IWGA 1F3DJ 4DK6A 3VXSD 3LV3A 1MCKA 3GBNH 2ITDA 4KHTL 2BNUB 3DURA 3MGTA 5JNYB 4FFZL 4JN2B 4GT7A 1MREH 4S2SB 1FE8L 5T3ZH 4KTDL 1WCQA 4XTRD 1LK3H 3EOBB 4DGVH 2VAJA 4ZUUB 3H7BB 2XY2A 4EBQH 4JN1L 3WIFB 1BQHB 3L5IA 3RU8H 4WI4A 4B41A 3U30B 4HK3N 3IAPA 3MNZB 2MPAL 3IKCB 4IOIB 4KJPC 4U1NB 2R2BA 3V4PH 5JXAH 1XF5B 4OLVH 5DRWB 3G5ZA 4ZTOH 4JRYB 5CD5C 1FLRL 4FMFA 4XI5D 3F8UB 2FH6A 3ZHLA 1MUJA 2X4QA 4KVCH 4PRIB 5DQDH 3WN5A 1KCVL 2UY7A 5C09B 3ARBC 2WLYA 2KQNA 4GRWB 3VXUB 4X4YB 3MRJA 4Z7QF 3MJ9L 2OSLA 4OLYL 4XVUD 1PG7H 3MMEB 3QI9B 2BVPB 2E9JA 4HMCA 4CJ0A 1XIWA 2DKMA 3H9ZA 3QQ3B 3I02A 5BMFH 5DMYA 5DD6A 4NRYA 5T5NG 2FSEB 5D6DC 3QEGL 4FQPA 3CX5J 2WIMA 3BW9A 4O9HL 3JV0A 4P2QE 1IL1B 2YN5A 2YZ1A 1ZA3A 5EIVA 5DGQA 1KIPA 3PWPE 1TZGL 3L6FA 1QYGL 1NBZA 4GSDH 1OTSD 3TIEB 1ULVA 3MLVL 5E6IB 5ENWB 5DEZA 4ELME 1CVRA 4PJ5E 4EI5A 4UBDD 3VXMA 3GSVB 1Z0MA 4A2LA 1I1RA 3F5WB 5IOPA 2NY1C 4M61B 4XPGH 4XC3L 3ARUA 4MB5A 5KSBB 1F2XK 1CDGA 1CFTB 4PBVC 4GKNA 4OLZL 1YEGH 3TPUA 3MV9E 1QR1B 3L3KB 1OAYH 2R2EA 1VDGA 3IETB 1CG9A 3RVVD 1RIHH 1M7IA 1LK2A 2ZCHL 3EYUH 2AEIT 3GI8L 4NZTL 4PRNA 4WFGE 4Y8DC 1MCDA 1JHTA 4RGMC 3VCLA 2A6JA 3FO9B 5HYJE 4QXTA 4I0PB 1SQ2N 3MRBA 3CUPB 5ALBL 4P4KA 4P46A 4DQOH 3C8HA 2VTFA 4L8SA 3ZE2F 1CD8A 5IG7B 3MLSH 2Y23A 2CRIA 1I9IL 5DEGA 4AEIL 3QCTH 3LHPH 4TPRH 2DQFB 1T5XB 4Y2DB 3H9YA 1OP5K 5D7IE 5CHNB 3QUKB 5DR5H 3VD4A 5ID0A 2OJEA 2GIYA 3FQUA 1E4WL 3IAGC 4U3XA 5EC2B 4W81A 3PIQB 3JXAA 4U2YA 3W9DB 3L9RB 1S7XA 4V2BA 5DVNA 3PGDB 3WIHH 5SWQA 1YDPB 3GM8A 1G0YR 1MWAB 2AQ2A 3OKMB 3MLWH 2GUOA 1DL7H 3NGBC 4P2QD 2OR8A 3SGEI 3OJDB 2UUDK 4N0FA 3IDIA 5DJZB 3PWPD 1Q72L 3D0VB 4K7FA 4KJPD 1DDHA 1KC5H 5JZ7C 1NC2D 2AKRA 1DUZA 5CKGA 1F42A 3IJYB 4LAJH 4Z18A 1ZVHA 1GAFL 1P4BH 2DLTA 2FGWL 5CD5D 2DTSA 2YD7A 2F53B 1K9TA 4PJ5D 4GS7B 1A0QL 5F7LB 5HHQA 1RJYB 2MMXA 2FHCA 2V5TA 4Y4FB 1N0XH 2AXFB 3UPRA 1G7QB 4MQ7A 2XKSA 2H32A 2OXGA 1BVLB 3MUGA 4RAUB 3T3PF 4X6CB 1MCLA 4LARH 4Y5XB 1EHLL 1DBJL 1YEDA 3MV9D 4NOFA 2E9BA 1T7XA 5CIPA 4F37K 1BFVH 4M7KH 3FT2A 4HIEB 3UPAA 1NFIB 2CDGA 3U9PL 4OCWH 4WFGD 3L3GA 1CTNA 1IFHL 4LAQL 5DRXA 2IBZY 4JFOA 2H1PL 4CU7A 2MQ3A 5LAXA 1X6LA 1A22B 1AGCA 4U1GB 1KCRL 1QSEE 3BHBB 1F02I 4XNZC 4KHTH 2E8YA 1RULL 5IMLB 4FFZH 3R8QA 1NDGA 1PKQB 2F15A 2XZQH 4HX1A 3BDXA 4KTDH 4P9MH 5T5FH 2X1PA 5L2KB 2Q3AA 2D7MA 1L0XA 1K2DB 1F6LL 3SQOH 2NY1D 2G75B 4RDQF 4Z7UE 1MHEA 1JWMA 3EOYG 5JIKA 4MDIA 5AWNL 1UXSB 5IW1B 4U3CA 3G6JE 4XCYA 4OFDA 2YD5A 2X4PA 5GGTH 1BM3L 3RPIB 3Q6GH 1PY9A 4YXKL 1IAKB 5GJSL 3T04D 2CIKB 2BX5A 4ZG1A 3BOVA 1YYML 3O3AA 3VFWB 2XG4A 5DJ8B 4K3DH 4NN7B 3ZE0E 5ERWB 3HZKB 2K7PA 2MCPL 3RQ3A 3KPQA 5DZNA 1Q9KB 4WW2B 3HMWH 4P4KD 1B6UA 3O9WA 1ORSA 1X5AA 2YUXA 2NW3A 3VA6A 1MSPA 3RTQA 4DCQB 3DYOA 1Z5LB 1HDMA 3ZO0A 5GGRA 2V9QA 3QEGH 4XCNB 3T2PA 4F7PA 4AG4H 4WU7B 5EZIH 1SBSH 3G5VA 4G3YH 1QUNA 5IV2B 3KLDA 5KANG 1EEZB 3LSOB 4I2XA 2QQNL 3O6KH 1NSNH 3K2UH 5AAMA 4E5XB 1KTLB 1QYGH 5HJ3A 3MUJA 2R0ZL 2F54A 1LP9F 2FHBA 4XVSL 2CK0H 3ZKNC 3IDMA 3MLVH 4JFFE 1GHFL 3HI1B 3DX7A 1U36A 4KU1A 3VXOA 5A40E 5LWYL 5HGDB 3JVGA 5I19L 1MLBA 2AEWA 2YUZA 1UWXH 3ZDYE 2EIZB 1FG2A 2LAGB 3AREA 1OTUC 3ZHKA 3GMPA 1ZWIB 3T0DA 4LCCA 1IT9L 1X5IA 5JZ7D 3QO0B 1KNOA 5HDBF 1KPUA 4JFQB 1I1CA 4RMUA 3QXTA 4OZ4A 5KJRL 1QSED 2AXGA 1R3KB 2ITCA 5L6YH 4PJ7A 2NY7L 5D96B 1UWGL 5JA8B 1OL0A 3RWEA 2BSED 3TZVA 2BNQA 1LP9E 3NZ8B 3VI4E 1SYVA 1GJIA 4PIRF 1X44A 4BFIA 3RWFB 1HQ4A 3JTTA 2VDRH 5SWSA 1AD0A 3Q2CA 4GQPH 5D1ZA 4PJ7F 5BQ7B 4Y5VA 2C3HA 1P5UA 3FRPG 5KSUB 3EO1A 3PV6A 5DTFB 5LQBL 2X2YA 1VCAA 5HDBE 1TTUA 4E42B 5JHDE 4Y5YA 3RZCC 3JWOL 1S3KH 4N68A 5IM7B 4P2CG 4MNHA 5L0QB 3ARDA 1OSZA 1YEIH 4ZOCA 4A6YL 2R0KL 4LGSB 4GW5A 4YFDB 1OB1B 3P0VL 3OB0H 1HHGA 2HLFD 4GMTH 3H0TA 3OGCA 3PWJB 1E4WH 4M6MH 3IXAA 1CLOH 4DEPB 4PJFB 4OUUB 3GSQB 2ATPB 2D3VA 1M4KA 4M5YL 4OZIB 2EKSB 2BY1A 3WIHA 3C5ZC 5FUZL 4CADB 3ISWA 2WWKO 2Z0BA 3GGWA 1QRKA 5C0JB 1FFNA 3MYZA 1EBPA 3EZJB 4X80H 1PVHA 4TNVK 1OCWL 1Q72H 3V5HB 3L3DB 2PCPB 2ZUSA 4G42B 3CIQA 1EJOL 4ZOAA 3NA4A 1I75A 4D9RE 5EBGA 5HYSB 2VDLL 4JFFD 3HRPA 3O8XA 1MF2L 4YDIL 2Q7YB 3L5XL 5LGJB 2H41A 1UACH 4ZFOL 4LP5A 5E4IA 4PJBA 1T2QH 2JE8A 1T1ZA 1J86A 5B38B 1OAXL 3QFJE 5DEFB 4L9DA 3VDBA 1BOGB 4MNGB 5E2UH 3BH9B 3BP6B 4P99A 2VLKB 2R0LH 3SKOA 3R4DA 4K07A 1MCSA 3V4VL 3MLRL 1S8DA 1PG7X 3BUYB 1DBJH 4TNWK 4XAKE 4CMHC 3P40A 1DFBL 4LHUA 4B0MM 3RTQD 1YEFH 5HYEA 4PR5B 4PJBF 1KIUA 5ACZB 3MTRA 1UZ8B 5E7FA 4XXCC 3U9PH 1HHJA 2FNBA 3HCVB 4NIKB 2HFFB 3WSQL 4CRPA 4LAQH 4W68A 4RSVA 1R3LB 3WD5H 1LO3L 1CQKA 5HY9A 2NY5C 5D9SB 2BSRA 1DP0A 1I8KA 5D1QC 3ZKND 4X8JA 5JHDD 1JGEA 1EPFA 2AI0L 2M2DA 3RWDB 5DD3H 1RJLA 1RULH 5GIRB 5F7KC 3UTPE 4MAUH 1BGXH 3B43A 4GRLB 3IB4A 5FYLE 3BKYH 1T1XA 3BAEH 4UNTA 1G84A 1OTUD 3ARSA 3L3OA 1D5ZB 4BZ1H 1L7TH 1I3RA 3TYGL 5CGTA 1L0YA 4NKDB 2DMBA 5CILH 3GIZH 4OM0L 4R7DB 5GS0C 1GIGH 2R56L 4KWUA 1HI6A 3SBWC 1R3HB 4F3FB 4E0RA 4WWKC 4PGEA 2DLFH 3GBMH 3SOBL 2MCG1 4M4PA 3MRRA 3NFPB 4NZDA 4WHYH 5GGTA 1BM3H 5T1MA 3TZVD 2BNQD 3RVTC 5IP4A 2R4SL 4EN3A 4ZPVB 4YXKH 1YECL 4JM2C 1RUQL 4RISH 4EI6B 3CFJA 2R69L 4Z77A 1HKFA 2I60L 3VA2C 4WVRA 4N5EC 4D9RD 3U0WL 5D1ZD 2R8SL 4U1JB 4DGYL 4Y4KA 3GFUA 3AB0B 3RZCD 5ISZB 2FECI 5E9DA 2DLGA 2Q76A 1IC5L 4M48H 4CW1A 5DURD 4P5KB 4YK4B 2ICCA 1BHGA 3E8UL 3GSWB 3QFJD 4U1KB 3QDMA 3AM8C 5D71H 2IFFH 3IFNL 3BSZL 3KYNB 4NHCH 5BO1L 1C5CL 3MYJA 5KVFL 1VHPA 4XAKD 5C7XL 3C8KA 3HN3A 3QIWC 2KDGA 2A6KB 2R0ZH 1A3LL 1DQJB 3SDYL 4AM0B 3EHBD 4O4YH 3C5ZD 4U6TA 3TO4C 4PJCE 3GSNL 3TBVB 1BZ9A 3OSKA 2GITA 5I19H 1HHHA 3QUZC 2ZUXA 2V5SA 1BD2B 3FN0L 4X7DC 3RBGA 5ILTL 4U7SA 3WXVL 1TCRB 1LE5A 5FGRA 4C83B 1IT9H 2AEQL 3IU3A 3SKNB 3MRPA 4XHQA 5KJRH 2I27N 4NT6A 4WHCA 5E08L 2E7BA 1MJ7H 3CXDH 2ICWJ 4JO2L 5ALCH 5GGSY 3RVUC 1UCBL 4J6RH 1LO2H 2XICA 3GMQB 3OPZL 2Y5EA 3VXPA 4O2EA 1X4ZA 1VFUA 5TE7H 4CN1A 3D0LB 1WIUA 1DBAL 1AQDB 3U1SL 1WWAX 1YMME 4NRZB 1HXYB 4NJAL 1Q9WA 5MI0B 2FX8H 3MCKB 2CMRL 4LHUD 5E70A 5TE4L 5LQBH 4XNMB 3KPSB 2OI9B 5AD0B 1EV2E 1N7MH 4HCRL 5CJ8A 4HBCL 3SDDB 4EUPB 5I8OH 5J89A 4HUXA 2IH3A 4PJXA 3DBXB 4L4VB 5I6XC 1W0VB 4L8DA 5F1NB 2QKIA 1U92B 1QSZA 4NO0D 3I50L 2HN7A 2D03L 2DM2A 1FDLH 3ECBB 5D1QD 4QF1A 2ILLA 1WTGT 2JB6B 3RI5K 1FZOA 1X6NA 5CSZB 3P4LA 5MEQA 1NAKH 4R0LC 4M5YH 3SDAC 4PJXF 4NZUH 4CNIB 4Z7OE 4MD5B 2Z93A 2AV1A 3U36B 1ED3B 2BCKA 5GS0D 1G6RH 1QEWB 4ETQB 5E8EB 3ELAT 4HXAL 4P2OA 2XQBL 4WWKD 4RMVA 2EYSB 1J11A 3ULUF 5A1AA 1J1OL 2DQIL 4P5MA 5J13C 4ZAKA 4KMQA 4HK0B 4HWZB 4YDIH 3B8SA 4LKXA 2HJLA 4K71B 4OCRL 3RVTD 2APXA 2ZOLA 1IGIL 2B1HL 2ICEA 3NIDE 4JM2D 1MELA 4YDJA 3LN9A 5I17B 1DQMH 2AP2A 3MRGA 1OAXH 4PV9B 2A6DB 4HC1H 4MCYB 2KUTA 5F1IB 1FGVH 5AG9A 1EAPB 3HZVB 2V2XA 4I18B 3TM6A 3C5JA 3HG1A 4OF7A 4KROB 4P9HC 5DLML 3V4VH 5GSVB 3BGMB 1CU4H 4U1IA 1IM3A 1KFAL 2EDBA 4I4WB 5INDA 2MJWA 1YUHB 2XRAL 3GB7B 3RRQA 3RUGA 3ULUE 4AQOA 3IVKA 4OCSL 4Q9BA 2D7TL 4B7LA 4WJ5A 4H1LB 2VAAA 4O58L 5EOCL 2J88L 1MFBL 4YJZL 3J8F7 3WSQH 3RAJL 1QA9B 1IM9D 3DV4A 3ROOB 1HHKB 3L95A 1LO3H 4M7LT 5TDNA 3QNYB 1FNEB 3DSFH 4X6FB 3QIWD 1X4YA 5BV7H 5FHAL 4LLQB 4WTZG 4KZEL 1NUGA 2NTFA 1QRNE 3RUGF 1PBYA 3UEZA 2GT9A 3O3DA 1ZLWH 4JQVA 4PLKC 1JV5B 1UGNA 4HK3J 2VXSH 3QPQD 4GAYB 4RZCA 5HGAB 3RWHB 4PJHA 3WLBB 4MXWL 4GG8B 4Y16C 1K5NB 3HPLA 5DJXB 3TYGH 2JCCA 1FVCA 3VFVB 1OW0A 1KIRA 1AHWB 5F7HA 1H3PL 2R56H 4QRPA 5BRZE 3T77A 1TENA 5E5MB 1PEZA 1T0MB 3N1FC 3CFDB 3KYMA 4WUUE 3RVUD 5E8OA 1KCUL 2DIJA 3EDFA 4PJHF 4X7TB 5SX5K 5CEYA 1J9CT 1YEKL 2P1YA 4GBXC 1U91A 4BFGA 2I07A 4QHLA 2JCCF 1RUQH 4XXDA 3JV6A 1L6XA 2R69H 1QFHA 3ULVF 4LASL 3X14A 2FR4A 2R9HD 1A21A 2Q86A 2R8SH 4FQCH 5IMMA 4ZFZA 5T5NF 1H3VA 1HNGA 1V7NH 5C6TL 3SE3C 2V5RA 3D39A 1A6VL 4NWTL 1CGXA 5F3BA 1I7TA 3IDJB 5D2NA 4PJHE 1FYTE 1RHFA 2ZSVA 2GEEA 3INUH 3LN5A 2P7TB 1RU9L 1C5CH 3ULVE 3MPCA 4YDKL 3PUCA 4HD9A 2X44D 35C8L 3LV3B 3ULUD 3CSBA 1P7QD 1GSMA 4MVBD 2ITDB 3GSNH 1EMTH 3DURB 3MGTB 3HLAA 1Z2KA 1QLEL 3PWVB 5AZ2L 4J3OC 1HINL 3FN0H 1REIA 3QISA 4OCXL 2CRMA 2AEQH 3OWEA 1QRND 5IB4A 3M8OL 2ZUQC 5IBUG 3EJYD 2XPGA 5E08H 1NC2B 3BD5A 4ZAKD 4HUMB 3WNOA 2IPTL 3EDEA 1MCNA 3WFDL 2R2BB 3D39E 3VGFA 2DTMH 5DI8A 1KELH 3G5ZB 5HHVL 4R26H 4PJ5B 1LHZA 5EFIA 3OPZH 1DN0A 3BIAX 3DRTB 1DANT 1I7ZA 4J3SA 4NQSB 3WN5B 2XXMB 4EOWL 5BRZD 4OBSA 3C5SA 5LGHH 5EUOE 5FFLA 4TYUA 4CU6A 2VXTL 5K9JH 2MKLC 2BSSB 3FKUS 4PJ8A 4WUUD 3W81A 1CF8L 2OSLB 3HZYA 5TE4H 5CAYB 4BZ2L 2VLMD 1KBGL 1U8LA 1XIWB 3FHQA 5MP6H 3TPKA 6CGTA 1OD7A 3I02B 5CJ5A 5J9PA 5I73C 4CVUA 2V2WA 3SJVA 5DD6B 4NRYB 3MJ8B 4LCYA 1E6JL 5CINH 1OM3L 4TTGA 3BW9B 5HYFA 1JZ8A 4JY5H 3BQUC 3NACL 1F13A 5C08E 1UM6L 1ZA3B 1FYHB 1QFPA 4ZUTA 3C6SA 3VD7A 1KIPB 4NM8L 3OAUH 3ZYZA 3EJZD 3WIIH 5FM5M 3L6FB 3KLHC 1BBJA 1NBZB 2BDNL 4WGVB 2LU4A 4KY1H 1IAII 3NCBB 1OARL 3OBAA 4Y16D 2VXUH 4JO3L 3O2VL 4XB7A 4EI5B 1G7JB 4CVZA 3VXMB 1G6RA 3QHZL 1ACYH 2D7NA 3ULVD 2XQBH 3LEXA 1J1OH 5MHSE 3IRPX 4XAWH 2P49B 3SE8L 4GKNB 3TPUB 3S35L 1CG9B 3KPRA 4GAGH 4HAGA 1M7IB 1LK2B 3UJJL 1EX0A 5FKPA 3KPTA 4HC1A 3B2VL 1Z9OA 4XPHL 2CJUL 4PRNB 3NBNA 5FO9B 1I3UA 5DLMH 4GOSA 2GTZA 3VCLB 4NKQB 2A6JB 4DUWA 1MHPL 2DL2A 1KFAH 4QXTB 1VFAB 3D39D 3MRBB 1A7PH 2XRAH 4P4KB 4P46B 2B2XL 4OCSH 2XKNA 5HGHA 4KKNA 4L8SB 2GJ6E 1S5HB 2NY6C 4WV1A 4G9FA 3X3FH 5DEGB 3CLEH 1UM5H 4K7PL 3S36L 4N5UA 3OKOB 3VWJC 2IAMC 3I6KB 5FHAH 3WS3B 2QJDA 1HCFX 4XPBL 3FFCE 1MCPL 2N4IA 2VITA 5ID0B 1D5IL 3T2NL 1L7IL 1LD9A 2OJEB 3FQUB 1MCEA 1UH4A 3U9UA 5EBWA 5EZJA 3BP4B 1I8LC 3BPOC 3EO9L 3FB6A 1S7XB 3OV6A 5SWQB 1AR1C 2GUOB 4PRHA 1MJUL 5GRXG 1NL0H 1ZV5A 5C08D 1H3PH 3DNKA 3VWKC 1JI1A 4N0FB 5EDXA 3IDIB 3DUUA 1VENA 2YUVA 4K7FB 1DDHB 3SPVA 2AKRB 1KN4H 1QSEB 4TTDC 4IRZL 1I1FA 2J8UF 3QEHA 4ZXBA 5HDLA 1QO3A 3RKPA 5HHQB 1EGJH 5L8KB 3GSRA 2BVYA 4LASH 3UPRB 4G9FE 1HH6A 2EC9T 4MQ7B 4Z7UB 3UZQA 4JHAL 4JZJC 1KYOK 3AS0A 3FO0H 5MHSD 3P30H 5TFSL 1VADA 1J5OL 4KK5C 4PJ8D 4XP1L 2DI8A 2HTKC 1YEDB 5EIQA 2HRLA 3F6IA 4X98A 5CIPB 2J4WH 4EZMA 4KQ3L 4HFWA 2ZUUA 2OLDA 1WZLA 4BZYA 5FYKL 2DQEH 1Y6KR 4ERSH 2J8UE 2QQQA 2CDGB 1D6EB 2P8PA 3BQUD 2YK1H 4NBYB 3H3KA 4XMPH 3L3GB 1KJ2L 1RU9H 1RIVH 2HFEB 5DRXB 1BIIA 1MOEA 2VMFA 4JFOB 1EBAA 4RGNC 3ZE1F 3KLHD 4PJ9C 2X70B 5LAXB 5IESH 1UVQA 1EZVX 4XNZB 1INEL 1U93B 5B21A 3GSXA 1RUML 3G6DL 3GSNA 2GJ6D 1FSKB 1QLEH 1KCSH 2D4FA 4JHZA 1AY1L 2ZG1A 5AZ2H 4JQIL 3NABL 4Z7VA 3AS3A 3OJMB 3FRPA 3LKRB 4P57A 1WICA 3FAXA 3FFCD 3QXWA 1MHEB 1ZOXA 1JWMB 4JM4L 3KJ6L 3U4EA 3EDJA 4WO4C 4MDIB 4TVPE 4X6DA 2VXVL 2IPTH 3LIZL 1AGFA 3ZE1E 4FMKA 3P4MA 4XCYB 5HHVH 5KS9A 4Z7VF 3Q5YA 5LBSH 5EA0L 3MCLL 1V3KA 4P3WA 5KVEL 4LF3A 4XBPA 1J0IA 1NBVH 1EFXA 1J1XL 1NGZA 4L8BA 4R8WH 4EOWH 4H8WC 4I0CC 1JUFA 3O3AB 4X6DF 5HI5C 2Y9RT 5JA9A 4MLIA 4LEXL 1CF8H 1S7VA 5I1KL 3RVXD 4BZ2H 2B4CH 2GJJA 1KBGH 3E3QE 1PEWA 1CI5A 1ORSB 2NW3B 3RTQB 4TUOA 2NY6D 1LP9B 1Y18B 5C92A 5EBLA 1HDMB 4OGAC 4G9FD 5GGRB 1ADQH 4F7PB 2IAMD 5BS0E 3G5VB 4UQ2A 3DROB 4U2ZA 4H88H 2X1WL 1GL4B 4G6AD 1LQSR 1QHPA 4IS6A 1I1YA 4I2XB 5CBAA 5HJ3B 5JHDB 2F54B 5GRUL 3IDMB 5A2FA 1U0QA 3SGEH 4IEFB 3O2VH 3SGDI 3VXOB 1M7DA 5EIIA 3CDYA 4N9GA 1AR1D 2IANE 2EE2A 2MNUA 3WCYA 1MLBB 3VWKD 1FG2B 1EEQA 3AREB 5IF0A 5IVXA 3GMPB 4J4PA 2PN5A 3GMLA 1YC7A 4OGYH 4JPKL 1TJIH 4LCCB 3FRUA 1KNOB 1KPUB 1KB9J 4TTDD 3A67H 1RZ8A 4OZ4B 5KAQG 4OT1H 3SE8H 4P2YA 4PJ7B 1IEAA 3RWEB 3ZKSD 4ZXBD 2ZCKH 3TZVB 4UT9H 2BNQB 5IVXF 3UJJH 1RFDH 5GGVH 1SYVB 3B2VH 4XPHH 4BFIB 1HQ4B 5SWSB 1XR8A 1AD0B 1Z9LA 3VFPA 4TVPD 1MHPH 5D1ZB 5FOJA 2HTKD 4Y5VB 3EO1B 4GJTB 4RFNB 3PV6B 4Y5YB 3THML 4YIQA 2ICWA 4XP6H 3MLTA 5MENA 5B22A 4ZQKA 4X83A 2A1WL 4MNHB 1RQ5A 1OSZB 2HFGH 3MLXH 5IGXL 3C8DA 1TVHA 1IRAY 5HPOA 4GW5B 3KVQA 1MFEH 4PJ9D 1RSFA 2FL5A 3CLFH 4Q7DA 4F9LA 5ACLA 3UTTA 4OCYL 3T2NH 4EDXA 1HHGB 2IADA 3H0TB 3OGCB 3EO0A 1NPUA 2WSKA 3IXAB 3V6ZA 4FQIL 4ODWA 2EDRA 1TETL 3GGWB 2YA1A 4YHPA 3QWOA 1WBXA 2NY4B 4YUEH 2W07A 3MX0A 4ENED 4WO4D 4NQCE 2GY5A 2KPNA 3VW3H 4X4ZA 4ACPA 1MFAL 4FQ1L 3MO1A 2NY3B 3Q0HA 2IAND 1DBMH 3IDYC 4R97C 2P5WA 2WANA 1EGJA 2JELH 2FRGP 3ARYA 4PJBB 1I8IA 1T1ZB 3O4OB 3SCMC 2P45B 4IIQC 1Q0YL 3RY6A 4MZ3A 4JHAH 2H3NA 1AI1L 3LEYL 3LS4L 5HI5D 5TFSH 1FH5L 4XMLH 3SKOB 3K8LA 2G5RA 5CZVL 4IJ3B 4LHUB 4Z7WE 3S8WA 1FNHA 5KSAA 1RVFH 2ARJB 4FQXA 3OQ3B 3RFZC 1CD1A 4FP8H 3SGKC 4KKAC 2CKBL 2EZ0C 3GJEA 3V0VA 1HHJB 4OKVA 4UV4L 4YLQT 2CR3A 2FBOJ 4PD4K 4NO0B 2AV7A 4KJQC 1IZKA 3ALWA 4LCWA 1UFUA 5HY9B 2GI7A 1NMBL 1ZT1A 1TJGL 4NKMA 2BSRB 1I8KB 5C2UB 1A4JA 4LSSL 5L7XL 1E6OL 1IGFH 3BKML 1NBQA 2ZG3A 4X8JB 1JGEB 3QEUA 1QNZL 1RUMH 1PSKH 3BP5A 1RJLB 2GK0A 3LQZA 2QBWA 2X7LA 2ZOKA 1IJ9A 1N5AB 1CDCA 4OJFH 12E8L 3NABH 4WY7L 1T1XB 3LCYA 2ICES 1JPGA 3L3OB 5FF6A 1AGEA 2LE9A 1F11B 5I9QC 5ICXA 1SEQL 4WUKL 4WWKB 1HI6B 1JRHL 4E0RB 1CDYA 4PGEB 3GRWL 4Y8AA 4LQ1A 5IWLC 2WIIA 3H2WA 3M17A 1RUKH 3CSYA 3P4OA 4PG2A 2FYYA 4QHNA 5T1MB 5KVEH 2Z31C 4PP1C 4EN3B 3V7AG 4YHKH 2UUDH 2ADJA 3CFJB 4Z77B 3NIFF 4NQCD 4JFHE 5CJOH 1F8TL 1NKRA 5BVPL 2M8XA 3R1GL 4JAMA 1H8OA 5DD0L 4ZFGL 5E9DB 1ZLVK 4B7IA 1EFQA 1JN6A 2JIXA 4HWNA 4CW1B 3GZKA 1EZVY 2UWEA 3HE6A 1QPPA 5EBMA 3SKJL 3UO1L 1ADQA 5KW9L 3QDMB 1R5WA 4NC1C 1GGCH 1RZGA 1QBML 2JK5A 1NBYA 4NHUA 3VMOA 4W6YB 1EEYA 3MNVB 3DHMA 3MYJB 1QFWI 3WV0A 1D6VL 3PDGA 3C8KB 2OYPA 3NIFE 4TSAL 5HPMA 3VI3E 4S1SL 3WKNA 4BQ9A 4JG0L 1B0GA 2QSQA 3F12A 2UWEF 3C08L 3M1BA 1RZ7H 2EC8A 1BZ9B 4XB8A 2GITB 5IFAH 3RWJA 4DW2H 1HHHB 3ULSA 5I1EH 2QQLH 4I0KA 4UTAL 5CEXA 3GO1H 1LE5B 3U6RA 3FONA 3IU3B 3MRPB 1TQBC 2WW8A 4Q6IC 1RIUL 4NKOA 4NT6B 3UTSA 2EXWD 2NXYB 3WDHA 4NO2B 4RGOL 3AVEA 4JVUA 4Y4HA 1BWWA 4HLJA 4ODUA 2P5WD 3OR6A 3SCMD 3A6CH 3FB7A 3OXRA 4KPHL 1E28A 4NJ9L 4XHJC 3VXPB 4LVOC 2BK8A 3BT2L 4O2EB 4WTZA 1BX2A 4HZAA 1NFDA 3REWA 4DAGH 3BPNC 5I75C 4Z7NE 2H8PA 3WL9B 1CFVL 4OZHF 5KSAD 2QQKL 4LVNC 4FQXD 4KKAD 4HUUB 2EZ0D 3QZWB 5E4EC 1JGLL 2HA1A 4HUXB 2IH3B 2F19H 4PJXB 3KDMB 3UTZA 2EDOA 3ARDC 4WHTA 1NFDF 4L8DB 2AXHA 5DK2B 1U8OA 2HN7B 1Z3GL 4LOUC 5GJTH 5C07E 2FBJL 4LCWD 5DUPL 3F65A 1LO5A 4QF1B 2BY2A 2X5PA 3V52H 3MOQA 2M1KA 2IGFH 1OSPH 5D6CB 3NPSC 3UROR 3UTQA 1FZOB 3SO3B 2VO5A 5GZOC 3RX7A 1T83A 2HJFA 4XP5L 3QAZC 4R2GC 2Y1VA 1SBBA 4P48A 1AQKL 1KGCE 1TETH 4OZHE 1I3VA 4KRMB 3X13A 3IFOA 5ICYB 3CMGA 4YDLB 3EYVA 5L9DH 3LS5L 5C0CE 2Z93B 2AV1B 5FYJL 2WAHA 1BREA 1FVDA 1ZTXH 4P2OB 1NFDE 8FABB 3OJVC 2OS7A 4QXGL 4ZAKB 1YY8A 4LKXB 2HJLB 4X4ME 2AJZA 2Z31D 2ZOLB 4QHMA 2ICEB 2J5LC 3Q48A 4YDJB 1F3JA 1HNFA 2VXQH 1Q0YH 2GFBA 3MRGB 1SM3L 4ALAH 5I1HL 2O5XL 1WCBA 3CPLA 3LEYH 3VFSB 3LS4H 5BRZB 4RCAA 1FH5H 1W8NA 2V2XB 3C5JB 3HG1B 2R4RL 1N5YL 3ES6A 5D2LA 4WUUB 2W65B 3G9AB 1NCAH 4U1IB 1JHLH 1IM3B 5IW6A 4N8VG 5INDB 2YD9A 2R15A 4AYFA 5HVHC 4G7YL 2JIXD 3NCYS 3IVKB 5DSCB 4FA8A 2W0FA 4LMQE 2CKBH 3HE6D 4WJ5B 3N9GH 4E41A 4UV4H 2X4SA 2CLRA 5DD1L 3L3JB 4PB9H 1P84K 5FGSA 1ZT4A 3DV4B 1UJ3C 1HZHH 3L95B 1FBIH 3RY4A 4OLEA 5D2LF 4Y88A 1PD6A 3WFCL 5L7XH 3K7UA 2NTFB 1L9MA 1TQCC 4M5ZL 2GT9B 3O3DB 1Y6NR 1X5YA 5J0BA 4BH8A 1MWAL 5T1LA 4RZCB 4PJHB 3C2AL 3OAYK 1Q9LA 4OSUH 1OGAE 3L5JA 1HIMH 3EOTL 4YQXL 5C07D 1KUMA 3HPLB 3L5HA 2JCCB 4QRUA 1FVCB 3QUYA 1KIRB 1FFOA 2X89A 4LFHG 2NR6C 3T77B 2QEJA 1KENL 1CL7H 4K3EH 4R3SB 4V1DA 3D69A 3KYMB 1LO0H 1WAAA 2AK4A 1UQSA 4M9PA 5E8OB 4AT6A 3ZKXB 3S35X 3B5HA 5CEYB 1KGCD 4M8QA 1XGQA 1U91B 5KOVC 3HFML 3QEQE 2QV2A 4BELD 2I07B 4QHLB 1OAQH 4XXDB 3WBDA 2P5EE 3JV6B 4EJ1C 5F44A 2DLIA 3X14B 4JKKA 3P11H 2Q86B 2R1XA 5IMMB 2R2HA 5I8CB 3R1GH 3STZA 3S34L 2NTSP 3D39B 4ZFGH 1EHXA 1QQDA 1ZHBA 3MLZL 2F5AL 1ZLUK 5F3BB 1U95A 4QLRA 3L1OH 4V2CB 32C2A 2Z4QA 5CEZH 4K7PX 4NN5C 1TLKA 4LOUD 3S36X 5D2NB 5KW9H 5F1KC 1PLGL 1QBMH 1DN2A 2ZSVB 5E56A 4R90L 3LN5B 5EUOB 1FNSH 2CGRL 5E95B 1DQQA 4AEEA 1BJ8A 4N0UA 2B5IC 1HYSD 1NANI 4TSAH 1M05A 1HH9A 3MRCA 3LKPA 1U42A 4JFPA 3N85H 4R2GD 4BSWA 1DQDL 5F7WC 3C08H 3OX8A 4Y19A 3ZDXE 1JWUA 4MJ6A 1RHHA 5DFTA 4WDIA 4NNPL 3HLAB 3S7GA 4AMKL 5GSRA 5I1JH 5HHME 3HMXL 3BDYH 4LSRH 2HLAA 4UTAH 5HVGB 1ZLSL 2EH8L 1A02N 3SE4C 4F58H 4HF5H 4JHBA 4MA7L 4QHUA 4LHJB 5AAWA 4JZOA 1RIUH 4OD2A 2I5YH 5IEKA 3STLA 2CUHA 4ZNEA 1OT2A 4AEFA 1CXFA 4UU9A 1OGAD 2YBRA 1D9KA 3CDGA 5DI8B 5F6IC 3IFPA 4PPTA 4ISVB 5EFIB 4I3SL 2DM7A 4NJ9H 3VRJB 1DN0B 4Z0BL 5TJWK 4Y1AE 3ZTJG 1I7ZB 5LVEA 3KXFA 4LNRB 5IHLB 2CK2A 4UIMA 2F8OA 3C5SB 4GKOA 1NUFA 5E8NA 3CZFA 3BH8A 4PJ8B 5I1CL 3FOMB 4B50A 4NQEA 3HZYB 4OF6A 3ALXA 1U8LB 3ESUF 1WQVT 3W0WA 5J9PB 1MCBA 4HMDA 2V2WB 3SJVB 5I1IL 5J12B 1A1NA 4LCYB 5ICZB 1FAIH 3S97C 1EO8H 5FA3A 4K23L 2FBJH 5DUPH 1FGNL 4KHXL 4KH2A 1F45A 3VDAA 4KMTH 4RFEA 5HDQH 5AG8A 1BBJB 1FIGH 2VZOA 5EU6A 3HI5L 4S1RH 5FDYA 1QVOA 1U3HC 2NXZC 3C9NB 3KJ4C 3HKFA 4WI2A 5EOQL 2I26N 4Z9KB 5FYJH 4CVZB 4PRPE 4D9LL 2OJZH 3Q5OA 1G6RB 2NR6D 2X89D 4X7SH 4YWGH 2E3VA 1FLTX 3TVMA 3LEXB 3I2CL 4HQQH 1I9JH 5GQBA 4QXGH 1F58L 1OAUH 5CGYC 4AK1A 1J0ZA 5C0BE 3VXRA 3CZJA 4JREC 2ZG2A 1FPTL 4F7CA 3KPRB 1OQXA 5FCSH 1SM3H 3MODL 5FKPB 5DHYB 1IKFL 3MLPA 3QCVL 5M95B 4KUZL 4KKBD 1S9WA 2GTZB 1F5WA 3KPLB 5DJ2A 1NCNA 1H5BA 5CS7A 3QH3A 4I77H 4DN3H 5HHOA 3F58L 4RWHA 3PL6A 2XKNB 5HGHB 2CKBA 1WFTA 2YRPA 3QIBA 4Y1AD 1G1YA 2FEDD 4WV1B 4G9FB 3UX9B 2IAMB 4MX7B 1DBKH 1KF9B 3RWIA 2FIRT 4P2RA 5BV7B 1BMGA 1AXSA 3NCMA 1LD9B 4XX1G 4F7EA 3U9UB 4RMSA 3EIFA 5EBWB 5EZJB 3MV01 4G6JL 3TV3L 1IGMH 3FB6B 2J8UB 5JUEL 3EOTH 2ZNXA 2BJML 2E6JA 4PRHB 3O2DL 4YDVB 3D3VE 4QWWC 3U2SA 5DK0B 4KK8C 3HZMA 3DWTA 4PJAA 3D9AL 3SPVB 4QNPE 2X4UA 2YD3A 2VLRA 1D9KD 1BLNA 4GQ9L 4ZXBB 3HFMH 5IFHL 3BJLA 5FDWA 1LNUA 1A7QL 1ZHNB 1U3JA 4HHAA 4PRPD 1PW3A 1H3WM 4C56E 3C6LA 5DA4A 3GSRB 2F8XC 1HH6B 1H8SA 1VEPA 1BEYL 1MQ8A 5LXGL 3P77A 1VADB 1WGOA 5IVZB 5IB5A 1JZ3A 4M1DL 5C0BD 4RFOH 3DHJA 3IDNA 4EQ2A 2FJHA 3MLZH 2YC1A 4X98B 1DZBA 1X5XA 4HFWB 2HG5A 3ZL4H 1UWXK 3HUJF 5LKNA 3HA0A 1X5FA 2PETA 3RBSA 4OIBA 2P8PB 3D1MC 4HH8A 1J10A 1NC4D 2FO1A 3S88H 5E2VL 5FGCB 3R8BB 1BIIB 4HWUA 4PJ9B 1IAIH 5EH1A 2ZCLH 3KR3L 5JNYA 2HRPH 4UT6L 3NH7L 4JCLA 4PGBA 1UVQB 1DQDH 1FL3B 3KNBA 3REVA 4ODSL 1U3HD 3GSXB 3V0AC 4AMKH 1XT5A 4Z7VB 5JOEA 1NLBH 5KAQF 4K8RH 4AL8H 1ZLSH 4Q0XH 3MNZA 3U4BL 3HUJE 4MHHI 3DMMA 4P57B 3IKCA 4MA7H 1G0DA 5TH2A 1JE6A 5EZLB 3QRGL 4HUNB 5KVGH 5L8LB 2E7HA 5FM5O 2CR6A 5CGYD 3U4EB 2NY0B 4M6NH 4X6DB 2A83A 4MA1B 4XNUL 4P4RB 1AGFB 1YNLL 2O5YH 1K3IA 3GK8H 2IANB 5IMOA 1CXLA 4I3SH 5F71A 5C09A 4OLXH 2AGJL 1LO4H 4LF3B 1NGZB 3D3VD 1EFXB 3Q1SH 4L8BB 3DRQA 4K7PY 2EKJA 1MAMH 3B4NA 3OB0K 1JUFB 4YZFF 3QRFM 3BO8A 1OTTC 4D94A 5J4MA 1OT1A 1S7VB 4F15B 5GGUA 3OF6D 3DVFA 5SX5H 1OD9A 2VLJE 4UV7L 3QUXA 4XBGB 3JWOC 5DUMH 3BJ91 4HMEA 4TUOB 3VFUA 1A6WH 4C56D 1S7SA 4RNRB 1IVLA 3GKWL 2E27L 4K23H 3RDTD 1CGVA 2QADD 3CX5K 1NGQL 3SEPA 4IS6B 5F96L 1YMHB 1WLHA 5ENWA 3BPCA 4Q58C 5F9OL 4S1DC 5E0QA 2Q7NA 2K7QA 5EIIB 1M7DB 1FL5A 4MD4A 4N9GB 5I71B 2X40A 4OQ1A 2GSIA 3LMJL 3PDDA 5IF0B 4QWWD 5IVXB 2VZ3A 1CIUA 1OP9A 1H3TA 4KK8D 1CFTA 4S11A 5D7SH 4PJGA 2C3WA 1VEOA 4KI5F 3FRUB 1WISA 1IGCL 1WBZA 1RZ8B 4HIHB 2EO9A 2G60L 5FUOH 3NIGF 4DFHA 3AUVA 4YHZL 1CD0A 1FO0H 2FB4L 3FAWA 1IEAB 1QFUL 2VLRD 1PJ9A 2XN9A 4ODHL 2PO6A 1WV7T 1IKFH 3QCVH 3L7EA 4PJGF 3FO1A 3QP3A 4N8CH 4KUZH 1MHHA 1EVUA 1GVIA 1XR8B 4I48A 1AO7E 4APQA 4LSQH 1ZEAL 4L8CA 3EDKA 5F9AC 5FGBA 1HK6A 3MACL 3QPXL 3H9SA 3F58H 5IG7A 4JY6A 4OAWB 3RJQB 5JLZA 1TFHA 5T1DH 5EPMA 4YIQB 2ICWB 4Q9QL 3MLTB 4BYHA 5MENB 1AP2A 1V3MA 3MV8A 4DKEH 2QL1A 1BJMA 1KXTB 5ESAA 1JCKA 4F2MB 1TVHB 1Q8MA 4D2NA 2QSTA 1P5VA 5DK3A 1GPOL 2VLJD 4RBPH 5H2BA 3UTTB 4F7TA 3TA3C 4EDXB 2IADB 5J8OA 3EO0B 3V6ZB 4RMWA 2EEAA 4G6JH 4G5ZH 2CKNA 5JUEH 4ODWB 2BJMH 1ZVYA 3PP4L 2OZ4L 1WBXB 3O2DH 4X7EC 4BQ8A 15C8L 3BYTA 3DMMD 2Z35A 5H94B 4GKZA 3B2UD 2P4AB 4PJIA 1XFPA 1GGUA 4YGVA 2WUBL 5SX4I 4TUKH 3O41A 3PWLA 3OG4B 1LEGA 4GQ9H 1CLZH 1A7QH 2P5WB 1I8IB 3TN0A 4NPYB 3MJ7B 4DTGL 2E7LA 4G7VH 4TRPH 1ORQA 2NX5A 5H35B 4NQDE 2H3NB 3MRDA 2PXYA 4PJIF 3VXNA 1H0DA 1A7BA 1OHQA 1W72H 4ORZC 1CLCA 1UEMA 4HJJH 4FQLL 1JPST 1NFIA 3QUXD 2YN3A 1QBLL 3QDJE 3IFLH 2EC9U 5KSAB 4PLOB 2D31A 4YC2B 1JPTL 2XA3A 4FQXB 2X10A 4KTEH 5A3ID 2YR3A 1T89C 3FHAA 1CD1B 3I84A 3QDGA 4KRPD 1WF5A 3GJEB 1QFWL 3V0VB 3BWAA 4OKVB 4KGJA 3EYFA 2W9DL 3O3EB 5J1SC 4UINL 1AO7D 5E2VH 4LCWB 3V0WL 3NVQA 1IKNA 1Q1JL 2P8LA 4NKMB 4M7LH 3SGDH 1JPFB 3NH7H 1A4JB 2EDLA 4RAHA 4ODSH 3BP5B 2GK0B 2X7LB 2ZOKB 5DFWH 3ZTJH 4BQCA 5JQ6H 3O2WL 5JIIA 1Z9MA 1UG9A 5FF6B 1RUPL 1AGEB 4UIKH 1MQKH 3O6LH 5IKCA 3L7FA 4JFEE 3HNVL 4KJWC 1I4FA 1G9NL 2Z9TA 5I76B 1A64A 4MNQE 3O4LE 2VZUA 4QYOB 1SJEA 3B6SA 1FNFA 1BQSA 2BXYA 1YNLH 2QSCH 3BGAA 3K1DA 3MC0A 4P23C 3M17B 2CIKA 3CSYB 3P4OB 5GZNC 1PZ5A 1O7VA 2FYYB 2XN9D 2Z31B 1CGWA 3MRIB 3VFWA 2ADJB 1UA6H 1GC1L 3ARWA 2ADIA 3OKEA 3WUWG 1T0NB 1YNKH 4IRJC 2X9YA 4WENB 4BJLA 3H9SD 3T2QA 5EUKA 1A6PA 2JJTA 4JAMB 3UYOD 4LVHC 3P4NB 5CUSL 3S96B 1JN6B 2JIXB 3SDXE 4FG6D 2IFGA 2UWEB 2WWKT 1CDHA 3HE6B 2E27H 5EBMB 2PKDA 4NQDD 3GSUA 1R5WB 4E5XA 1R3IH 1NBYB 2HP4A 3BZ4A 1EEYB 3B9KC 2A6IA 4MS8D 5GS2D 4NNYA 2KQMA 5GHWH 3TA3D 1CGSH 3ARFC 5HPMB 3QDJD 4XP4L 5MERA 1B0GB 1XF2A 4LHQB 3F12B 5ITBH 3IU4H 1HKLL 5F9OH 2AJVH 1ZWIA 4J7RA 3M1BB 4OFYD 2BHUA 1CZ8H 5KBNC 2BVOA 2VZ1A 3RWJB 3IDXH 3IDUA 3ULSB 3GNML 5TQ0L 5C07B 3DI3B 3PDOA 5D7LE 1JYNA 2XZZA 5CEXB 3PQYA 4N8VA 4ONGL 1F4HA 3U6RB 1T7VA 3CK0H 3FONB 1F00I 4MJ5A 2LFGA 4L9LA 4J3WA 4NKOB 1XH3A 1FO0A 1NGXA 1F97A 2PF6A 3UC0L 1MVUB 4Y4HB 3UZVB 3WS6C 3T08A 4OZHB 3OR6B 3RWFA 3KPOA 1UT9A 2W38A 3FB7B 4IRSA 4PJEF 3T0WA 3MRQA 4QRRE 3V6OA 1E28B 2W9LA 3LH2L 2YKLL 2FX7H 3EDDA 4JFED 2NX5D 2DQJH 4YHMH 2FGZA 3VGDA 1BX2B 1H3XA 1NFDB 3REWB 4MNQD 3O4LD 1QZ1A 3F7VA 4JG1L 4D3CL 4QGTA 5A2IH 5AEAA 1ZLWK 3AMKA 5DFVD 4LLMA 2BNRA 2CPCA 5DDHA 3SDCA 2V5YA 3ARGA 4OKDA 1MPAL 1UEYA 3UJIL 1ZXQA 1C5BH 4WHTB 1Q0XL 5D5MF 1U8OB 3WE6A 4LGRB 4ONHA 3GSOB 3PWJA 4PJEE 25C8H 3ABZA 4FQHA 1LO5B 2BY3A 4MWFA 1GPOH 4MXVF 2X9XA 5K59E 4G6KH 4OUUA 3GSQA 4XPAL 1A5FL 5KOMC 4X6EA 3NA9L 1N64L 3UTQB 5FIEA 3V6FA 2HJFB 1A6AA 1MCIA 1FIEA 2DQHH 1JMXA 3MRFB 1AXTL 3DO7A 4AIOA 4LKCA 1I1AC 3V5HA 5ANMA 4LLWA 3X13B 3IFOB 3L3DA 3FT3A 7FABH 4MAYC 3O2DA 3EYVB 4G42A 3V6OE 4MD0A 1NKOA 5FA4A 1FVDB 4D8PA 5D5ME 2OTUA 4K2UL 2Q7YA 5FKAB 3TFKC 4PY7A 4P23D 3T0VA 4AIXA 1YY8B 3DJ9A 5GZND 4Z0XB 4HPOH 1XCQA 1X3DA 1JGVL 5KVMC 4K9EL 5HD8C 4QHMB 3DIFA 3BH9A 3BP6A 1NCUA 2IMNA 3FQRA 3NAAL 5GRWA 1F3JB 1YPZE 2VYRE 5E2WL 5JPNA 5D7LD 2GFBB 5LGKA 2IPUG 4KRNA 1ZHLA 5BZDA 1WCBB 3CPLB 3FQNA 3U0PA 4TSCL 5FUCC 1KJMB 5F7NC 5C0NC 1W72A 3MV7E 3I3BA 3P0YL 2CUMA 2XA8H 3ES6B 2B8OT 5D2LB 1KULA 3E1F1 4O02H 2W0LA 1U8PA 5FCUL 1LDPH 1MRCL 1P84J 1JGDA 2P24A 4QRRD 2W0FB 1ZANL 4HKXA 1CFSA 1QFWH 2VQUA 3C09B 4LSTL 1P6FA 3TJHC 4CDHA 3QT2A 5D9SA 2CLRB 4WIQA 3B9KD 5IBUB 1ZT4B 4XNQA 3JWDL 1E4XH 4D9QD 2WBWB 4H26A 3H8NA 2WBJA 3ARFD 4YXHL 2QR0B 5GIRA 4G6FD 2AK1H 3P9LA 3SY0A 4BFEA 3BKJH 3MRHA 4BH8B 1DQLL 3O2WH 2V7HB 5T1LB 4JB9H 4QTIH 1E27A 1Q9LB 1RUPH 1R3HA 4F3FA 4QRUB 3QUYB 1FFOB 1G6VK 2RB8A 3HNVH 5FUCE 2ZUTA 3T4YB 4J3VA 4ODTH 2OR9L 1NCBH 5D7JA 4V1DB 3D69B 4WFEE 5I74B 4R96A 5C2BL 1UQSB 4EI6A 1CWVA 4AT6B 1B6DA 3V9FA 1XGQB 3QIUC 3R0NA 1CXIA 1U6AL 5HHPA 4DVRH 5DD5H 1JNJA 4MHHG 3WFBL 1S78C 5H37H 3ARZA 4RWYL 3FMGH 5ISZA 1MIEL 2R1XB 4KAQL 2R2HB 3KLAA 4HS8L 4OD3L 1IBGL 2BNRD 3MA7A 4L4TE 3STZB 5HI4C 1I85A 1ZHBB 1INDH 3EJJX 3SDCD 3RX8A 1EK3A 1U95B 5IVNA 5DQJB 2XQYG 3ARGD 2Z4QB 4LFHD 4CAGA 1I7RA 3MV7D 2A6KA 3QULA 5T1KD 1CICC 3UXFA 1DQQB 2VUOA 4TOYH 4XNYH 2X1XR 4AM0A 4C59B 4ZTPL 1A4KB 3GBNL 5FOBA 1HH9B 5IW3A 1GGBH 3MRCB 4XCCH 6FABH 3LKPB 1FN4B 4G8GA 4JFPB 3W2DH 5TPWH 1EUUA 4BSWB 1S5IL 4GG6E 4Y19B 1BVZA 1MREL 5E24E 3MZTA 5F8QC 4HDIA 1I1AD 1JWUB 4MJ6B 4BQ6A 1LK3L 1RHHB 2IPKA 4DGVL 4WDIB 4MAYD 3CVIH 5GSRB 4EBQL 3RU8L 4FQ2H 1FNLA 2HLAB 5A2JH 2ESVA 4OGXH 2IQ9H 3T0EE 4QHUB 3V4PL 4JZOB 5JXAL 4OD2B 2A38A 4OLVL 1WIOA 3QHFH 4ZTOL 3STLB 3UC0H 3S6CA 5HD8D 4UU9B 4MYWB 4KVCL 3CDGB 1D9KB 4QOKE 5FM4A 5DQDL 3D0LA 3WNPA 3LH2H 5KANI 3EYQC 3LKQA 1AQDA 3VE0A 3B9VA 1HILB 4UIMB 4JG1H 5DWUL 3MBEA 3CZFB 4YHLH 4IMKC 4U33A 4D3CH 3BH8B 4WFED 4OGZA 5F7FA 5DJ6B 4BUHA 5BMFL 1N4XL 5F1NA 1K3ZA 2EDFA 3H3PH 4I1NB 3VGAB 4AQ1B 3EAKA 1Q0XH 2LVCA 1WVZA 1Z9SA 5I2IB 3VXSA 1WUNT 4DZBB 3FOLA 1JIBA 1A7RL 3I3EA 4LVEA 1A5FH 8CGTA 4L4TD 3NA9H 1N64H 4CNIA 4RFEB 1HSBA 4NN6B 3HAEG 5F6HJ 5EU6B 2VH5L 1MRFH 1OGTA 1QVOB 4CUCA 2RHEA 1UZ6E 2WWMC 3PWUB 5GS1C 2Z8SA 4XPGL 3SKMA 2I9TA 1RK0A 1R24A 5DVMA 2D7QA 3DXAE 2OP4H 4K2UH 5F3HA 1YEGL 4XX1E 5D7JD 5JR1H 4BK5A 1NEZG 4HUKB 1OAYL 1I8MA 1OWRM 4PRDB 4P3CH 3N1QC 5EULV 4I3GA 4PV9A 3QIUD 3EYUL 4U6YA 3UCRA 3KPPB 4YHYB 3CXHJ 2OL3B 2QHLA 3HZVA 4F7CB 5E2WH 1JFQL 2X4RA 1RZJC 1P1ZA 1S78D 3T0ED 1IARB 1KV3A 4P5TC 3UBXG 1PDKA 1S7UA 3O6FA 3TF7C 1VGKA 1YUHA 5HGGS 5DRNA 3SE9H 1K8IA 2YD2A 4KXZI 4W70A 4DQOL 5DJ2B 5HI4D 1H5BB 3QH3B 5JHLH 4ZNCD 1MRCH 3PL6B 3MLSL 4QOKD 1IAOA 1CYGA 3IJSA 4BK4A 3QCTL 1MH5A 4JDTL 1N0LA 1FNEA 4TPRL 4X6FA 5D72H 3PNWA 1VACA 4BSJA 1CICD 3JWDH 5CCKL 3RDTB 1FHGA 1MFCH 2QADB 3AY4C 4L1HA 5DR5L 1NCTA 1A7NH 4XP9L 5IJKA 4P2RB 1CT8A 1L0QA 4OZGA 5JMOC 3ZYJA 2BFVL 1YYLH 3KYKH 4LLVA 4XNXH 4P59H 3NCYP 1TPXB 4PRBA 2Z8WC 4F7EB 5B39G 3K1KC 4NGHL 3MLWL 1DL7L 2F74A 4FTV