4L4JA

Crystal structure of fc-fragment of human igg2-sigma antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
ASSVFLFPPKPKDTLMISRTPEVTCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An engineered Fc variant of an IgG eliminates all immune effector functions via structural perturbations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-2 chain C region
total genus 40
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA01
5I1IL 4LVHB 1CFSB 3BPOB 4GKSB 1MIEH 4WY7H 4ALAL 4DN4H 4PJGF 4UNTA 3UO1L 5D7JD 3EOAB 4Z77B 3BQUC 1T22B 2YD7A 2FX7L 3B9EA 5T3ZE 1BF2A 4JY6B 5IQ7H 4L8SB 4U6YA 1R3LA 1SYVB 3T1FA 1BLNA 2DN7A 3QDGB 5GGTL 3LKRA 2C1OA 4LBEA 3KPLA 2WWMC 1YECH 3FO2A 1K4DB 1UWEH 4MA3A 3NABL 3VDBA 3K46A 4F2MB 3QDGA 2W38A 4LF3A 2DQIH 2WNGA 2BOCA 5JXEA 5C08B 3WHE1 5E8PA 3KPOB 4XNQA 2Q8BL 3ZTNH 4XCEA 1RZJH 2YUXA 4M00A 4JN2B 4YQXH 3B8YA 5E9DB 2K3TA 4GUPB 1MFDL 2IFFH 3J8F7 2R1YA 5HVGB 4JRXD 3CFIC 4UMGA 4Z7QE 4ORGA 1UZ6F 5I1IH 3MV01 5L2KD 2CMRH 3TC9A 5CZKA 3QEGL 4QO1A 3WUWG 2GYSA 5KVEL 4ALAH 1W0YT 2V5YA 3NIDE 3BIAX 4LGPB 2RBLA 4YH6A 1GOFA 2WBJB 1NSNL 4GAFB 2P8LB 4HUWB 4PYGA 1JP5A 4RMRA 3C9NB 2YSSA 4K3GA 4X6CF 4XVJH 4HT1H 1SBSH 3I2CL 5D2NE 2BSRB 4PJAA 1IL1A 4HIXL 4A6YH 3NFSL 1DN0B 3SDCD 4X5XB 4NPYA 5IB4B 3QRGH 1T2XA 4G43A 3VXUD 3K2MC 2X42A 3SDAB 3VFWB 3WLBB 2CRMA 2R0LH 4KDTA 5EZJB 3ARZA 5E94A 4G42B 1BQUA 3NA9H 4DAGL 1NMCB 4Q2ZB 1GOGA 4H20L 2CUIA 3HZMA 3VGBA 4XMLH 2V17L 2EIZB 3WFDL 4HWBH 4FQHA 3WE6A 4GOSA 1I1AA 3GIVB 4WV1C 4JM4L 3F7YB 3DBXB 5C0JB 2EDYA 1DSFL 3MUHL 3UYRH 4G3YL 2AGJL 3HI5L 1CXHA 3FFDB 2QQQA 1JPGA 4MA3B 4Z7WF 2D03H 4M4PA 3AM8A 5IFJB 2ED7A 1EAJA 1OARL 4POZD 3ULSB 1UJ3B 4QHMB 4E42A 1ZAGA 3KYNA 5HHQB 5IJKC 1J8HD 4PP1D 4X5WB 4WW2B 2BK8A 3LHPH 4JFDE 1YECL 5CHNA 4U6HA 3NCMA 4GBXC 3QJFA 5I1EH 4MQXD 5GZOC 4BQ8A 4HBQA 4RFEA 3RY5A 4D9RE 4TSAH 4G6KL 1DBAH 3WKNA 4O2EB 3MLXH 4Z7UA 3LKNB 5DHVH 3OWEA 4C56B 1JZ4A 1UM4H 2CJUH 4GRLB 1RHHB 5B38A 2B1AL 4X0KA 5F6HJ 3MXVH 3FQXA 5INDA 5JOPE 1Q1JL 1W72B 4GW5A 1MY7A 2A6DA 3QNZB 1RUQL 4RAUB 5HHQA 3BPLB 4MJIB 4OCWL 2APTA 2BSRA 4PJAB 1MJ8L 3V4VL 4ZAKB 3B8SA 4JLRA 2ZJSH 1QO3A 4MJ4A 3NMEA 3OJVC 4MAYC 4P4KA 1NCDH 2UZIH 4U1JA 1KJ2B 5KS9A 3IKKA 3V6FB 4ODTH 3B43A 4YDIH 1G7MB 2HVKB 3GBLA 1IGMH 3ULUF 3SJVD 1H8OA 2ATPA 3SE4C 3QUYB 2IQ9H 3L7EA 4M48H 3T3PE 1JJUA 4Y4KA 1GZQB 1KUMA 4Z7OF 1NDGA 4JCLA 5DMKB 1FLRH 1M7IB 1MF2H 3SE3A 5KVMC 2YK1L 5CD5D 1T1XB 1G6RH 4APQB 4R2GB 5DJZB 5L7XL 1NBVH 1N5YL 4PJ7F 1DBAL 5DYOB 5D7IA 5DQJB 1EAPB 1KIPA 4Z18A 1C5BL 3T3PF 3ESVF 4XPBL 2BSTA 1DVFD 3CFEA 3TO4B 3WNMA 1HSAA 5DQDL 3HE7A 2UVFA 2X1WL 3HI5H 4J7RA 3CCHB 3R8BB 2XY1A 5KZCB 1P7KB 3QCTL 3IRPX 1CCZA 4N68A 1MI5D 3N85L 3EBAA 5JIKA 1TIUA 1R6VA 5CGMA 5JR1L 3AMKA 2IAMA 5DC4B 1TVHA 3MRRB 2CIIA 1IGYA 1DQDL 3GSOA 4X7DC 3S3JA 4XVTH 4G8EB 3ET9F 2D9CA 5DO2D 4NC1E 3H9YA 2J8UE 2DQCL 3NZHL 1HDMB 3GSVA 2NY6B 3OZ9H 4PG9B 3VA6A 4Z78A 2DM3A 3G6JE 2D31B 2VLRD 3RQ3A 3DX6A 1F4AA 4GAGH 1QPXA 5BRZB 4HJGB 3TPUB 1HDMA 4PG9A 4EI6B 4UNVA 4YJZL 4P2QE 3VI3F 4P9ML 1MFAL 5D2LF 4CU8A 5GSRA 3MCG1 4M02A 1MF2L 4YZFE 4RCAA 3MLRL 4CN6A 5E56A 1MFNA 4PJHA 1AO7A 3RPIB 5FOBA 3S36X 2D7QA 1VEMA 3BRDA 1CFVH 4YXKH 5C6WH 2V5MA 5C08E 5T3XE 1P4BH 4UDTB 2VSDA 4WHYH 2XTJC 2DQJH 2BY3A 3S6CA 1HHIA 1LO2H 1VGKA 1S3KH 5D1ZD 1KIRB 1TQCC 4HKJB 5I76B 1QBAA 3G04A 1ZE3C 3OX8A 4LKCB 1SBSL 3I2CH 4POZC 3TBYA 5BOPA 1I1RA 3OV6A 4U1NB 4OLWH 2FGZA 1AIFA 1T04B 5DMIH 2FJHA 4N0YL 4JHZA 4OKDA 4EVNA 1W8NA 2IANB 3A6CH 2DIJA 2E8ZA 3WIFB 4YXHH 3FOLB 4G5ZL 3TIEB 2XZZA 3LRSA 1IEAB 1G7IB 2NXZB 3OHXA 1MFBL 4OIIH 5I76A 4KU1A 4X9HA 2NTFB 4DVRH 3B2UC 4XX1G 4YHML 4LARH 1RUMH 2CXKA 3S5LG 3VFNA 5IR1A 4JFEA 1QSVA 5GS0H 4C55A 2A74A 4Y19A 5EU5A 5F1NA 5E8PB 4EJ1C 1YN7B 3FQWA 3ARVA 1CDCA 2VH5H 3DRQA 3EJYC 4YHLL 4Z8FH 5IEHA 5C0EA 1P7QD 3QH3B 1SMOA 1J5OH 3WO3B 3VW3L 4NN6B 3FOMA 1G6RB 3MOQA 1GAFL 4OZFA 3ZKQD 2PUQT 2XWJB 3STLA 3E2HC 1N7ML 3TIEA 1T89A 3IT8D 2EO1A 5C0DB 2UWEE 1MIML 2P5ED 1OTSD 1UWXK 1YEHH 3ALPA 5BV7B 4ZODA 1SJXA 1OWWA 1P4LA 5LCVH 5D7IE 5MEOB 5LJYH 5JNYA 2B5IB 4TVSa 5GRJH 4LLYA 5C0AA 4JG0L 2B39A 3BVNA 5DXWA 4TNWK 1JTPA 4HDIB 3MV9D 3T4AA 3U4EA 4F15C 1C12A 3GBNL 4BM7A 3BPNC 3ELAT 5ERWB 3ABZA 3RDTA 2HFFB 1ED3A 4TUJA 4PP2B 4Q97A 4Z7VB 1CGTA 3BUTA 4Q6IA 3ZE0F 2P1YA 1S3KL 1E4XI 4KDTC 4JAMB 4PTUB 2XWJA 3BN9D 1I9IL 2AI0H 3G5YA 1G9NC 2X89D 3VG9B 1MH5A 2ADIB 1NCUA 3OG4B 5C0CD 1YEIH 5HHXL 4ZTOH 4LCCB 1JPTL 4Q9QH 2AJZA 4NQDD 1FNFA 5F8RC 4FXGB 5JPNA 1LDPH 3WE6B 4NUGH 3D48R 4WUKL 3T4AB 4EVNB 5C0CA 3SDDD 1DQLL 1OAQH 3OB0H 3OXSA 1G7IA 3NIGE 4KJWC 5GRUL 4R2GD 1YNLL 3Q1SH 1S9XA 4PRIB 1LE9A 5F9JA 1Q9OA 1EUUA 4IOFD 3SDDA 3KHOA 1Z9OA 1ES0B 2BMKB 4YGVA 4BFIB 1UXSA 3N1FC 4OCNC 5BMFL 2FLBT 1BQLH 4BYHA 1QFPA 4G7VL 4C56E 4ELKB 5DEGB 2ED8A 4IDJL 5ILTH 2ITDA 3QDHA 2NY2D 1RJZB 2I26N 4JO3L 2GSGA 5EUKB 1SY6H 3EYOB 4MGXA 2X9YA 2IAMC 4ZXBC 1PG7W 2KZ1B 3MPCA 4K3EH 3LZFL 5CMAB 4YEFA 4H1LB 5ISZB 4EI5C 1HHGB 5HVHB 4PY7B 4EUPA 4C56A 3GEWB 5IW3A 5LCVL 4KKNA 5C09B 1BREA 4PRPA 4UI2A 2Y9RT 2YD9A 3BDYH 2NPLX 2GUOA 3MR9A 3OKEB 3HR5A 3P0VH 1J1OH 1KJMB 2E9IA 3VRLF 1WISA 5EDXA 1UG9A 3DYMA 2MSPA 2F58H 2ITDB 1N59B 4WEUD 5LGHH 3O8XA 2J5LC 5D72H 5DVMA 1JVKA 1MCHA 4HSQA 3UEZA 4S2SA 3ZT6A 3SE4A 5IGXH 4WI9A 4OI9A 5IM7B 4LU5H 1WAAA 3U7WL 3U30C 1Z3GH 5FK9A 1G9NL 3MNZB 4ZAKC 5JW4M 4UAOB 3PIQA 2Q76B 3QO0A 4GS7C 5JHLH 4MD4A 2DJSA 3ARBA 4BK4A 3GB7B 1T1XA 4APQA 1A3RH 4LLWA 2COQA 3U0PA 1A3QA 2H32A 5GGUB 3DXAD 5I73B 3V6ZA 5J9PA 4XX1E 1G7HB 4HV8B 3WIHA 1CLCA 1NGZB 5DHXB 3JWNC 4ISVA 3MREA 4ZO9A 4M7ZC 4ZUVA 1KFAL 3ALWA 1DQQA 3MA7A 4QRTB 1A8JH 5K9JL 3RY4A 4YLQT 4OFVA 1DLHB 2BY0A 3NIFF 5CJ8A 3E3QE 2UZYB 2Z8VC 3MNWA 5E6ID 5BMFH 1U8JB 2XWBB 1C7TA 5F3BB 1JYXA 4LLVB 3A67L 2A6KB 4MDIB 2AERT 1P2CA 2JB5H 2JB6B 3TYFA 5D1QD 1J0YA 5DJAA 3K4ZA 4C57C 2HH0L 2EKSA 2CKBB 3BGFB 5JDJA 3CXDH 5IB3B 4HC1H 4X4ME 4CW1A 3RKDD 4HAFA 1RUPH 2Y23A 4ZOAA 2OL3L 3RY6A 2EYTA 1I9IH 4QRTA 2YBRB 4F15B 4LASH 1S8DB 3OB0K 2I9TB 1J8HE 5GZNC 3JTSB 3TA3C 1REIA 1TPXB 1MRFL 1A7OH 3PL6A 3ULSA 3NCJH 3VGAC 3LZFH 4PLJC 1J1OL 3IDMA 3ARRA 3FTGA 4NM4H 1KXTB 4LSQH 3TBTA 5CHNB 3CUPA 1Q1JH 2Y06H 3OJ2C 4OQTA 1F3RB 2HVJB 3SJVE 4RGND 4IMKC 2BSED 1NUDA 4IOSD 1FVDB 3WEXB 1I1YA 5K9JH 4F7EB 2VZOA 2HVJA 1L6ZA 4LPTA 4UINL 4DKFH 4KZDL 3SKMA 2VDOH 1EHLH 3I84A 3O6ML 5E00B 5IFAL 2VISB 4JRYB 1W72H 4UT7L 4YX2L 5B3JE 1CDHA 3BGMA 3FMGL 4P3WA 5C0JA 5GGUA 3LN4A 5EZOL 4IDJH 4JRYA 4XWOD 2MNUA 1OCWL 3NFNA 1DUZB 5TQ2L 4E41E 2F19H 4LCWD 3NCEB 5BVJB 1NGXA 5LXGH 1Z5LA 4YBHA 4ONGL 1AE6L 1JHLL 4E41D 3O3DB 1I4FB 4KK8C 5IVZA 1TZIB 2EE9A 1DQLH 4WUUE 3SKOB 1CD9B 1OAXH 5E9DA 2Z91B 1ZT4B 5DEFB 5CLTA 3FL7A 1XGPA 4CRPA 4KK6D 4NQEE 1S9KC 2XWTB 2D7OA 1N5AB 4P99A 4PRIE 5JQ6H 2XWBA 3MV8B 4ZPVB 3VD3A 4NKDA 3LMJH 1OM3L 2FRGP 1MCDA 3ARWA 2XG5A 1I75A 3VXPB 1D5ZA 3OXRA 1DEDA 2CH8A 2HT3D 5L0QC 1NUNB 2VLJE 4UBDD 4P23B 5FYKL 4J3WA 3C09C 3D3VD 3REWA 5I1AA 4OLVH 5C0RL 4LCIL 3HMXA 2QADD 4YDLC 1X5HA 5CP7A 5KW9H 3G9AB 1KC5H 2QJDA 4YAQB 1WBZB 1YC8A 5DRXA 3FT3B 2YUVA 1UA6H 4OZHA 3SDYH 1DANU 5ESVA 4QRPB 1N5AA 1TVHB 5B8CA 3VH8G 3B83A 2WUBL 3OSKA 4J4PA 3RBGA 4P5TB 4RWHA 5D2NC 1JWMA 3CIQA 3G6JA 4Z0BL 3F5WB 5C0FA 4HUNB 4PJBB 4GG6E 2XIDA 5FM4A 4JKLA 4U1GB 4JFFA 4P5TA 3C5SB 1WITA 1ZSDA 3O41B 4HMCA 4L3EE 2H1PH 1MCEA 5GGRY 1QLRA 4PJFE 3TYGH 1NFDF 4KKBC 4JZJC 5IEKA 5D7IB 2JTDA 3EYUL 3IB4A 3FFCD 4HCRL 2Y07H 3RWCB 1A64A 3U9UA 3RTQB 2HP4A 4WDIB 4RGMC 2VL5B 4OZHE 1RIVH 4ODWB 2P47B 2E8YA 5FUOL 2EDQA 1PG7H 3QEQD 2ZCKH 3L5XL 4KHXH 5FUCC 4WW2A 1RZ8B 3HCVA 3ZTJH 1SVCP 5C07A 2F5BL 3OKYA 1INDH 1OP9A 4I0PC 4OF5A 1ORQA 4X8JB 4PJEF 4NO2B 2J1KA 4O51B 1FDLH 4HKXA 1U91A 2V7NB 4XNZC 3OF6D 4CKVX 1HN1A 1J8HA 1OWRM 3KXFD 2YS4A 2P8PA 4CVZA 3IU3A 3EO9H 3HMWH 3RTQA 1J0KA 1MELA 4LNVA 3NGBB 2IANA 5KVEH 3HUJB 3H9SE 5C86A 2F53B 4FTVE 3F7QA 4JZNA 5C9KA 5ENWB 3W5MA 1FL5A 4LCIH 1P7QB 3HR5B 3O6FA 1N7MH 4PJHF 5T3XL 1KXQE 2A2QT 4EIZC 2CR3A 1G7MA 3TESA 2HT2C 3AVEA 4QCIA 4M6AA 4B0MM 2MQCA 2KKQA 3CDCA 4WU7B 1FZJB 4NQCA 3G04B 4J1UB 2YA0A 3A0OA 2EDWA 1LVEA 3IS0X 3ZKSD 5I19L 5C0EB 1AKJD 4OTXL 4MNGE 3VXNA 1MOEA 4EZMA 1FE8L 4L4VB 3UC0L 2WUCL 3MX0A 1K3IA 3VDCA 1SM3H 3ARDD 4NQUA 3MROA 4NRXA 5MEND 1WFTA 4ZFZB 3QO1B 5E1AA 1P4LB 3CFBA 1VENA 2R15A 2NY3D 4MA1B 3CXHJ 2UWEA 3GJEB 1YN6A 3WO4B 3PWVB 2PW2A 1FYTD 4NYLA 1C08B 2NMSA 3MLWH 2NZ9D 1YN6B 2GT9A 3EFDH 1VHPA 1MHCB 5CEYA 3MJ9L 2DQGL 4J3TA 1MWAH 1ZT1B 3UJIL 1XH3B 3GO1L 5JHDB 4S0TD 4JFEE 1S9YA 3QUYD 4GH7B 3KYMB 5EU6E 2O5YL 3MLYL 5ISZE 4OTXH 2FWOA 4HS6B 4CBPA 3OX8B 4LKCA 5F21B 4U1KB 4M61B 1FZOA 4YDJB 4JFQB 1S78D 4JHWH 3BPOC 3OKMA 5AZ2L 1P1ZB 2XN9D 4X7EC 2B4CL 5CILH 2E5EA 5C0AB 2VDMH 1KB5L 4K3JH 5DHVA 5FEBA 4UDTA 4KGJA 5L88L 2OXHA 4OUUB 4OZIB 2V7HA 3E0GA 1VERA 1RUKL 1NC2B 2X10A 4PJEB 2XTLA 1MLBB 3PDDA 2D3VA 2BP3A 5KN5B 5H35A 1KTDA 2CXGA 1KLGB 1T0NA 2IH1B 4Q74A 3RVWC 4RA0C 3PHOB 4CAGA 4O2CB 1H0DA 3RGVC 4ODVL 4YFDB 1NUFA 2DM4A 3IDMB 4UTBH 3PGCB 5DK0B 4JFDB 4FNLL 4AH2A 5DEGA 4JPWH 4LHUA 2FJHB 2BVQA 4K8RH 3UTSE 1J88A 5EIIA 3FZUC 1Y18B 4JQXA 3QH3A 2DDQH 1NEZB 5HHPB 2CDGA 3H9ZA 5EWIL 2BNRD 3QCUL 4S10A 2EDNA 3RI5K 3C6LC 1TQBB 4OD2B 3Q6GL 3ZZ1A 3WFHA 4WFEE 1UJTA 1RMFL 4PJCB 1U6AH 2E27L 4OF0A 3PV6B 4NC1C 1UKQA 3K2UL 3V5DA 4D9QD 3ARED 2AJSH 2BNRA 4KQ4L 3SJVB 2CLRB 1CT8A 5IVXB 3AUVA 3W2DL 3V7AG 2FD6H 4C4KO 3BE1H 3WCYA 2BOCB 4JR9H 1CU4H 4NRZB 1OSZA 1QO3B 4LMQE 4G3YH 1DBMH 2CDGB 1MUJB 1NFIA 1QLEL 1F4WL 4CGTA 1EEZB 1VESA 2NQCA 3VJ6B 1LNUB 3O2DH 3QXAB 2XTJE 4N0CD 2FWOB 1HQRA 4HS6A 3GJFB 4PV8B 4M7LL 3B9DA 4I0PA 1M71A 3ROOA 1SEBA 2DQEL 5GRVL 4EBQH 2VITA 1RJLB 1MPAH 2FIKB 3H3PH 3O3EB 3CDFA 1VFBA 4N8VB 1BZ7B 3WS3A 1F3DJ 1CXEA 3NAAL 4Z7VA 4FQ2L 1DBBL 1JHKL 4ERSL 3D25A 4KHTL 4JO3H 1DEEB 4MA8L 3WS3B 3IDYC 2R2EA 3GSNA 4ZD3H 1U8PA 1IC5H 1FJ1A 4TQEL 3SDAA 2XT1B 5DFTA 1EHXA 1YEDA 4JB9L 3IFLL 1NC4D 4MJ2A 4R96A 2A0LC 1S9WA 3OKOA 3O6FC 3RAJH 2OK0H 4X4ZA 5I1JH 3LIZH 4GAYA 3WSQL 2IWGA 4PJBA 4OCXL 5JHLL 2PO6C 1A3LH 4B41A 2NNAB 4I48B 2OTWA 2V6HA 5C6PB 1HWGB 2Q7YA 3GHBL 3ZHDA 3O4LB 4V1DD 4JQIL 1GRWA 1HSAB 4QTHB 3PP3K 4C83B 5SV4A 3CLEH 4JE4B 5EG6C 1YDPB 5CINH 4MMXC 2R69L 5DJ2B 5EBLB 5FGCB 4Y1AE 4KKLC 2G9HB 4TPRH 4FQCL 3BZ4B 5BXFA 4FABL 1MI5E 1JK8B 2AJSL 5FO9B 4XPFH 2PYEB 2Z8RA 1UGNA 3ULVC 1HOCA 4N0RA 5E99H 3EYVA 5FO9A 1H15B 5J1TC 3CDGB 4U6VH 2NXZC 2W9LA 4N8CL 1F6AB 2NW2B 4JFED 4X5WA 1MHEB 4KQ4H 1JI1A 1GZPB 5EZOH 2EC8A 4PJ5A 3BEWB 4FFVC 2Y06L 5F96L 1WWAX 2BERA 3P4OA 4HT1L 2Q86A 3V7AE 4F7EA 4M03A 4KMQA 4GKZA 1L0QA 4R8WL 3RZCD 5BRZE 1PY9A 1ZWIB 4P4RA 3M17A 2Z93B 3K80A 1FZMB 1A3LL 3MGTA 5DWUL 3UJIH 1MRDH 4Z77A 1R3IH 4PB0H 1JFQH 2DWEA 4LCWE 5IIEB 1FLTX 2EC9U 3TBSA 4PJXB 4FNLH 4N0CC 1XR8A 3WFZA 1F8TL 2HWZH 3R0MA 5IBLC 2P7TA 2YC1A 4PPTA 2IC2A 4JN1H 5EA0H 2VDKL 1RK1A 1FGNH 3DROA 1MREL 1HWHB 3BRGC 3VXRA 3BGAA 2G5BB 4HWUA 4XPFL 3BSZL 3BISA 4HUUA 1J8KA 4M93B 1JN6A 1SJHA 2G75A 4AIZA 4M7LH 3L3GA 4PJBF 1QG3A 2CK0H 4G80A 3ORJA 2DLHA 4WO4D 4EOWL 4YBLB 5ICXB 2H9GA 1KACB 1J18A 1UM6L 5JZ7C 1TJGH 4X6FA 3FQWB 4MLIA 1HCVA 4GAYB 3LEVL 5CEZL 1I3VA 2Q87A 3RGVA 4WTXA 2VXSL 1CK0L 2C4FT 2J6EA 4M1CD 1OSPH 2FBOJ 2WLZA 3V6ZB 5JMRA 4S1DC 4QTHA 1ZHKA 1JNHB 4S1QH 1D6EB 4IRSD 2BOBB 3TCLB 2OBGA 2P8LA 4HUWA 3AB0B 3PGDA 4NSKA 2UUDH 2M1KA 2EKSB 2B8OT 2BSSB 5D6DC 5IMKB 1QSED 2X7LA 3C6LA 4JDTL 5IB3A 3A6CL 3QPQC 5ESVB 3DARA 1EJ6A 2X1QA 1UM4L 32C2B 3BH9B 4AM0A 4YIQA 3UTSD 4OM0H 5E8NA 1MCNA 1MHPH 2R29L 5E08H 4NO0D 5F3BA 1J05B 5KS9E 1S7QA 3KPPB 5E9DD 2ADGB 2DS4A 5CCKH 1JL8A 5HXMA 2DL2A 3VCLB 4OCYL 3R4DA 3G5YB 1OARH 1PG7X 4HLJA 3TCLA 3OAUH 4NQSB 2B20A 4R26L 1HXYA 4LMQI 2WIMA 4YDVA 4MD0A 4BUGA 2OYPA 3LHPL 4P46C 1NCDL 2UZIL 1A5FL 3RU8L 1BGXH 1HZHH 1C12B 3O6KL 1DANT 4D94A 4U6VL 3P9LB 1DQTA 2YPLD 4PBVC 5FOBB 3GSRA 4WGVB 1ONQB 3V4PH 4ODHH 3T0AA 1PFCA 2O61B 4JGMA 3PL6B 5H8DA 2NY2B 1J0ZA 4H8WL 2FATH 5IFHH 4O9HH 1U8HA 2F8VA 2VDNL 1P7HL 3NFNB 1P4IH 1ODAA 2ZNXA 3MJ7B 4DN3L 5E1HB 3QDMB 1WWBX 1K85A 5DMYA 5CAYB 1HI6A 1QRKA 4MS8D 3RX8A 5FKPA 3MODL 2AI0L 5KTEL 4LQ1A 2F53D 3BSZH 5D7JB 1FN4A 2GTWB 2VZ1A 2VZ3A 3MO1A 3OKDB 3ULVE 3MYJA 3QQ9C 1CR9L 1NCWH 1N64H 3DMMC 5HGAA 5HYFA 1T83A 1RZKC 2PTVA 5EOCL 5B3JF 1BQHG 3SDDB 5I74C 4F8TA 3QHFL 4V1DB 4ODWA 2DMBA 2BJMH 4GQ9H 1OAZL 4J6RH 2X70B 2IAMD 4JDTH 3FO9A 1NBVL 5B3NA 1N2RA 2C3GA 5JUEH 2HG5A 5CBAB 2AV7B 1VGEL 4ZQKA 1UB5A 3B9VA 3UTTB 4C59B 4WEBL 3PP3H 1KTRL 3DX8B 2XY2A 5ICZB 2I5YH 1IZKA 1IEBB 3LN5A 3G5XA 2W65B 2NCMA 3K81A 3BP5A 2X1XR 2HT4C 1BOGB 5D71L 2J8UB 2ZUUA 5E2WL 2VITB 3LQAL 2AXFB 4JREB 5JNYB 3ZKND 1MHHB 5IQ7L 1WBZA 3SDCB 3QG7H 3HE7B 2WWKT 3WV0A 5EIVA 3NACL 2HFFA 2XTJB 3MRCA 5HYIA 2CSPA 4KK5C 1IAOA 1RZJC 3VFOB 3GMRA 3ZYIA 3L6FA 1U95B 1X5ZA 4H8WC 2OR8A 1KENL 1QA9A 3IAQA 3QUMB 1Q9LA 1IQDA 4M8VA 4HEME 4YUEL 2J88L 4L3EB 3HI1A 4XCNA 1QFWI 1FVEA 1IAIM 3RWEA 2A6IA 2Z92A 4H25B 4NP4H 1MFDH 5JDSB 1GGTA 5IF0A 3GGWA 4HHAA 3DO7B 5EO1B 3BI9X 2VLKB 1BVZA 1U91B 4HUXA 1RY7B 5JPNB 3RJQB 4OFIA 1EGJL 1WZ1H 3AU1A 3IFNL 2VKWA 3P0YH 5F7KC 5IF0B 4F57H 5TH2B 4Z7WB 4EOWH 5GISL 2Q3ZA 4EI5B 5EUOF 1VKXA 5T3ZH 3L5WA 4PGCB 2VDQL 4NZDA 4D3CL 3MLRH 2Z31C 1J0JA 2A73A 1QSFD 3QIBD 4F9LA 3T08A 5DSCA 1C08A 1T66C 3DETC 2WINB 3FFCA 4Y5YA 2C3HA 1ES0A 5D7LE 4P2OA 3D18B 3M8OH 4OQTH 4NZTH 4PJAE 5DUML 1NCAH 4K3JL 1XGYH 2AK1H 4OGYH 4PUBH 3VFVA 4O2CA 5A16B 3I3BA 3Q5YA 1ZA3A 5EZJA 3JVGA 3GBMH 1OL0A 5I8KL 1CFQA 2XFXA 4NCC2 3TT1H 1JZ6A 1GGIL 3L3KA 4NKMA 1TPXC 2MWCA 1A1NB 3WJLA 8FABA 3IDNA 3AREB 4NOBA 2VDOL 5KANG 1JBJA 5E6ZA 5C0IA 4NCDA 5AWNL 3G5VA 4NUJA 2P5EE 4P4RB 4XVUC 2LAGB 4HS8L 4HD9A 1CG9B 2HA1A 1YYLL 1BOGA 4JKWA 2X4UB 3AS3A 3FFCB 2B1HL 1MHHA 4FXLA 1A1MB 1K4DA 5D7LA 3WFCH 3RBSA 1YPZA 1SY6A 4ORZC 2HRPH 1F3JB 4DN3H 1QNZL 1R3LB 5FM5O 3DROB 3DV4A 1FNEA 4Y4KD 1KPRB 3L6FB 1RZJL 1QPPA 2ZKHL 2CMRL 4IJ3B 4P46B 3PL6D 4L8BA 5DUMH 5TDPA 4MCZB 1OSZB 4GAGL 2GT9B 1WC7A 2V2XB 3LQAH 5D1ZA 1ZHNB 4MNQB 3VW3H 2FATL 3KXFB 4RFNC 3X17A 1AD0B 3FT2A 2NY5H 5I1HL 4BZ2L 3VXQA 2DYPA 3HZKA 4YK4B 4R7NA 1MIMH 3MJ8A 2APVA 4HGWA 4A2MA 5CLWA 1F4WH 3QIWC 2VLKE 4PJHE 1BFSA 3EAKA 1X44A 4JY5L 4H88L 1I4FA 4DN4L 2EE6A 2KQMA 1N6QL 3KPSD 1IAIH 5D8JL 1ZANH 4MJIA 3QZWG 4Z0BH 4KHTH 1I8KA 1JWSA 4L4VE 3IETB 3VXOA 1OGAE 5I2IB 5I9QB 4CVWA 1P6FA 1FGVL 4XNXL 1ZV5A 4MB5A 5HGDA 4ZS7L 1AGCB 1M7DB 4YR6B 1Q8MA 2VLRE 5L8JB 3Q6FB 4ZYKB 1U6AL 2RGSA 4GSDH 4ONHA 3PJSB 4HWNA 5T33H 5SWZB 3QWQB 4LQFL 3E6FA 4X9FA 4UDUB 5FYKU 3VXPA 5BO1L 5HHNB 2Z9TA 3GSQB 3SKNA 3D85A 4E5XB 3B4NA 4XPTH 1EX0A 4KVNL 2H26B 4EN3C 1CGXA 4G9DA 2IFFL 1N3NA 3RL1B 3GRWL 4M93C 1KCUL 1Z0NA 2VLME 2R2CA 3C60A 3O2WH 1U2CA 3IDYB 5D5MF 4QGTA 3WNPA 5GGRB 1PG7L 5EU4A 4LLUB 5LG1A 5CIPH 2X40A 4NZRH 5CUSL 3K8LA 3OPZL 3RVXC 2B1AH 3IXAB 5HGBA 5D71H 5E2WH 2X05A 1MCOH 4ONHB 3PGCA 1QSEE 3BJLA 2A9ML 5E2VL 3CDGA 1WWWX 5T1KD 1A4KB 5I30H 5H2BB 3G6DH 2BVYA 1YC7A 3IF1B 3QQ4A 1D5IL 1NLDH 2Y5TB 2A83A 2QL1A 3MRPA 5E4EC 2OTWB 1X5KA 4MHHI 1V7MH 4P3CH 1N26A 3HMWL 5BRZA 4RNRB 3QUZA 3ULVF 2C9AA 2EXWC 4UIKH 1LNUA 3PWJA 4OT1L 1Z0MA 2BCKA 5JW5B 5IK3B 5E2TH 5JMOC 5BJTA 4CVZB 4RMUA 4JO2H 1M71B 4M43L 3PWJB 2H3NB 3Q1SL 5IK3A 2WSKA 4UQ3A 4JM2A 3QXUA 5IROA 2YPLE 4K07A 2UY7A 1NGWB 3T0XA 2DWDB 4U1JB 1VSCA 3L5XH 4D0CA 2R39A 3ALXA 3MA9L 4MQXC 5GZOD 5JIPA 3CU7A 1S7TA 5FF6B 4LIQE 1EEYB 2AV7A 2HH0H 4E0RA 4ZYKA 3BUYA 3GSWB 4NNPL 3PXJA 3VGEA 2OLDA 3PQYB 3P30L 5CKAA 4BZYA 4U1NA 2FCBA 5F9AC 1OD7A 4OSUH 1TENA 4PLJD 3TN0A 4ELMF 3O4LD 1CGSH 3I6LD 1MAMH 2DQCH 3QB7C 4LVHC 4XP9H 2EXYC 2NR6D 3X12A 3OXRB 4WU5A 2BVPA 4QGYA 4X9IA 4Y1AB 4KGLA 1FYHB 2CD0A 3P0VL 4RFNB 3BH8B 3QG6A 1VFMA 2DLFH 5AEAA 2NY4C 3H7BA 1J9CT 4TYUA 5KS9B 1ND0A 1OD9A 3LD8C 4LOUC 1I7UB 4HK3J 3QEHB 3MRJB 4WRLA 1UQSA 3LS4H 1L4IA 2NY5C 3IJHB 5ELIA 3EFFA 4Z95L 2DKMA 5INCB 3NTCL 3O6MH 3SGJC 5IV2A 1X4ZA 5CJOL 4HGKC 4WW1B 3TT3H 1JGLH 3HI1B 4JFZL 2QADC 1T5XA 4Y5XA 4KRMB 2NW2A 3HRZB 2EE3A 4W6WB 2P4AB 4AENA 3WKML 4U3CA 5E1AB 5DQJA 3WUZA 2WM0A 1W0WA 3FB6B 2FEEL 2EDLA 3HRZA 3C8KB 1HHJA 5DI8B 5K9KB 3BKML 4IRZH 4NFCA 1D7FA 1UENA 2DBLL 4GAJL 4FZ8L 4O4YL 3SPVA 5IQ9A 4NJ9H 5D1ZC 2Q86B 1F58L 3DVNB 3VD9A 1JTOA 4HULB 1E6JL 2A38A 2WUCH 4B5EA 2HTKD 2AV1A 1VGKB 1KCRH 3MRRA 2ZJSL 2DWEB 5JXED 3L1OH 1MHEA 5TF0A 5JQ6L 1S8DA 3FT4B 4L1HA 4QRQA 1XH3A 2NX5D 3I9GL 3W39B 1I3GH 3DSNA 1V05A 1EXUB 1ORQB 2YA2A 1NEZG 3P4OB 3FB6A 1RMFH 4KJYA 3FN0H 3QIUD 3ARGA 3EDFA 3P30H 4JFYA 5CJOH 1OAYL 2E6QA 3PDGA 1A9BA 3BX7C 3ES6B 4NKQB 3O2DA 3T0WA 2KUTA 5DHVB 3PWPB 5B39G 4XAKD 1JGVL 5D9SB 1J0HA 3K4AA 3SDXF 5C08D 1Y6MR 2AQ3A 3RKDC 5ACMA 4JVWA 1MCJA 3MLPA 3TIDB 2MTPA 1FCCA 1IZJA 4N0FA 4WHTB 1AQDA 2VR9A 2DLGA 1KPVA 2AEPL 2Z35A 2FDBP 2NTFA 3VGAB 3T4YA 3SJVA 4OSUL 4FP8H 4MLSA 4FOMA 1D5BB 3W82A 2FH8A 1AO7E 1AXTH 5D7KD 1XGQA 5FO7B 5I1KH 4IHOA 5ABDE 4XNZB 4YFLF 4YHPB 1J10A 4MX7A 4C54A 1JNNL 3ARFD 4H1LA 3QJHB 1Q0YL 2FX8L 3RNKB 3BWAB 5HGGS 4PV8A 1MQKH 1TXKA 3T2NH 4YDKH 4LARL 2DRUA 4WNQB 3SE8H 5DFVD 3S37X 1KEGH 4TPRL 5IR1B 2WMPA 5K59F 1R24B 3QULB 2ZUVA 2W9DL 4U0RC 2R23A 4QOKE 4GAJH 1KC5L 1K9TA 3MJGX 5CP3H 1L7IL 5C0BD 4NC0B 1AP2B 4JB9H 1MUJA 4XCFL 1E6JH 5GRJL 1VFUA 3R1GH 2X4NB 1Q9LB 3BW9A 3HAEA 5FYKD 3S3SA 4O4YH 3GMNB 1WFOA 2VIRA 2P43B 3GBNH 3J7HA 4R7DA 5CGYC 4OZGF 3F7VA 1QSFB 3JV6A 2DD8L 4U1KA 3CSYB 1FPTL 1XGUA 1R24A 3V7MA 5F7DA 3MOAH 4Y19E 3IDXH 4A2LA 5IEKB 2P5WB 5MENE 5I71C 1MCWM 2ESVD 1A0QH 3ILPA 4WI4A 2AVGA 3BXNB 4P57B 2DM2A 1D5MA 2Z4QA 3V4UH 4LIQL 5IESH 1KEGL 4PTTB 3RVTD 3DUUA 1UZ8A 4XP9L 5D2LB 3UC0H 3JWOL 2WAHA 5EBMA 1P5UA 3N0PB 3UP1A 2VDQH 4XB7A 4Y5VB 4CMMA 2NX5E 1MRCH 1NAMB 3V5HA 4I9WE 5ADPL 3HNVL 1S5HA 2Z8SA 2B0SH 1F6LL 5I1EL 3V0WL 5FXCH 4K23H 2ICWA 3VXMD 5CEXB 1A6VH 3QUZC 3HC4L 1GZPA 1B2WH 1A9EB 3DO3A 2NY6C 4PRNA 4KWUA 4UB0L 7FABH 3MLXL 2ERJC 3BEVB 3ZHLA 5HSFA 2G9HA 4TSBH 4OV5A 1L0YA 1A9EA 1VEPA 3GMMA 5HVHC 5DJAB 2Z4QB 2VLLA 3RUGE 4YC2B 2DMCA 2OM5A 3G5XB 1T0PB 1N6VA 3NFSH 3B2VH 3CSPA 3D1MC 2JCCA 5CD3A 5SX5H 2AEWA 3U0WL 3LKRB 3SGKA 4QRUB 4ETQA 3F6LA 4GG8A 5HGHB 4XNUH 4I0CC 4N8VG 1JNLH 4DVBB 4OLXH 4FA8A 4KPHH 5ICYB 1HH6A 2VXSH 1NAKL 4LCUB 3MLUL 1YNLH 3H6JA 1LE5B 2YHGA 5I8EA 1I3RA 3KS0H 3V6OE 4OKVA 5J56B 4PJ7E 5LAXA 1D6VL 3TO4D 3TF7C 1M4KA 1WCBA 1WF5A 5E99L 4MNQA 4V1DE 3DHJA 4WTZG 1DL7H 1JRHH 3MRHA 5GGVL 4L3EA 1BQHA 2FBJH 4NJAL 1BF8A 1CE1L 3CSYA 2VZVA 1FFOB 1A6ZA 1P84J 3GI9H 3NPSB 2GJ6A 5FCUL 4GXVL 4M48L 25C8L 1NLBL 3HNTH 1U92B 5DDHA 2XN9E 3RGVB 1JF5A 5FGBA 4OZHF 2NTSP 3EO1B 4LPWA 4OBSA 3AU1B 4POUB 5EU6B 1ZHKB 2P44B 1TTGA 1YYMH 2E9BA 4NNXB 4PJFB 3BKCH 1R3KA 2PYFB 5MEQB 1I3RB 4HS3B 3EYQC 1PY4A 3B2VL 3G6JF 2LFGA 1FAIH 4XPTL 4LNRA 1I1CA 2YMXH 1WT5C 3OAUL 1YNKL 5MEQA 4MQ7A 4MAUL 1XGRB 2YR3A 3L95A 1YEEH 3JV5A 5D7KE 3CFDB 2JELH 3HI6L 5JHDA 3S4SG 5CWSB 2G60H 4X7SL 5DS8B 4LSRL 5DUBB 5E8EA 4G42A 2CKBH 3LV3A 2VQUA 1YMHB 5ETUB 1JPFA 1KCSL 3E8UL 3NFPA 4YFLI 4NFBA 4I3SL 1TCMA 1YMHA 4LRIA 2VLJD 2X4SA 2YA1A 3S9DB 2D0HA 2X2YA 4TTDD 1MCBA 4TSBL 4NOFA 2MFNA 4PRDB 1S7UB 4GSDL 1YDPA 4HH9A 4NT6A 5TPWL 2UUDK 5ALCL 3EKCA 4FQXA 5C07D 2ED9A 2Y1VA 4X99B 1J1PH 2I60L 2WK2A 3VMPA 5HDLA 1UACL 2YD8A 1ZHBA 1NC2A 4PJEA 1JZ5A 3NCYS 4ODXB 1RZGB 1OSPL 5DRXB 4P5KA 5CSBA 4LGRB 4K94C 4G9FA 4AEIL 5HYEA 3QIBA 1PSKL 4OZGE 4RAVA 1Q72H 5DURD 1KB9J 1Z9LA 2EDJA 2FGWH 3FMGH 1TJHH 4ODSL 1HIMH 4LSPH 2NLJB 4CN1A 4G9FD 3W0WE 2A77L 3N06B 4N9GA 2F53E 5FKPB 2CKBA 3MRHB 1F4YH 5E00A 4HWZB 2FJFB 2HJFA 4N0YH 5F1KC 3FQTB 1EH9A 2NZIA 4OZGA 3UJTH 3MACL 1I1YB 2GJ6B 4ZUUB 5DUPL 2OI9B 1AJ7H 5DRZA 1IM9A 3B3IA 5FECA 3D9AH 4JO4L 4YHOL 3C08L 1E6OL 2BJML 3FFDA 2NYYD 3EW3B 3SGDH 4UQ3B 1XCQB 2UYLB 4P5MA 1AQDB 1YMMA 1M05A 1BVLB 5DVOA 1BECA 1H3GA 3S34L 3KYNB 5CJBA 1TQCB 5IB2A 4NRZA 1K8IA 3ECBA 3B9KB 4KKAC 4MWFA 3W0WA 5SWZD 1B2WL 5I17A 4MZ3A 3ZKMC 3D69B 3BPCB 43C9B 4OLYL 5F7EL 1OB1A 1IM9B 3F12A 1JV5A 4H20H 3C5ZD 1HKLL 1N8ZA 1JPFB 1OW0A 3OBAA 3ZTJG 1D5ZB 5TF1H 1M7IA 5SWZA 1HNGA 1OB1B 2ZNWA 3Q3GA 4MX7B 5T1MA 4P2QD 3MZTA 4P23A 4WFFE 1C16A 5E8DL 5E03A 3G5ZA 4Z6AT 5DJZA 4G8GB 1J1XH 1KNOA 1KIQB 1QSEB 1X7QA 2QHRH 4Y4FB 4KKCC 5F6HI 2ADFH 5HHXH 4P2QA 1O0VA 3EIFA 1TLKA 5E8OA 3KJ6H 4G7YH 1DQJB 1ND0B 4LLMA 4UT7H 3C60B 3BZEA 3HPJA 3V95A 4H26A 2R0LL 2GQHA 1A2YA 1BMGA 2B2XH 3W9DA 4PRHE 1NMBH 1EA9C 1PLGH 2AXJA 4O00A 1R3IL 1TZHA 4JPKL 1ZLVK 1OT2A 3QIUA 4F7PA 2K1MA 4LFHD 1WEJL 2AK4B 2DQTH 3GM0A 2Z31A 2EIZA 1EZVX 4K7FA 4MD5A 3BP5B 3IAGC 4RZCB 4OUOA 5H2BA 2ZG2A 2H8PA 5E6IC 4AMKH 2EYRB 5F70A 5FYKH 1FCGA 1U8MB 3IFOA 3U30B 2HJFB 2Z92B 1WZMA 4H25A 2GITA 5HVFB 4YO0A 3RDTD 3T0EA 3PUCA 2A6JA 4RA3A 2DLFL 3OR6B 3D85D 3MLSH 2A77H 2XZAL 3P9MA 2M8XA 5DVKA 5KSBB 5JPMA 3MRJA 4NFDA 1XGTA 1JGDA 2R0WL 4PGCA 5ADOH 4U1SB 3U9UB 3JZ7A 4HIEA 4I13B 2NY3B 4KJQC 4QRQB 3LS5H 4QXUH 3QAZC 1BEYL 3PWPD 4HMDA 1XF2B 3QFDB 4HWEL 3BDYL 1IBGL 4O5LL 3U6RA 1KCRL 1ORSB 1N0XH 2DICA 3BN9C 5AZEL 3MRGB 4AENB 1BBDL 1G84A 4U1IA 1HCFX 3CSGA 4UOW0 1B3JA 3BHBB 1RHHA 2BRRH 3PWNB 5ITBL 2XFXB 2PR4H 3ARDA 43CAA 4NQXA 3BKJH 2X4PB 1WBXB 2GY5A 3RWJA 5MERA 1I9JH 3ZSTA 2GW5A 5C09E 4U3XA 2DWDA 4NQXB 1I8IA 5B39B 2VZSA 2R9HD 1RIHL 4PGEA 5L2JA 2XN9B 3FT4A 2AJ3A 3CX5K 1V3LA 2CGRL 4I2XE 4PJ8D 4DGVH 5F1OB 3CFKA 1P84K 3EGSB 2AK4D 3ILQC 4KTDH 3CPLB 4Q6YA 4Z5RA 3AXLB 3UTTD 2VABB 2AGJH 2SEBA 2YD1A 1I7UA 2CUHA 5BV7L 5F6IC 3TN0B 3IKCA 5HDOA 1NDMB 3DXAB 2DQHH 5HHVH 1LK3L 2AABL 4PGBB 5SWSD 2W9DH 1MY5A 4WU5B 3BPLC 4PJCE 2PO6D 5D2NB 4YHIA 4FQCH 5MEPB 4FFWD 2OZ4L 4U31A 1I3GL 4J3OC 4FQLL 4PGEB 5L2JB 4GRLD 1CL7I 3UYPA 5T3XH 2A6JB 4U7SA 2QSCH 3DHMA 4J3XA 4RBPK 2CK0L 1GHFL 1RIVL 5BQ7B 3EFFB 4MA7L 4Z7NF 5CILL 5D4QA 1CE6A 1EFXD 4G8IB 2JB5L 3MJ6A 1QQDB 1FSKC 5FV1L 5F7UA 1CVSC 5IHUH 5EC2B 1E6OH 4WO4C 4KTYA 5BS0B 5D1QB 4PRHB 3AY4C 3VXME 3I6GA 4HAGA 1NBYB 4NKIL 5F1IB 2E6JA 3C60C 3PQYD 1UCBH 2XQYK 5TE4H 5AD0A 5HHOD 4HGWB 4RGNE 2EICA 2NZ9C 5F3HA 2D2OA 3QUXB 1R3HA 1IC7L 4URTB 1I7ZA 5L7XH 1MCKA 3VXSB 2WP3O 2UWEF 1MCQA 1ZT7B 4LSVL 3GIZH 3IFPB 2QV2A 4L29B 5KOMC 4QHKI 1FLRL 2A73B 4ZFOB 1KYOJ 3MXWH 3V0WH 4CVXB 1EMTH 2IQAA 4O5LH 1NGQH 2ZUWA 4PRHA 5D7JC 4PTTA 5GJTH 5HPOA 3D3VB 5I30L 2HMIC 1BVKB 5EO9B 4YGAB 2VDML 3RVUD 3AXLA 4KTEL 2E7LA 3LPWA 2YZ8A 1MFEH 4HEPG 4LVEA 1A6TB 5CP3A 3HKFA 4JHWL 3KNBB 3HB3D 3UAJC 4W4OC 3KLAB 4G6JL 5D96C 4WUUA 3BKYL 4LLQB 2ZUYA 1JHLH 2EH8H 3H42L 5C0ND 3QWOA 5T5NF 1PYWA 3MOAL 3O3AB 4JPVH 1T5WB 4GKNB 3N1GC 4R90L 4QOKB 4JREC 3WL9B 5CGTA 5DT1H 5EU3A 5IMMB 5FA3B 2WBWB 2YPLB 5EFIA 5IHZB 1JK8A 1YPZB 4XVSL 3VWJC 5E0QA 2G5RA 5DGQA 2LQRA 3UJJH 4OLWL 4HCRA 4MNGB 2PYEE 2XRAH 4LHUB 1NQBA 2CLVB 1U8LB 5M7QA 2BNQA 4HPOH 3FOMB 5EC2A 2F8XC 5D1XA 1MWAA 1OY3B 1L6XA 4Y89A 2R2BA 3IVKA 1UB5B 1GL4B 4RSVA 1CXIA 4I2XA 4WVRA 3RNKA 5T1DL 1CLZH 4P23C 4R0LB 2N56A 2I07A 2KDGA 4X9GA 3M8OL 4OQTL 5I1DA 2WBJD 3UROR 2JIXB 2ARJA 1A7NL 4JZOA 1I7ZB 1EO7A 2F54D 1ZLVH 4LLWB 5I1DB 1TVBB 2V2WB 1CF8H 1U92A 5DDHB 5SV3A 1J5OL 1G7PA 3SGJA 3D25B 4EXKA 1MI5A 2V9RA 2FBJL 4PGDB 3VGDA 1JWUA 2V2TB 3CLEL 1Q0XH 4XP5H 3KYOB 4LDLB 2FHCA 1AGFA 3TYGL 1TITA 4P59L 3FB5B 1HH6B 1RI8A 4MQSB 5BV7H 4YBLC 3D2UA 5C9JA 3WYRA 1LO3L 3M1BA 1HQRB 1OTSC 5CINL 4L8DB 3KHQA 5LGKA 5SWZE 5DHYA 2APXA 1E27B 4U6XA 3RTQD 2LU4A 3S35X 3T0EC 4NO5A 3MRKB 5B8CC 5DUPH 3BJ91 3DVFA 1AKJB 4K7PH 5JOFA 4JPVL 3QPQD 3MCKA 2PETA 4PRDA 3ZL4H 1JHKH 1AGBA 1FNSH 4N1EA 2GIYA 5IB5B 1IGML 1F90L 4GMTL 2DL9A 1QRND 3GI8L 4ODSH 2FJGA 1FORL 2VQ1B 4AT6B 1RVFH 2W60A 3MFGB 1A7QL 1JPST 3LVEA 1L7TH 2H2PC 4HIEB 5C0BB 1RD6A 1QRNA 4LSUH 3EZJB 3OR7B 4PJDB 1QEWA 4Q58C 2HTLC 5HDBE 1TCRA 4QXGH 4G6AC 4Y2DB 4PD4K 2QKIA 3VE0A 4D2NA 3TGXA 3FTGB 1J05A 3K1DA 4NN7B 4JRXE 4PJDA 3MMEA 4OM0L 1DBKH 2XKNB 3C87A 2QEJA 3UPCA 5HYQB 1MCPH 4LSTH 2P24A 1ZLSL 4L9DA 4RX4A 1U93A 3ZDXF 1A1OB 3NIFE 4N0UB 3IAPA 4PRAA 5C0IB 3QDGD 3G6AA 3F58H 2ATKB 4X6BA 1X4YA 4X80L 3W9EB 5AUMB 4EDXA 3ZLQC 4ZFGL 4RX4D 3QPXH 1GJIA 1BFTA 2ERJB 1H15A 2OS7A 5GRVK 3S8WA 5IG7A 3TFKC 3NBNA 4F9PC 1P5VA 4L3AA 3TP4A 4E42B 5DJDB 3TIDA 4DKEL 4IMLB 3HS0A 2HAZA 4MAYA 4P4KC 1INQB 1JE6A 4JPKH 3BEWA 1JGUH 2Y72A 3ROLB 1NC2D 4WHTA 1IQWH 4JY5H 2Z91A 5DLML 1F11B 4U0RB 1K8IB 1KPVB 1TDQA 4G6FD 4JFOA 4OM1L 2P5EA 1FE8H 4L8SA 2Y5EA 1XZ0A 2C4XA 3KJ6L 4GXUM 1E27A 2QQLH 4TSCL 3SE3C 2BHZA 1DUZA 2CDFB 4G7VH 1GH7A 5LGHL 3OAYH 4R7NB 2IF7A 4KTEH 4X0KB 5FO7A 3MRDB 3TH4T 2MQ3A 4P3DA 2DI8A 2P5WE 4XNYL 4DGYH 1FNAA 1A7PH 5FECB 1A6AB 1PEWA 1FIEA 5C08A 4RDQF 1RQ5A 4TULH 1UVQA 3UYOD 4ZS6D 4XMLL 1A5FH 3RU8H 3RWIA 1LO5A 1A7QH 1KPUB 1RHFA 3W11C 3JTTB 1WSST 2IBZX 2OI9C 3CFDA 5EC1A 3RIAF 3TA3D 4NPYB 1N2RB 4GMTH 1C7SA 2HWZL 3GHEL 3C5JB 4NKDB 4YHZH 5BZDB 2NY6D 2D4DA 3HG1B 4Y4KB 2QKIB 4Z7NE 1BGXL 3QA3B 1PKQA 4FXKA 3IXTA 2Z8WC 5BRZD 4AZ8A 5F1IA 1JYWA 1U3YA 1H8SA 1RPQA 1IT9H 1IAKB 4K94L 4NQSA 4UDUA 5F9OL 1IC1A 2DLTA 3N9GL 4HLZG 2B2XL 1K8DA 1J87A 2EKJA 4POYA 4Z7UF 3WMSA 4PRBB 1U8NA 2H2SC 3B5GA 3QI9D 4ODVH 5TE6H 4X98B 3RWIB 1LO3H 1BD2E 2QHLA 3C6LB 3RIFK 5L6YH 4ZG1A 4L29A 4ZNEA 2E3VA 4X98A 1H3WM 3QHZL 2DLIA 3BIKB 4B7LA 2DJUA 1OLLA 5IJVB 1IKFH 3QDMA 3UTOA 2BRRL 3H9SA 1A2YB 2E7LC 5IKCA 3UPAA 4S1SH 3P40A 1P69B 1HZHL 4MB3A 3QIUB 4R7DB 4F7PB 1YMMB 3GFUA 3KVQA 3ULUE 1PJ9A 2XTJD 4KAQH 5ANMB 3VFUA 4Y5VA 3DPBA 3S88L 1IM9D 1QBML 2V7NA 3UZVB 2BFVH 2PXYC 5IW6B 2BVTA 1UWEL 2VERN 3TO2A 4JANB 3R8QA 3QUYC 4NQEA 1H3PL 1FN4B 1CU4L 2HLAB 5GQBA 1ZEAH 2PTUA 4LCYB 4PJ8B 2JJWA 3LRHA 4G5ZH 4JVPA 5IMLA 1TMCB 1QKZL 3BEVA 2X09A 4JQXC 4NHUA 3T77B 4ONGH 1A0QL 5HYJD 4NNYA 5B39A 4DVRL 4FHBD 3ZT7A 4O58H 1CICC 3LH2L 4QHLA 4R6UA 4KMTL 5IB2B 4IOIB 3DV6B 2J4WL 1NC4A 1ZGLM 1PD6A 3HRPA 2EDFA 4L4VD 4L4TD 4PS4L 4O2FA 3TH3T 2ZUQC 1F4XH 3QFDA 4QRUA 3K1KC 3FO9B 3IYLW 4GFTB 4JANA 1KELH 2R2BB 5TE4L 4H26B 3MV8A 4JFFE 1IKNA 1D9KB 4MA7H 1A1NA 15C8L 3FQNB 4H0GA 3MRFA 1RIUH 2FHFA 4DOHE 4GW1B 3AAZA 3G5VB 3KPSA 1UEMA 3MRLB 1PDKA 4PRPB 1FAIL 2XZCL 4QRPD 5C0GA 1EUTA 4WWKA 2VR5A 3RZCB 1P7QA 5GJTL 3X14B 5JLZA 2Y4SA 1FFQA 4K7PX 4JKKA 1ZLWH 3T2OA 4X6DF 5LBSL 3AC0A 2VN4A 3WIIL 4MAYD 1OCWH 1G6RA 1NAKH 4FQIH 1CLYL 3GK8H 3MROB 4KJWD 4NRXB 2E7CA 5K9OA 4NKIH 3T0ED 4LLDA 3TT3L 3TNMB 3CLFH 5C0AD 4UILH 1AO7D 4UIKL 5IP4A 1G9MH 5E7FA 5B4MC 1U0QA 5DRWA 1VACB 5DA0B 3KYMA 3FT2B 5TH2A 1LK2A 4KROB 5JA9A 4WO4B 3QEQB 1V8HA 2ESVB 4M43H 2AQ1A 2OP4L 4HHAB 4X6CE 1LO4H 4TULL 3DRTB 1VDGA 4I0PD 3CFBB 1QKZH 2IPKB 3CFJB 2JLLA 4RMSA 3RRQA 3KPRB 4Z76A 4L4TB 5F96H 1BD2B 4ZUVB 2ZZUT 4OZIA 3GBML 2MOVA 4O58L 4X6DB 3C60D 1Z9SA 1I8IB 1OTUD 3CXHK 4Z7WE 3IETA 3VXOB 7CGTA 5I2IA 2BFVL 5KOVC 1CDJA 5DK2A 4M3JA 2X4QA 4YDJA 4XCYB 3OR7A 4GG6F 2FGWL 2EXWD 3RWHA 5DR5H 4YHMH 4BH8B 3KNBA 1KG0B 3VD4A 3FO0L 5FO8B 3QT2A 5T3ZL 3GSQA 3TWCH 2D7NA 4OD3L 3SCMD 1HH9A 2HKFL 4FQXB 2F54A 4PJXE 5KN5A 3CDYA 4KC3B 4KV5E 4LCWB 1KN2L 4ESKA 3WIFA 1MEXL 2C1OB 3LRSB 4F9PA 4B50A 5JQHC 2YD4A 5F9JB 5IMMA 5JW4N 4KVCH 3D0VA 2X4QB 2R2HA 4XVSH 2IGFL 1RJCA 4X7FC 1SY6L 3MLWL 1OQOA 5IVXA 1JFQL 2VDRL 5F89A 1NKRA 4UIMB 3ZDZE 2EE2A 5CD5C 3X13B 3MRNA 1FPTH 2IG2H 3EOTH 1NDMA 4L8SC 4ELMA 4I1NB 4ZPTA 3VRIB 1IC4H 4MSWB 4U6HB 1HSBA 3FONA 2AJXL 4ZSOB 5B21A 2F54B 3O2VL 3GKZA 2IALA 2NY1D 1HIML 4LSPL 5DJCA 1P6AB 4F3FA 1JCKA 1DUYA 1G1YA 3C8HA 2IBGA 3SEPA 1VB9A 2ZOKB 4HC1A 3PHQB 2YPVH 4XNMB 2BCKB 3FB8B 4MXWH 3C2AH 1IGTA 1UWGL 4YPGB 5I19H 3QEQE 5FV2A 1RZKH 1Z5LB 4U1GC 4LU5L 5KBNC 3MLSL 4Q9CA 5DGRA 4DKAA 3L9RB 4P2YA 1MI5B 4W70A 4Q9QL 2CUMA 3VXSA 3CH1B 1K4CA 4WHDA 4W6XB 4XWOC 3U0TB 3HE6A 3PABB 2OQJB 1ZTXL 4IIQC 4FFVD 3WFCL 4KY1L 2X41A 1W72L 4N8PA 4YX2H 3S34H 1FNSL 2O5YH 3ARXA 4ZXBB 2J6EL 4G8FA 5KSAD 4DZ8B 4TNVF 4KK5D 1G1CA 4XNMA 1T7WA 3BGFC 1CXKA 3QUML 5BVPH 5KANI 3EFDL 1YY9C 5B4MD 5IVNA 3X12B 2AEQL 4CDGC 1N6QH 2QR0B 4KRLB 2E9WA 1EAPA 1KIPB 4QRPE 1J1XL 2EYSB 3PGFL 2C5DC 5A43C 1W8OA 3MREB 4JG1L 1IAMA 1G9ML 1NLDL 3V6BR 3ZDYF 4OT1H 3VU2A 2V9QA 3KJ4C 3U7YH 3CMGA 2BVOB 5K59E 2W60B 4UBDC 3ZE1E 4IS6B 4G7YL 4OF6A 2Y6SC 3HC0B 4B7IA 4ODTL 4G8FB 3WN5A 5E94B 1FP5A 5FHBH 3ULUH 3X13A 2AK4A 2Y5TA 4M7ZB 4PRHD 1N0XL 1ACZA 3PV7A 4CN4A 1W0VB 5CEZE 2Y7QB 1MFAH 2ARJQ 1FFNA 3FQRA 35C8L 4J12A 5DD3L 3QWOB 4XC1L 2DQHL 5DC0A 4IMKA 1CDYA 4XAKE 4HBCH 1XF5B 5HHVL 5C3LD 5CEXA 4BZ2H 1ETZA 4XZUB 1MCOL 1DE4B 1W0WB 1JGEA 5DZNA 5L8LB 1ADQL 2W9EH 5BJTB 5GGRA 1JGUL 4XZUA 5DK3A 3SPVB 3ZE0E 1JGEB 1UYWH 4WDIA 2DBLH 5K9QI 4BQCA 3QUZB 2WUBH 4RGOL 4QKXB 1RZ8A 2PKDA 5TQ2H 3QCTH 1QBBA 1CWVA 2CLVA 2VXVH 1BJMA 2XKSA 4G6ML 2GFBB 3M07A 4PGDA 4FG6D 3CH8A 1IEHA 3QJFB 3PP4L 2Q6WA 1YA5A 3BUYB 3IFLH 4ELME 5KSVA 5EBWB 2C3XA 1XMWA 1RZIB 4K94H 5T1LA 4OKVB 3LS4L 5J12B 5FYKE 3CPLA 4Z5RB 5D5ME 5FK9B 2BY2A 3NACH 2F5AL 2NXYC 3TZVC 4DQOH 2I5YL 4PGZA 1OAKL 4ZO8A 1I1FA 3M17B 3SE9H 5I1LA 4U6YB 1HHIB 5IWLC 4L3CA 3RL2B 1KV3A 5T3XD 1UWXH 5EBGA 5FCUH 3UTQA 1DBML 5EORL 2F19L 3EO1A 3FN3A 4Y8AA 3IDGA 3BD4A 1P4BL 1AGFB 3VFMA 2MCPH 3U2SB 3MCLH 2M26A 4OIAA 1KJ3H 2AJVL 2P8MA 4PLKC 1FIGH 1NGQL 2V9TA 1U42A 1YY8B 2Q8AL 2BSSA 5IMKA 1G9MC 1NBZB 1NH6A 1ZVSB 4XXDA 3CD4A 3ZKXC 4HKBB 1LP9A 1QACA 1EJOH 5IVXF 1G7QA 1F5WA 1T7YA 2EDHA 3ARQA 3KYKL 4ZNCD 3IJHA 3GSVB 1NFKA 4S1RL 3LKSA 5DMKA 4EI5D 4J4PC 4GRWF 1QD0A 4ZO7A 1LD9A 5D2NA 5CWSA 1LQSR 5IFAH 2HKHL 3D2UD 5C8JB 4LVOB 4Y1AA 1RURL 5SWSB 5HI3D 2ZOLA 5DWUH 4F7MB 1MJJA 3TO4A 3V79C 1U3HA 1QSFE 2YSSB 3VFNB 3O6FD 5F93C 1B0GB 5GHWL 5DT1L 2OTUB 4OB5L 5L9DL 1V3JA 3L7FA 4JG0H 1HK6A 2OTPA 4YBQD 1EEQA 2J4WH 4YDLB 3THMH 1WFUA 3BIKA 1ADQH 3DVNA 3SDYL 1KPUA 4J23A 3HNSL 2EXYD 1S7QB 3KPPA 5TE7L 3H0TA 3LKSB 3LPFA 1ZT1A 1ZK9A 4HBCL 2QSVA 2O26U 3NPSC 3OAZH 1FIGL 5DK2B 1WWCA 4RGNB 2A6KA 3S97C 1Z6JT 3FHAA 3W39A 4U3HA 4HJGA 3TPUA 3GMNA 5I18H 1A9BB 1J86A 1NKOA 3H42H 3DTXA 4KRPD 3G6AB 2CDEA 4XC3H 1FVDA 4NJ9L 1P1ZA 1WLHA 2E7HA 4L4JA 3TO2B 1M1SA 2FEDC 3K0WA 4YDIL 3VG0H 5JXAH 2ITCA 5KG9A 4KQ3H 3P9LA 1PKOA 5EORH 5GS2H 1I7RA 3IDJB 2IADA 3GMQB 4JGUA 4B53A 5MP6L 5TQ0L 2ZCHL 2F8OA 2PW1B 1XEDA 4JRXB 5C07B 1SJHB 3H9SB 2VE6A 4PJGA 4QTIH 1YEGL 1YNTB 2F5AH 1ZVSA 5F97E 1OLZA 3OKNB 3GIZL 3MV7D 2CKBL 5DMJB 2HTKC 4ZXBD 5C0CB 1A6UH 3ZE2E 4PYHA 1KTLA 5DURB 4RGOH 3KPQA 3HPLB 5I75C 3JWDL 3UZEA 1KB9K 3FCTB 4KI5E 1CK0H 2D03L 1RFDH 5FYJD 3WN5C 1MLCB 3TVMC 4LOUD 3GMPA 1NCBH 4UUJA 3FQNA 1A6VL 4PJFF 4IRJD 4XNXH 3D39E 5E5MB 3UBXB 1MQKL 3PGDB 3HLAA 4QY8B 4NQVB 5GPRA 5E5MA 1EDQA 1RUQH 3RWGB 2AW2A 4Q6IC 3INUH 2IAND 1ED3B 1VEOA 4TUJB 3MBEA 3LEVH 4YXLL 1DQJA 5T1KA 4KVNH 2X89A 3FT3A 3JVGC 2AJYH 5GGSA 4L1DA 1XGQB 4LSUL 4OQ1A 3Q6GH 2QQKH 5DVNA 1KULA 3STLB 6FABH 4MXVF 1LWRA 3MBXH 4EIGB 1U8KA 5C6TH 2IH3A 5D1XD 4IEFB 5HHOB 5E7BA 3HNSH 4UU9A 5IKCB 1MREH 5LAXB 3T09A 3RHWF 1DQDH 1G7JA 4D0BA 5DQ9B 4UV4L 2EEDA 4MNQE 1MVUB 1S7VB 4RISH 2CO7B 3QEQA 1H5BB 1N0LA 3BVNB 3QDJD 1NGPH 3NCJL 4X7TB 3T65B 2R23B 3H9SD 3U48A 3RFZC 1VKXB 3TZVA 5F7WC 2IADB 1FV1A 4LASL 3MV9E 3LAFA 2X6MA 2ZG3A 3WO4C 3KDMA 1VPOH 4XAWL 1YUHA 2D0FA 1KB5A 3ARPA 3JUZA 1T03H 4PY8I 5EN2B 3OKOB 4FMFA 3GKWL 1CF8L 4YQXL 1KN2H 1M6OA 2VRAA 2B0SL 3DV6A 3QQ3B 4NO5B 1KJ3L 2AJVH 4EI5A 3FQUA 5FOJA 1DBJL 2GJZB 3L3DB 2XYCA 2NY4B 1U41A 1R3JB 5DD5L 5TE7H 4HUXB 3MRBB 4O9HL 4K55A 2F9BT 4JKMA 4P57A 1G9NH 1U8QA 3TBVA 3SDAC 4XVTL 5ID1B 1MRCL 1YUHB 1S9XB 4M7JH 1BJ1J 1U93B 1W2KT 4NQVA 5GS2D 4OCYH 5DJ6A 1S9VA 3MRLA 4LAQL 4M6OL 1KJMA 1DQML 1KLGA 2IH1A 1NMAL 1QRNB 3K3QA 4OCXH 3O6FB 1T1WB 4MNGA 1YEFH 3TJHC 1FC1A 2Y6SD 4XP4H 2JJSC 4S2SB 2VDRH 1T3FA 4JFXB 4K3DH 3L5HA 3VFVB 2DYPD 3S3PA 1NAMH 1YMMD 2GHWB 5MENA 4J4PD 4HJJH 1T3FB 4JFXA 4L8CB 1NCCL 1INQA 3RA7H 1Y18A 1BBDH 1SEQH 3LY6A 1YEJL 4PD4J 1ZKAA 3O3BA 4JFFD 1I1AB 3NN8B 3HE7D 5I15H 4GKSA 2ATKA 4X6BB 1HNFA 3NOIA 4NQDE 1CTOA 5IW1A 1CIUA 2HLFD 2YEZA 4HK0A 2JCCB 3HZYB 5LKNA 4F58L 1LMKA 1T1WA 3NABH 3RGHA 4YHNB 2D0GA 2CDFA 1DBKL 2DTMH 3TN0C 2W0FB 1B90A 4LBEB 1I9EA 4NHCL 3HUJE 4M8QA 4NUGL 4WUKH 5D1ZB 5ANME 1CE6B 5GS1B 5EU6A 1IL1B 1IQDB 2EIBA 4LPXA 1YMME 1T0MB 3HTLX 4X6DE 5DJYA 1MHCA 1MNUL 4L8BB 5GIRA 5DUBA 1YQ2A 4P0DA 1GC1H 2H41A 3DSFH 2YD2A 3MOBL 2FX9H 3D87B 3LQZA 4PJ7A 3KXFA 1OGTB 2WWKO 4LLVA 3K8MA 3F12B 4HIJA 3GKWH 3GMOA 1SEQL 1A6AA 1IGCL 2RQ8A 4JFQA 5HD8D 3N1PC 4PJFA 1IGTB 1INDL 5FO8A 4RAUA 4HPOL 1JHTA 3RHWK 3TBWB 1Y0LA 3T3MF 4ZUWB 3G08B 2LVCA 2ZCKL 4KHXL 3KPTA 3PL6C 5I16A 1JHTB 1JRHI 4Q6IB 4XP1L 1A6PA 3AS1A 4HIIA 4F37K 4AEHH 3O11A 4LEXL 4G8GD 4U2YA 2B5IC 3FO1A 4U1LA 1R0AL 3HC0A 1PKQB 4FXKB 1I8MB 2ARWA 3SKNB 1EPFA 4XP6H 1GGIH 2RJMA 4XHJD 1ZEAL 3FB7A 3B2UD 3MYZA 3WFDH 4YXLH 4UIMA 5A3IC 1CIDA 4OZFH 4QF1A 3MV8D 4FABH 4FFWC 3RVVC 5DC9B 1WTLA 4YDVB 4BUHA 4WI5A 4XVUD 3BKYH 4XHJC 3C5SA 3L3OB 1CICA 2QSCL 2WV3A 3PE9A 3UPRB 4NO3A 1VA9A 2ADJB 4FP8L 1U8OB 4ETYA 5I16B 2YKLL 5BXFB 3HZYA 4NQDA 3ARGC 4I5BA 5SX4I 3KJ4B 2OCFD 2QLVB 3U79A 5JORA 1CFNB 1KELL 1QFUH 2XZAH 3P0GB 4LLUA 1P53A 1HYSD 4Q7DA 3TCXA 5DMGC 4WTWA 1EBPA 3CVHA 3AFLA 5C0RH 5LVEA 15C8H 3VFTA 1HI6B 4JDVB 5HD8C 2EIEA 1UJ3C 4G6FB 2BNUB 2UYLA 4MDJB 1YYLH 4RNRA 1RV6X 5FYLD 5D1XB 1BFOA 2Y7QA 2JELL 3HI6H 4S0SD 5EBWA 2FEDD 1F4YL 1DBBH 3U0TA 4OGXH 5TDOA 1ORSA 4DW2L 5I1GH 5E4EB 4ZUTB 3TVMA 3BKMH 4WWKC 4EI6A 2HJLB 4NQEB 4G6MH 4UV7L 2ENYA 1GIGH 3FB8A 1JPGB 1Q72L 2ZP0T 4XCFH 3IU3B 4IRSB 2XXMB 4P3DB 2XA8H 3OL2A 4LAQH 2JIXA 1XR8B 2NYYC 2F15A 3V4VH 3IRZA 2V5RA 3PWLB 4K9EL 4WI8A 1ITBB 3MRFB 3CH1A 4K71C 1ZANL 3ISWA 2NW3B 5EOTA 2GKIA 4BSWB 3L1OL 5H37G 4GW5B 3IDGB 1AD9A 3QXDA 3W5NA 3QNZA 4NO2A 5HYJA 2EDRA 3OJDA 5EOTB 3KPNA 2OMBA 4HUUB 1FH5L 1KIQA 3SQBA 2Y36L 4OD1H 4S1QL 3PQYA 1PEZA 5GRXG 3OJDB 1FQ9C 4O2EA 2HLFC 3F65A 1BIIB 4BKLB 5KSVB 4GRWB 2A9NH 3LKQB 4MXVE 2R29H 1UH2A 5IT2H 4P49A 1VADA 1BWWA 4QF1B 4RIRA 1C16B 4QYOB 1DJSA 4CL7A 1HQ4A 5HHOE 1F13A 1JNHA 5JOFB 1MAJA 1UADC 4CMHC 3IDUA 4TUOA 1RUAL 1H9VA 1U3HB 1LEIA 5E24E 2XQYG 1FGNL 4YNYA 3V6FA 1TETL 1MEXH 1BFVL 3EO9L 3ZMRA 1J12A 2O93L 2LE9A 3QG6B 3TZVB 1UH3A 1XGTB 2HVKA 5JR1H 2VJXA 5GGQL 3BOVA 4JFEB 4ONOA 2CRIA 2A74B 4Y19B 5F1NB 3V0VA 2OZ4A 3S35L 3A6BL 1AI1H 5D93C 3FO0H 2DDQL 3HFML 1P4IL 4M1GL 5EU6D 4H88H 3SCMB 5I1KL 4YDKL 5D1QA 1HQ4B 4MS8C 1LEKB 4C56D 1N6UA 3MODH 2EYRA 2QSTA 4U1IB 3VMOA 3RTQC 1PZUB 2YZ1A 1Q9WA 2LAAA 4FTVA 3HHRB 1Q9KB 3ESUF 3ARDB 4FZEL 3U6RB 2W91A 3DMMB 4PRAB 2XI9A 3BQUB 4NYLB 2Z93A 4ENEC 4JM2B 4ODHL 3PWNA 1F90H 1OVZA 3C2AL 1EHNA 1HHHA 4JFHE 1KFAH 2O5XL 3VXUE 4YWGL 2WIIB 4P46D 4RRPA 4QNPE 3WXWH 3JTSA 1WFNA 4NP4L 5K93A 2FECI 3VRJA 4HUKB 2VNCA 4D0DA 2DQGH 4EKXA 3GZKA 1OOAA 4R3SA 5EO9A 1HYSC 1NANI 3LEYH 4BH8A 2X4TB 4H1LH 1KXVC 4HK3N 3PWPA 1YY8A 4TRPL 3RWDA 3SGKC 3U4BL 1PQZB 4PREB 4M5YH 3CU1A 1OT1A 1OPGH 1GGBL 4QTIL 2AEIT 3VFGL 4H0IA 4WFED 3OHXB 5FA4B 3VRIA 2VLMD 3DX7A 3ARFC 4ZTPH 2EDBA 1PYWB 3KPSB 2F53A 1F02I 4RRPG 3H3PL 3TWCL 5I9QC 4JM2F 5KG9B 2YN5A 3QPXL 4FQPA 3O9WB 1FYTA 3KPLB 1WAAF 2F54E 3O6LL 2ZOKA 4ERSH 1OM3H 3U1SL 3QEUA 4RFOL 2W0FA 4R3SB 2A9NL 4JRXA 4PJDE 4JFDA 3SKOA 2BZDA 1HEZA 4NSKB 1EO8H 1ZOXA 3QULA 2A1WH 2EZ0C 1CDBA 3JTTA 5EC1B 1XF4A 1MAML 2NX5A 2HN7B 3GNML 1KN4H 2VH5L 1T20A 2XWTA 4HCRH 4CU7A 3UTTA 3C5JA 4G8IA 5K9OB 1MVFA 1Q94A 3WFEL 5ICZA 1D9KD 1NMCC 4U1MB 5KSUB 1EHLL 4YC2C 3ZYOA 1OGTA 3MXWL 1HHGA 1F00I 2APBA 4OJFH 2BNRB 4M5YL 4KXZI 4F7TB 4KMTH 1T03L 4XBEL 4P9HH 1FO0H 3EJZC 4F7TA 3NCFB 1FL6B 2EH7H 4Y1AD 3PF2A 2VXQH 3H0TB 5SWQB 2OJEA 4LRIC 1FV1B 1KGCE 5T1KB 2E27H 3KYOA 1IFHL 2WBJC 4QRRA 3KWWA 1Q9OB 2DQFB 3WLBA 4XMPH 3ULUD 1CVRA 3VXTB 3GHEH 4NN5B 1U8PB 2DLEA 5J7CC 3FN0L 4OCSH 3F5WA 1CZ8L 2CKNA 3C5ZA 2ZPKH 1QFHA 3MFFA 5DFWH 1RZ7L 2AK1L 1DBJH 4HFUL 1B4JL 1ZTXH 3IFPA 2AJZB 5FGBC 1JNNH 2QSQA 3I50H 3DURB 4XCCL 5I1CH 2DF3A 4K8RC 3EDJA 1TNNA 5ECJE 4M6NH 4D8PA 2CO6B 5DFVC 2VB5A 4NHUB 3T77A 4BZ1H 3S35H 1NFDE 2RB8A 3GM8A 4JJHA 3WHXA 4NZTL 1WT5A 3H9HA 1BX2A 2VXUL 2YOCA 3T4YB 2GUOB 3OKEA 3C6LD 1UJ3A 3VI4E 4PJEE 3MXVL 3C5ZB 5T1DH 1F4HA 1MWAB 5I8CB 4I48A 1EVTC 5A2JH 1XF4B 2NX5B 1FFNB 4PRNB 4GLRH 2NXYB 4HUMB 3MRPB 4AQOA 2NY1B 3L3KB 4NKMB 2ZUTA 3VJ6A 2J3SA 4ZSOA 2XZQH 3GMPB 3P0YL 4UUJB 4F57L 3BO8B 2OMNA 3WFEH 3HMXH 5FUZL 4XP4L 3E1F1 4KRPB 4KK6C 4KI5F 1SJEA 1WCBB 5MI0B 3WFHB 3DLQR 2ZCLL 5EU3B 2QTEA 3D5OF 3WIIH 3U7AA 3ZE2F 5JHDE 1SJEB 3V5DB 3V8OA 4MD4B 5J0BA 4JZNB 1QR4A 1V3MA 3GSXA 1I8LA 2I07B 1CI5A 1UM5L 3MJ9A 5DTFA 1INEL 2IEPA 5D72L 4L3CB 3RL2A 4F2MA 2WQ8A 3K74B 5E95B 3UX9B 3CVIL 3QIBC 3V5KA 3FRUA 4LRNH 1KJ2A 5CGYD 3MV7E 5I6XB 1DCLA 3BP4A 4Y4HB 1LEGB 1T7XA 2H32H 3BT2L 4Y8DC 4HKZB 5EUOA 5FGCE 4GKZB 3MBED 1IEBA 1JF1B 2VLJA 2CQVA 3LB6C 1PZ5B 5C09A 1AXSA 5DJXB 1S7VA 2NY0B 4XWGH 5FKAB 5JW3H 1CFBA 2FLRT 2N7AA 2D9QB 1MJ8H 4GG6A 1AKJA 3LQZB 5SX5K 5BO1H 3DNKA 4U7MA 5J9PB 3LEYL 2PXYD 3O4LE 2GK0A 1G7HA 1K6QL 5DHYB 4N8VA 1ZVHA 5H94B 5FCSH 4JM2D 2ZCLH 3R1GL 4ZFOL 2JB6A 5CBEA 2IG2L 4U05A 4KQ3L 3L5WB 1FC2D 3QXTA 1P7KA 4NC2B 1D9KC 5FAAA 1WAAE 3KPOA 4XNQB 2C7UA 1BX2B 1B0GA 5ITBH 3EOBA 3O11B 5E2UH 4CNIB 1S9VB 1B6UA 4LNRB 1F42A 3RIAK 3UBXI 4PJ9D 4JZJB 4TTGA 4HXAH 3S5LB 1SMAA 4LSDA 5SWSE 2DQJL 4D9LH 4YIQB 1Q0XL 4XP5L 4PBWD 3OTTA 3BDXA 3MRBA 4S1RH 5TF1L 1IGIH 1CFQB 1CR9H 4WIQA 2W07A 1B0RB 4OV5B 4FMKA 4MXQC 3IDNB 4L8CA 1L7TL 4UT9H 5KVFH 3GIVA 5HPMB 3DYOA 3IU4H 2DJ4A 1UM6H 1A7NH 3L3HA 4IRSC 5AYQA 4P48A 5JUEL 2BDNL 1CD0A 3Q0HA 4KROD 3HB3C 3NH7H 5IMOB 4XI5C 2XG4A 3ETBF 3SDXA 2XQBL 4J6RL 4Y5XC 3W9EA 4A6YA 4DVBA 1CFNA 4IOFC 5AUMA 1T6VN 4S11A 4U1LB 4OCSL 1TJIL 1ZGLP 2QQLL 5E2TL 3QIUC 1KCVH 4IRZL 2EH7L 3QIBB 4JDVA 1PX3A 2XKNA 3PNWB 4NDMB 5LWYL 2Q20A 2HFEA 1FNLA 3ARUA 4OBRA 3UO1H 2H9GB 4JFYB 2ENSA 3NN8A 1NCWL 4NBZB 3LPGA 2PXYB 4DZBB 4GJTB 3UBXG 1HSBB 1V7ML 4KFZC 1NFDB 5DD6B 4FQHB 3SY0A 4XB8A 3WDIA 4P2RB 4WWKD 4X80H 1RU9H 1BLNB 4M1DL 5IBLD 3DX7B 3QDME 1LDSA 5CCKL 3SKMB 5D93B 1QRNE 1J0IA 5HDQL 2P7TB 2YC1B 4PJ8A 1FRGH 2R0ZH 5D6DA 1TTUA 3B3IB 1FYTE 4EUPG 4BELD 4NWTL 5F9WC 3ZTNL 3NCBB 2X1PA 4ZDHA 4NN6C 5DMGD 3CUPB 3HLAB 1DLFH 2ZCHH 3B9KC 2J8HA 4OD1L 4MDJA 2R1WA 4CNIA 3AS2A 4UNUA 4X6CB 1SBBA 3QA3A 4PJIF 1EEZA 3IXTB 3P9WB 4DUXA 5KSBE 4XI5D 5DD0H 3SBWA 3LCYA 1T2QH 4GW4B 3O2DL 4OD3H 1I7TB 4N1HB 2DQIL 4AG4H 1H8NA 5EZLB 3CMOL 4ONFH 1MJUL 3WKMH 1TNMA 2P5WD 2IH3B 1NBQA 4ODUA 4ODBD 4QHKJ 4OGAD 3QDAA 4XT1C 5CJXA 3SGDI 5TPWH 4JR9L 4PLOB 4MJ5A 4LLYB 5C70A 3EJYD 3OJMB 4KDWA 4ZO6A 4FN0A 2MHAB 4G43B 4JO4H 3F7PC 4OLVL 3KG5A 3W11D 4MB4A 5BCAA 3IS1X 2MHAA 2YWYA 3RWCA 3BDBA 1UQSB 1AFVH 4PR5A 2VXTL 1B0WA 4X7TA 3CC5B 1SVZA 3RPKA 2ZSWA 4FQQB 4X6EA 3SO5A 1BQLL 5C0FB 4XPGH 1LO0L 1WQVT 5FDWA 1Q0YH 3BD3A 1E28B 3C5ZC 4NGHL 3PNWA 4NDMA 1TJHL 1ZSDB 3O41A 4OCLC 5F9OH 3GUTB 5J89A 3DIFB 5D7SH 3VA2C 1N3NB 3RL1A 5D7JA 4U6TA 3ULVL 1GGYA 4JVUA 5F6IB 5D5MA 2C3WA 3MYJB 4M6OH 5J57B 5DRWB 2CDEB 2ADJA 4XC1H 1Q9KA 4EN3B 2GITB 3VFRA 3TVMB 3T0EB 1N4XH 3QHZH 1QLFB 2IANE 2UWEB 4V1DA 2X4PA 5FHBL 3ULUL 2LU3A 4IBLT 2PYEA 5ALCH 3CGTA 4ZAKD 3EZ8A 1XAUA 2DQDL 1QNZH 4HIXH 4R4FL 4A6YL 4RWYH 4MZ2A 1O5DT 1XIWA 3VFTB 4DCQB 1XF2A 2PW1A 3LDBB 3WUWB 4CMMB 2ZKHH 3DIFA 1ZT4A 4OFYA 3MRGA 2C4FU 3AY4A 1OHQA 5L6YL 1WZKA 1LP9E 2MPAH 4I3GA 5JO5B 5HI4D 3WUWA 5M95B 3KPNB 1HHKA 3QHTC 1C5DB 3KLHD 1C5BH 1D9KA 2SEBB 1QTYT 1OP5H 1FVCB 5JO5A 3MLYH 1T21B 5C0CE 3HPLA 1MCIA 1Q9WB 4FTVB 3D0LB 3VXNB 3N9GH 3CZJA 1OPGL 4LPUA 3GMMB 4HUVB 4FQIL 2ICWI 4NKOB 3G5ZB 1VADB 3CZFA 3RPIA 4XBPA 3V52H 1UH4A 1EO5A 2UV3A 1FBIH 4YHYC 4AG4L 3RZCA 4GQPH 3CZFB 3UTPE 5HY9A 2NY2C 3MRQA 1NC4B 5ENWA 3RVVD 2R2HB 3UJTL 2Z35B 4HLZH 3O8XB 3VRJB 1HEZB 2EH8L 5GRWA 2IQ9L 4ZUSA 3QWRA 4OGYL 4NBYB 2OL3B 3QEHA 4M5ZH 3A6OA 4LF3B 3MTRA 4L4VA 35C8H 5ICXA 4AEEA 3ARBD 4GO6B 2NY5L 5I1HH 1JF1A 2IAMB 2ID5A 1IGYB 3B9KD 3GSOB 1WICA 2BXYA 2HFGH 2MKWA 4KJPD 4M6ML 3I6GB 3LN5B 1LK2B 4P9MH 3T0EE 2XV6B 3CK0L 5I71B 5FA4A 4I3RH 4NM8L 5DQ9A 2R56L 3LKPA 2AXFA 3TNMA 3O45A 4IRJB 4KUCD 1KCUH 4BQ6A 1H5BA 5HI4C 4NWTH 3SO3B 3P9MB 1QVOA 3GO1H 4MJ6A 3VWJA 3C2SA 4P2OC 5DZOA 1OF2B 4GRMB 2VL5A 3MRCB 3RVUC 5J06A 5TDPB 4X6DA 1K2DB 1L7IH 4P2OB 2RFXA 1IVLA 5HYSA 4QWWC 2IPKA 1OGAA 4FRWA 2EIDA 2ICCA 3HA0A 3P4MA 3V6OA 2DQUL 3CVHH 5CSZB 1FGVH 1KEML 4OZ4B 3H3KA 2NY0C 3QUXA 4ZFFA 2EDEA 3QXAA 4QWWD 2VAAA 1H0DB 2YXMA 4TOYH 1YEKL 3QSKB 4PRID 1FL3B 1MCPL 2Q3AA 2MPAL 3HC4H 3RWHB 3VXSE 1PLGL 5MEOA 1S7UA 3SE8L 1CD1A 3OGOE 4DTGL 2YKLH 1ZHLA 2JKXA 1KG0A 4PV9B 3HNVH 1AC0A 3EDKA 3OQ3B 3UDWA 5ID1A 4HWBA 4KK9C 3ZDZF 3UMTA 2UZXB 5EU7E 1QYGH 3DVGA 4M6NL 4ZFOA 4JFPA 3VFWA 4PJCA 5J1AA 2YBRA 4WFHD 1QOKA 1CFTB 4GRWE 5E6YA 3RWFB 4ZNEE 5AZ2H 3RDTC 1NPUA 4PTUA 3DVGB 1F3DH 3I50L 4KTDL 4F8QA 2ZSVB 3NVQA 5HGBB 1RZKL 1G7LA 4C4KT 4WUUB 5C7XL 5M94B 5KSBF 1V3KA 3EHBC 5EIIB 1R0AH 2CRZA 3N85H 1U8LA 1CLYH 8FABB 5DLMH 3L3IB 2VWEC 5EWIH 1AFVL 5DJ0B 4M7KL 4NWUH 4WHCA 3WEXA 4AH2B 1XFPA 1HH9B 3WBDA 5D96B 4OI7A 1AD0A 2D7PA 3CAFA 4NUJB 4L9LA 2NY4D 4ZPTB 4TOYL 1T22A 1WJ3A 4PY7A 3F62A 5IW1B 5MHSD 5C0DA 3BESR 1AQKL 5ESQB 2HJKA 1XF1A 5BQ7A 5BS0D 3PWVA 3DYPA 3WD5H 1CN4A 5HHMD 2ICEB 1BHGA 4RGMB 4TNVK 5A2LH 3DV4B 4AIOA 4Z7VE 1K2DA 4HIHB 2PR4L 2YRPA 2CLRA 3SDDC 5J4MA 4FFYH 1CLOL 4LHUG 4H5SB 3GJFH 3P77B 4LCUA 4XCEB 4LRNL 4MNHB 2DQEH 1AD9B 3QXDB 1M7DA 2YPVL 4I2XB 4TN9A 4YR6A 2OZ4H 4LKXA 2FR4B 4RDQG 2R1YB 4NZRL 5CUSH 2Z31D 1X9QA 3QI9B 3D2UB 2AJUH 3VFPA 3MRIA 1KCKA 4WEBH 5T1LB 3JSSA 3OB8A 3PIQB 1ZWIA 5LXGL