4L4JA

Crystal structure of fc-fragment of human igg2-sigma antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
208
structure length
208
Chain Sequence
ASSVFLFPPKPKDTLMISRTPEVTCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-2 chain C region
publication title An engineered Fc variant of an IgG eliminates all immune effector functions via structural perturbations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4jA01
1JP5A 5D2NA 2V7NB 3WO4C 2IADB 1DEEA 5IBTL 3EZ8A 5E9DD 3N1PC 5FB8B 3QEUB 4N0UA 4I3GA 3JWNC 1Q9OA 4P49A 4U6HA 5DJYB 4L9LC 2NLJB 1AGFB 4XBEL 3MRQA 2BP3A 3PE9A 1N8ZB 4G8IB 4KXZH 3U7WH 2H32A 2DQJL 3ZKXB 2CH8A 3VWKB 2CDEB 4N8CH 5I76A 2WW8A 3Q5YA 3VD7A 5JDJA 3UEZA 5E56A 4S1QH 5FYKE 3GSOB 4HIJA 1A4KB 3DX7A 2R29H 2YC1B 1Q38A 2ZWLT 3RIFK 1C5CH 1MI5B 3VRLE 4U4BA 1RK1B 4DZ8A 2B8OT 3UTOA 1BLNB 1XGPA 3QAZB 3L1OH 4ZDHA 3IXAA 1T5XB 4O4YL 4JFPA 4JZOA 4Y4HC 1T2JA 1KC5L 2XWTA 4R4BA 1KENL 2HLAB 3K81A 4JM2D 2GJZA 4QWWC 3EOAA 1CDBA 1LQSR 4IHOA 4DEPB 4MA8L 1P4LA 1NMBH 2A0LD 3PWNA 2YRZA 3TZVA 2CR6A 3EJYC 2WAHA 3G9AB 2CK0L 2R1XB 4KJYB 3IJHA 4L8SA 1U36A 3S8WA 3KPTA 3HHRB 1AIFB 2ZOKA 5IV2A 2J6EH 5DZOA 5DUBA 2XA3A 4S0TD 3HI1A 3BE1H 4PRAB 3S96A 1RUML 2NX5E 3RTQD 4QRQB 3MV8E 3HE7C 4WO4D 3TBTA 4OD3H 1KPRB 4PJDB 4EQ3A 3ARSA 2VDLL 1PW3A 1S8DB 5L8LB 1HSBB 4X9BA 5LJYH 4ZPVA 4ONGH 3S37H 1MRDL 2DKSA 5JPNB 4NUGL 2ESVB 3T2PA 4XVUC 1UM6H 3CLFH 5F6HI 1BHGA 1MHEA 3BPLB 5DC0A 4M93B 5L7XH 4K3JH 1OT1A 3S34H 1G84A 4X6CB 4Y5VB 2Y6SD 2A6JB 4IRZH 3DETC 3FFCB 2H3NB 4M8QB 1KSRA 2OTWA 1QYGL 2BVYA 4ODUA 1JTTA 1E27B 5D7JD 5IIEA 2H2SD 4R8WH 4WW1B 4X7CC 1GL4B 1ZLUK 4HXAL 1RUKL 2Y07L 2VXUL 1FE8L 1DP0A 3HG1D 1ZE3C 3QRGL 2NXZD 1BZ9A 4NQSB 5CJOH 2HJKA 4KUZL 1DBML 2OL3A 1AGDB 4DW2L 3QEQB 2W65B 4H1LH 1YNLL 2BVQB 3G6DH 3HNSL 3RWJA 1JWMA 2VL5A 1PG7L 1N0XL 1OAXH 4MQSB 5C0RL 3BQUC 3U30C 2Q7NA 1GPOH 1Q1JL 5FECA 1RZIB 3MLZL 3S36X 1AGCA 4PB9H 4BKLA 1X7QB 1UWXH 4NDMB 1IGCH 1IGMH 1DLFL 4I4WA 1KCKA 1FO0B 3OR6B 1HKFA 1KCRL 4NRZB 1R3JA 5F7HA 4HV8A 3VWJA 4KHTH 25C8H 5SWSB 2FCBA 5BO1L 3LV3A 3ULUC 5LBSH 3U82B 3BSZL 4TTDD 3OG4B 5C0BD 1R3LA 1S7SA 3MV7B 5IW3A 4OF0A 4UINH 2XICA 4L4VB 4RRPG 3UTTD 1JGUL 1AH1A 3MREB 3OAUH 4KJQC 4P4RB 4KGLA 1CE6A 2Q7YB 3T8XA 3VDCA 2Z91A 5IMOB 3GIZH 1RZ8B 4OLUH 4RGOH 1OSZA 5BV7B 4LSPH 4FABL 1YPZB 3G5VA 3CXHK 4P3DA 3DO7A 2MCPH 1MCPH 3BN9D 4F9LC 5CD5D 5INDA 2A83A 4ZUSB 3JV4B 3MV8A 2PXYD 3MCLH 1ZLWK 5KVEL 2R0LL 2QADB 2G60H 2Z93B 3K80A 2Q8BL 4OKDA 4HWZA 2WWMC 3QJHA 3QNXB 1T22A 3PV6A 4J3UA 3ULUL 3PHQB 4XCNB 4YHPB 2DMBA 2UVFA 4WUUA 4YC2C 1UFUA 2RJMA 1KLUB 1HHJA 4IMLB 3PXJA 2V7HA 5DT1L 2A1WL 5HHVH 3FOMA 4HIEB 3MV11 1AP2A 3ARBA 3U2SA 4UV7L 1Q9KB 3BKMH 2VLJD 3RKPA 1SJHA 4WRLA 4ZMAT 1W0VB 2PNDA 4JFXA 3W81A 2WBKA 1KCSH 3MRJB 2F9BT 3W82A 1ZV5A 3IDXL 4PD4J 4KKAD 5IF0B 2D31B 1JGDA 2IALB 2PW1A 3LS4L 4KQ3H 1ZHNB 3T2OA 2EDOA 3HRZA 5CSGA 4O2FA 1HXYA 3OWEA 3FQNB 4P46A 3DURA 4WTZG 4QYOA 1AO7D 4XHJC 2EH8L 5DQDH 2EE2A 4BH7B 4Z77B 3NFSL 5HXMA 2AXJA 1N5AB 3VFPA 3ZYJA 4JLRB 4FMKA 4N8PA 2AXFA 1LO0L 5K9JH 4ZYKA 1KXTB 4PG2A 3LN9A 3FO1B 4Y19D 1ZVSB 1A0QL 4G80A 5EU6D 3PDDA 1XGQB 4FOMA 1NC4A 2WINB 3SQOL 5IB1B 1UXWB 4HC1L 1MCNA 4KI5C 2Z31D 2ZCKH 3ARTA 1YUHA 1S78C 4OLYL 2X9YA 5FCUH 1SVZA 2ED8A 1XH3A 1YMHB 4WI4A 1OW0A 3FQTA 3TO2A 4GXUM 1CBVL 3RWGA 4OF5A 5KS9E 2CPCA 1KT2A 2VQUA 3NGBB 4FFZL 3HG1E 1KLGB 5CJ8A 5DS8A 1A6WH 2VXSH 1YMMD 5I8EB 4GRMA 3CU1A 5EU7E 5IR1A 3QJFA 3BGAA 2VJXA 5DMKB 1JIBA 4PJ8C 5E5MA 5IFJB 2IMMA 1MREH 3WNPA 4E0RA 2E7CA 4M62H 1RJYB 4I3RL 4N0FA 2DQIH 4OD1L 4PPTA 3VXMD 1MJJB 4KMTL 3IFPA 5FHBL 3TF7C 4AQOA 2FJHB 2XTLA 3CXDL 1FBIL 4HUUB 3S35X 1T66C 1A14L 4OSUH 1NCDL 4RMSA 5BOZG 4WU7B 2ZZUT 3MOAH 3LKRA 5CSZB 4R96B 4YEEA 2EYTA 3O45B 3VFWB 5C0BE 2SEBB 5MEOA 5T3XE 4PJXA 3UTTE 3FQRB 5KW9H 1NGQH 4U49A 1E4XH 4U1KA 1X5KA 5IB3A 2WBJD 5E00A 2VAJA 4L8DA 4PP2A 4NM4H 4Y4KB 4QRRD 5F7KC 3D69A 5IP4A 1F3JA 3VGAC 1X6NA 2NW3A 1YEEL 5JIIA 1JZ6A 4HKJA 3CX5K 4ZO6A 4JRXA 1RZKH 4TVPD 1RU9L 2FH6A 2DQCH 3PJSB 1DE4B 3VXRD 5EORH 5KSAD 2HVKA 1QBAA 2IH3A 4JE4B 2MSPA 4TNVF 1CE1L 1EJOL 3QUYC 1F58L 3MV01 5DLML 1IBGL 4PYHA 3TIDB 1HH9B 2JJTC 2NW2A 2VLJE 2D9CA 2XZAH 4PP1C 1GYAA 3MRBB 1S5IL 2LAAA 4HUVA 3GMNA 2XZQL 2XKNA 3CFKB 1K2DA 3HPJA 2AJSH 4TQEL 3UBXB 1KJVA 5KS9A 1RVFH 4TPRL 3QIBA 2IPUK 2JB5H 3GGWA 3F7VB 4G3YH 4XB8A 4ODWB 5E4IA 4GBXC 5SV3A 2QBWA 3ZE2E 1AO7E 4YQXL 2FWOB 1PQZB 4PJIB 4OLXL 4PREB 1JZ4A 1BIIB 3GMQB 4P23A 2E6JA 1GH7A 4Y19E 1H8NA 3UYOD 5EU6E 2AI0L 4FXKB 1UZ6E 1EO8H 1MLCA 3O3DA 3U48A 1I7ZA 1OQXA 3ILPA 5KG9A 1I3GH 4YDLB 3HR5B 3PGFL 1QLFA 4X98A 3TNMA 1MJ7L 4YHLL 4NZUH 3VFNA 1MF2L 3B9DA 5C1MB 4JPIA 3C2SA 3O3UN 2OS7A 5FGBA 2G9HA 2R2CA 2C4FT 5D1ZD 3N50A 1J8HD 2FR4B 3MYJB 4BZ2L 2L4OA 3SOBH 4TOYH 4Z7UB 1P6AB 4EUPB 1DEDA 1BP3B 1A7NL 3K3QA 2WLYA 2LTQC 3PDOB 5ALBH 4JN1L 4YWGH 4PJ9C 1TCRA 3O2WH 2ZOLA 4GG8B 3MMEA 3QI9A 4X80L 1AJ7H 1GC1H 4WFGD 4F7CA 1SYVA 5D70H 2E7HA 4M48H 1WIOA 3VXME 2E7LA 5GISL 1J0HA 4OB5L 4U1NA 5C0JB 1OAZL 4NWUH 3CFJB 3LD8B 1ZA6A 5E8OA 3HE6A 3SKNB 5HHQA 1A21A 4MNQB 1E28A 3RIFF 1RAMA 1FZOA 4EIZC 4X7TA 1MWAB 4NRYA 4R3SB 4NC0B 2MJWA 5I1DA 2VLJA 3L3HB 1AE6L 2MHAA 1F3DJ 5K93A 3EUUA 3VXUB 1OL0A 4P2YA 3DUUB 4Z76B 5E03A 1ZGLA 4I2XA 1HIMH 3CDCA 4LLMB 1FDLH 4JGUA 3R06B 4QRRE 3S3PA 2D03L 2CLRA 3KYKH 1IGFL 3QQ4A 4G6FD 2WNGA 3WIIH 3MUJA 4NO5A 4PLJD 4AY0A 1M7XA 3L3OA 4QRUA 3FCTB 5EWIL 4CN1A 4R4NC 1HK6A 5J9PA 4H0IA 2BC4A 1U8QA 3V79C 4EI5C 3VXRE 1U41A 4IOIB 5IESL 2YPVL 5SWZA 3V4VH 5JW3L 1U8JA 1BZ7A 3PIQB 4P4KC 2DQTL 1CDCA 3OJDA 5D7KE 5BQ7B 3IDMB 3FQXB 1S9VA 4CN4A 1BD2D 1FIGL 2A9MH 1H9VA 1LEKA 4NQVB 4P9HC 2VLKB 3GBLA 1IGIH 3O4OC 4GLRH 4OTXL 4U2ZA 4YZFE 4WW2B 3GMRA 5FYJL 3E3QE 4F37K 4KKCC 1OY3B 2AXGB 2CKBL 3DYPA 3VFTA 3WDJA 1F97A 3T1WA 3MLYL 5J13B 5E6IA 2GJ6B 3BDXA 2YK1H 4LSTL 3TT3H 1L0YA 4O58H 5J06A 1EEQA 1MCKA 1PG7X 4JDZB 5FYKH 1VFBB 1MIMH 4MVBC 4WTZA 2DQHH 4CGTA 1CGVA 4YO0A 2OR8A 1S7TA 2FB4H 4Y5YB 2VDQH 1T1ZB 1REIA 2VIRB 5ACLA 5AZ2L 4QXGH 4P9HL 2OL3H 3VG9C 4X6FB 4ZSOB 1OAQL 3IDJB 2NY3D 3KR3H 5DJ2B 3QCUH 4JFOA 4WHTB 1K6QH 2GTZA 3O2DH 4MD0B 3O2VH 1RZJC 3QCVL 1T21B 3WN5C 1CLOL 3EJZC 3JWDH 4RDQF 4O02H 2EDBA 5IG7B 2DQDL 3LSOA 5EPMB 5E99H 1J8HE 5E1HB 5ICZA 2VXVH 1KTDB 4L9LA 4MD5B 1BF2A 4QRTB 1AFVH 3SDCC 4JHZA 1A2YA 5T1KA 3O3BB 4WJ5A 2V2TA 4UB0L 2E9BA 5E2UL 4XH2A 1IEAA 3DOSA 1A3LH 5DD5H 1ZGLP 5HGDB 3ZE0E 4BSVA 1QHOA 4NZTL 3BKJH 1UWXK 1RZJL 1FFPB 1HEZA 2NZIA 1KB5L 1CFVL 2AEQL 5DMIL 1ZT7B 4JVPA 2QSQA 2F53E 1C7TA 3TO4B 3SDYL 4JPVL 1QQDB 4NO0D 3QXDB 3TBYB 5HBBA 1XT5A 2MWCA 2BNQB 1CL7L 3GSRA 5DK2A 1NBYB 1MJ8H 2YKLL 3UROR 5C07B 3OX8A 4HUKB 4FXLA 32C2A 1I9JH 4KKBD 1P5VA 4OLVL 1FNSL 5GRYA 5HHOA 1QLEH 1EUUA 1IL1A 1NAKH 3RUGE 4YEFA 1YEGL 5CUSL 3EDEA 1LK2A 1IKNC 5FO7A 2JKXA 3P30L 3OKNB 4LRIC 2HWZH 4NJ9L 4Y1AA 1B3JA 2NR6C 1S7WA 2CIKB 3PV7A 4FQIH 3C5JB 3AXLA 4MB4A 2HRPL 1SYSA 1U91A 4XNQB 2D4DA 4NP4L 3U6RA 4FTVD 1MCEA 2ZCHL 1CS6A 4JFED 5A2LH 4YJZL 5D7IB 1C5DB 1A9BA 1IM3A 4C4KT 1MNUH 3P9WB 1Y0LB 2EDLA 2D3VA 3GZKA 1OLLA 3MACL 1NJ9A 4F3FA 1WK0A 4G9DB 4GW1A 1QO3A 4RFNC 3TH4T 1LE5B 1BD2E 5JOEA 3HE7A 5KN5B 5I74C 1BQSA 2ORBH 3LEXA 3QXUA 1X44A 3GSVB 1U9KA 5GS1B 4PJBE 5BZDB 4QT5A 4HUWA 1IVLA 3SKMB 4PJGB 1J8HA 1NGPH 4XVTL 1C12B 3M8OL 3VDAA 4ALAH 3DX6A 1FL6A 3EYSH 1R5IA 1CGTA 1KNOA 3GSQA 5IHUH 2P45B 4H26A 3QYCA 3T1FB 3PXHA 3ARFB 4TSCH 3QDJB 5EBLA 2PYFA 1TNNA 4AL8H 4TNWK 1IZKA 5GZOC 2CQVA 2O26U 1JPGB 1NGWB 1FG9C 1QFWL 4JG0L 2O93L 4Z0XA 4M7ZC 3HN3A 3CH1A 2RFXA 3L3KA 1X5AA 3MCKA 3TJHC 6FABH 5FA4B 3S36H 4LCWE 2F53A 4X5WB 4YNYA 5D7LE 2CIIB 4HIXL 2GAZA 5MENB 4OCYL 1MRCL 3O0RH 5DA0B 3X14B 1TNMA 4H1LB 1E6JL 3GO1H 2VLLA 4KVCH 3BQUA 3QDGD 4P2RB 3V2AR 3Q48A 3ZO0A 5DJAB 1UZ8A 5EC2B 5H2BA 4LEOA 1LO5A 3NTCL 1QNZH 4OGYL 2EYRB 2E9JA 2XNAA 4XP9H 1CZ8H 1BFVH 4WDIA 3O9WC 3JWOC 4QGYA 3CH8A 2PTVA 3REVA 2WUCH 1IGJA 5BVPL 1T7XA 4P5KA 3OKLA 1AGEA 4KH2A 4F7MB 5HHXH 1U3HB 2V2WA 3MLSH 5J56B 3SGEH 5EU4A 3INUH 5CP7A 3EAKA 5F7WC 5HI3C 1VADB 3NCJL 2FBJH 3N9GH 3DIFA 3O6FC 1KTKE 4Y16B 3V4UH 3H3PH 1RULH 1S7QA 4KK9D 2VTFA 1HQ4B 4PJ9D 3VXSB 1DQQA 1YEKL 2OMNA 2Y06H 4PRDB 4QXUH 3RZCC 2BXYA 4F9LA 5F7DA 2R0ZH 1BD2A 5F9WC 3W2DL 5BZWA 3TH2T 1S5HB 5IW6B 3GMOA 4NJAL 4FQ2L 2HN7A 3JWOL 4RMWA 5IMLB 3N85H 3GMLA 3MRPB 4PJBA 1JNHB 1AD9A 1NEZA 3QDMB 2X4RB 4MSWA 3RVTD 1J0IA 5ESAA 4GKZB 4NUJB 5JOPD 4LP5A 1NC2D 5HPMB 2ZJSH 4HX1B 1LEGB 4HEME 2HFFB 2AK4E 4GO6B 5EN2B 4HGWA 2W9DH 3CPLA 4FTVE 4LEXL 4ZFGL 1UACL 3QQNA 3STLB 4JFEE 4K23L 1UWGH 4JFYA 4ELMF 4CVZB 3QA3B 4HC1A 1H3VA 4GMSH 4EDXB 3THMH 3OGCA 4LSQH 3D2UB 4UOW0 1GAFL 5IKCB 4DTGL 4PJHA 4ORGB 5KBNC 3FTGA 3BP4B 3P3YA 3DVIA 3P0GB 2R0WH 3C08L 3OF6D 4LCWA 4OFYA 5D7LA 4YBQC 4M7LH 4IJ3C 3ZE1F 1DN2A 1XGYH 1MCWM 1RIVL 4DFHA 3KLHD 1M6OB 3GSWA 4Q6YA 5ITFB 2FECI 4WW2F 5EBWA 5ANME 4PGCB 5ACZB 5IVXA 1AD0A 5C9JB 2PYED 5CD3B 3FB7B 3EKCA 4MDJB 1TZGH 3T77A 5DWUH 1R3HA 3GSNL 2WWKT 3PF2A 2Q3AA 3D87B 1ZK9A 4P2QE 3SDAB 1CDGA 1YZZA 5C71A 2ZUQB 5T3XH 1JHTA 5DDHA 4AENB 4FZ8L 2PUQT 2XPGB 3D25B 1R3IH 1MCCA 1Q0YL 3RI5K 3C6LC 1BX2A 3BP6B 1BQLH 3MXVH 3WS3B 1HQRA 4OV5A 3AUVA 2H1PH 3MLTA 4OKVA 5I1HH 3NAAL 5IMKB 4JY5L 1OCWH 1QOKA 1I7RB 2AQ1A 3FT3B 4PRNA 1T04A 3RIAF 3WLBB 4LNRA 1DQML 1RZ7L 4GXVH 4PJAB 1RJCA 4I0PD 3EYOA 1ZS8A 1F2QA 3DBXA 3EDDA 4X9GA 5DD3H 1AI1L 4PJ8A 4LLDA 3JUZA 3S35H 4FQ1H 5I2IA 2Z35B 3QDGE 2VISA 4AT6B 2AJVH 4MXWH 3KWWB 1PKQE 2P24A 3T4AA 3MA9H 2NY0C 1MH5B 4DOHE 1DUYA 5JPMA 2BOBA 5CZXC 5L9DL 3T0WA 1U8NA 2P5EA 2V9TA 5HSFA 1NSNL 1FFOB 1IJ9A 1DBKL 1KACB 1WWWX 3P4NA 4GUPB 2R2BB 2VN7A 1QUNA 4HFWA 3U0TB 3NACL 5I17B 1NBVH 5D5ME 3ESUF 3HI6L 1UB6A 3L5JA 4JO3L 1U3JA 4C83B 2AK4A 5KTEH 4NQCD 4FTVA 1UXSA 4HK0A 3V5DB 5IT2H 3U46A 5LGJB 2ZPKH 2BHZA 1K9TA 1C08A 3T0ED 1B0WA 4X4XA 3LRSA 3G5YB 4PTUB 2J88H 1G7MA 2NY7L 3HNTL 4QHKI 1U8IB 3CVHB 3WFCH 1CGSL 2FX9L 1P7QA 5F96L 1KULA 1ADQA 1MRFL 4CMHC 4KTDH 4O00A 2WIIB 1KCUL 5CLWA 1EEZB 1G9NC 2AK1L 3VFSB 5FKAA 1OPGH 4Q9RH 3VXOA 1BFTA 5HJ3B 4KZDL 1SM3L 4PRPB 5IFAL 4D9QE 1G0YR 3QUYA 3VJ6B 1F4YL 5FK9B 2JJTA 1MHHB 4P2QA 4S2SA 4HWBL 1VACA 4WI5A 5DMGD 4KQ4L 5E8NB 4HS3B 3BDYL 4U6YA 4KK6C 4UAOB 1NEUA 1ZAGA 5JORB 2XA8L 4BYHA 5IBTH 5CAYB 1YQ2A 3VGGA 3LDBB 4OBSA 1XCTB 3PUCA 4XP5H 4AEIL 4F37F 3BRDA 4JFDB 4J8RB 4PRIE 3VG0L 4E42A 2X1WL 2JK5A 4XBEH 5I66A 4GBXA 5SV4A 2Z92A 3V6BR 1G9NL 5TE4L 5FYJE 1XR8B 4H25B 2OJEB 2YHGA 5D93B 2DQJH 4J2XA 4J4PC 4PJEE 4G6AC 4YXHL 3MLRL 4TVSa 3TWCH 3GI9L 1H3GA 4K3HA 3DI2B 3BEWA 4XBGB 2YA1A 2C26A 2HLFC 4E41B 3BD5A 2PYEE 3QUZD 4JN2B 4L3CA 1JRHL 2P47B 2UZXB 3D39D 4YK4B 3ZDYF 3QNYA 3ME0A 3RFZC 5SX4H 1QR4A 2AJ3B 1DEEB 2Y5TB 4UILH 5L6YH 3U1SH 1YC8A 3ZSSA 2NY2B 1DL7H 1ZHLB 4N0UB 1P1ZA 2IAND 2NY1D 4YBHA 1Q9OB 4U6HB 3WHXA 4CVUA 1VPOL 1MLBA 2EIEA 3MRQB 3ZKXC 2OTPA 3VWKC 2ICWI 4OF3A 5D5MA 4DKEL 1F6AB 2KQMA 5GRJL 4O4YH 2VLME 5IVOA 4W4OC 2PO6B 2DI7A 1KC5H 2EICA 2AAVA 1TLKA 2W1NA 4LGRB 4JPKL 3DLQR 1OAKH 4EBQH 3UDWC 4PJ9A 3D0LA 4M7LT 3NVQA 1BWWA 3F8UB 5AG9A 1RY7B 3KAAA 5DSCB 1T5WA 3BKYL 3DX7B 5DHYA 5BJTB 4LAJH 4MA8H 4ZFFB 3GFUA 1MFAL 4Y2DD 2P46B 2XG4A 2AABL 3P9MA 4JPWH 3MA7A 2JELH 4C56D 5IQ9A 4P5MA 3TT1H 2D0HA 1YEIH 1I7TB 1U92B 4ESKA 3RWEA 4JZOB 4PS4H 1QSEE 1T0MA 3WXWL 1OP5H 4OZGE 5I75B 3K2MC 2WK2A 2XWTB 3DHJA 3H3BC 1PY4A 2NTFB 4NWTL 5KSBB 4MXVF 3FO2B 5TDPA 5CGYC 4DEPC 3P0VH 2GJZB 4NQCE 5JOFB 2VDLH 3H42L 3K4AA 3LN5B 1LO4L 4MA3A 3T0EE 5FGCB 4EVNA 4NUGH 2GW5A 1CVSC 3BGFB 3PWNB 4HLZG 3WJJC 2VZSA 2R39A 4KVNL 4MLIA 3U0PB 3WO3B 4E5XA 4PRIA 2IAMB 5MERB 1G7LA 4N0YL 4WFHD 3E1F1 4L8SB 3I6GA 1A6VL 3HUJE 2JJWA 3RWCA 15C8H 1OTSD 2ZOKB 2CKBA 4H20H 1TETL 4MGXA 2YEZB 5DUBB 4ZD3L 4Z7WA 1QYGH 1FCCA 4RGNC 4JAMB 3HI1B 1VEPA 4EI5A 2EZ0C 2VLRD 3LKPA 3FB6A 4LGSB 5DI8A 2QSTA 4P4KA 1RUKH 2Y07H 3GBMH 3HC4L 1FE8H 1NFDE 4IOFD 3B9KC 4ZPVB 1HSAB 1QSFD 2NXYB 3BPLC 2P1YA 3QRGH 4M93C 5FOBB 4FFVC 5I15L 4KK8C 4KUZH 2XY2A 1DBMH 5K59F 1ZLSL 4POZD 3HNSH 1S9YA 1W8NA 1PG7H 1N0XH 5C0RH 1Q1JH 5F6HJ 2DD8H 2MTPA 3MLZH 5IQ7H 3U4BH 3UTZB 4JKWA 2W9LA 1OAUL 2HJFB 5C3TA 4OGAD 4GRWE 5IIEB 4JG1H 1MHCA 3T3PE 4ZAKD 4UQ3B 2KDGA 2Y1VA 1VESA 1KCRH 1W72B 4JFFE 3FT2B 2CDFA 4NKMA 4TNWF 5HYSA 2ZUVA 3L5XL 1O7VA 5F7MC 5I9QB 5JA8B 1I8IA 2VL5B 3CXHJ 1LVEA 1OAYL 3MRLA 2P8LB 4LVOB 2V9QA 5IFHH 3WN5A 5ID0A 4FABH 4HDIA 4BKLB 1QSEA 3TNNB 1KB5A 3V5HA 1YQVL 3H9ZA 4KROC 4OZGA 4UNTA 2GSIB 3BFOA 5KVEH 2FJFA 2R0LH 1FLRL 3MUY1 4Z7OF 5EUOF 3CU7A 1R3JB 2Q8BH 2YD2A 3FO9B 3SDCA 3DRTA 3VWJB 2ZUUA 3LV3B 3QFJA 3GNMH 1U8HB 4XVSL 5CZKA 2R56L 1S7SB 5BV7C 5DO2D 5AG8A 4V1DA 4XNZC 3K7UA 5T5NF 1CE6B 1E4WH 2CGRL 1CIDA 5DT1H 4HXBH 3HUJA 3VFOA 1QFPA 4MQTB 3OKEB 4POUB 4O2CB 4OZHA 4UV7H 4MQ7A 2ICWB 4P3DB 1FO0L 3MFFA 1FNLA 3PWLA 4C56E 1CIUA 2HT2C 1CD8A 2NX5B 5INDB 2A83B 3MV8B 2KKQA 5HDLA 4OZ4B 3IDIB 2PTUA 3JTTA 1D7FA 1NFDA 5E4EB 1FV1A 1IEHA 2AEPL 1T22B 4XBPA 3T2NL 3WHE0 2FO4A 1XIWB 4G8GD 1U93A 5BV7L 1X9QA 2EH8H 1BM3L 2HT3C 2BSSA 1L6ZA 5J6HB 3NCYP 1H15A 3S9DB 3BI9X 1JTOA 5IBUB 3RVWC 1AP2B 1UCBL 1KBGL 4MJ6A 1SJHB 1IKNA 4DVBA 1KGCD 2DWEA 2VAAA 3PGDB 3A6BL 4JO2H 4WFHE 4LRIA 4AM0B 4M9PA 4NHCL 4OI9A 1YNKL 2XV6B 2QKIA 5BS0D 4OLYH 1EDQA 1KJ3L 2VUOA 3HRZB 4JRYA 4O2FB 1HXYB 4RAUA 4JFFA 4G8FA 1SBBA 1SJEA 3MJ9H 3DURB 4R7NA 4CJ0A 1G7IA 1CBVH 3OBAA 4KFZC 4FFZH 3MODL 1QSFE 3U9UA 4NT6B 2DLTA 4MJ4A 5E9DB 4CVXB 5D9SB 4RGMB 2ICES 4OZIA 2Q3ZA 4KDWA 4RAVA 1XF3B 4K3DH 4R97B 2ADJA 4PJ5E 5DQJA 4XMPH 5JTWA 3SCMD 4NSKA 4XWOC 4I3RH 4OZFG 1EHLL 3RVUC 1MFEL 4YHOL 3S4SG 3T4YB 3WFBL 3NGBC 1X5LA 1JYNA 1EO7A 3TO2B 1BJ8A 4OD1H 2W07A 4KMTH 2EDEA 3FAWA 4HPYL 2XXMB 5EOTB 5FHBH 5I8CA 2OK0L 4W6WB 1KT2B 3CXDH 1FBIH 4XNMA 2FNBA 1A14H 3GMMA 5J89A 4WY7L 4X6DE 1P84J 1ZTXL 1OGAD 1KJ2B 3RVXC 5D6DC 5DJCA 3LN4A 4Q97A 2HMID 3PP4L 3QO0A 1KEGL 1IEBA 5C0CD 3QWRD 4HKXB 3IDYB 2AVGA 3QIWD 5F89B 4GKNA 2DM2A 1XEDA 4OQ1A 2XQBH 3EO0A 4ZO9A 2VWEE 3CX5J 1T7ZA 4EI6A 1XF5A 2I9TB 4F58L 1IAOB 1M7IA 3I02A 4JM2B 4ZUUB 4J3OC 1YEEH 2W60A 5CMAB 4RX4A 5F9JA 1RFDL 2EDJA 1UJTA 3G08A 5C92A 1WCBA 1RU9H 3MLVL 3LKRB 1NCTA 1QLRA 5M94B 2I5YL 3O9WA 5F7LB 1NL0L 2YUXA 2P8MA 4HS8L 2YZ1A 5DK3A 4ZUTA 3EHBD 2XFXA 1HXMA 4Y4KC 1CE1H 1EJOH 3QHZL 5DLMH 1IBGH 2Q86B 1AY1H 1Z9OA 3F7YB 1GGIL 1S5IH 4GAFB 3D69B 4Z95L 3VA6A 3RTQB 1U95A 3LS5L 4X7FC 3WNNA 3O6FA 4LOUD 4M5YH 4WO4B 1TFHA 12E8L 3QEHA 4TQEH 3MRDA 2JCCB 4HG4J 1FRGH 4G43B 1ADQH 3RZCA 2VDNL 3N1MC 4JGJA 4OGXH 2A9NH 1HHHA 3LQZB 4L3EE 2HVKB 2IH3B 1KFAH 2GSGB 4PJ5A 1RJLA 3P9LA 4CNIB 5LAXA 4ONFL 1ETZA 2XWJB 3HMXH 4N8VA 2GTWA 2A77H 5I16B 3GMNB 3HKFA 5D7JB 1BJ1J 5BS0E 4RIRA 3EGSA 1WVZA 2J8UE 4P0DA 4DGIL 3PGFH 5KS9B 5CGYD 1MJ7H 1TQBB 3HG1B 4YHLH 3KYMB 4OIIL 1L4IA 1MF2H 3UTSD 4R2GD 3GSNA 3TPUA 3V5KB 3V0VB 1UYWL 3VH8G 1MCQA 2ADGB 2JE8A 4IRJC 5IM7A 4QNPE 4I77L 3PNWA 4B50A 3AM8C 4R26L 4Z0BL 2W9EL 4QHLA 4P23B 2DYPA 5AD0B 4YDJA 4ZO8A 3DECA 1T6VN 5BVJB 4CW1A 4YHIB 2R1YA 1Z9LA 3MNZB 2YWYA 1X5YA 4UTBL 4J6RL 1TXKA 5IJKA 2D7MA 3ZHKA 2EXYC 4ODXA 3ULVF 1QLFB 3BWAB 4X80H 5C0NC 4D0CB 1M7DB 4HZAA 3WFHB 2IH1B 2ZCLL 1JUFB 3O3AB 1DANU 1I4FB 3MJGX 4G9FD 4K8RD 4JPIB 4DGVL 2G9HB 1OAZH 4X0KA 3DGGB 4N68A 1JN6A 1U8OA 5DJ8A 5C0BB 4HUXA 4BJLA 3UTTB 1E6OL 3OJ2C 4M6AA 5CZVH 5IJVA 1ORQA 3C6LA 4YHMH 1JYWA 4X6EB 3P4OB 3VRLF 1AE6H 5C0EB 5C0CE 1UH2A 3TESA 3V6ZA 5HGAA 1F6FB 1U8MA 4DQOH 5IGXL 2ZSVA 3DV4A 5GIRB 4M7KH 3LD8C 4F7CB 2ADFL 5FYJU 5C09E 2D03H 4GQ9L 5GS2H 1IGFH 3T0DA 3DROB 1Q94B 3PQYD 2RGSA 1WWAX 4U1NB 2YD3A 4FFWD 1ZA6B 5HHQB 4L3EA 3DX9A 5IVNA 2AGJH 5B22A 3MJ7A 5EWIH 5F7FA 3QXAB 1JGEA 4JM4H 5L2KD 4LHQB 4NRYB 2YPVH 5IESH 3FB8A 2VLJB 3SE4C 1BREA 5JW3H 5LVEA 5TGBA 3VRIA 2DQTH 3MRIA 3E6FA 4PTTA 1CFTA 4KROD 1RMFH 3VXTB 2BOCA 3GMPB 4OFVA 1ZGLB 4L5FH 1FIGH 2J8UA 4ZQKA 2EO1A 1IM9D 4OTXH 5F93C 1T4KA 5E8DL 1G9EA 1M4KA 1KOAA 4IS6A 5TDNA 1MWAL 5FYJH 1X5IA 1N64H 1AO7B 4HWBA 4WV1B 5EZIL 2CKBH 3X12B 3MLYH 4WU5B 2Y36L 5J9PB 2G5BA 1U8QB 5I1JL 2KQNA 2ZNXA 4LSTH 3ZKNC 1QHPA 4Y19B 3VI4E 1TTUA 1QP1A 5EU6B 2Q76B 4LPCA 3RA7H 3SCMA 2BERA 2X1QA 3TH3T 2F19L 2G2RB 3VGHA 5DEFB 3VFVA 1BBDL 5CEYA 1KCLA 1LEKB 3OR7A 1ZSDB 4P9HH 3P0YH 1J1XL 1OAQH 4HIHA 4WGVB 1BQHA 4UDTB 4HCRL 3GMRB 2ERJB 4F8TA 5J13C 3BT2L 2HH0L 4S11A 4FQPA 1MFDH 4ODTH 2NY4B 2WV3A 3VFTB 4N90D 4A6YH 1YN7B 3QCVH 1YMMB 1CLOH 2G5RA 3R1GH 1KIPB 1IC4L 5DJ6B 1A6ZA 5MHSD 5J7CC 3G6AA 4LPWA 2VSDA 3QQ3A 4Q7DA 1N6QL 4YO0B 1S7TB 3ZDZE 4ORZC 2N56A 3X11A 3IYLW 3ECBB 3C09B 3WEXA 4MXQC 4UB0H 5F1NA 3QXWA 5HI4D 4J4PA 1INDH 3HPLA 3OHXA 4RGNE 2VRAA 5C09A 5T1LA 4LDEB 3VXMB 4F7TB 5HVGB 4PGJA 4JFOB 4KDTC 5FB8A 1P6FA 4NZTH 4XPGL 3QEUA 1RZJH 1ZXQA 1Z0NA 2ZG3A 5EIVA 4GG6B 4PGEA 2BNUB 1AGFA 1CFVH 2AEQH 4X6CE 3ARGD 1N8ZA 2QTEA 4G8IA 3SDYH 3FFCE 5DEGB 5ICZB 4L9LB 3L95B 4M1CD 5DZNA 2CDEA 4O9HH 1QG3A 4YR6B 5T1KB 4WJ5B 3LKOA 4U1GB 1EAPA 2Z8SA 3DX8B 1UKSA 1Y6KR 2OLDA 4QRRB 4W4OA 3U36B 3L3DA 3GSOA 4HT1L 4OLVH 1FNSH 4QRPD 4BSVB 1VGEH 1A4KA 2QL1A 3FN3A 3UDWA 1FVEA 2YC1A 3SHSA 5CUSH 3PQYE 3ZHLA 1BLNA 3TLRA 2Q87A 4BK5A 4XNUH 5DXWA 4PLKD 1INEL 3VXRB 3U7WL 5KSAB 4YHKL 2XI9A 4J3WA 1T5XA 2HRPH 1T2XA 2AV1B 3SPVA 4N8CL 1ONQB 2ZCHH 3GSRB 5DK2B 3QFDA 1EHAA 1B4JH 2HLAA 1NDMA 3OX8B 4S1QL 1U2CA 4PJXF 5J4MA 3LVEA 1IQDB 2NQCA 2KBGA 3EDJA 2C1OB 3OAZK 3S6CA 3CFDA 1C5CL 1IGYB 2YS4A 1F3DH 4L4VE 1PG7W 3LPGA 2R1XA 3V6FB 1R3KB 2YZ8A 4GRWH 4Y7MA 4KJYA 3WJJA 3IVKB 5GRXG 1SYSB 1U91B 1YPZE 2MKLC 3M8OH 4ZXBC 4UT6H 2Z8VC 4PRAA 1SMOA 4GS7C 2GK2A 2QQNL 4QRQA 5F7EL 5L8KB 1DANT 4PJDA 1HKLH 5DURD 4F3FB 2DI9A 3IF1A 1IAII 4GW1B 5IUSA 1F42A 1HSBA 2XWBA 5GS1C 4JG0H 5JPNA 2ESVA 1ITCA 1NMBL 3QQ9C 3LEXB 1UEYA 3B9KA 1BFOB 1YYLL 4QT5B 4X6CA 2YA0A 1XZ0B 5D1ZB 2A6JA 4Q6IB 1J8HB 5KS9F 3L5HA 4XWGL 4N90E 3FFCA 3D85D 2H3NA 4HIXH 4M8QA 3VD5A 4IRSC 2J6EL 1MRCH 3ARFC 1BAFL 1YEDB 1WQVT 1PZUB 1IC7L 1E27A 1E6JH 3BE1L 1KNOB 1H0DB 4WW1A 4H26B 4UOW1 4GQPH 3S37L 3NTCH 3KS0J 4NQSA 3NCYS 4OGYH 2P43B 4MJID 4WNQB 3CLFL 1MCBA 3DVGB 1AGDA 3T08A 3QEQA 3MCKB 3JSSA 2W65A 2M26A 4YFLF 2IJ0C 2F53B 4IRZL 4YNYB 3CIQA 2ARWA 1RZIA 3ARED 3QXTA 4QY8B 5I73B 2DM7A 2CKNA 1X7QA 3RKDD 2KL6A 2P5WD 4FRWA 2FEDD 4HIIB 3IXTB 4R8WL 5CWSB 2GY7B 3NIFE 2H2PD 1CDYA 3FZUC 1UZ8B 3VMPA 4LHUG 1FO0A 3OR6A 1R0AL 4NRZA 1UENA 3CFEB 5KANG 4G7YL 35C8H 3W2DH 3ELAT 5SWSA 3MNWB 4RMUA 3KVQA 3NIGE 3RUGB 2VITB 4WDIB 4NJAH 4FQ2H 4G6FB 3OTTA 1U3HC 3CC5B 4QRPE 4N9OB 3JWOH 3P73A 4L4VA 3HNVL 3REVB 3MREA 4P4RA 2Q7YA 3OKLB 1RZ8A 4S1DD 1GPOL 2V2WB 1YPZA 1DTUA 2JIXD 1IGML 2UWEE 3QIUD 4ZOCA 3TA3D 4ZUSA 3JV4A 1IFHH 1KXVC 1S7QB 2OTUA 1N5YL 1SBSL 1DQQB 3V52H 4EN3D 4LEXH 4ZFGH 1UACH 4K23H 4Y4FC 1BD2B 3I9GL 4KHTL 3PHQA 4XCNA 5LBSL 2X9WA 4R6UA 3BAEH 4BZYA 5EBGA 3GMLB 4PJBB 4LHUD 1KLUA 3U0WL 4LSVL 1JJUA 5C0GA 4IMLA 3F5WB 5JLZA 3C08H 2F8VA 5JHDD 3TN0D 3D48R 4MSWB 4HIEA 4YC2B 4HLZH 1CTOA 1RIVH 1Q9KA 1IARB 4Q9BA 2EE9A 2MCPL 3V6OE 1H5BC 1W0VA 4NC1C 5GQBA 1MCLA 3OKOB 2CXKA 1KJMA 4HGWB 3MCLL 2FX8H 1KPUB 2D31A 2IALA 3ZL4L 2G60L 2R8SH 1GOHA 1VDGA 1ZHNA 3CLEL 3GSNH 3OGCB 2ATPB 1FJ1B 4WTWA 1RD6A 1QFUH 2YPLD 3KPSD 2V2XA 4ZUVA 1UZ6F 4YPGB 4V2BA 4FZ8H 1RUQL 4Y8AA 1Q0YH 1N5AA 2NY3B 4LCWB 5D7LB 1TJHL 3NAAH 3BKML 3GSWB 4JY5H 3W9EB 4XCCL 2WINA 1KCSL 1UXWA 5FUCC 1FC1A 3O6ML 1BOYA 4KQ3L 1YECL 4DKFL 2ZUQC 3O8XD 2L7JA 1AI1H 3KDMB 4UIMB 4PD4K 1ZA3A 1T83C 4ZTPL 3DYOA 1JHTB 3KXFD 3JV6B 1BX2B 5I8EA 1HI6B 4KY1L 4M03A 5L9DH 3BPCB 4OV5B 4MJIE 1BQUA 3X13A 5DD0L 1S9XA 4YHZL 1DBKH 4PJIE 1XCQA 4GSDH 3NACH 5IFJA 1GGTA 2UWEA 1P7HL 4PGDB 1CK0L 4JO3H 1EZVX 5FO8B 2ZCKL 4GH7B 5D6DA 3T2QA 1RJYA 1A6AB 5FCUL 3DBXB 1TMCB 3L6FA 1BVLB 5DUPH 4LLDB 2AEIT 4NCC2 1MJJA 2ILLA 4HUUA 5F9OL 2P24B 3HNTH 3KPLB 1A6WL 1DUYB 5JPMB 1CGSH 2FX9H 5FAAA 4WU7A 4PBVC 1FNGB 4R96A 3CDGB 2RQ8A 5F96H 1NUGA 3OKDB 2SEBA 3VFWA 1WEJL 2IFGA 5K9OB 3LQAC 3FQRA 4HFWB 4Z7NF 1KCUH 1UB6B 1MREL 2OR7A 1WZ1L 2AK1H 4M62L 2AK4B 4FTVB 4KZDH 1IGTB 1UXSB 4GKSB 4HK0B 3U46B 5IFAH 4JFEB 4Y4KA 3MZTA 4C55A 5BRZD 2PETA 2LV4A 1N6UA 3I3BA 4TSBL 4OJFL 3LRSB 1CR9L 1PD6A 3EYFB 1NFKA 2OQJB 3WKML 1G7MB 4QHMB 3I3DA 1XFPA 3BDYH 3UCRA 1PLGL 3VGAB 3E6HB 4P3CH 3UZEA 2XA8H 3MOAL 1P7QB 2CO7B 3R8QA 3PJSA 5I19L 4AEIH 4MNQE 4QHKJ 3V8CA 3LH2H 3LQAL 4YZFF 3ESVF 1NGQL 5IHZA 4HS6A 5F8RC 1E4XL 1WBXB 2QSCL 3H2WA 5ANMB 5ID1A 3ALPA 3TIDA 1TQCC 3D85A 1HH9A 4NOFA 4J7RA 1OM3L 4EDWL 3VFUA 4HJJL 4NM4L 4JY6B 4YXHH 3MLRH 3QUYB 1OTTD 3MRBA 1WC7B 5IEKB 3CVHL 4UAOC 2ATKA 3ZKMD 4M9OA 2LVCA 3CFKA 4RBPH 1JRHH 3LDBC 3ILQC 4W4NA 3DUHA 4U0QB 3F7VA 4XAWL 3L7FB 1IC5H 4ODWA 5FYLD 2DQCL 1X5FA 2YPLE 1ORSB 3KPSE 4MJIA 2EO9A 3JUYA 4F7EA 5EORL 1AGBB 2AQ2A 5D93C 5I66B 3CD4A 1JGVH 2FWOA 5K9KB 1CFQB 4PJIA 2IQ9L 3SDDC 1BIIA 1I3RB 1XF4B 4IRJA 5HYEA 5GRJH 2B1HH 2VDPL 3AM8A 3AREA 3SO3B 1SVCP 2WP3O 4FXKA 4K9EC 4YK4C 3VW3L 1Z0MA 1JV5B 3QDGB 2BSRB 4KKLD 2NY2C 1RVFL 3QNYB 4LMQI 1PKQB 4G3YL 4DOHB 5E7BA 1FVDB 3BKYH 3GJEA 1T1YB 3QQ9D 2VDOL 4G6JL 1JVKA 1SY6L 5DD6B 2VL4A 3KXFE 2FR4A 4L8BB 2JB6B 2PO6C 4Z7UA 4Z5RB 4EUPA 4LLYB 4OCWH 5CEZL 4LVEA 3FQWB 5IOPB 1B88A 1K3ZA 4IRSD 8FABB 3PDOA 1DUZB 3WXWH 1R5WA 1EO8L 2ICWJ 1G0DA 4K9EL 4ZNEE 1OQOA 2JIXA 3W5NA 3FOLA 4GG8A 4PJ9B 1B0GB 4BSJA 1GC1C 3DNKA 3Q2CA 4ZSOE 2GCYB 4GRLD 3H42H 5T33L 4QTHB 1LO4H 1A1MA 5JW4N 5DHYB 1TVHB 4XC1L 2ITCB 5C0JA 4X8JB 2QR0B 5F1SA 4KVNH 4LCYA 4MNQA 1NGZA 4U1JB 5J0BA 3SOBL 2FECL 3MA7B 5IQ9B 2WBWB 1A7QH 3WDHA 1MWAA 3OJMB 5C0AD 1OP3H 1PEZA 5I75C 4R9HA 1A6VH 5A3ID 3MRHB 2B0SL 3RWEB 4R3SA 1TETH 4OUOA 5ALBL 1T0MB 4ZD3H 5LGHL 3L3HA 3MV9E 1EH9A 5KZCD 1NC2B 5KVMC 4M7JH 3VXUA 3ULUF 4Z76A 5CJBA 3DUUA 1JNLL 1GC1L 1N26A 3BGFC 3VD4A 3HC4H 5D70L 3ARQA 4KJPD 2IAMC 4MA3B 5BRZE 1J88A 4EVNB 5CS7A 2X4NA 3DGCR 5I15H 4KUCF 4LCCC 1ZLSH 5EBMA 3FCTA 3NMEA 4HCRA 3EOYG 3P77B 2X4OA 2O61B 1GJIA 4U1IB 4GAYB 3VD3A 3H9HB 2CKBB 3PIQA 2D0GA 4PJEB 4PLNC 4AMKH 3VMOA 4JKLA 4PJBF 3PP3H 1NMCB 1ACZA 1OAUH 3ORJA 3LKPB 2NXYC 4G7VH 1IT9L 3FQXA 2PYEB 3IDMA 1HIML 3WHE1 1A7PH 4NQVA 4YLQT 4UNUA 5AEAA 2M8XA 3S3SA 1A6UL 3WIIL 4ELKB 3K8LA 1ROWA 3HAEG 1NBQA 1ZKAA 4BA8A 4QXTB 1S9YB 2GJ6A 2F5BL 1OAYH 2H8PA 4M00A 4HH8A 1T89C 4A6YB 1NCAL 4PJHF 1L0XA 5KVDL 5KSVB 1YQVH 4ZNEA 4FP8L 3RX7A 5D7IE 4I0PB 1T1ZA 2VIRA 1KYOJ 1MHCB 3EOBB 5ERWA 1FLRH 2A74A 4JCLA 4X6FA 4ZSOA 5AYUH 3LOWA 2CDFB 3IGAB 3CVIH 5I9QC 2XOTA 1P4BH 5IVXF 3IDJA 1YDPB 4OIBA 4XVSH 2FATL 5DJ2A 3VG9B 4LVOC 4WHTA 4ZTOL 4MD0A 1CXKA 5DVKA 3JWDC 3M1BA 4KI5F 3JXAA 2HFGH 4XMLL 5IG7A 2XT1B 3CFIC 3TT3L 4KDTA 4PJGE 5EPMA 3RGVD 5ID0B 3KGRA 3GK8H 4HDIB 4PR5B 1KTDA 1QSEB 4MD5A 1MIML 3MV9A 1FO0H 2DQHL 4OZGB 1W72L 2KZ1B 4LKCA 3RVVD 2E9IA 2YOCA 3O3BA 4XT1C 3ETBF 3QUKA 4UUJA 4OF6A 5A2JH 4NQCB 2FJFB 4B0MM 3NCMA 4Q2ZA 5IB5A 3ZHDA 3ARDD 1R5VA 3T0EB 4WI7A 3D9AH 1FN4B 3KR3L 3QCUL 4LASH 5KOMC 1Q0XL 3O2DL 5BV7H 3O2VL 1FFPA 1BM3H 1RUAL 1DN0B 1J8KA 3OB8A 3JWDL 1UB5B 2BSTB 4YDIL 1ZT7A 3ARXA 5GGTL 3HUJB 3VFOB 2KUTA 2EIDA 4HWEL 5E99L 3VFGL 1UCBH 1KBGH 4L4JA 1QQDA 4MNHB 1FAKT 2R1WB 5SWQB 3A6BH 3TBYA 1J0YA 5C0AE 4M02A 4NHCH 2AXHA 5E4EC 2BNQA 1RPQA 2XYCA 1NBYA 3W0WD 1U6AH 4FMFA 5EZOL 4HK3N 5F97E 5HDBE 3HZKA 3JTTB 1FNEA 1NFDB 1XIWC 1YC7A 1A3LL 1BBJB 4RFEB 3G6JE 5DD5L 1CFBA 1YEFH 1FNFA 3TCXA 3GRWL 1Q8MA 1QSZA 3BKJL 2H9GA 3VGBA 3MODH 2EEBA 1QZ1A 1A8JH 3DHMA 2N7AA 2DQFB 3MOQA 2CIKA 3C5JA 4L3AA 5CKGA 1KXQE 3HZYB 1BVZA 4XP4L 1WT5C 3LB6D 4XNQA 5D96B 2B2XL 1QEWB 4GRWB 5D7IA 1C5DA 2F54D 4APQD 3EJJX 3O41A 1A3RL 1Y0LA 1N0LA 2J6EA 4ZXBA 4YHOH 4JFFB 2A2QT 5A40E 4NQUA 1SJEB 2J8HA 3QUZB 1LE5A 1QLEL 3BYTA 3QISA 4YFLI 3LPFA 3D39B 3OXSB 4RGMC 3O4LD 1NAKL 3X3FL 2R69H 1KIUA 1ZLUH 4LK4A 4R97C 2V5MA 5GS1A 4WY7H 1MUJB 1RZFL 2HWZL 5I74B 5BZDA 2IANB 2NY1B 4U1HB 2X4TB 4PJGA 1IZJA 3QDME 3DVNA 1JPTH 5DQJB 1C12A 1KCVH 3HR6A 2VABA 4NSKB 2DIAA 3FQUB 1MNUL 3K1KC 4IRSA 4PV8B 3MYZA 1CD9B 3T1FA 4KZEL 3ARFA 5TE7H 5D6CA 3P40A 1UKTA 4HEPG 1JPGA 1NGWA 2NY6D 3OKMA 4D8PB 2LQRA 4WFEE 4XNMB 3BJ91 1RFDH 1K8IB 1UQSB 2WQ8A 2HP4A 4MWFB 5FA4A 3TBSB 2I5YH 1GRWA 1NGPL 1ZVYA 3QO0B 1IEBB 5MENA 4C56B 3X14A 4EXPX 4H1LA 5C0AA 3EYSL 1HOCB 3T04D 1JBJA 5IHUL 4JM2C 4P2RA 3FHAA 1DR9A 5DJAA 3L7EB 4Z95H 3G6JA 1DSFL 1F4HA 3LS5H 5D5MF 4UDUB 1OGTB 3IU3A 12E8H 1KJ2L 2A0LC 4WHCA 1RUPH 2EYRA 1ZWIA 1G6VK 3G08B 4HJGA 4G6MH 3EO9L 2VDNH 4BQCA 5DFTA 6FABL 3S36L 1QLRB 1D6VH 1ZEAH 2HTKD 4F7MA 3O9WB 2BNRD 1U3HA 3DSFH 3O0RL 2RB8A 3BUTA 4M4PA 3SO5A 1HXMB 5EO0B 3FFDB 3GO1L 3QEGL 3RTQC 2IBBA 2YSSB 4ONFH 4WO4C 2R9HD 1T2QH 2C3VB 1RI8A 4P9MH 1I85C 1HQ4A 1T7VA 1U95B 2VLRB 4U0RB 5D1QD 4PRDA 5ITBL 3W0WE 5TJWK 1QNZL 5DF0A 3MRDB 4DGIH 4XP9L 3IKKA 1CZ8L 2Z9TA 5JQ6L 1BFVL 1QSFB 3AS0A 5IW6A 4Y4FA 3RZCB 3MRPA 1DVFD 5F44A 2WUCL 2Y6SC 3Q3GB 5C08D 5B3NA 4H5SB 3QDMA 1FL3A 3MLSL 1J1PL 5DVNA 1MI5D 3FRUA 3MRFB 4Z0BH 4GKZA 3INUL 3BIAX 5LWYL 4NUJA 3WIFB 4MNGE 5D7JC 1ERNA 2FBJL 5HPMA 1FIEA 3KPNB 2O5XL 1ETZB 1LEGA 4HX1A 2HFFA 3GEWB 4K07A 3EYQD 5EN2A 2GTWB 3IAGC 4UTBH 1TQBC 4J6RH 5D7SL 1H5BA 4R0LB 3STLA 4LIQE 4QXUL 5FHAH 4CVZA 2NXZC 1FQ9C 1FGVH 3QA3A 2F54E 4EDXA 2R0ZL 2CLVA 2R2HB 4ZAKB 4XMKL 1NFIB 5I1AB 4Z7WF 5IKCA 4JKPH 4ORGA 2L7UA 2XKSA 5CEXA 3TPUB 4X6DB 2FIRT 3N85L 3I6LD 1ED3B 3DI3B 3AFLA 1WBZB 2R0KH 3UX9B 3WE6A 4DGVH 5IM7B 3O4LE 4KK5D 5D8JL 1E6OH 4QHLB 4RBPK 5ITFA 1N59A 3OKKB 3E0GA 5D2LE 2D7QA 2ZJSL 4NPYA 3SBWC 3BMWA 4IJ3B 5ACZA 5EZLA 3O6LH 4CW1B 1FG2A 5CD3A 3FB7A 2P49B 3ZDXE 4MDJA 2HRLA 4IEFB 2LFGA 3KHQA 4OUUA 4F2MA 2FEEI 2H41A 1EEUA 1KN2H 4OCXH 2V5YA 2R23A 1I7UB 4TTDC 3X3GL 2V9RA 2ADFH 3KLAB 3QB7C 2VDRH 2XPGA 3D25A 4EUPH 1I8LC 2R0WL 1T83A 3BP6A 4BFIB 1EPFA 5DJ8B 2EDNA 1GCFA 1Q72L 4YDVA 3WS3A 3MQIA 4M7LL 1LK3L 3VCLA 1MAKA 1XGYL 1ZMYA 4YAQB 4GAGH 4D0DB 5IJVB 1ORQB 5F1IA 3FT3A 3WLBA 4F8QA 3BN9C 4JO1L 5FV1L 1QRND 5CD5C 2EDFA 4PJAA 3MUGA 2PXYC 5JUEH 1QFHA 3FRPG 4HWUA 4Z7VF 4PY7B 1U8MB 3SKJL 5CEZE 1DJSA 2Z35A 3DV4B 3BPNC 5IK3B 3IS0X 2AKRA 4XC3H 5E8DH 4OZGF 3ARVA 5DC9B 1E4JA 1R3IL 1MH5A 3IFOB 1BVKA 3G04A 4G8GB 1CQKA 3L3IA 3DX9B 1YY9D 2CXGA 2CO6B 3MJ7B 5EZIH 5I1HL 2HFTA 4PJCE 3A6CH 1FFOA 2D0FA 4GUPA 2R2BA 3NCFB 4MNGA 4KKAC 5F6IC 1U58B 2BNRE 3HI5L 3NH7L 5TGBB 4C83A 4PTTB 3V5DA 5DD3L 3WJLC 1HINL 1RIUH 5BS0B 3C5SB 3S35L 3RDTD 4FQ1L 2XN9D 4LQ1A 1W0YT 4ZQKB 1BBDH 3HUJF 4KV5F 2WANA 4OZHF 1T7YA 3T3MF 3CFCL 4PTUA 4WV1C 2X1XR 3WCYA 4OI8A 1OP3K 2LVEA 2UY6A 4HCRH 2BX5A 2D4FA 4YX2L 5HGHB 3CVHA 3BT2H 2HH0H 1C1EH 1CDJA 2P4AB 4FXGB 2XTJD 4JQXC 1EO5A 1FP5A 1NFDF 2HJLB 4WEMB 4NBYB 2G5BB 3MV7D 2WIIA 3ABZA 5HPOA 2Z31C 5JQHC 1EEZA 1S7UA 5D2LA 3S5LG 3VFSA 7CGTA 3BUYB 1VFMA 4U1MA 1LO3H 1N6QH 5JHLH 4PRPA 2VNCA 5B4MD 3SCMB 4KWUA 3QUMH 3VJ6A 1ES0B 3VFVB 5FK9A 3I3EA 1MHHA 2J88L 5E8NA 1BQHB 3HS0A 1JZ3A 2QADD 4H0HB 5GGRB 4KRLB 3RL1A 5JORA 4GRWF 5DR5L 4J3TA 4XPGH 3DXAD 1XCTA 1A47A 1S7VA 3PP3K 4ONHB 4J8RA 7FABL 3I6LE 4KTDL 3BVNA 3H9SD 3RPIA 5HYQB 1BJ1H 4BQ9A 1PKOA 2EKSA 3G6AB 4H25A 5A2KH 4Q9RL 4YFDB 3PL6D 2OJEA 1SY6A 3QH3A 1RURL 4RDQG 1T1WA 5C0CB 1S9KC 3GKWL 4FZEH 3SDDA 1J1OL 4P2OD 3QIWB 4XBGA 3X11B 2BVEA 4OZIF 1CLZH 4E41A 4M1DH 5EA0L 4JN2A 5C09B 5T1LB 4CDGC 4HT1H 3KJ6L 5E8EA 1A9EA 2AJ3A 2KH2B 2Y5TA 5GRWA 5HHNA 1DFBH 1ZHLA 1PAMA 4XP5L 4PJCA 5HYJD 4OZFB 4PGEB 3S4SB 3AS1A 4WUKL 3CK0L 4F57L 4B5EA 1INEH 1F6AA 2VZOA 2WBJC 4YHKH 4JJ5B 4U1GC 3R0NA 4KU1A 3TWCL 2AEWA 2PO6A 3TEUA 5BW7C 3LKOB 1EAPB 5L88L 4RMRA 5CGMA 3L3DB 4LLUB 3RWFB 4MQXD 4UILL 5L6YL 5DSCA 3U1SL 1DL7L 4BUHA 5TPWL 3ALWA 5BJTA 5IB4A 1FVEB 4ZFFA 5MEPB 5KSAC 3TVMD 2YD4A 2YD8A 2PN5A 4TUKL 2A6KA 1I7TA 1D3CA 1U92A 5FV2A 1WAAA 4S1RL 5H94A 4XVJL 3SPVB 2J3SA 3QFDB 2NTFA 2X7LB 5T3ZD 4O51B 2QQNH 1JMXA 1NDMB 3E3QC 5F7EH 1WLHA 5KSBA 1OAKL 3FO2A 4EBQL 5LKNA 4YHYB 5JOFA 1VEMA 3RY5A 5LGKA 1M71A 4TVPL 5CBAB 5JNYB 3LN5A 2ICCA 3B2UD 2AQ3A 4XNXH 3D1MC 1MY7A 3CFDB 4POYA 2YXFA 4R2GB 3U0PA 3BIKB 3NCCB 3KYNA 5B3JF 2IAMA 5K9QG 3BZEB 5MERA 4JPWL 4LPXA 1YYLH 1I75A 2JELL 4XCFH 3TT1L 3GSUB 1YEIL 1MQ8A 4HD9A 4TUOB 2XTJE 4UQ2B 4XWGH 4LCCA 1D5BA 4PS4L 3GIVA 2YEZA 1CICD 1BAFH 1G1CA 1HCVA 1IC7H 5KJRL 4HMDA 4JAMA 2OZ4L 3SN6N 5GJSH 4XRCA 1I9RL 2VXTH 3P0VL 4RGNB 4FN0A 3IF1B 3TBWB 5H35B 2XWBB 1HSAA 2OI9B 4NQDD 5DQ9B 5EZJB 3LZFL 5FOBA 3JTSA 4U1SA 5C2BH 5D1ZC 2H6PB 4Q6IC 3EYVB 4FFYL 3B9KB 4LVHC 5JA9A 2X44D 4TTGA 3HC0A 4UMGA 5GGUB 4MAYD 3KPOA 1GGUA 1TVBA 2I9LA 15C8L 3FMGL 4H20L 1Z9MA 1YEHL 3BKCL 3UTZA 3H9SE 5IEHA 4UT9L 1YEJL 3RL2A 1EIBA 1TZHB 2HJFA 4CKVX 1I1AD 1T89A 1CXEA 2PKDA 2LAGB 1EUTA 5E95B 4OLEA 2PTTB 1FZJB 3GBML 4UQ3A 1QBLL 4MCYA 1R0AH 1W72A 3E2HB 1IAIM 1RHHA 3FT2A 5EOQH 4AYFA 4G7YH 2QV2A 5I30L 1I9IL 3FHQA 4KJWD 4MA7L 4LCIL 5EO1B 5F1KC 4DFIA 1SMAA 3GSXA 3PQYB 5I73C 4TSAH 4D9LH 5GGQL 3HNVH 1G0XA 2FX7H 5E9DE 1ZT1A 2P8LA 2VZUA 1GOFA 1V3JA 2DD8L 4EEEA 3O2DA 5IQ7L 4LBEB 3U4BL 2J4WL 3TNNA 2J8OA 2GSIA 5GGTA 1XR9B 4JG1L 3QP3A 1N5YH 1SBSH 4KROB 3NZ8A 5LCVH 3FO9A 2E8YA 3I9GH 2ARJQ 4PLJC 2HT4D 1PYWB 1U8HA 2HA1A 3QXVA 3IFNH 1KIQB 4DN3L 3WUWA 3BZ4B 5I8OL 3QDAA 3P73B 3U0WH 4L8CB 4LSVH 3GRWA 4LAQL 3ROOB 1AXSA 3MNVB 5IFHL 3OKEA 1ZHBA 2IPKB 2C4FU 4O2CA 5HY9B 4XNZB 4ZO7A 2ICWA 1NGYB 1OOAA 2NX5A 4NBZB 5GRZA 3CUPA 2OTUB 4OZ4A 5GRVL 3IDIA 3ZL4H 3VXQA 3CLEH 3WV0A 4N5ED 5T3ZE 2BY3A 3GNML 1XIWA 3RPKA 1JZ8A 1RUQH 5J6HA 5C0GB 1E4WL 5JLZB 3LKQA 4HXBL 5DUML 2J8UF 4AQ1B 1J5OH 3MCG1 3R0MA 1TJHH 4PB0H 4XCCH 3PGDA 4KAQL 4AM0A 1FFNB 1KJMB 3HB3D 4QNPF 3O6MH 1WT5A 1YECH 3KJ4B 3GDBA 4LL9A 1EJ6A 4DKFH 2VQTA 2PW2B 1WFTA 2FJGA 5L2JB 1K4CB 2NY3C 4XPHL 4ZTPH 2V2XB 4ZUVB 2JCCE 3CSYA 5HVFB 3AROA 3QWOB 1GOGA 4NQDE 1DQLL 4NT6A 4KY1H 1EBPA 1DDHA 5E9DA 5D9SA 4CVXA 1S7XB 1MEXH 3GJFA 4CRPA 1Z5LB 5DD0H 1XF3A 1ZVHA 4YHZH 4CU7A 4JO2L 2CR3A 4QRSB 3ARGB 1CK0H 3K8MA 4XX1G 2APTA 5I1KH 1LO2H 4DUVA 1TJIL 3SGDI 3T4YA 2RR3A 4UTAL 3MRKB 1ZA3B 3U7AA 3MJ9L 2DQEH 3D0VB 5I1CL 1FPTL 3KPRD 3QUXD 5EOTA 4PRHD 5F9OH 3U79A 4QRPB 2VLKD 3P11H 3MBXL 1KJ2A 3KHOA 4U6VL 1CWVA 1JNNL 3X13B 1S9XB 5KANI 1WEJH 4K3DL 3IB4A 1XCQB 2B5IC 4XMPL 2ZUXA 2UWEB 1FORL 2IBZY 3KS0H 2EIBA 1WZ1H 1RZGA 4HKXA 4OCRH 3HZMB 5F89A 4ZUWB 1N7ML 4I5BB 3L6FB 4GFTB 1HH6B 2F8OA 4KKBC 2I9TA 2B39A 2X42A 4J12A 1IAOA 4TSBH 4OCLC 4JM2A 4OJFH 2RCSH 1CR9H 4ZUUA 1Q9WB 4MMZC 5CMAA 5AAMA 3WKMH 3ZT7A 3OZ9L 4OGZA 1PLGH 3I6KA 4LVNB 5GGSA 4NNXA 3SKUD 5I19H 4S1SL 2DM4A 3LQAH 1P84K 2JTDA 4LIQH 3CMOH 4W81A 4H0GA 3I75B 3D18B 2QSCH 5DHVA 3ZTJG 2Q86A 3LRHA 5FF6A 3DVFA 4MLSA 1QACA 3F7YA 2FL5A 1OM3H 4C58B 4EDWH 1T03H 2XQBL 4HJJH 4WFFD 2VR4A 2EH7H 4XNYL 4E9LA 3CVHH 3RTQA 4HHAB 5IMMB 1QVOB 1JYXA 4WO4A 3VI4F 2XACC 5DURB 2JCCA 5J3HD 3T09A 1I85A 1LEIB 1A7OH 2MKWA 4G43A 4WWKD 4XAWH 1I1FB 3WD5L 5K33A 1SQ2N 1DQJA 4NCC1 4X5XB 5TF0A 3LQZA 2X4SA 4U7KA 3BO8B 2GSGA 3C60D 1K4DA 1BEYL 5IHZB 4HS6B 3UJIL 1KIRB 1VFAB 2IQ9H 5ID1B 3NA4A 3UP1A 4CNIA 3D85B 4PY8I 1AY1L 2BSED 2VDPH 5LG1A 3TO4D 2XWJA 3VFUB 3B8SA 4FQXD 5I16A 3VW3H 5D7JA 2ATKB 1OSPL 4WGWB 4M5YL 4UT7L 5D1XD 1FRGL 3CFBA 4ODHL 3WNMA 3MRMB 3HG1A 3KYMA 1ADQL 4HUMB 4Y0GA 2A6DA 3LAFA 4OGXL 3V5KA 2A9NL 3V0VA 4G42B 4MJIB 4X83A 5DJZB 4HG4K 2ADGA 3RNKB 4F7EB 3FB5B 4U31A 4G6JH 2VDOH 1SY6H 1KFAL 4PJDF 5MP6H 1HHKB 2FZ3A 3UPRB 3SO3C 4JR9L 1CF8L 4NQED 5AD0A 4IRJB 5CEZH 3JVGC 3AREB 4XXCC 1Y6MR 3HMXL 5GRUH 5BVJA 5DTFA 1A4JA 5JXED 4YHIA 2A77L 3MNZA 4K9EH 4ELME 4JFQB 1MCFA 4X6CF 3SBWA 4HH9B 5T1MB 3BWAA 4D0CA 1M7DA 3WFHA 2IH1A 1JUFA 2GY5A 3O3AA 1I4FA 5FGRA 5T33H 4OF8A 4HKBB 2BRRL 4KGJA 3GJEB 5B38G 3H0TB 3IFLH 5I1LB 4XC1H 3KPRE 1GGCL 3C5ZD 3DGGA 5T5FL 1HHGA 5C0BA 5JW4M 2D7OA 3ZE1E 3AGVA 1X4ZA 4XGZB 4DKAA 1YMME 3UTTA 4K2UH 5CLTA 3TYGH 3VFMB 1I8LA 3BH9A 2XQYG 4X6EA 2B0SH 4KK9C 3P4OA 1R5WB 5LGHH 5C0EA 3T65B 2JIXB 4XHQA 1AC6A 2IMNA 1M1SA 3FOLB 4HLJA 3TA3B 4CADA 3J8F7 2PXYA 1OWRM 3PWJB 1D9KD 3MLUL 5GIRA 2LABA 4EN3B 1JNLH 4OF7A 3RU8L 4JZNA 5HD8D 3QDJD 2EDKA 4UBDD 1A1MB 1URLA 3A6OA 3DROA 2QQKL 1Q94A 3SEPA 2E6PA 2NCMA 3ZYOA 4LCYB 4XX1E 3RVTC 4IBLT 1NGZB 4GG6E 4LHUB 2EEAA 5CZVL 4YHML 1FH5H 5JHDB 3TN0B 3QXAA 1CFSB 3TC9A 1DZBA 2DN7A 4X4ME 4RRPA 3VXTA 1IT9H 1C5BL 3GMPA 3M17B 4DQOL 3AMLA 1J9CT 4M7KL 4Y89A 2DQUL 4WFFE 1YPZF 3WJLA 2P7TB 1UM4L 1N2RB 5E6ZA 4KRNA 2DLFL 4PJFB 5GJTL 3SKOB 1A6UH 2X4NB 4MZ2A 2YPLB 1P4IL 3KPSB 5FM5M 1AO7A 1T0PB 2AGJL 2GUOB 4JFZL 3RJDA 4WV1A 5EBMB 3KLHC 3X12A 4LLWA 4TVPE 2X4OB 4OQTL 1B0RB 3MGOB 4WU5A 3S88L 2F5BH 3GHEL 5FYKU 3QPQD 4JM4L 1NMCC 4YXLL 1JPSL 3A67L 4GAJL 4JQXA 4Y19A 1NCAH 3TGXA 1NDGB 2OP4H 5EU6A 5KVDH 2Q76A 4KRPD 4FP8H 5GSRB 3OL2A 1RMFL 2Z31A 3LY6A 3IJYB 4XI5D 2G2RA 4L5FL 5DEFA 1JF5A 4Y16D 1ZSDA 4QLRA 2DTMH 2XZCH 3D3VD 4C4KO 2EDQA 3QUMB 4UDTA 1C8PA 1TPXB 4IOSD 3QUXA 1KF9B 4NN5C 1N64L 2FATH 4ZTOH 3KXFB 1YN7A 1YMMA 2DLIA 1TZIB 1WZKA 3IKCB 1KIPA 2H8PB 4XMLH 3W11D 1X6LA 5DJ6A 4I18B 1D5IH 3I50L 3BZDA 1J10A 1P9MC 4WCYL 1IQWH 4I0PC 4X99B 5CJ5A 3OXRB 5EU3B 5IROA 4N0RA 1W72H 3RA7L 1EHXA 3BHBB 1X5XA 2DLEA 3WDIA 3MBED 3GB7B 3ECBA 5ERWB 4WEBL 5GS0D 3P0YL 2A74B 4WIQA 4FNLH 5FGSA 3GHBL 1FAIH 3VXMA 5A2IH 1WTGT 1G9MC 4F7TA 1MFDL 4ODTL 1Q0XH 1GGYA 2DBJA 1PX3A 4A6YL 1RUAH 4GG6A 2BVTA 2BNUA 3M1BB 5ISZD 3R1GL 5J1SC 1NH6A 2CUMA 4YDIH 5IBLD 5GGTH 4HWEH 4P48A 3VFGH 4NN7C 3NIGF 2Y7QB 5DEGA 1FGNH 3MV9B 3L95A 1C7SA 4X4MA 5T5NG 2YD6A 4LKCB 4YR6A 3IJSA 3T0EC 2W0PA 2IGFH 2WBJA 3QUKB 4UUJB 5EZOH 3SJVD 4ENED 1INDL 1UJ3C 3DX8A 4Q2ZB 4XPTH 2BJML 5IB5B 4QRRA 2X5PA 3U36A 1R5VB 5BRZB 5BW7A 5EIIB 3L3JB 1G9ML 4YUEH 2H26A 2UWEF 5MI0B 3GRWH 3TCLB 4LSUL 4WFGE 2ZUYA 3TYFA 4K7PL 4MDIB 4AH2B 1ND0B 2EDRA 3SDAD 5F3HB 2C3GA 4P5TD 1NKRA 3VXNB 3T0VA 3P4LA 3VXRA 5KSAA 5EOCJ 1WCQA 4XP4H 1MCSA 5J6GB 2AV1A 2B2XH 1ONQA 4O9HL 4RCAA 5IB2B 4W68A 5DD1L 4L4TD 3IDGB 5DMGC 1A3RH 3HZKB 1MJUH 2I24N 3S7GA 1FNEB 5KAQF 5ACMA 1IQDA 3GKZA 1VGEL 2OZ4A 3K2UL 4L1DA 4AK1A 2LE9A 2YN5A 2H9GB 2C1OA 5H37G 3X3FH 5JW5B 1IGYA 1FYHB 1XGUB 2VZ1A 5DK0B 5D96C 1RZFH 1H8OA 4XNUL 3V6FA 1R3KA 5FFLA 3IVKA 2ICEA 4QOKD 1F45A 5ILTL 2W38A 4UIKL 1EFXD 1MCDA 1L9MA 4LPVA 1KEML 3QUZC 3O41B 4MXVE 1B4JL 5JXEA 1O7SA 5JIKA 3PWUB 5DRNA 4ZXBB 4KZEH 3UPCA 2G75A 3QZWG 2CDGA 4RZCB 5FDYA 3CCHB 4C59B 4GS7B 1QFOA 3MO1B 2NY1C 4PJ7B 3D3VE 3GJFH 3L3GB 4HFUH 5E2TL 2J1KA 3SDXE 2X89D 1BFOA 1QBMH 1XZ0A 5D1ZA 5FM5O 4Q6IA 3DVNB 4PGBB 1MFBL 1PGRB 4NBXB 1F00I 1YEDA 4UT6L 4Q0XL 2VABB 4R90H 1PZ5A 4OFDA 3PWPD 4IRSB 1H0DA 1ZHKA 2HFEA 5D6CB 1HKLL 4DK3A 2IFFL 4PJIF 1DSFH 3OKMB 2UUDK 4OD2B 2WWKO 1KJ2H 3M45A 5LQBL 4WNQA 5K59E 4GRLB 2ENSA 4QF1B 4Y2DC 3OAYH 2VZTA 3DVGA 5J8OA 3EO9H 1N4XH 1PFCA 2JJSC 3QCTL 2IBZX 4YE4L 1GVIA 1F3RB 4XTRD 1JL8A 5HHPA 3MRNA 5ISZE 4QY8A 4JFDD 5C0AB 4LSDA 3VDBA 4DN4L 2F74A 3QEGH 5T3ZH 3C8KB 4HIIA 3IXTA 5CWSA 5KZCB 1JNJA 3G6JB 2FDBP 5GZND 3R4DA 4Z7UF 5ITBH 3IU3B 3CFEA 5GHWH 1C16A 1ZWIB 3MNWA 4OCMC 1LILA 3RUGA 2VITA 5JQ6H 3VU2A 3LIZH 4U7SA 4HJGB 3CC5A 4LCUB 4KPHL 5DHVH 1G7QB 3BH8B 4XP1L 3IETB 1OTSC 2GEEA 1J1PH 2WUBH 1UKQA 3BEVB 5HI5D 5LWYH 4YH6A 5HVHB 5HGBB 4U0RC 2J7LA 3ISWA 3V7MA 1JWUB 2EECA 2O5XH 2X1OA 3V0WL 2LU4A 1EVTC 4Z7OE 2CLZB 2F58H 4IOFC 5D7SH 1V7NL 1F8TL 1JHLH 35C8L 3AAZB 4XMKH 5EC1B 1N6VA 4Y4FB 2BFVH 5MEQA 3QSKB 2VZ3A 3SDXA 4POZC 4LLQB 4WHDA 5JW4R 5AWNH 3F5WA 2DMCA 3WIHH 1FL3B 1F6LL 3AVEA 2CUIA 5D8JH 3FRUB 5C70A 2QQLH 3N06B 4R0LC 1CDUA 4OGAC 2IF7A 5JZ7D 3OKOA 1IFHL 3PABA 4ZAKC 1KPUA 5C8JA 4LP4A 3V52L 3Q1SL 4QXWA 1H5BB 2VN4A 3WKNA 1JK8B 2CLVB 2ATPA 1FJ1A 3X3GH 2I26N 5EOCL 2H45A 3BAEL 5CEXB 4JO4H 1JI1A 4YPGA 5TH2B 1UM5L 3WE6B 5I6XB 5B8CB 3MJ9A 5EDXA 4YDKH 1Q72H 4Z7QE 1LK3H 1VFOA 3TZVD 3BD4A 3W9EA 2J2ZA 2VWEC 1N59B 4HW6A 5IJKC 4JO1H 4NPYB 3RGVB 1I1YA 5EZLB 43C9A 1FG2B 2FX8L 5I8KL 2R8SL 4OUUB 4F2MB 1CFNB 2P8PB 3HAEB 3KDMA 3SKJH 3WNOA 4UIMA 2R23B 3PWPE 2ED9A 2BDNL 1QFUL 4OFIA 5DO2C 3MOBL 1EEYB 3JV6A 3UZQA 5SX5K 1KN4L 1KPVB 1HI6A 4YDVB 3BPCA 4LKXB 3VCLB 2IQAB 3EW3B 2J5LB 2Q1EA 5F1IB 4PGDA 3MUGB 4ODSL 5FO8A 3HI5H 2PCPB 3NH7H 4X6BB 3ULVD 4NO0A 1SHMA 1A6AA 1KUMA 3MR9A 4RMVA 1BVLA 5F70A 1HINH 2BZDA 4HAFA 3W0WB 4JKKA 5EFIB 4MB5A 2AKRB 3CFCH 4ISVB 3ARUA 4N1EA 5FYKD 2W0LA 3KPLA 1MPAL 4YX2H 1BVKB 3G04B 4OLWL 1F4XH 2Z8RA 2EDYA 3L3IB 1FNGA 2YMXH 4D3CL 1EAJA 1RK0B 3UAJD 3CDGA 3OKDA 4FG6D 4NIKB 3CZFB 5K9OA 1NCCL 1OF2B 5D2NE 4GSDL 4MNGB 1HE7A 4X8XA 5ENWB 2F5AL 4TN9A 1IGTA 4GKSA 5DUPL 4LPYA 4JFEA 4JREB 3VRJB 2F54B 4APQB 1L7IL 3OB0K 4ERSH 3B5TA 3NFPA 3MLWL 1UA6L 3EYFA 2OQJA 2UYLB 4QHMA 5KVGH 3E6HA 4Y88A 5DR5H 3O4LB 1A02N 4JJHA 3CDYA 1LHZA 3RZWA 7FABH 3SCMC 3DMMD 1Z6JT 1S7UB 5D2LB 5ANMA 1WBXA 1UGNA 4OIAA 4U1MB 1RJZB 5HTSA 1RURH 1NMAL 4AG4L 2VC2H 3IRZA 4JY6A 5JOPE 3GKWH 4CU6A 1J1OH 1WC7A 5IEKA 4NC2B 1TQCB 5TDOB 3LEVL 2OXGA 5EA0H 3HMXA 1XGRB 3MV8D 3U4EB 3HS0B 5E2VL 3KJ6H 1G6RB 1ZT4A 2NY6B 4NZRH 3L7FA 2VH5L 4NN6B 4P3CL 3RL1B 3OPZH 5D7IF 3ZTNL 1ORSA 2R2EB 5GGRY 1AGBA 1S7VB 4B53A 2HMIC 3LH2L 5K9KA 4WUUD 3BVNB 3QZWA 3RPIB 1YN6B 4WUKH 1CFQA 3CK0H 2HTLC 4M6ML 4F57H 5ADOL 2EKSB 1I3RA 1RIHL 1XF4A 3QIWC 3ULSA 2QLVB 3QH3B 3ARBD 1T1WB 5E5UB 2FSEA 3SDDB 5JO5A 3O11A 2PF6A 1JV5A 3QDGA 3JVGA 5L88H 4XXCA 4PJGF 1JZ2A 2BSRA 3RY6C 3FT4B 2AJYL 3MLXL 5E8EB 1PKQA 4K55A 2BRQA 1A9EB 1IC5L 5HHNB 1FVDA 5TPWH 1EERB 4P46D 2W59A 3AC0A 1T1YA 1X5ZA 4PJCB 4TRPL 5DD6A 1JGVL 3EHBC 4L8BA 1LE9B 2JB6A 4K7PX 4TUKH 4MS8D 4Z5RA 4LLYA 3DTXA 3FQWA 2BNRB 5IOPA 2B1HL 1PBYA 2X10A 4S1RH 8FABA 4XVJH 1EMTH 2AJZB 1DUZA 5CILH 1FCGA 4XCEB 1H3PL 1SJVA 1YY8B 3UMTA 1NC4D 4LOUC 1RQ5A 1X4XA 1NCWL 1NAML 3ULVE 2Y72A 3AMKA 3WMSA 1PJ9A 3RWHB 1B0GA 3QG6B 1NLDL 3F12B 5D1QB 4TVPH 2GCYA 4PIRF 4QTHA 3IAPA 1LDPH 1W8OA 1W2KT 1TVHA 5IB4B 2ITCA 3QT2A 4X8JA 2QR0A 5HDBF 3B6SA 5DC4B 1PDKA 3DUSB 3LCYA 4U1JA 1INQA 4NO3A 1DVFB 3G6JF 2A6KB 5C08B 2YPKA 4OCWL 2RAMA 1L7TL 1B2WH 3NFNA 3MRHA 1HNGA 1YNTB 5H94B 2OYPA 1WZMA 5D71L 2FEEL 4YHYC 1A7RH 4JDVB 4OQTA 3EOTL 1NC2A 4H88H 5KJRH 2OZ4H 4HBQA 2D2OA 4OM1H 2GFBB 3ZTJH 3C9NA 1I9RH 5E08L 1WWCA 2FD6L 4MZ3A 1M71B 4L1HA 4BUGA 4R2GC 5DFVD 3RX8A 2B1AL 5A1AA 3LZFH 2FGWH 4LMQE 4FFYH 3NIDF 3KYNB 2O61A 3P77A 5KVFL 1A7QL 4AIXA 4CUCA 1B6UA 3RX5A 3OF6A 5EIQA 4U1IA 4LCCB 4OV6F 1D5BB 4RQQB 4GAYA 3MGTB 1D5MA 1WISA 3H9HA 1NANI 3FMGH 5A2FA 3B83A 3GIVB 3VD9A 4PJEA 1YEHH 3BKCH 5AZEL 2E3VA 1I3VA 1T1XA 5HGGS 4UT9H 3VXPB 1YEJH 5I1GL 4UI2A 1VEOA 4M7JL 4XCYA 5E2WH 4NZDA 1EBAA 2OI9C 4XRCB 3RWIB 2PYEA 1V7ML 1VFUA 3L5IA 3R8BB 1JFQH 4JGMA 1WIUA 1QBLH 4K8RC 1ODAA 5ESVB 3O81A 3BGMB 5FDWB 2BCKB 3JTSB 4U1SB 5I30H 1I9IH 2K3TA 4ELKA 4MA7H 4LCIH 1D5ZB 2EXWD 4JRXD 3HC0B 5GGQH 4ZOAA 4QXTA 3Q6FB 2EIZB 3KPOB 3HTLX 1T0NB 1TVBB 2L0DA 2I9LB 1BECA 4A6YA 3KYOB 4PV9B 1HHIA 1CD0A 4WUUE 5IEHB 4AMKL 3RL2B 4QHUB 2J4WH 5KSVA 1QRNB 3AB0B 3E2HC 1P9MA 3GJFK 1AR1D 1YYML 4G7VL 4I0PA 1MCOH 4BSWA 3EOBA 4PFEA 1A7PL 3I2CL 4MCYB 4K8RL 4LU5H 5IVZB 1RHHB 3IGAA 5DRWB 4DAGL 1FYTD 2FBOJ 4FFWC 4C57C 1VKXB 1YDPA 1V3MA 2E9WA 4GKOA 3D39E 1MQKL 2LU3A 3QIBD 5DHXB 3GSXB 1CGWA 4DN3H 5I8OH 4QEGA 3U4AA 1ZT1B 3PGCA 4LAQH 2IANE 3J7HA 4CAGA 4M4RA 4HJ0D 3MRRA 4G6KH 4PR5A 1SEQL 4MCZA 4N9GB 2X4QA 4JKMA 2NZ9D 4D9RD 4K3EL 4M1GL 1FL5B 1EV2E 4P23D 1IAKA 3OAYK 2UY7A 4ETYA 1AXIB 4NQCA 5DVOA 1YJDH 3E8UH 5AYUL 4LFHG 3NZ8B 1CGXA 3RDTB 2XN9B 3CVIL 1CG9A 1P4BL 1KYOK 3T0EA 4PJAF 1P2CA 4CJ1A 1FN4A 2D7TH 2X4UB 1UJ3A 1MHPL 5DJXB 3WUWB 2XXCB 1DN0A 2MOVA 1UB5A 2BSTA 2HFGL 2XTJB 1AXSB 1WV7T 5DUMH 4EZMA 2IC2A 1ZHBB 3GK8L 3OAZH 5KSUA 5T3XD 1KB9J 4MNHA 2R1WA 5SWQA 4KAQH 3DMMA 3A0OA 1FHGA 4LDLB 5K9QI 1OB1B 3CUPB 3RWDB 4MJ5A 5FO9A 5DZLA 4KMQA 3VXQB 5HYFA 1BBJA 4RFEA 1U8LA 5E70A 3W9DB 1H3UA 3D9AL 4XPHH 3GM8A 2Y9RT 3KYAA 4NGHL 3U9PH 5FXCH 3QI9D 5FIEA 4CVWA 4LASL 1WITA 3UBXI 4ZFOB 2GHWB 2R4SL 4Q9QH 3U83A 3LKNB 1DQLH 3EZJB 3LKQB 4LFHD 4OT1H 3DXAB 4KC3B 1GIGL 2IEPA 2DQFA 4QHNB 3HE6D 3HZYA 3RP1A 3FL7A 3H9SB 3KJ4C 2VZVA 5TQ2L 1QEWA 3PL6B 1U6AL 2VE6B 5I18L 5ESQA 5GS0H 5HI4C 3OJVC 1TJIH 4DUXA 1OTUD 3KNBA 4PJXE 1CCZA 4P2OB 2FJGB 4UTAH 2XKUA 2VLRE 1KLFA 1YEFL 5E2JA 5D2LF 3QUZA 5I1CH 3G5ZB 1FPTH 3S5LB 3PWVB 5TFSL 5TF1L 2FYYB 3D39A 3OXSA 3CSYB 3VA2C 1U3ZA 2Y5EA 3ZDXF 2EC8A 4HZLB 3C6SB 5IW1A 1PSKL 3T0XA 1DDHB 1MUJA 1WTLA 3ARGC 3MBXH 2IANA 4U1HA 1FFQA 3GJFB 2X4TA 2O5YL 4U6VH 1JNNH 5HYJB 4JRXE 2HAZA 4M1CC 3NPSC 5L0QC 5F1OB 2DRUA 1FORH 43CAA 3FQUA 1E4KC 4KI1A 5SWZD 4UNVA 1N7MH 4NOBA 4PV8A 1IAIH 1KG0A 4ZOEA 3AS2A 3QPXL 5CBEA 5J1AB 1F13A 3WUZA 2VO5A 1IE5A 4D8PA 4L9DA 3U7YL 1VERA 1WWBX 4IM8A 5BXFB 2R69L 4JVWA 3VGEA 2ZUWA 3OZ9H 3RJQB 1FYTE 1ZANL 1K8IA 1UQSA 1DBBH 4MWFA 4PLKC 1D6EB 3RI5F 3TBSA 3TVMB 4S1SH 3REWA 4Y2DA 3H9YA 1JPTL 4MJ2A 4U33A 2NY4D 4ZS7H 4JQIH 4C56A 1KCVL 3K8KA 2JJSA 3B3IB 3KPPB 2HTLD 3F7RA 3MX0A 5E6ID 1HOCA 1RZGB 5EG6C 1HCFX 2W0FB 4AZ8A 4WI6A 4PJCF 5TE7L 4N0CD 5AUMB 2EE3A 4D9RE 3L7EA 4XNYH 1K8DA 5CGTA 1VCAA 4H8WC 4UDUA 3VE0B 1OGTA 4PUBL 4LVNC 2CRZA 2NYYC 4JVUA 3EO1B 3I6KB 3WYRA 2NNAB 4F7PA 3V6OC 2PR4H 3WD5H 2C1PB 4FQHB 5GGSB 4NNXB 2FH8A 2DBLH 5CIPH 4DCQB 5GPRA 1LD9B 5DJDB 4BFGA 1BEYH 2YUWA 3UJIH 5EO0A 2DJUA 3FFDA 5DHVB 5FF6B 2FL5B 4M61B 2YSSA 1CICB 1CTNA 2C3VA 5TQ0L 1MVUB 3HLAB 3L5WA 2DJ4A 2VLRA 3NZHH 4H8WL 1OSPH 4QO1A 3LHPL 3TIEB 4UT7H 4XPAL 5T1KD 3FAXA 1RUPL 4YGVB 1WAAF 4ODHH 1OLZA 1QSFA 4G6ML 4NQDB 1DQJB 3Q3GA 1D6VL 2X4SB 4G8GE 1ZEAL 5KSBF 3RY4A 4H5SA 1UEMA 1K4DB 3DSFL 5H37H 3O3E