4L4PA

The mutant(e139a) structure in complex with xylotriose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with xylotriose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4l4pA00
4UR9A 2Z1SA 3T2QA 3ALGA 4HA3A 4PCSA 3W53A 1W9DM 2FH8A 1PEZA 5CPSA 3AI0A 2CBUA 2YDSA 1V6XA 1J0YA 3MMUA 1XYZA 5ABGA 4W8LA 1HKMA 1FH7A 1H1NA 2ZWYA 3NCOA 4LXFA 3VIOA 4GKLA 1XV8A 2WANA 4OUEA 2YL5A 2AAAA 3AMGA 4BZYA 3AMCA 1TA3A 4HOZA 4KH2A 2WMKA 2YL9A 1OINA 1H3GA 1DTUA 3L4WA 1I1WA 2BHZA 4JZ5A 3NIYA 3ZIZA 4BQ3A 5A69A 4MDOA 2BY2A 4J28A 4U3CA 1NOFA 3VD4A 3KZSA 3ARZA 3U5YA 1WZMA 3SCUA 1JDAA 1V3HA 2ZXBA 2J25A 1EOKA 2QLYA 3WUBA 2V5DA 3WEMA 4UFKA 3DC0A 4URIA 2BXYA 3AYSA 3ARPA 1KR1A 4JHOA 1Q6GA 1B1YA 1Y7VA 4RE2A 2PF0A 4M80A 1NWTA 1G0CA 1HJVA 2J62A 4DM2A 5BXPA 1E4LA 4PMDA 3OG2A 4A3YA 3WDJA 1OCQA 1E5NA 4C7GA 2FH6A 2E8YA 3PZQA 1IZJA 3TP4A 3AYRA 4FF5A 2J7FA 5I79A 2DQXA 2FGLA 3POCA 4UQ9A 4L4OA 1V02E 3SCSA 3WQVA 1J0ZA 1H0GA 4CU7A 3OIHA 4Z2GA 4UOJA 3BAXA 3M6DA 2PWHA 3GM8A 1WO2A 2WMJA 1EXPA 1QHOA 2GK1B 4P7NA 4FLOA 1E40A 3ZT6A 2OSXA 1BQCA 4ATWA 4XZWA 2DH3A 4TOQA 1E6QM 2ZE0A 1CWYA 1M03A 1E1FA 2DSVA 2ZX6A 2WMIB 3VO0A 1NOWA 3AHVA 3HMCA 3VGGA 1UZ1A 3AMLA 8CGTA 3FAWA 1K6AA 1SFSA 3WDHA 1KCKA 2DSKA 3GNRA 2NT1A 5JIPA 1KXHA 2YJQA 3MV01 1JGIA 2VUYA 1EDTA 4AZ7A 2WMFA 1CXFA 1AQMA 2CXGA 3M46A 2V3DA 2XIBA 5GQBA 3WIJA 4P7RA 1J0JA 4UQDA 5GPRA 3TTSA 3RCNA 3GH7A 2J7HA 1IT0A 4HMCA 3DYMA 4GQQA 5IFTA 4Z2JA 1EQCA 2ZIDA 3WUEA 4JL1A 1R86A 2VR4A 1WZKA 3N13A 2ZUMA 3VKKA 5C70A 1B30A 1X1NA 2VCCA 4U2YA 4AD5A 3PZGA 4NZCA 4WKHA 2JIEA 4WK9A 3EYPA 1XCXA 1MW0A 1OM0A 3RM8A 1CZ1A 2XM2A 2XVGA 5CPQA 2G4FA 1E6SM 1B2YA 3BMVA 3ZJ7A 1DWAM 1UKTA 3WD1A 3OLIA 1V08A 3NUKA 1NQ6A 1G1YA 1KB3A 4L4PA 3UERA 4P7LA 3VU2A 1V0LA 1KXQA 4GIAA 1ZBKA 4U2ZA 1UD3A 1UQYA 5FCZA 5IHRA 3THDA 4WF7A 1W1VA 3VILA 3BCFA 4B15A 4D1JA 1WDSA 1BHGA 3DYOA 1VFFA 3WBEA 3UG4A 2D2OA 2QMJA 4IPNB 3WMSA 3FNDA 1V0MA 4M24A 4J3WA 1AVAA 5A6JA 2WVUA 4ATLA 4XV0A 3BH4A 1E0XA 1B3WA 4QAWA 2E8ZA 3N12A 2DH2A 1TG7A 3WF2A 5EFFA 1IZKA 1QNPA 3PZMA 5BRPA 1ISZA 1OD8A 2J7BA 1E6NA 1CPUA 3CZLA 2VZSA 2W66A 3WNKA 1DP0A 1HKIA 1Q4NX 1WDQA 1MYRA 2J4GA 2DT3A 2GVYA 1HX0A 2W67A 3PHAA 3GBDA 2VZTA 3CMJA 4D6HA 5BRQA 5HXMA 1VJSA 2ZX7A 3HU7A 3T08A 1E6ZA 3UG5A 3MV11 4AD1A 5JBFA 5KEZA 1LF1A 1C8YA 2FHFA 3VMOA 3OZOA 1MW2A 2WC4A 2WSKA 1UR8A 4WIWA 5HPOA 3TTOA 5AYBA 1UD6A 1XD0A 3MSGA 2ZXQA 3T0AA 1NARA 4AIOA 1CEOA 1FP8A 4MAZA 1C91A 4WSJA 2BXZA 2BHUA 5E6YA 1VJZA 1HN1A 1SMAA 1U33A 1EDQA 3W37A 3PZOA 1PBGA 1HP5A 4M56A 3KL5A 3CZJA 2BV9A 2VL4A 4JL2A 2WPGA 1FH9A 1L0PA 2WHLA 2QF8A 1V0KA 4AC1X 1XYFA 2CETA 1KGXA 1X6LA 2VR5A 2OYLA 2ZWZA 4W5ZA 2ZX8A 4KWUA 4B9YA 1XCWA 5E70A 4UQEA 4HU0A 3AMKA 3L4TA 1TMQA 1NM9A 3MMDA 1N82A 5EMYA 3W27A 2RGMA 2D3LA 3LMYA 4UFJA 1UR1A 1NH6A 3GNPA 5ABEA 1EH9A 5C8BB 1W3JA 4QLLA 1BAGA 3WUGA 5AY7A 3BAKA 4CUCA 5I0DA 4PTXA 1E71M 1Q6DA 4E2OA 1JYXA 1JYWA 1TR1A 1RP8A 4JIEA 2WMHA 3AZTA 4LYQA 4P8XA 3VGFA 2VZVA 5A6SA 6CGTA 3NYDA 1RP9A 3ZJ6A 3SCRA 4OJYA 2BY0A 2J78A 1E4MM 5D9OA 4EANA 1LWJA 5FL1A 2WM0A 1D3CA 5A3HA 2O9RA 2YDRA 4M82A 1ZB5A 3WH7A 1R8LA 3AHYA 1MXDA 3SCNA 1C3FA 1UYQA 5I2UA 4Z2IA 5JUVA 3PZNA 3PZVA 4H8HA 3TTQA 2Y8KA 3PZUA 4AYSA 5IXEA 4ACZA 1QHZA 2GDUA 2XVNA 1G94A 3EDKA 4CN6A 3N04A 1R7OA 3SUUA 1OGSA 2VURA 2ZUUA 3WNNA 4OOUA 3WENA 3VD9A 1E6RA 1A3HA 1UH4A 2WCGA 2JEPA 4FMVA 1E9LA 2Y24A 4OIFA 2CKSA 3WBAA 5BXRA 4NRSA 3ARVA 3FXYA 3BLKA 1UR0A 1PIFA 3T0BA 1Q6CA 1UQZA 1V6VA 2VVSA 1QI2A 2D0GA 3PN8A 1J12A 1BSIA 5GNYA 2E9MA 1BG9A 1W3KA 1JD9A 3WN6A 4ZE4A 1QOXA 2CESA 3ZT7A 5IDIA 3CZKA 3BSHA 2WBKA 1QHPA 3E1F1 3ZR5A 3MU7A 4OOZA 4AMCA 3OLDA 1OT2A 2WHKA 3CHDA 7A3HA 1UKOA 2XFRA 3L4VA 1F4HA 3L4YA 3MMWA 2CITA 1GVIA 3K8KA 4GZIA 2D24A 3ZSSA 3WH8A 4EE9A 4ACYA 1VB9A 2XJ7A 3K8LA 2XTKA 1CXLA 2ZUWA 3O6AA 2D23A 3MUZ1 3KWXA 3WKZA 3L4XA 4D71A 4Q7NA 3MO4A 1MQQA 3WQ5A 4DWSC 1R87A 4HPGA 1UOKA 2E4TA 3RPMA 1CIUA 1GJUA 1VENA 1DWJM 3VDHA 1HKJA 3FY1A 3WNOA 2J7GA 1HVXA 3VNZA 1K9EA 3ZJ8A 1TVNA 2W5FA 4FLQA 4UFHA 4OZOA 3WSUA 1E3XA 2VZUA 3W4RA 1PX8A 1GOKA 3L4UA 5A6LA 3ARYA 3SCOA 1UKQA 5BWFA 3W81A 4UFMA 5A6AA 2VX4A 3AIVA 1UH3A 3DHUA 1W1PA 2A3BA 4F66A 4B16A 4D72A 5A2BA 5ABFA 3AIWA 3I3DA 4QDMA 3W29A 4W7VA 1E3ZA 4RE4A 1UWRA 1UR2A 3WH6A 1K9TA 2ZXAA 3ALFA 2WAGA 2OSYA 4W86A 1K9FA 2YL8A 1KWGA 1J18A 3FHQA 4LPCA 2DEPA 4GINA 5A6BA 5CJ5A 2JALA 3VIPA 1Q6EA 4BA0A 1UD4A 3GTNA 1W9XA 3MSDA 4V27A 5CLTA 3QR3A 4HTYA 1DEDA 2UY2A 4OKDA 3CO4A 3CPUA 4UCFA 5F7UA 4AD3A 4W93A 4GZJA 1CGVA 3WEZA 2CNCA 3WD2A 4PMNA 3U7VA 3W28A 4NI3A 4XB3A 1OWQA 2EXOA 3RJXA 4MADA 3PBGA 2A3AA 2O92A 3WUFA 2IXVA 1OB0A 1ZBWA 3N17A 2ZUSA 3WL0A 3WQ4A 4MDPA 4QP0A 4AEEA 1HL9A 1UD8A 2CIPA 4D6CA 4QCFA 4KRUA 1V6YA 2WK2A 4GI8A 2V3FA 3VVGA 4JKKA 4CCDA 1JIBA 1ZBVA 1UWTA 4CU8A 1O6IA 3AHZA 4CVWA 3VDBA 1GOMA 1W32A 2D0HA 2VNCA 2WCAA 4F79A 3VNYA 4ATDA 2RGLA 3A3HA 3K4AA 4ZXLA 3ZJKA 3IAPA 4PEEA 1GOOA 4UOQA 1V3LA 3WD0A 5AC4A 4AWEA 1H0IA 2VX6A 1XSJA 2PWFA 3SCTA 1UKSA 2IXUA 3OBAA 1HF6A 2YBUA 2WCSA 1QW8A 3AOFA 1B3VA 4QLKA 4AIEA 2XFFA 4YN5A 4HOXA 1JFXA 2VRKA 4V2XA 4J3UA 1LL7A 3VOCA 1EOMA 3ARXA 3EBVA 5D9MA 3VINA 3S6TA 2NT0A 3RM4A 5DO8A 3AS2A 1C7SA 3GXIA 2ZOXA 2E40A 1LJYA 1EDGA 5M17A 1Q6FA 3ARSA 2GJRA 3BC9A 3TONA 5A6BD 3M07A 4FK9A 3U7BA 2FGZA 3A47A 2D3NA 1BYDA 5DEZA 1JI1A 2WVSA 5FL0A 4TVDA 4J3XA 3UESA 2GSJA 3GZAA 1XH0A 3AROA 4AZBA 2JF7A 2VI0A 1WAWA 4WJXA 1KBBA 2X2YA 5JIWA 4W87A 1H2JA 5I5RA 1MW1A 2YOCA 4N0RA 4M1RA 4IISA 2DDXA 3ZT5A 1UD5A 3W6LA 3OGVA 4ZEPA 2DPEA 3BMWA 1HJXA 2ZX5A 2WKLA 2J77A 3A6OA 4TVCA 4A4AA 4JFVA 5I6SA 4CN1A 1JYNA 1HJUA 1JFHA 4P8UA 1LL6A 1HNYA 2CBIA 1UZ4A 2J7CA 4CVUA 3AIEA 4PN2A 1HJSA 2JE8A 2X0YA 3AQUA 1XH1A 1VRXA 3AISA 3VIGA 3FW6A 1HJQA 2XVPA 1MVYA 1W2PA 1TCMA 2G3IA 2D1ZA 4JCLA 4H8UA 5D8ZA 3TTYA 5EB8A 1MWOA 4E4PA 3RMEA 4W88A 1JDCA 1UH2A 1CXHA 1OSEA 3SUTA 2XWEA 1W9PA 1GCYA 5I3DA 5HPCA 3WD3A 4UQBA 1OT1A 2PWGA 1QVBA 4J7RA 4CD6A 3IANA 3EMCA 4HOWA 4GO9A 4AZIA 2FDMA 2FHBA 5BXTA 3POHA 1WPCA 5CZKA 1Z32X 3G6MA 1ECEA 2PC8A 5TD4A 1CXEA 1CGXA 3AHTA 2A3EA 4JFWA 1US2A 2YLLA 1GHSA 1JDDA 2YKKA 1G5AA 4J3TA 2J75A 2YLAA 1QBAA 1V3KA 1QBBA 3W0KA 2CHOA 3B9DA 3U5UA 5GNXA 4GO8A 2DT2A 5ABHA 1BGAA 2VO5A 4HU8A 1E56A 4D1IA 1P6WA 4BS0A 3UG3A 2G3MA 4EAMA 2ESCA 2WWDA 2E0PA 3UR8A 3RM9A 3W38A 3MANA 3CUIA 1I75A 1E0VA 5I24A 2WZEA 3CLWA 2W92A 1UUQA 1NWUA 3AJ7A 5D9PA 2NW0A 4PMUA 3GH4A 4D6DA 1QI3A 1E73M 1FOBA 2O9TA 3CH9A 4AZGA 5C71A 3PZIA 2VVNA 3TA9A 1UWQA 3T0DA 1MFUA 3WMBA 1W91A 3SEPA 3D5HA 4IM4A 1VAHA 1HXJA 2C7FA 1XHGA 5D9NA 4U5IA 4PMXA 5BROA 1AQHA 1KXVA 5E09A 1KGUA 4P7OA 4AW7A 2VCBA 5CGTA 1M01A 1BG4A 1NWSA 1C90A 2WC7A 2WW5A 4U3AA 1TA3B 4JFSA 3CHEA 2WHJA 1C7TA 4TTGA 1VIWA 1LLOA 2CERA 4W7UA 3T2PA 4B3KA 1AQ0A 3VIIA 3GXFA 1DWHM 2XSAA 4PUDA 1CECA 3AS3A 1NWRA 4TTUA 1HL8A 2Y8VA 1MQRA 3NSNA 1RH9A 1V3IA 1QW9A 4YHEA 3B9EA 2WWCA 2CCRA 5LA0A 2DSZA 4JHZA 1ITCA 2Z1KA 1E0WA 1J0HA 4E8DA 3DHPA 2VZOA 1W3HA 4ACZB 4PTVA 2BVTA 3N15A 3S2CA 4KRTA 1UA3A 4PUEA 2XVKA 1VBRA 2C8NA 3BAJA 4OBSA 2F2HA 3WFLA 3I3EA 4MNMA 1V3MA 3UETA 4AZ5A 2XGBA 1GZJA 3VDCA 5FD0A 3VGDA 1ESWA 1WDRA 3O9NA 1JI2A 4HZ7A 2J7DA 4GI6A 2EO7A 2CHNA 2ZUNA 1NOUA 2JFEX 4YPJA 5HOSA 1GHRA 2JIWA 3LPGA 1OIMA 3JUGA 3W82A 3WQ6A 1LL4A 1BVZA 4JCMA 1BTCA 1WZLA 1CXIA 1MFVA 1UWSA 2XYLA 2J7EA 1B3ZA 2YA0A 4AD4A 3WY1A 4K68A 4PRWA 2EEXA 1QI5A 4GXPA 3ZSTA 3A4AA 2NSXA 3WNMA 4AZCB 1BYBA 1H09A 1H49A 2ZX9A 3CBWA 1ZJBA 2Q8XA 5KZ6A 3HJEA 1GQJA 1WZAA 4HMDA 1CNVA 3WH9A 1E6XM 2ZUTA 2WVTA 3PTKA 4BQ4A 1C8XA 1LG2A 3FN9A 1V6UA 1VEPA 1TZ7A 3A4XA 1W2VA 1KBKA 1NP0A 3GDBA 3WMCA 1XH2A 2XGIA 1PX4A 3II1A 1CENA 1E72M 3DECA 2JEQA 3QHMA 3VIHA 3RJYA 3WL1A 4GZEA 3VX1A 5IFPA 1UR4A 4LYPA 1OIFA 3BAIA 2PWEA 1FHLA 2VRQA 2Y2WA 4AEFA 5M3WA 5FOOA 2YDQA 1GQIA 1TUXA 4UTFA 5DMYA 5CXPA 5A8MA 3AMDA 5CQ1A 2YIHA 1V3JA 2E9BA 2XM1A 3CMGA 4B9ZA 4J3VA 4DWSA 2XVLA 3MUY1 1E4IA 2BVYA 4X0VA 1E5JA 5A94A 2WVVB 3FHAA 3HN3A 5DT7A 4QLJA 1H11A 1QNQA 2D22A 2UY4A 2VRJA 1GJWA 2DT1A 2W63A 1UHVA 4EKJA 1J11A 3B9AA 3FAXA 3LPPA 3VM5A 3CZ8A 4JKMA 4C7FA 1FA2A 4XUYA 3EMQA 4AZCA 4LQ1A 3VGEA 1VEMA 3WFZA 3AZRA 3WEOA 2CBJA 1W9VA 2VCAA 4CN4A 1GW1A 1B31A 1MW3A 3AIRA 5EBAA 1WKYA 1XC6A 1VF8A 3VD5A 1SR0A 1B0IA 2WMIA 4C7DA 3G6LA 3BSGA 3WF0A 2DSUA 3W24A 3VTRA 3MUIA 4TX6A 1WCGA 5EFDA 3VX0A 2GJPA 4CD7A 2FHCA 5JBDA 1BFNA 3F4VA 2XG9A 3WDRA 1YQ2A 2J47A 1KFWA 1PPIA 3KEHA 2EPOA 2PB1A 4CD4A 1ODZA 1SYTA 1GQKA 5BYWA 4PSPA 1CGWA 3L4ZA 5CSUA 5A1AA 4MTVA 4S3JA 4GQRA 2J74A 1TE1A 1ITXA 3AXXA 4ZXOA 4U33A 1GVYA 1ZU8A 1FFRA 3WNLA 1ISWA 5A2AA 3NDZA 4CGTA 3K1DA 2XFYA 3KL0A 4PYSA 4TVUA 5HDRA 3SCPA 2WLYA 3VIJA 1PZ2A 5ECUA 1HJWA 2G41A 3O2LA 1JL8A 2EQDA 1UA7A 1XD1A 1CTNA 1OD0A 2F61A 2EPKX 1JF6A 1S46A 1BYCA 3BGAA 1X6NA 3T09A 1ODUA 3WDIA 2PI6A 3AICA 4AIUA 3WDQA 3WELA 4NSBA 1C92A 1QNRA 3ZMRA 2Y4SA 3CZEA 1DWIM 3VD3A 7CGTA 4PTMA 1V0NA 2BVDA 1VFMA 4WKFA 3L2MA 1ISVA 4AISA 1V02A 4WSKA 2X09A 4Q22A 4U31A 1HIZA 1MXGA 2AOSA 3PTMA 2WLZA 3QOKA 1E1EA 2OYKA 4UZSA 2ZUVA 2W62A 4W8BA 1G9HA 1KGWA 4NRRA 4H04A 1JNEA 4PMZA 4NF7A 1KXTA 1C93A 2X8RA 5D4YA 3THCA 4RE3A 1CGYA 2XIIA 5M5DA 1JAKA 5CG0A 1V6WA 3NSXA 4MAVA 1O7AA 2PBGA 3ZQ9A 2CPUA 1QPKA 3U57A 4XZBA 3VIMA 1H41A 3SCVA 3GH5A 4JFTA 1E6PA 2V5CA 2G8ZA 1ZL1A 3QOMA 4F9JA 1R85A 1UKPA 3F5LA 3F5JA 3VGHA 4DUXA 2WZHA 1US3A 4MB3A 3NDYA 2X05A 1EO7A 4AD2A 4CD5A 1XGZA 4ZE5A 4H8VA 2A3CA 5A6KA 1UG6A 1EA9C 4AZ6A 4PMOA 1WNOA 3BAYA 4PTWA 3WQWA 4TXEA 5FIPA 3APGA 2QPSA 4AZHA 1EQPA 2YL6A 3OB8A 2X0HA 1FH8A 2WYSA 3BCDA 3BLPX 4A3HA 4QCEA 5E0CA 1WDPA 3PZTA 5CGMA 5ABFB 2BHYA 1OGBA 1XRVA 3K4DA 5A8NA 4HA4A 1EO5A 2XUCA 4ZENA 3GYCA 4D6EA 1PAMA 1BYAA 3I3BA 1JZ4A 2GUYA 2OSWA 4M81A 1H5VA 3A4WA 1WB0A 3LPOA 1JG9A 2E3ZA 4DM1A 1GOIA 1JAEA 4H7VA 2BFGA 1CGTA 2WKGA 3WF1A 3CUJA 4PMRA 3CHFA 1E4NA 1TVPA 1B90A 4W89A 3AIUA 2EPNA 3LPFA 2BY1A 1HP4A 1EGZA 1KCLA 4HPHA 3B8SA 3ECQA 4Z2HA 1GPFA 5LYRA 2GK1A 2D0FA 5A8PA 2EPMX 2UY3A 1ISXA 4BQ5A 4PMVA 3M7SA 4BCEA 3D3AA 1ISYA 3QGVA 4CCEA 1M04A 3CIVA 4KGLA 2VQUA 4GPNA 3GXMA 2WBGA 3WD4A 3AHXA 2C0HA 4UOZA 1CLVA 3IAQA 4H2CA 2BS9A 5BCAA 3BAWA 4PMQA 3AXHA 3N9KA 1BF2A 4WKAA 3AXIA 3OLGA 2CBVA 4TX8A 3SUWA 1J0KA 3VMNA 1LWHA 3K8MA 1PIGA 3AFBA 4W5UA 3VMPA 1W1TA 7TAAA 4BQ2A 3UEQA 1EHAA 4D6GA 4XX6A 3ZR6A 2O9PA 2EPLX 3L2LA 2W4XA 3AIBA 3OGSA 1QI0A 3SIMA 1V03A 2QHAA 2GDVA 5AYIA 3DYPA 1ZJAA 1W3LA 3SCQA 1KWKA 1GUVA 3ARRA 5AC5A 2PWDA 4DUVA 5CSYA 2QV4A 3MUAA 4MNLA 4V28A 1J10A 4J3SA 1WE5A 4MB4A 2XPKA 4UFIA 2EJ1A 3CZGA 3IJ9A 4QFUA 2D20A 1SMDA 1HT6A 4LYRA 3ARTA 4D6IA 4R27A 4P7QA 4E8CA 3VM7A 1E55A 1PX3A 2BY3A 3AS1A 3WNPA 4P8WA 1JZ3A 4D6FA 1CLXA 2TAAA 1QNSA 1E15A 3EDFA 1XSKA 1UD2A 3VPLA 4Z2LA 2QMKA 3N11A 4MJ4A 4KGJA 1UR9A 4AXNA 4LX4A 8A3HA 2WZIA 5A8QA 1R7AA 3F5KA 2VT0A 4FLRA 2DSWA 1GOWA 3UCQA 4S3KA 4IUGA 1GQLA 5M03A 2IUZA 4DWSB 1GNXA 1KQYA 3GBEA 1QI4A 3RILA 3AZSA 3T2OA 1QNOA 2WHMA 1RPKA 3CHCA 4R5EA 5A2CA 1OGGA 2OWXA 1ZBCA 1ZS2A 4W85A 3ARWA 4TUFA 2W91A 2GJXA 1LQ0A 3VIFA 1LG1A 3RIKA 1AMYA 5I78A 2W61A 1UWUA 2MANA 4UQCA 4AD0A 1JYVA 1JZ8A 1C8QA 3ZM8A 1EHNA 1BLIA 4HMEA 1B3YA 4H41A 4RL3A 4M29A 4UFLA 2CYGA 2DT0A 2G3JA 3CTTA 4CD8A 3ARUA 1JXKA 1TFVA 5JBEA 1UWIA 3WF4A 4MJ2A 5DT5A 3AIQA 1FP9A 4PCTA 3CUFA 4HZ8A 5I77A 5LA1A 1K9DA 2DIEA 5DFAA 3SUVA 1W9BM 1KR0A 3K46A 1JZ6A 4WLCA 1CYGA 4PBGA 5CPTA 1J0IA 4D6JA 5E9AA 2G3NA 1DWFM 5DF0A 2J79A 2VTFA 3SURA 1F4AA 3VD7A 6A3HA 1I1XA 3RDKA 2DGAA 4W84A 4U5KA 1G01A 1M7XA 1WP6A 2WXDM 2XSBA 3PTQA 4M8UA 4JKLA 4W8AA 4F8XA 2WNWA 4X9YA 2VX5A 1M53A 2X1IA 9CGTA 2JF6A 4CU6A 1XSIA 3EDEA 1JZ7A 3GXDA 3EMZA 5HBFA 4UQAA 2OWCA 1DHKA 1HKKA 1VBUA 2F8QA 1B9ZA 1JNDA 2VMFA 4MNJA 2OLHA 2V3GA 2ZXDA 2WSPA 2GJXB 2O9OA 2UWFA 2EBNA 1J9YA 3N1AA 4DUWA 2V38A 4JAWA 2XHYA 2PBOA 1EIBA 2AMGA 2BNJA 4OBRA 3PZ9A 3MS8A 1YHTA 2XWDA 3QHNA 5BXSA 2VC9A 3EDJA 4W7WA 4X0NA 2YBTA 2YA1A 4MB5A 1DWGM 2HISA 1GONA 4Z2KA 4ML4A 5LA2A 1KQZA 3ARQA 3MKKA 1CDGA 4F9DA 4CKQA 3NJ3A 5IHSA 3VIKA 4PMYA 2VJXA 1JZ5A 3AS0A 1B3XA 2CEQA 3W25A 2WC3A 2J8FA 1JF5A 5A6MA 3IK2A 4P8VA 1U2YA 3WH5A 5D8WA 3OZPA 1U30A 1RD6A 4UNIA 4Y7EA 3GNOA 1J01A 3VUPA 3CGTA 1JD7A 5A95A 5HNNA 3J7HA 4MPKA 1H4PA 3RO8A 4HP5A 3OA5A 4FLSA 4J27A 1VFOA 2WVVA 2QPUA 2GFTA 5CLWA 4MB1A 2J8GA 1CBGA 2WMGA 2VOTA 1CGUA 1NP2A 2DIJA 2UY5A 2WB5A 2OYMA 1MQPA 1JXJA 2ZICA 1FFQA 4IPLA 1JZ2A 2VX7A 3EDDA 3IJ8A 3WDPP 5A8OA 4HZ6A 1D7FA 2A3HA 3VDAA 5GNZA 3QHOA 4DWSD 6TAAA 4MNKA 2Y5EA 3BXWA 3IJ7A 4BF7A 1VFUA 3CUGA 3KE0A 4CCCA 2VQTA 2YA2A 4PSRA 5FKYA 1BVNP 1GORA 4B3LA 1L8NA 3UR7A 4KMQA 3OLEA 2OWWA 1VEOA 2V3EA 3W26A 4ZFMA 1PJ9A 5E0FA 1A47A 4YHGA 2CKRA 3SCWA 3SUSA 1GOQA 1BPLB 3WF3A 3ZO9A 3CUHA 4LGXA 1W1YA 3ZOAA 1E70M 4EK7A 1CXKA 3OGRA 2E9LA 3N18A 3VGBA 4JFUA 1HVQA 2B31A 4AY1A 5E6ZA 4GI9A 3W6MA 1W9UA 1FHDA 3WQ8A 1E43A 3KL3A 1IV8A 1PZ3A 1D2KA 4N42A 2HVMA 1OBAA 3TOPA 5I23A 3NSMA 1BGGA 4HA1A 4UZUA
chains in the Genus database with same CATH superfamily
1VJIA 4UR9A 4HYWA 2E28A 4FOUA 1W9DM 1JPIA 3IARA 1C9DA 2R8WA 3AI0A 2CBUA 4JGDA 3MKCA 1V6XA 2WJZA 3S5ZA 2FLIA 3OYXA 3TN4A 1BSLA 2QF7A 5ABGA 1HKMA 3D47A 5C9RA 3LN3A 1H7WA 2WANA 1SSDA 1Q3NA 1PKMA 4H01A 3AMGA 4BZYA 2DY3A 4HKPA 4DF2A 2ZA3A 1OINA 4B92A 3EKGA 3VNDA 1I1WA 1U5VA 2QJIA 3KBVA 4PUMA 3NIYA 1B3OA 1DQWA 4BQ3A 5A69A 3APTA 1XPGA 3DKLA 5F2MA 2BY2A 3C56A 4J28A 3UZJA 4U3CA 1EGVA 3ABSA 2DZXA 3QQ0A 1F76A 5DANA 3U5YA 1W3NA 3WUBA 4BFAA 3WEMA 4S2BA 3IJDA 3KHDA 2TSYA 1VBJA 3AYSA 1P1MA 3PK7A 1B1YA 4HK5A 3IIOA 2OQYA 1K8ZA 4M80A 2DVXA 5EMLA 1NWTA 1G0CA 5G2HA 1E4LA 4A3YA 3KBNA 3OEXA 1P0DA 3PZQA 2R91A 1IZJA 4XWUA 3POCA 2PRHA 1M1BA 1H0GA 4CU7A 3OIHA 4UOJA 4PZVA 2PWHA 5FJRA 4PEKA 1QHOA 4P7NA 4FLOA 1VPXA 2PLCA 4LT9A 4DF0A 2GLKA 1BQCA 3ES8A 5F4WA 4XZWA 1EEPA 2ZE0A 2NQ5A 3SGZA 1M03A 4HHHA 2V2HA 3W7LA 3HURA 2CLKA 2WMIB 1X38A 3AHVA 3T05A 3N4EA 1UZ1A 1S5NA 1SW7A 3AMLA 3FAWA 1JQXA 5K4XA 3SN4A 4Q8MA 3WDHA 3T4WA 2NT1A 1KXHA 4UTWA 4AZ7A 2H3DA 5J04A 3PS7A 2ZQ0A 1RLCL 4IMAA 3CB3A 3TLQA 5TBOA 1KRAC 4UQDA 5GPRA 4Z17A 3TTSA 3GH7A 5FI8A 2O55A 4FI4A 3DYMA 4GQQA 4DBDA 3E5PA 4XSMA 4NNCA 5IFTA 1EQCA 4IIGA 3WUEA 4JL1A 3KTSA 2C19A 1WKDA 4YMZA 3RF9A 2VR4A 4NZJA 3N13A 4JDYA 3VKKA 2VCCA 4NZCA 4AEOA 2JIEA 3IK4A 1OM0A 3W6YA 4XAYA 1B2YA 3SSZA 4WHBA 3BMVA 1JCNA 1DWAM 4LAMA 3W86A 3QJAA 4FXFA 3JS3A 3NUKA 1GVOA 1NQ6A 3FEMA 4YCOA 1G1YA 1I2OA 3VU2A 3KW3A 4GIAA 2Z26A 4HIBA 5IHRA 4O4WA 3L9CA 4HQVA 3R8GA 3UG4A 5KZMA 3WMSA 3FNDA 3O05A 4M24A 4TU1A 3E2QA 1KBLA 3L67A 3BH4A 1E0XA 3ONCA 1B3WA 2Q01A 3GKAA 2E8ZA 3A3WA 5EFFA 2O7SA 2NQZA 1TMLA 2J7BA 3G24A 2W66A 1Q4NX 1RVKA 3PHAA 1KKRA 2VZTA 8RUCA 1SJBA 2OKOA 2QUMA 4IT1A 4L9XA 1WBJA 2AL2A 3WX7A 3UG5A 3MV11 4AD1A 3DHFA 2HPMA 2R24A 5G5IA 5KEZA 1UR8A 3TTOA 2XN1A 3K13A 4PRRA 2V0TA 1PXGA 3T0AA 1NARA 4AIOA 1P7TB 1B9BA 1PWLA 1O12A 1FWSA 4MZ1A 2OMAA 2J8TA 5D37A 3IVUA 1R47A 2DZPA 2E68A 4IIBA 3KL5A 1EJXC 1AH0A 4NHVA 5T9BG 4JL2A 4H9ZA 1S5VA 3B8WA 4H2HA 3QV6A 1V0KA 4AC1X 3IJQA 1XYFA 4A3QA 1YXCA 4YVPA 3DFSA 5G2WA 2ZX8A 1TWSA 5E70A 4UQEA 4WGHA 2H9AA 3T0CA 2VR2A 3WCZA 3MMDA 2IPFA 3SSJA 3TKFA 2D3LA 3CAKA 4CQDA 4RZBA 5ABEA 2HXTA 1IT7A 2OXNA 4QLLA 3U2EA 4QITA 1TUFA 5AY7A 3CEPA 5I0DA 1Q6DA 4NZ3A 4BJHA 1JYWA 1TR1A 4JIEA 2WMHA 3AZTA 4P8XA 2NVAA 4ZOBA 3M0KA 2BY0A 1FCBA 2OGJA 1XLLA 4MVAA 1EKOA 3EB3A 4M6QA 4Q8TA 1OF6A 3C2YA 4ROQA 3WH7A 4JTTA 2NLYA 2J66A 3AHYA 5E9XA 3SCNA 1NF7A 4MM1A 4Z2IA 4ZA0A 3M5YA 4WDUA 3E38A 2Y8KA 3KX6A 3UT0A 5JMUA 2J6VA 4FB7A 4PUKA 3PP7A 1IT8A 5REQB 4DAIA 3EDKA 1AK5A 1AD1A 1MXSA 1P0EA 3WENA 3VD9A 3MBFA 3B8UA 1A3HA 2JEPA 2ZDSA 2YFNA 1KFEA 3N2TA 1X39A 1NFPA 5EKYA 5BXRA 3ITCA 4DXKA 4NRSA 4H9UA 4PB3A 1PIFA 3W88A 2KAUC 3PJWA 3N2OA 4NAFA 3DXIA 1BG9A 4QEHA 3ME3A 4JTHA 1QOXA 3ZT7A 5IDIA 5BOEA 3CZKA 4C6MA 1QHPA 1EZWA 5HUOA 3EB4A 4AMCA 3H2CA 4DBUA 2WHKA 3CHDA 3NAVA 3UNTA 4O12A 2XFRA 3L4VA 1F4HA 1NJJA 4GZIA 3TYCA 5FF2A 4ZQPA 4KERA 4ORMA 2D24A 3WH8A 4ACYA 1FDJA 1OFBA 2ZUWA 3O6AA 1NFGA 2HPIA 2QDGA 5K9CA 4Q7NA 3MO4A 2E1DA 1K77A 4PGLA 2E6FA 4WRHA 4DO5A 2F9RA 1GJUA 4WJ8A 3GDRA 3W01A 1W3IA 3WNOA 3W87A 1Y8BA 4HK7A 1CT5A 3VNZA 2PGEA 3HGSA 2ZE3A 4UFHA 4OZOA 4WDWA 3MP3A 4IL0A 4DO7A 3W4RA 2E5CA 3JZEA 4IXXA 2CXEA 3SCOA 4QHRA 1XGDA 4UTHA 3AYTA 2A3BA 3U2ZA 2DZSA 4G9PA 2R82A 5EYWA 4D72A 1T7LA 3AIWA 4QDMA 1MZRA 3M0ZA 2PODA 1E9IA 2YGYA 1K9TA 3H21A 2WAGA 2DP3A 1MZHA 1J18A 1YXDA 2DEPA 4NX5A 1XLKA 3PPHA 5I7GA 3VIPA 4IIEA 4V27A 5CLTA 3QR3A 5FEWA 1A5CA 1DE5A 4GZJA 2CNCA 4F0MA 3WLKX 1O68A 1ME7A 1XYAA 3U7VA 3W28A 2F2KA 1IIHA 4HHPA 1OWQA 5AN7A 1VYPX 2EXOA 2C1HA 4E4UA 1R3SA 2VHLA 3NL6A 2J88A 3NO5A 4KETA 3ONBA 3M4HA 1X97A 4Z0SA 4HN4A 1OG0A 2IXVA 3MHFA 1ZBWA 5BU6A 1UP2A 5CJNA 3WL0A 2WPBA 1WKEA 1MI3A 1ME8A 4F0LA 1UR3M 2PDUA 4JN7A 1YPIA 4KRUA 1V6YA 4RE0A 2V3FA 4KS0A 3VVGA 5GJMA 1G4TA 3AYVA 2QCDB 4H8NA 3UXIA 3E0IA 3NQMA 4AX7A 4UTLA 1P43A 1GOMA 4AAJA 2NV1A 2VNCA 4OE7A 2EAWA 3A3HA 4ZCWA 4AIBA 4ZXLA 2J9XA 1GOOA 2QUVA 1V3LA 4LY8A 3P84A 2C14A 4IUOA 4AY7A 4JHMA 4QX4A 2PP0A 2WCSA 4JN8A 1QW8A 1K02A 4R53A 1LCOA 1A5AA 3TSBA 4GKTA 3VOCA 4XD4A 3ARXA 4FF7A 1IQ8A 3CM4A 3G22A 3H22A 3AS2A 4C6FA 1LBLA 3N2XA 4A8IA 1T40A 2QUNA 1EDGA 3W3OA 3BC9A 5D05A 3U7BA 2FGZA 3CL7A 2D3NA 4HB7A 5GJPA 1ZCCA 1Q85A 3N6QA 4U10A 5DEZA 2Z0IA 3VOGA 4RZ6A 2WVSA 4GUHA 4I9MA 4PCFA 1WAWA 2C71A 1DJQA 4J40A 3KS5A 1QRQA 3P8IA 3ZWTA 1XX1A 1GOXA 2WJFA 2PGFA 5I5RA 1QWKA 1UD5A 1YE4A 1T8QA 3GE7A 3W6LA 4CQ8A 3VCNA 2J77A 3P62A 1SPQA 4JFVA 2H9AB 1HJUA 2PGRA 4I7UA 1LL6A 4HGXA 2PTYA 2J7CA 1SW0A 4PN2A 3AQUA 3P80A 1XH1A 1F3WA 1JCYA 3FW6A 1E1CA 2ZBTA 5AC7A 4JCLA 4K1WA 1KW1A 1XM3A 1BD0A 2VM8A 2ADAA 1XCFA 1RALA 4N4QA 1JDCA 1XICA 1OSEA 4V1YA 2CLPA 3W84A 1OC5A 1V79A 2TODA 1DQUA 2C79A 3EX1A 3OA3A 4UQBA 1OT1A 4RDVA 4HOWA 3GNXA 2FPYA 4HCHA 4I6VA 4AZIA 3G8EA 4FOKA 3V7PA 1WPCA 3ITXA 3SM0A 5TD4A 3DAQA 1KM0A 5C6MA 4LVGA 2BGQA 2DUZA 3HGJA 3ITLA 1YPFA 2YLLA 4HHLA 1R3WA 1GHSA 4J3TA 2J75A 3CWOX 2JK2A 3FX4A 1AL7A 2CWXA 3LM7A 1UWAA 3PAJA 4MPQA 3FVMA 2X1RA 4GO8A 3AXKA 3PFMA 1RK6A 3N6HA 2XGZA 5D2TA 4D1IA 4BS0A 2VFFA 2QJMA 4POCA 2RUSA 4KRZA 1EEXA 4D9PA 3MPGA 3W7OA 1HQTA 4WZHA 3EWYA 3CUIA 1I75A 1E0VA 3NEHA 5FJTA 4DRSA 4GC4A 3CLWA 2W92A 4UMCA 4Z1BA 1K4HA 1NWUA 2BVWA 3UVAA 2OZ0A 3R2GA 3P8JA 3CH9A 2B7PA 4YU1A 3D6NA 2VVNA 1UWQA 1R46A 3FDGA 3D5HA 4EOUA 1HXJA 3WO8A 1XHGA 2NZLA 1Q7QA 4PMXA 4UUIA 2PTWA 1C9WA 5E09A 1PWMA 2BBFA 3INPA 2VCBA 3C2OA 2PP3A 3HA1A 1EZ2A 2FJKA 4HBKA 1BG4A 2XH0A 2NVDA 4E2BA 4O14A 2NUWA 4ICMA 1K3UA 1C7TA 3PM6A 1UJPA 3ZVHB 4DBEA 4PCPA 4R3UA 4W7UA 3PANA 2FFCA 4IG2A 2DVTA 3AJXA 1W1B1 2P0IA 3MYPA 4US5A 3O06A 1NWRA 4IXHA 4XKYA 1RH9A 5C0QA 4I9JA 4YHEA 4JHZA 1V93A 1NDZA 4QR6A 1E0WA 1WUEA 3DHPA 2HROA 2VZOA 2HNHA 4LVDA 1W3HA 4PTVA 5EA9A 3S2CA 5LZLA 1VBRA 2C8NA 5DY3A 2X1SA 3QFEA 1TPFA 2F2HA 3I3EA 1EYEA 1GZJA 3VDCA 2E77A 5FD0A 1ESWA 1WDRA 2DZBA 2J7DA 4GI6A 2Z1BA 4H6QA 2EO7A 5CAKA 5AOUA 3WQFA 2QCMA 3QW3A 3ELFA 5C9UA 1GHRA 1KRMA 3W82A 1LL4A 2G4JA 4GWEA 4JCMA 4KWVA 3ZZ1A 1BXCA 1MFVA 1UWSA 1IXPA 2YA0A 4O18A 5D02A 4CEXC 4AC7C 5FA5A 3UD6A 4H6EA 2ASHA 3A4AA 2P88A 2NSXA 1ZLPA 1JPKA 5FSDC 3LI1A 4ZQNA 3Q4DA 1XLDA 1H49A 1LRQA 2Q8XA 1GQJA 4MKNA 2NQJA 1CNVA 2DZTA 2TRSA 2OELA 3FN9A 1V6UA 2DU2A 1OCJA 4WJEA 4F0SA 4FNPA 1V51A 3O15A 3MUCA 1NP0A 1UROA 1KD0A 1W5QA 3IGUA 1PX4A 3II1A 3NXLA 4HYVA 3EA3A 3RJYA 4GZEA 1DJYA 3DFYA 4ZOAA 6REQA 2HZGA 1FHLA 2Y2WA 2AKZA 4PUWA 5M3WA 5FOOA 1B5TA 1GK8A 3S5NA 2VENA 4GC3A 5CXPA 5A8MA 3C2FA 4C6PA 3EOOA 4J35A 2E9BA 3NQBA 3UXAA 1TV5A 3MSYA 5H6HA 1ZAHA 3CL8A 2BVYA 1L9WA 1SO3A 5A94A 3DBNA 4YXGA 1XQLA 2PLKA 1H11A 4E0CA 3KRZA 4KWWA 4YYFA 2UY4A 3QPEA 2W63A 1UHVA 3OZMA 2I9UA 3B9AA 2XZ9A 3WJXA 3VM5A 1RQEA 3R43A 4J5NA 3R13A 2G3FA 5FAJA 1FWBC 2F84A 4AZCA 4ZO7A 1K03A 3LUTA 3O07A 2CBJA 1MW3A 3AIRA 3GG1A 5EBAA 1R2RA 4N9EA 3N4AA 4GMEA 4FNSA 4KKXA 1SR0A 3V4BA 2XIJA 2XU2A 3UZXA 4C7DA 4HTBA 4E38A 4AXKA 3MUIA 1ENUA 3EAUA 4TX6A 3QR1A 5F2LA 2Z27A 3PC0A 3LV5A 3HPFA 3G0UA 1OVDA 2GJPA 3VX0A 3H55A 4N7QA 1H5YA 3F4VA 4H7ZA 4A8LA 4WDXA 3UBPC 1KFWA 1PPIA 4TO8A 2P76A 3KEHA 4CD4A 2YCJA 4Q4RA 3WLPA 2I14A 3KUMA 1EA0A 3LCWA 1GQKA 3NL2A 4R7OA 5A1AA 4S3JA 1TE1A 1GVYA 1I2PA 5D2WA 3H4XA 1FFRA 2BOGX 1UC4A 5A2AA 3NDZA 3LV6A 5G4WA 4BKNA 1PIIA 1FCUA 2WLYA 1PZ2A 4XKYB 4Z42C 1ZENA 1JL8A 3LGDA 4A8RA 3MWCA 1DJIA 2EPKX 1FWTA 1JF6A 3OOQA 4S3AA 4AIUA 1NSJA 3WELA 5DY2A 3JVAA 1XIHA 3CV7A 1DWIM 2PDHA 1V0NA 2BVDA 5CBIA 1VQTA 3L2MA 3KVLA 3MCOA 2X09A 4YTSA 1HIZA 3GDLA 1MXGA 3SY8A 1XISA 2AOSA 1CI1A 1P0NA 3PTMA 3QOKA 1I6NA 5LGZA 3LHUA 4NRRA 5KSWA 2X8RA 2OZTA 4UTTC 1CGYA 3KP1A 3LZ5A 1IE7C 3TYBA 5M5DA 2YXGA 2VEPA 4QISA 2W3ZA 3K30A 3EEGA 3RFAA 2CPUA 1EXBA 3GYEA 3H2NA 4C6DA 3G1DA 1SO5A 3VIMA 3VOHA 1YDNA 1OFEA 2V5CA 2OQHA 2R6OA 2BOFX 1ZGDA 3WQGA 2X7WA 4GCXA 4X2RA 1W17A 2WZHA 2ISSA 4WDTA 2V82A 3TROA 1XGZA 4H8VA 3MZ2A 3IUDA 1OYAA 4PMOA 1LRNA 1XG4A 4O0ZA 3HZ3A 2QGYA 3PJUA 2WYSA 4HU4A 3ANUA 4JTGA 5E0CA 1TJ1A 4MY8A 2HVNA 5CGMA 1PUDA 5ABFB 2OX1A 2FPTA 3K4DA 1EF2A 3BJTA 1PAMA 3I3BA 1R3VA 4DX3A 3BWWA 1EJ7L 2HRWA 3CV1A 3A4WA 5LNSA 1JG9A 3R10A 4OV9A 2E3ZA 4L61A 4H7VA 1R6WA 1TVPA 1W3TA 4NNAA 4NZ5A 1QNVA 3LPFA 2E6DA 2PZ0A 1AFSA 1EGZA 3BOXA 5H91A 4JX4A 4HPHA 3LK6A 1QMLA 3B8SA 4EF9A 2BB0A 1IHIA 3OBKA 2UY3A 4LS0A 4UCGA 3D3AA 1W1IE 3L21A 1ISYA 3EWDA 3UWZA 2RDWA 2Q71A 4R33A 4B5SA 1Y5VA 1XLFA 4GPNA 1RQHA 4UOZA 3U3HA 5LHEA 2BS9A 1OX6A 1TPDA 2INEA 1PYFA 2CBVA 3Q65A 3SUWA 2ABAA 1ZAIA 3PWIA 4GY0A 3VMNA 3NQ2A 3AFBA 1F5ZA 1W1TA 4WOZA 1PHQA 1JRCA 2DUXA 3FCPA 4BQ2A 4JR5A 3UEQA 1TQJA 1IWBA 1FWHC 3L2LA 2W4XA 3COTA 3OGSA 1V03A 4FALA 4HMNA 1A4MA 3GIPA 1ZJAA 3E9AA 4NP7A 3OODA 4LCRA 5ENLA 1Q13A 4MNLA 1WE5A 1FWAC 4GD0A 4XKMA 4K7VA 4IIFA 2TPSA 3LERA 3FLUA 3IJ9A 4IWWA 2D20A 1A3XA 3GDKA 4I5RA 3VM7A 2BY3A 4IFKA 4P8WA 3W7CA 4WCJA 3IWPA 1CLXA 1JPDX 4ZOEA 1E15A 1ONWA 4P5UA 3IUIA 1UD2A 1YLVA 4Z2LA 2QMKA 7XIMA 4MJ4A 1PV8A 1TSIA 2O4MA 5A8QA 2KX9A 1NY1A 5HQLA 3W7JA 3PR2A 2VT0A 1P6BA 3UCQA 3ISIX 1KQYA 3QSTA 1Q8AA 1BKSA 4IMEA 4S39A 3AZSA 1R5YA 1ELSA 1RPKA 1FRBA 3C0LA 4JTEA 4XAGA 2V2DA 1SZFA 1ZS2A 3GIYA 3ARWA 4TUFA 2W91A 3C0SA 3DGRA 1RQBA 2ISWA 1PO9A 4YL2A 4O54A 4DXVA 5AC6A 3ABOA 3SJ3A 4EPBC 4UQCA 4AD0A 4KW2A 3TSDA 4O52A 4UTWC 2B7QA 3LRLA 1C8QA 2Z4GA 1BLIA 5BW6A 4PBFA 4H41A 1LUCB 4N2YA 2CYGA 3ZYZA 3WYZA 1KFBA 3CTTA 1TFVA 5JBEA 1UWIA 5AYZA 1I8JA 3GX9A 1MRAA 4DB7A 1CB7B 4MJZA 4NI8A 3LOTA 5DT5A 1FP9A 1DV7A 3IRSA 5LA1A 2ALRA 1QXLA 1ZUAX 1PYMA 4BY3A 2GVJA 3DI1A 3K46A 1JZ6A 4D6JA 5E9AA 4M7SA 2EPHA 5KZDA 4D8AA 5DF0A 1TZ9A 2G5WA 5CPNA 5KMYA 1G01A 4GIEA 4IP5A 1WP6A 4Q8NA 2OODA 4L9YA 3TDFA 4YWSA 1UPMB 4K7YA 4DJDD 2OKTA 4V33A 1OG6A 3A12A 3BLIA 3ORWA 5DMNA 3EDEA 1BWKA 1DPMA 2FFIA 5I3IA 1Q6LA 3EMZA 3HF3A 2F8QA 1B9ZA 2VMFA 3TAKA 2GJXB 1JULA 1M65A 1OFDA 3PUDA 4LAZA 1DYSA 3DBPA 2CZ5A 4JAWA 1EIBA 3HM7A 4XIMA 5C2CA 3AALA 4GG9A 3GY1A 5BXSA 4JY9A 5DXXA 4DXXA 4Q6XA 4NXKA 4GHRA 4MB5A 4LEQA 3UJRA 2NQLA 4N6EA 2HISA 2CZFA 3MZNA 5PTDA 3G1FA 2VDHA 5LXXA 3I4EA 3MKKA 3PPGA 1RCXB 3VIKA 2D2HA 4MYXA 4REQA 1UCWA 1W31A 5A6MA 2VC6A 3UYCA 3IK2A 2YYUA 1U2YA 1P0KA 3GQYA 3WH5A 4Q4OA 1F3EA 4Y7EA 3GNOA 3C6CA 3CGTA 1GGOA 5HNNA 1N8FA 3OVPA 4BK9A 1H4PA 4QXIA 3OA5A 1EWEA 2FVLA 4J27A 1VFOA 1LRTA 3M6YA 2GFTA 1AODA 2Q8ZA 2J8GA 2UV8G 3MA8A 3T4CA 4LUSA 3BE7A 1CGUA 1NP2A 2QJGA 2DIJA 2UY5A 4IF2A 4B4FA 1TPH1 4AWUA 3LEPA 1MQPA 1JXJA 4JXCA 1JZ2A 3W83A 1Q2RA 4Q8PA 5FJIA 5U7SA 3IJ8A 2D2JA 2VUNA 3WLQA 5A8OA 1EFZA 3CQHA 2A3HA 4HZ6A 5AHEA 2QNEA 5GNZA 3QHOA 5AECA 4DWSD 5I3FA 2Y5EA 3BXWA 4FX7A 5JU6A 2PDQA 2QDDA 4PB5A 3CUGA 1YMYA 2QGHA 4LUTA 1BRLA 2P53A 4M51A 5FKYA 3UR7A 4DPPA 4GXMA 3SBFA 3NTYA 4XBJA 1VEOA 4DZ5A 1X8FA 5E0FA 2H6RA 4S3BA 3WF3A 4LGXA 2CWNA 2BGSA 4UIOA 3OGRA 2E9LA 3N18A 3VGBA 4HSNA 1YIXA 4IFKB 4KWOA 4JFUA 1UW9A 5E6ZA 5C9ZA 2HS8A 3HQOA 4GI9A 5DMLA 4QDWA 1L6SA 2JQXA 2Y89A 3WQ8A 1E43A 1PZ3A 2ATSA 4GUFA 3NL3A 5I23A 4HA1A 1FBAA 3FJ6A 1LT8A 3VZYA 4AF0B 3SGUA 3ALGA 1TPB1 4HA3A 1LDCA 4KEVA 3VCRA 3SRDA 5TF0A 2C18A 5CPSA 4O0QA 1YTKA 2F38A 3P82A 4IPPA 4LC6A 1XYZA 4QE4A 2J24A 2FPVA 1K8XA 3MY9A 2ZWYA 1UUMA 4FHAA 4RW3A 4LXFA 3VIOA 3TX9A 3UW6A 4OUEA 4EWJA 3RNDA 1E51A 1TA3A 3TQPA 2ACRA 1XIIA 3T7VA 3HMJG 3S9IA 1UBPC 4N9BA 2NWSA 4JZ5A 3QVQA 3HFYA 3W73A 4CNPA 3NQAA 3TCEA 2EG8A 1VCFA 3A5VA 1VHNA 3VD4A 3SRKA 1WZMA 4C5YA 3M0VA 1JDAA 3MQTA 2J25A 1FHUA 2Z2UA 2QLYA 3THQA 5HATA 1SO4A 4S3CA 2V5DA 3DHDA 3GG7A 3KTXA 2Z00A 4E3VA 1L2UA 4C5ZA 1S3TC 5DRCA 2GQ8A 4Q6JA 1A4LA 4O4VA 5BXPA 1KLYA 3BMXA 4PMDA 4FNUA 3WDJA 1FKWA 1A50A 4C7GA 2E8YA 2ZTKA 5G1TA 5IM51 3MHGA 3AYRA 3VAVA 2J7FA 2ZZ2A 2DQXA 5I79A 3VE9A 4UQ9A 3SCSA 3TYAA 4FNQA 4FXSA 1ZP4A 4ZB5A 3L0GA 1QASA 3B97A 3QBUA 3BAXA 1NF0A 1VBGA 1Q5MA 3MCMA 2GK1B 3DCPA 4XZLX 2GUBA 5HQEA 1E40A 4GA8A 4Y96A 5I3KA 1HL2A 1FX6A 4KPLA 2OSXA 3JW7A 4KEZA 4JTLA 2ZX6A 3PBUA 2GYIA 3VO0A 1POJA 1WOAA 1EP3A 5CC3A 3LHZA 8CGTA 3GTIA 1FXQA 6TIMA 3ABRA 2DSKA 3B0XA 2Y8UA 3N3TA 4WXYA 2WSQA 3B8DA 1EDTA 2BASA 3UYIA 3O6DA 1AQMA 3M46A 2V3DA 4QSHA 1SUXA 4F0KA 3T0TA 1J0JA 3RCNA 5DBUA 2PDXA 5BU9A 1TYGA 3VDGA 1JRBA 4QG8A 4F48A 2V8ZA 3V3WA 7PTDA 1UB3A 2ONEA 3DIPA 3LXCA 4AD5A 3VOFA 3PZGA 1H51A 4WKHA 2EHHA 4L9ZA 4WK9A 3EYPA 1WX0A 2FVKA 1XCXA 1MW0A 4HSOA 3RM8A 2XM2A 2G4FA 4LSBA 3ZJ7A 3M5XA 4GZ7A 1TCDA 3BJSA 1R2TA 2PLJA 3QC0A 1Q63A 3VOIA 3B0YA 4PTDA 3OLIA 1V08A 4FX6M 4CQCA 3TW7A 3UERA 4ERGA 4XVEA 1V0LA 4GJ1A 4PR4A 4KT2A 4U2ZA 3SQLA 3R6IA 3BGGA 4WF7A 1W1VA 4XUGA 2RAGA 4GYJA 3UZZA 3BCFA 4B15A 1HKWA 1WDSA 1FWRA 3NO1A 3PY2A 1Q2SA 4IPNB 3O1NA 2DQWA 1V0MA 3GHSA 1M9HA 4ATLA 4XV0A 5AYYA 1F9CA 4QAWA 3N12A 2Y61A 4GQ0A 4O1FA 4OTKA 3CYVA 5BRPA 3B8TA 1TPEA 1OX5A 3WLJA 1CPUA 4E8GA 3W1QA 3WNKA 1DP0A 1MYRA 1YX1A 1PTGA 2J4GA 1HX0A 1YTEA 2W67A 3F7JA 4NG3A 3ZWSA 3GBDA 2PLMA 4YTTA 2ISDA 3QY6A 1VYSX 4D6HA 3DFQA 2ABBA 2VFHA 3FV9A 3HU7A 4I3GA 4JN6A 3RITA 4CNUA 2FHFA 1GVSA 3OZOA 1MW2A 2WC4A 3OW1A 1I60A 2ZZ4A 1XD0A 3NPXA 2Z1XA 4I7VA 4LWWA 1C91A 1KCZA 4J9JA 2D69A 2OVLA 3PUGA 1GPWA 4NL1A 5TNVA 4R9OA 3ABXA 1AMKA 2POTA 3S83A 2VL4A 2V63A 2WPGA 1L0PA 3GRIA 3LCGA 2Z2BA 2QF8A 4U4MA 3JR2A 2QIWA 1X6LA 3GXNA 1QDSA 4H9XA 4HU0A 4JYFA 3BURA 3LCIA 3LHWA 1GTEA 1TMQA 4XVDA 3C0QA 3A3XA 3NOEA 3W27A 5I06A 1KM4A 3LMYA 3GNPA 1NH6A 2VEFA 1EH9A 1W3JA 4QJ5B 2VXNA 3KWSA 1E71M 4C6JA 1SZGA 1KC7A 1MUMA 3TYUA 2ZRXA 4LYQA 4X2PA 5FJOA 1S2UA 2VZVA 1IXOA 4B5WA 6CGTA 5FSEC 3F4DA 5CPLA 4H7CA 3G8RA 1E4MM 4EANA 3NG3A 3KBSA 1J2WA 4WR3A 5FL1A 3TEVA 2PDFA 2QCCA 1UIOA 5G1YA 1A49A 1D3CA 5A3HA 1S2TA 4M82A 1ZB5A 2CZDA 1TX0A 2QCHA 4JYDA 4NNBA 1MXDA 3PSVA 1UYQA 1MNZA 3OVGA 1L8PA 4H8HA 3KZPA 2GPTA 3PZUA 5IXEA 4RV8A 1U22A 4DI9A 2GDUA 4AVNA 3C0JA 1TKKA 1W54A 4LNYA 3SUUA 1OGSA 2VURA 2VEMA 2WNQA 3DI0A 2O0TA 2HEJA 3AU6A 1FDZA 4O1EA 3IIXA 1VFTA 3TYZA 1U5JA 1GKRA 2H8ZA 4C6OA 3E2SA 1XUZA 1R3RA 3UPMA 4I5XA 3CIXA 4L1WA 3W1RA 1RA5A 3KCLA 2ZZ3A 4GX9A 1F6KA 4IH3A 2D0GA 4XBKA 1J12A 2QEZA 2E9MA 1JD9A 5L6UA 5MKGA 4NJGA 4MYAA 4Q8VA 2ZZ6A 1W6TA 3TC6A 3E1F1 4JD4A 4WVXA 2BG5A 4X61A 2P8CA 3KLLA 4JTCA 3NZQA 1PS9A 3VZXA 2OO0A 5C7VA 4QBXA 2I5GA 1RY0A 3S3GA 2E67A 2PAJA 4B5XA 7REQA 4YJ5A 3G2GA 3I7SA 1XLIA 2NX9A 4Z1CA 3K8LA 2CFFA 1CXLA 3VA8A 4OFCA 1A5KC 4C6CA 3BL3A 1R9YA 4YCPA 3L4XA 4D71A 1MQQA 3WQ5A 4DWSC 5BMWA 1GKPA 2WNNA 4HPGA 1O94A 1IGSA 1J5TA 1XYBA 4GCAA 2E4TA 3RPMA 2XIMA 1ICSA 3FKRA 4K8EA 4LNCA 6XIMA 3VDHA 1HKJA 1VH7A 3KBJA 1HVXA 3LMZA 2ZRZA 3E74A 4NYYA 1YBQB 3MP4A 3WSUA 3FA4A 1BRLB 1IGWA 1VP5A 5MHBA 1GOKA 3L4UA 3NM3A 3ARYA 2ZVRA 3W81A 4UFMA 2IQTA 4QS5A 5A6AA 2VX4A 3F2DA 5ABFA 3I3DA 5SWUA 3URBA 4DJED 3UWEA 1E3ZA 4RE4A 5T91A 2PSNA 4M1BA 3MCNA 3WH6A 1VFHA 3ALFA 4DNHA 4Z1YA 1K9FA 1RAKA 2A85A 2YL8A 3JZUA 5A6BA 5CJ5A 2WQDA 3PBVA 1Q6EA 4BA0A 1W9XA 3MSDA 4MWAE 2YW4A 3LLXA 2UY2A 5F7UA 4Y9OA 1CGVA 5DCDA 5HMFA 1JDFA 1UZDA 3UZWA 4QROA 3RJXA 3PBGA 2A3AA 2O92A 4CNSA 5A5WA 2VEIA 3H24A 4L7ZA 2ZUSA 3WQ4A 4DBWA 4DUOA 2GGIA 1XJBA 2C0AA 1R9ZA 4AEEA 1HL9A 3I7QA 1UD8A 2CIPA 2Z25A 1CX9A 2WK2A 4GI8A 2P50A 4CCDA 1JJKA 3QLLA 2VOMA 1O6IA 2OX4A 3RLHA 3M0JA 4RUBA 2FDSA 3T8QA 3LCHA 4GVIA 1GT8A 4JEQA 2D0HA 3VNYA 3ZLHA 4DLFA 2ACQA 3ZJKA 4UOQA 4NZ4A 5HNRA 4K8HA 1T99A 3PVFA 1A5OC 4IGMA 2VX6A 2PWFA 1UKSA 2IXUA 3OBAA 1HF6A 1X7IA 2BTMA 1V77A 2V81A 4S3GA 4H9VA 4YN5A 1G4PA 3Q45A 4N9DA 4I6KA 4J3UA 1EOMA 2VGFA 3EBVA 3EOUA 1XINA 3ERPA 2NT0A 3UP8A 4TV6A 5DO8A 2POZA 4JQ3A 1C7SA 3CQJA 3GXIA 2E40A 3CXOA 1LJYA 5M17A 1Q6FA 3FJLA 2GJRA 3M07A 4FK9A 3GG8A 1VFLA 4YTUA 2QYGA 1H1ZA 4LC8A 4HNUA 1U1HA 4LCSA 4PRTA 3ZFHA 3R8HA 2GSJA 2GSHA 2PEVA 3B06A 3C5QA 4AZBA 4WXZA 3MJYA 1KBBA 4JBRA 2OLAA 4Q7BA 2X2YA 3ICJA 1RZMA 1DTNA 4LVAA 3JU2A 4M1RA 4IISA 3ZT5A 3OGVA 2DPEA 4KESA 4GH3A 2QULA 5TIMA 3A6OA 3GUGA 2OPJA 4GNKB 4A4AA 3M0HA 4P8UA 3NZGA 3W71A 3G3MA 1UZ4A 6REQB 5HQMA 1HJSA 3RMJA 1XDJA 4ZQCA 2V5KA 3DZ1A 3VIGA 3ANVA 1MVYA 2BZNA 1H7XA 5D8ZA 3TTYA 2YDAA 2BODX 1MWOA 4W88A 4AVFA 1K7EA 2XWEA 3A5FA 3TSMA 3UXDA 3S2MA 3MW7A 4L6DA 1QVBA 4HSHA 1XI3A 4O10A 1QPNA 1QPQA 3I6EA 4A35A 4HCLA 3E0VA 5CZKA 4HJWA 1DQXA 1Z32X 3GTHA 4XTDA 3CO8A 1ECEA 2PC8A 3RG6A 1CXEA 1CGXA 2A3EA 2AKMA 1LORA 4RCXA 1US2A 5H1WA 1KM3A 3V5CA 2YKKA 1JDDA 2GJNA 4KF1A 2YLAA 1QBBA 1QWGA 4G7EA 3RLGA 1UC5A 1JUKA 5GNXA 3P61A 4PBEA 2VO5A 4AY8A 2DIKA 1E56A 1P6WA 3USBA 5D2VA 2G3MA 2CLHA 1B54A 4EAMA 1EC7A 3CWNA 5CCZA 3SI9A 3UR8A 3RM9A 3H2FA 4B90A 1KBIA 1SM9A 3O7UA 5CZ0A 2WZEA 4MWAC 4C1LA 2NW0A 3W7PA 3W2KA 1E73M 2B4GA 1FOBA 3TJIA 3NQ8A 2O9TA 1FKXA 4AZGA 2QT3A 2DZAA 2YBVA 1EP1A 2D2GA 5ABTA 3NXFA 1VAHA 3GD6A 5D9NA 4U5IA 2AQVA 1A0DA 2FZBA 1KXVA 4MIMA 4P7OA 3NQGA 1AH4A 4GUGA 3VABA 5CGTA 1M01A 3GB6A 2QJJA 2WC7A 3WZ0E 4JFSA 4KWSA 3KOWA 3CHEA 1T0OA 1GG1A 1S2AA 2DW7A 3M0LA 1MEIA 3UY7A 1AQ0A 1DORA 1XKYA 3VIIA 2ZYFA 2XSAA 1TJ2A 3DFNA 2HV5A 4TTUA 1AZ1A 3GHUA 1HL8A 2B0MA 1JCLA 2NQ9A 3TR2A 2VELA 4AHOA 2Z6IA 3QY7A 4JX5A 3QFWA 2WWCA 5LA0A 2F6XA 1UBSA 2DSZA 4GGHA 3FGCB 2XDFA 3F2CA 4E8DA 1TQXA 2ISFA 3KVKA 4KRTA 4QQUA 4OBSA 4MNMA 4AZ5A 1EL3A 4IQEA 4EX4A 4RKAA 3LQLA 3S5SA 2VGIA 3T78A 5EBUA 4K37A 3H7VA 3UCCA 4GRSA 4MFDA 1UUOA 4JDBA 3QMSA 4DLMA 4L64A 2EJAA 3P2VA 3QZEA 5HOSA 3GR7A 3FKKA 4EACA 4ZSTA 4Q8WA 3NPVA 4QNEA 2XYLA 4PB4A 1B3ZA 3BDKA 3MUXA 4K68A 4PRWA 1PDZA 4H83A 2NVCA 4GXPA 3GDMA 2V5JA 4LB4A 4RJEA 1ECQA 1O60A 3HPXA 3N2BA 1FWJC 3HJEA 1OFRA 1US0A 1WZAA 4HMDA 4UTMA 1XLAA 1E6XM 4DJEC 3LBOA 2ZUTA 4MWAB 4UBPC 3PTKA 1FWGC 2FTWA 4RPQA 1DJXA 1GQNA 1LG2A 2P8BA 1TZ7A 1W2VA 3GDBA 2EGZA 3W1UA 2Z7KA 1OZQA 3C2RA 5MF5A 1CENA 4JTIA 3DECA 4O8AA 2JEQA 1YBQA 3RCMA 3DUGA 5IFPA 1UR4A 4LYPA 1OIFA 1E0UA 3NNTA 2NQHA 2NSOA 3B04A 1NDYA 3QN3A 2YDQA 3BO9A 5CSRA 1XLEA 1XIBA 1C29A 4UTFA 2QDHA 5DMYA 5I00A 2I7GA 1T6MA 2YIHA 2YCLA 3YPIA 1XYLA 1ZRQA 2QCFA 3APYA 3K4WA 4CQ9A 4H9TA 4DWSA 3MUY1 4NIRA 3U6WA 1E4IA 5AHNA 1O95A 1H7OA 2WVVB 3FHAA 3AUOA 5DT7A 1QOQA 4HHMA 5I07A 2DT1A 5BOFA 4C60A 3B4UA 2RHGA 3A9IA 3ENLA 4EKJA 1KTNA 1NELA 1J11A 4IG2B 1G7VA 3FAXA 2BSLA 4ZFCA 3EMQA 4JYEA 5F4XA 1ZZMA 3Q94A 4B2DD 4JICA 2A79A 3WFZA 5JH1A 1UMLA 4LALA 3UCDA 3NQVA 1TMHA 3L5MA 3WLTA 2Z29A 1WKYA 3L65A 1FVPA 3Q58A 3WF0A 4Y9NA 1DJGA 2H8XA 4NUWA 1AH3A 3TE9A 3O0FA 5FF4A 3BZGA 3RYSA 1X1OA 5EFDA 3P14A 2QUUA 3VCCA 4V15A 4K36A 2BDQA 2FHCA 5JBDA 2DV0A 1XLHA 4INFA 2J47A 1TWIA 3G1YA 1L2QA 1SYTA 4L4MA 3H6OA 2HDJA 3TYDA 2G95A 2E7FA 1XQKA 4PSPA 1CGWA 3M7WA 2VC7A 5CSUA 4I90A 4XZ9A 1ITXA 3A13A 4JPGA 1LROA 1ZU8A 3WNLA 1ISWA 2PWVA 3THAA 4A3RA 1EUAA 4TVUA 4PYSA 5HDRA 3VIJA 1S5TA 1XXXA 5ECUA 3HOJA 3PAOA 2A7PA 3OHMB 1UA7A 1PB0A 5J5DA 2B7NA 1OD0A 1KM1A 2NLIA 3RPDA 4LUYA 3W7HA 3HGOA 1FWIC 4YNGA 3FYYA 1ODUA 4BEUA 1C92A 1OX4B 5CAHA 1PL9A 3ZMRA 3NR0A 3VD3A 7CGTA 1F3TA 4PTMA 5M1TA 2NXIA 3BOFA 3DC8A 1EX1A 1TX2A 2ZCGA 2VFDA 4WSKA 5HK4A 2DZUA 2FIQA 4O57A 3GW3A 4IGHA 1PDYA 2DZWA 3JRKA 4JIRA 3EXRA 4ZQRA 1ZJIA 2OYKA 4UZSA 2ZUVA 4WY0F 1GYNA 1P1XA 1Y0EA 4NXSA 1JNEA 4PMZA 3OTRA 1KXTA 3THCA 1TE6A 3TVAA 1BF6A 3KP0A 3VNJA 1ITQA 1V6WA 1Z7AA 1X1ZA 1O7AA 3A24A 2PBGA 3W1MA 4JQAA 1TWWA 1CCWB 5HMSA 4XZBA 4AHPA 2JGYA 2WKJA 3GH5A 4IQDA 3V16A 1HG3A 3L12A 3UWYA 3F5LA 5HAOA 5CBBA 3F5JA 4PCNA 1K70A 3WJWA 4HZMA 4AD2A 4CD5A 3LXBA 1S39A 1OFOA 2A3CA 2I16A 2QQ6A 4AZ6A 1UP3A 4UTTA 4PTWA 3SFWA 3WQWA 3N9RA 3OG3A 2QPSA 1X98A 4AVOA 1XW8A 3OB8A 2OT1A 3R25A 1FH8A 1SW3A 4K39A 4L65A 1VR6A 3BLPX 4LOCA 4JX6A 4BF9A 1RSCA 3UR2A 2X42A 3DH7A 2BHYA 2TMDA 3FYPA 1XRVA 3TXZA 3DENA 4HA4A 1EO5A 4ZENA 7TIMA 1H5VA 3LPOA 2HE8A 4BWLC 4CEUC 5C5YA 5FJJA 4O53A 2BFGA 3CUJA 4A3UA 3QPYA 1B90A 2OOGA 4W89A 2EPNA 3G1XA 5CGQA 3IRDA 4C6QA 1GPFA 1QK0A 1GVQA 4IIDA 2EPMX 2FZNA 4A6GA 5FF0A 2OR2A 1ISXA 3OVQA 3M7SA 4BCEA 3L5LA 2W0UA 4FP1A 3CIVA 1AW2A 4LAKA 4LUIA 2V30A 1IF2A 5U4NA 3GXMA 1H7RA 2WBGA 3M9YA 4UXDA 2W6RA 5BCAA 1BF2A 3AXIA 3M47A 4TX8A 5XIMA 3BQ5A 3E3HA 5I3HA 1IEXA 3TV8A 1SFTA 4M7TA 3TNBA 1JQVA 4D6GA 3BLFA 3GVGA 2EPLX 3AIBA 2YPIA 3W7NA 1J79A 1FY6A 2QHAA 4H00A 5AYXA 4KBXA 3H4WA 3DYPA 5AYIA 1XGEA 1GUVA 3NURA 2E09A 4MWAD 4V28A 2RDTA 2XPKA 4I9AA 3GIQA 2EF9A 3P6LA 4UFIA 1KFKA 1ZQ5A 5LNUA 3QY8A 1ONRA 1WDWA 2BWGA 1HT6A 1L6FA 1LWIA 4E8CA 1WUFA 1E55A 1PX3A 3WNPA 2PDKA 1JZ3A 4D6FA 4DEFA 4O1AA 4DNMA 4KGJA 3A64A 3LLFA 1R38A 4XD3A 8A3HA 4OV4A 1R7AA 1NFBA 4FLRA 2DSWA 1GOWA 3TTEA 1GNXA 5B80A 3QH2A 2WHMA 1YDYA 3CHCA 1GEQA 3W76A 5HWMA 1ZBCA 3MTWA 4W85A 1W8GA 2GJXA 1LQ0A 3VIFA 1LG1A 4IX2A 3M16A 4ADSA 3UXKA 2P1FA 4QEEA 3HPSA 1JYVA 1A0EA 1RV8A 3UZYA 1AW1A 3ZM8A 3WBXA 4YTRA 4UFLA 2VEKA 2PDWA 4CD8A 4Z1AA 4XAPA 3WF4A 4RR4A 4C90A 1TV3A 3CUFA 1YADA 3GU9A 1K9DA 3GVRA 4GBDA 1W9BM 3CC1A 4IX0A 4B4HA 1VFSA 5CPTA 1J0IA 1Q6OA 2G3NA 1IIGA 3THUA 1DWFM 5MKGB 1F4AA 1XLJA 4XBSA 4X22A 4ASTA 1PSCA 3MO7A 5IBXA 2WXDM 4LBUA 2ZA2A 4DO4A 4M8UA 4JKLA 5TQLA 3MI2A 2WNWA 4X9YA 2VX5A 2X1IA 9CGTA 4NKCA 3RPTA 4CU6A 4KFNA 3GXDA 2IKGA 3P5ZA 2OWCA 1HKKA 1VBUA 5REQA 1JNDA 1TJRA 2Z1VA 2OLHA 1R3QA 4MHBA 2O9OA 2UWFA 2EBNA 5FJUA 5C9WA 3TQVA 1PTDA 3N1AA 2V38A 2PBOA 4QE1A 2YCKX 1ZSXA 4QE5A 2O56A 1V7YA 1XS2A 4DYKA 2HCVA 4X0NA 5D30A 3NOYA 3IIZA 2EKGA 5HMDA 3HQNA 1OK6A 1JCMP 1LOQA 1XG3A 2V9DA 2J6XA 3ARQA 3F4WA 4DVOA 3W02A 4M0XA 1N55A 3M5VA 1LLZA 4ZTYA 3W9ZA 3S1XA 2GOUA 1EX5A 3G1RA 3PBYA 1TR9A 5CEWA 4ZZ9A 4QS6A 4FEZA 3CUXA 1F05A 2C6QA 3J7HA 1GKQA 2A7NA 4IJBA 3QV9A 1M41A 3VNMA 5AB3A 2OEMA 5D03A 1LM1A 4QTGA 3IJIA 3OP2A 3GNDA 4MGGA 1SJAA 3WK1A 2I57A 3DFHA 2OT0A 5EU9A 3VZZA 4BEQA 2Z6JA 2QKFA 2ZICA 1EPVA 1R9XA 1OF8A 3EDDA 3HV9A 4IP4A 1I2RA 1D7FA 1HKVA 5AC8A 1ZHAA 2A5HA 4Q3MA 3IJ7A 4BF7A 1VFUA 1NEYA 1TPWA 2VQTA 4C6BA 2YA2A 4QM1A 3IUHA 3C8NA 4PSRA 5H2ZA 1BVNP 1L8NA 3QR0A 1WBHA 3WQPA 4KEMA 5LIXX 1Q7MA 3U2CA 4B91A 4YHGA 4X60A 3ZO9A 3ZOAA 1YEYA 1VD6A 3C61A 1T8XA 3RCYA 1IYXA 4Q8OA 1HVQA 4PMJA 3MWAA 2Y7EA 4QJ4B 4ZO8A 1IV8A 4Q7IA 2HVMA 4WQ6A 3TOPA 1TWZA 2HNEA 2R1LA 1BGGA 3HO8A 3M0YA 3T2QA 2PDYA 3W53A 3PB0A 4AF0A 2O4QA 3CV6A 2FH8A 1PEZA 4C6NA 3GO2A 1DKWA 2UBPC 4M6VA 2YDSA 1J0YA 1N2VA 3MMUA 1XYCA 4ONVA 1FH7A 4Q4QA 3KCJA 4NZ1A 1XV8A 3HJZA 3OU8A 1FWCC 2YL5A 3ZR4A 3H7UA 3EX6A 5DX7A 4DJEA 3S2LA 4KH2A 3LENA 1X7FA 1TV2A 5C9XA 3RO6A 3L4WA 4FIRA 2BHZA 2YB1A 3O0KA 1IZCA 3B05A 3D0CA 1D3HA 3RR1A 3KOXA 1F6YA 1MEWA 5LNVA 3DESA 3VE7A 3NQEA 2Z1WA 4GACA 3PTDA 1E9YB 3ARZA 3BLDA 3E49A 3SCUA 1V3HA 3GNNA 3GZ3A 2V5BA 5B7ZA 4MF4A 1RY8A 1VYRA 1RD5A 1KV5A 5EL1A 3WQCA 3QQWA 4O19A 4UFKA 1JPHA 1ZCOA 3GXPA 4URIA 3LCFA 1BKHA 4J4KA 1KR1A 1Q6GA 2VDIA 1H62A 1Y7VA 4RE2A 3R0KA 5F1UA 4WOQA 1MNSA 2J62A 1K7FA 2X0SA 3OG2A 1VKFA 3B4YA 1IXQA 3I10A 3NPWA 1OCQA 2DUAA 1E5NA 2QR6A 3MI6A 3TK7A 1QW7A 3TP4A 2OO6A 3C3NA 2FGLA 3WLLA 2CU0A 3WQVA 4OGZA 3VFCA 4Y9AA 2BGNE 1WO2A 1EXPA 4TR9A 1DIKA 4GISA 3G77A 3B0VC 1V4YA 1EBGA 1PTAA 1Z44A 2OQLA 2QAFA 4YWIA 3IIPA 4ATWA 2DH3A 4TOQA 1E6QM 1CWYA 1E1FA 5XINA 3GR4A 1NOWA 4NYUA 4PULA 1VS1A 4F0RA 3CJPA 2GVGA 1K6AA 2WZTA 4FS9A 3GNRA 4IHCA 3SADA 3MV01 4J1OA 3HG5A 4NT0A 1P0BA 4IPIA 2CXGA 3LG3A 3A23A 5GQBA 1JCTA 2IMRA 1O5RA 2J7HA 1IT0A 2QW5A 1YTDA 2PWUA 3W1TA 4FXRA 1M5WA 4Z2JA 3S0CA 3M43A 2J9ZA 5E1QA 1R86A 1WZKA 6ENLA 2ZUMA 3BVJA 3N6JA 3STCA 4AG0A 3FJ4A 3QGKC 4U2YA 5L9FA 3TMLA 4ES4A 5I02A 1CZ1A 3GVQA 4V1XA 3IGXA 4RNJA 1P6CA 3WD1A 3TYEA 3EGJA 6ALDA 2XIOA 2CC0A 1KB3A 4L4PA 1OFAA 4P7LA 3NL5A 3HG2A 1G7UA 3H26A 2NWRA 1UD3A 1RBLA 2Z7GA 4FPSA 2Q02A 1IEIA 3GSMA 3URNA 5I09A 1V5XA 4DJFA 3U4AA 3VILA 2YFOA 4Z0JA 1EYWA 4GX8A 5DBTA 1EWDA 3Q2DA 1BHGA 3DYOA 3WBEA 1QFEA 3KAOA 2QMJA 2E6YA 1VIZA 3BV7A 3IV8A 2NX1A 4J3WA 1TTIA 4UB9A 1H1YA 4RDZA 2E25A 1TG7A 3V5OA 1JCXA 2ZADA 3WF2A 1E6NA 3R11A 3CZLA 4HNNA 1HKIA 1LQ2A 2PRLA 5AVNA 1CB2A 2DT3A 3H2OA 2YB4A 4O28A 3M0XA 3SQMA 3CMJA 1ZNNA 1FWNA 3FS2A 5BRQA 5HXMA 1VJSA 2IKJA 3T08A 3C86A 1E6ZA 3LRMA 4R7JA 5JBFA 4R9XA 1LF1A 3UFYA 3VMOA 2OU4A 4Q4KA 3P0WA 5AYBA 1UD6A 1YNYA 5C2GA 4WSJA 2V68A 2A3LA 5AHMA 2RDXA 3TFCA 3BLOA 1EJRC 3W7EA 1PBGA 1HP5A 1TV8A 4M56A 5LIYX 3CZJA 1R30A 4XZNX 4ZODA 2CETA 1J96A 2LLEA 2VR5A 4W5ZA 4B9YA 2HSAA 2C15A 2I5QA 3F4NA 3IIVA 3Q37A 3AMKA 4L56A 1IEVA 3L4TA 4JEJA 4UR7A 1KLZA 3S1UA 4E6MA 5EMYA 3UWWA 4MZYA 4IGSA 5FEZA 3S6OA 3WUGA 4CUCA 4PTXA 3EOEA 4E2OA 1JYXA 1RP8A 1NDVA 3VGFA 5A6SA 1OK4A 2H90A 3NYDA 3W1LA 3ZJ6A 1JUEA 5CZJA 3SCRA 2J78A 2XISA 1RLDA 3HB9A 5CJMA 2PDLA 4MKSA 2O9RA 4H6KA 3S42A 3P67A 4WD0A 1A0CA 2GGGA 2I56A 1R8LA 2Y88A 5I2UA 3H7RA 4L4LA 2PCQA 1S38A 3H2EA 4CN6A 1R7OA 4PC8A 3TQKA 2E1WA 2ZUUA 3WNNA 3EWWA 4OOUA 1E6RA 5K7JA 3UY8A 1HO1A 1DJZA 1UH4A 2WCGA 4FMVA 3I68A 1E9LA 2Y24A 4OIFA 2VFEA 3WBAA 3OO2A 4F40A 3D46A 3ARVA 3BLKA 4Q4MA 2GJLA 1RCOB 3T0BA 1UQZA 2QJNA 1V6VA 2VVSA 3QF0A 3P7YA 4WUIA 1XDLA 5FACA 2PMQA 1QI2A 2G37A 3PN8A 3UZ5A 4O8RA 4ZE4A 4PL1A 1AD4A 4B5NA 3G18A 3ZS4A 4NASA 2PF8A 3ZR5A 4BHYA 4EAYA 4OOZA 1FWWA 1OT2A 2IPWA 2EKCA 4ZO6A 1UKOA 1J93A 1V8EA 3WLOA 3MMWA 2CITA 1GVIA 5XIAA 4R88A 3KFTA 2Y7GA 1TRIA 4ZR8A 1VB9A 2XTKA 3GXTA 2D23A 3MUZ1 2HJPA 3KWXA 1R3TA 1W56A 2FB2A 5IOBA 5D2YA 5CG7A 3T42A 2PA6A 3CB8A 3G0XA 1CIUA 3CNYA 4AFYA 3TXVA 1ZAJA 4FOJA 3FY1A 1UASA 1VLIA 4DAFA 3ZJ8A 1TVNA 2W5FA 2C16A 3FFSA 4WEVX 5H8UA 3OYZA 1PX8A 4XAFA 5A6LA 1UKQA 4CNNA 1C8VA 1UH3A 3DHUA 1W1PA 4DIAA 4F66A 4ZOCA 3GC5A 3C4UA 2GQAA 1SFJA 4W7VA 2V6AA 3QYQA 2I9EA 1UWRA 3BANA 2ZXAA 2WJEA 2OSYA 4W86A 4U28A 7ENLA 4IP7A 3T81A 2NXGA 3SDOA 1EP2A 1Z9AA 4REQB 4LPCA 4RK8A 3MDWA 4ERIA 2JALA 4O1BA 3IS4A 1UD4A 2P3EA 3EWCA 1DXIA 1HW6A 2Z2AA 1GZ1A 3I6TA 4HTYA 3CO4A 3CPUA 4AD3A 4DF1A 1H61A 1OJXA 2CZEA 1NAL1 4PMNA 4HN8A 3T9PA 4NI3A 4XB3A 5CZSA 4ADUA 2PPGA 4MADA 4ZVJA 1OFQA 1DE6A 2P10A 3V0TA 4FXJA 1F73A 4EPDC 2ATMA 3MJMA 3W7MA 3L23A 1WXYA 3GKFA 4MDPA 1XFBA 4A29A 4Q4PA 4DJFC 2ZC1A 3NZRA 4OUIA 4WY0A 4LBRA 5FEXA 4UMBA 4JKKA 3GU2A 3V1PA 3S8HA 3AHZA 2XINA 3VDBA 3W2MA 2QZRA 4F79A 3WMLA 4ATDA 2RGLA 4IJRA 4JQ2A 5TAOA 1Q6RA 4PEEA 3DX5A 5KTLA 1QO5A 3CYJA 4IMDA 3K5XA 5EGRA 4DELA 1H0IA 2GVLA 3SCTA 3B8IA 1AA1B 3PNZA 2Y0FA 3MVIA 4XTIA 3PB2A 4K3ZA 3S1GA 2YBUA 3L0KA 3AOFA 2EG6A 4AIEA 1NTHA 2XFFA 5LIUX 4WSHA 1JFXA 4JIQA 2G0WA 2R9RA 1CLKA 1KO0A 4Y9MA 1LYXA 1LL7A 3IPWA 3S6TA 3V36A 2JKPA 4MKVA 2IW0A 4E5TA 3B9OA 3OQEA 3KRUA 3WQEA 1EC9A 1EC8A 4MUPA 3TONA 3A47A 1BYDA 1VGAA 5CZTA 1W8SA 5FL0A 4J3XA 2A0NA 3UESA 1WOBA 3GZAA 2X16A 1XH0A 3M41A 1XLMA 2JF7A 2VI0A 4HYRA 1RA0A 5AHLA 3KRBA 4X9SA 1XYMA 3S46A 4B3ZA 2P5NA 3DN5A 3GFYA 4AQLA 2DDXA 3PUOA 2WOQA 3BMWA 4QJ3B 1OQFA 1RJPA 3CASA 5I6SA 1JYNA 4P2VA 4K2SA 4GE8A 4YTQA 4O13A 2CBIA 4OU1A 1H60A 1MO0A 3QW4B 5HR7A 3N9SA 2X0YA 4NY2A 1VRXA 3AISA 1HJQA 4J2PA 2EG7A 2G3IA 5EY5A 4PA8A 2ACSA 4H8UA 5EB8A 4I7WA 2GDQA 3RMEA 1U5HA 1PCKA 1GG0A 3R5EA 1UH2A 2XH7A 3SUTA 4YYCA 1PKLA 1W9PA 4G6CA 4J7RA 3S5OA 1XIDA 2GWGA 4ZO9A 4GO9A 3VKCA 5BXTA 1XBXA 2V5LA 1AG1O 3S2NA 3U9IA 1W5OA 3V0UA 4DZAA 2VWTA 3OPSA 1GW9A 3AHTA 3TJLA 1A5LC 2ZRUA 4JFWA 1J6OA 1XKJA 3KCOA 5I03A 1G5AA 4PUNA 4GYPC 2HQAA 1VHCA 1QBAA 1V3KA 3ABQA 1POKA 2FYMA 3WLNA 3B9DA 5AKQA 2AQWA 1O5QA 5ABHA 1BGAA 1SFLA 1PCWA 3UG3A 4LAUA 1F6PA 3AXMA 2C1IA 2WWDA 2E0PA 3MANA 1SQ7A 3MB9A 2W27A 5I24A 2PP1A 1UUQA 1GWJA 3NQFA 5D9PA 1REQB 3GH4A 3NYZA 2GGHA 5CBJA 4D6DA 1QI3A 2ZTJA 1SU5A 3TA9A 1MFUA 4KIRA 3WMBA 3GVWA 1W91A 3GAKA 4JTUA 4YLWA 3UR5A 3QM3A 2C7FA 2GZXA 4MWAA 3IJLA 2BP1A 2HK1A 4QGCA 4ICCX 1C90A 4U3AA 5HWJA 2WHJA 4US5D 1UJQA 1XC4A 3CU2A 1VIWA 3MBDA 2ZC8A 4B3KA 1QPOA 1SGJA 4QG9A 4JTDA 4IMFA 3SJNA 3CPGA 3W7RA 1A5SA 2ZRWA 4PUDA 1CECA 3AS3A 1V6TA 2PE4A 2Q09A 1MQRA 5AHFA 4LEFA 1QTWA 2GUUA 4IQLA 2CCRA 5HJXA 4XK2A 3PJXA 1GVEA 2Z1KA 1TJ0A 4FR6A 1AL8A 4ACZB 1U1UA 1J6PA 1UA3A 4FR1A 1Q7ZA 4PUEA 3WK0A 5AZ0A 2XVKA 4NAEB 1O1ZA 3WFLA 5K2ZA 1V3MA 3OHIA 1QATA 2J13A 4ENLA 3H54A 5FEPA 4HZ7A 2C13A 1Z42A 5HUPA 2ZUNA 4NAFB 3USZA 3VNLA 5DELA 6XIAA 3V5FA 3LPGA 1S5WA 2FZMA 2HVOA 3BOLA 1BVZA 3R1ZA 1BTCA 1WZLA 4BI7A 1CXIA 2J7EA 2PD5A 3E6EA 3WY1A 2PDBA 4G2DA 1DVJA 1W37A 4GABA 1J4EA 3ZSTA 1AJ0A 3VOJA 1BYBA 2C3ZA 1H09A 2ZX9A 1ITUA 2PDIA 1EJTC