4L4PA

The mutant(e139a) structure in complex with xylotriose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with xylotriose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4l4pA00
1V02E 1UQZA 4CVWA 1J0HA 1MW3A 3WFLA 1I1WA 3THDA 3ZSSA 1QI3A 4UR9A 1GJUA 2ZOXA 1CNVA 3ALFA 3DYMA 4ZE4A 2J7DA 5ABFA 5BXSA 5BXTA 2ZXDA 1NWUA 1KGWA 1Q6FA 3WQ4A 5HPOA 3LPGA 4GPNA 4TUFA 4TVDA 4HPGA 1W1VA 1XSIA 1QHPA 2Y2WA 4W84A 2D2OA 3OIHA 1PX4A 1MW2A 5A2CA 2O9PA 1UG6A 5GNXA 2RGMA 5A6AA 2WLZA 2WK2A 1XYFA 1B31A 1LF1A 2Z1SA 3M6DA 3TONA 3N04A 1UR2A 5AY7A 1HP4A 4UFKA 4AZ7A 2O9OA 3VGEA 4DUVA 1TFVA 1HVXA 4D6FA 2OSWA 1OB0A 4MPKA 2BY0A 1E5NA 3VIGA 5A2BA 2G41A 1NP0A 5DMYA 4MTVA 4LX4A 3O9NA 3FAWA 5E6YA 1EA9C 1US3A 3WDPP 2VOTA 3SCNA 3N9KA 4AD1A 4AZHA 3SEPA 3EDJA 1CGWA 4OBRA 4HPHA 1PJ9A 5A94A 1JYVA 3VILA 4M56A 2DIEA 2X05A 2QV4A 1L0PA 4ML4A 5I6SA 3AJ7A 1E4NA 4CD6A 3N17A 3N15A 2WLYA 4AMCA 3U7VA 4UFIA 3K8MA 1UWTA 4M8UA 3B9AA 2E9MA 1JXJA 2XJ7A 3BMVA 3RPMA 2ZXQA 3VKKA 4UTFA 3PZTA 3EDFA 5I79A 1K9FA 5DO8A 1E6PA 1ZB5A 3CZEA 4DUWA 4QLLA 4UQCA 3G6LA 3OGVA 3W29A 1EHAA 1EQPA 1J12A 4WJXA 3FAXA 3VNYA 1VB9A 4H7VA 2FGLA 5A8OA 1OD0A 3ZO9A 3UCQA 2IXUA 2OLHA 4M80A 1Y7VA 1PEZA 5FKYA 1H11A 1E3ZA 1E40A 1RP8A 4P8UA 3RILA 4D6IA 2WB5A 1CTNA 2X1IA 1EO5A 4OUEA 2WC3A 4NZCA 3CMJA 5CG0A 2VMFA 1XSJA 1UYQA 2XYLA 1SFSA 3AXHA 4J3UA 3WF3A 3N1AA 2A3EA 2E40A 5DT7A 2CCRA 2J7CA 3WBEA 4PMYA 1KCLA 2PB1A 3UESA 1G5AA 2XVPA 3DYOA 5I2UA 2XTKA 4XB3A 2OWCA 4MADA 4AZGA 3RO8A 1LL7A 5BYWA 1XCWA 3BLPX 4JL1A 2PWEA 2J25A 4B9ZA 4AWEA 2D0HA 3GH7A 1V3LA 4UQBA 4R27A 1Z32X 2E0PA 4JKKA 4OZOA 4JFWA 4JZ5A 3WNKA 1UR8A 1HJVA 1C93A 2FGZA 4P8XA 3EMZA 5BCAA 2XHYA 3OLDA 3DHPA 3S2CA 2G8ZA 4LQ1A 2WCSA 3WH6A 5C71A 5E0CA 2VRQA 2V5CA 4AD3A 1H09A 1R85A 4OKDA 1ISVA 1BGGA 3VDAA 2ZUWA 2J7GA 1GVYA 1KWKA 1NH6A 3WD2A 1DWFM 3ALGA 1WB0A 1WDPA 1B3WA 1CGUA 1V3IA 1NWTA 3AHXA 4H8UA 2CKRA 4U3CA 1KXVA 1VBUA 4P7RA 4U5KA 2VUYA 1GQLA 3CLWA 1JDAA 1CGYA 2EPKX 2ZX8A 6CGTA 4PMUA 1Q4NX 3IAPA 5D8WA 4F9DA 4ZFMA 2GK1B 1UR4A 1NP2A 2A3CA 4UQAA 1UA3A 1EDGA 1J0ZA 1XCXA 3MUIA 1UKQA 5LA2A 4D1IA 2NW0A 2VT0A 4YHEA 1UH4A 1ESWA 4XZBA 1BTCA 5FL1A 3NCOA 1QBAA 2BHZA 1X1NA 5CGMA 3RIKA 1W32A 4ZENA 1E0VA 1BF2A 3B9DA 3VGBA 4MAVA 1CPUA 4NSBA 1UR1A 4BA0A 2BHUA 3VMPA 4W87A 3TTQA 3AXIA 3WDRA 1P6WA 3GXDA 3AXXA 3K8LA 3W25A 5CPQA 1XH2A 5FIPA 2XIBA 5BROA 1BYAA 2YL8A 3W38A 3VIIA 4JFVA 1CXEA 4HOXA 1JZ6A 1E71M 2WBGA 1FHLA 1H1NA 1NWRA 1KQYA 3KEHA 3N13A 4V27A 2CETA 2DT3A 1EQCA 3BSGA 3WNOA 4E4PA 1E0WA 3W24A 4F9JA 3FHQA 2J8FA 2QLYA 3MS8A 3ZR5A 2G3NA 1W9VA 1JNEA 1TE1A 3VVGA 1HF6A 2WM0A 2WVUA 4D6HA 1B3ZA 2JALA 3POHA 2W66A 3GZAA 3WDJA 3F5LA 1E9LA 3WKZA 1AMYA 1UD6A 1UOKA 4GZEA 3AZRA 2ZUSA 3WNNA 1BHGA 1UUQA 1E3XA 1MQQA 2VR5A 2VZUA 3BMWA 5ECUA 3WD1A 4A3HA 4AIOA 1JAEA 8CGTA 1FHDA 3HMCA 2ZX9A 1CLVA 2XVKA 5I78A 1DEDA 2UY2A 2XIIA 4HU8A 1WCGA 1ZU8A 3FHAA 5E09A 1B9ZA 4GINA 3AZTA 1FP9A 5JBFA 3QOMA 2DIJA 5IHSA 4W93A 1WAWA 4AD2A 2YBUA 4AZCB 1OSEA 2DSWA 1E4IA 1W1PA 3SCRA 4M24A 1HKKA 2YL9A 4HZ8A 1CZ1A 3PZUA 3AI0A 2NT1A 2OWXA 4AW7A 4W89A 3FW6A 4J3WA 4AD5A 3PZMA 4W85A 5A6BD 4X0NA 3OLEA 1V0KA 4EE9A 4RE4A 3W81A 5BXRA 2D1ZA 3CUHA 1ODZA 2DEPA 2Y24A 2G4FA 1V02A 1WDSA 3GM8A 3NUKA 4HU0A 4OBSA 4J3TA 2V5DA 1MQRA 4L4OA 3L4ZA 2JE8A 2V3EA 3T0AA 2JEPA 2VX4A 3VGGA 4BCEA 1PX3A 1AQMA 1KGXA 3OG2A 2FHFA 5CZKA 2YBTA 1TMQA 1E5JA 1GVIA 1TUXA 3UERA 4D6GA 4R5EA 1LL6A 1JIBA 1JL8A 2J77A 1HJXA 1V03A 3VU2A 3WD4A 4NI3A 4PMOA 1TA3B 2EXOA 2DH2A 3W0KA 4PN2A 4JCMA 2WMHA 1M53A 2D24A 5BWFA 3WF2A 1J0IA 1R86A 3VINA 5M5DA 4W7UA 3VX1A 1ISWA 3GXMA 3VMNA 1GHRA 4GO9A 3WNPA 1QNPA 3K1DA 3KL5A 2ZIDA 4JL2A 5HBFA 2VTFA 2EO7A 3CHCA 3D5HA 1RH9A 4CD5A 2WCGA 2E8YA 5EFFA 5A6JA 2ZUVA 2VX6A 2CHNA 2J7FA 1V6VA 1XH1A 1JGIA 1UH2A 1BVNP 3L2MA 3BH4A 2WSKA 5FD0A 1QPKA 3T2PA 4PEEA 3A6OA 1B30A 4CCEA 1WNOA 4W5ZA 1WPCA 1V0MA 4TVCA 2WMKA 3BSHA 3VIPA 4CCDA 1CECA 1MXDA 2WHMA 2G3IA 2CKSA 4HTYA 1VFMA 5I24A 1H0IA 4J3XA 2XVNA 4NRRA 1GOOA 4EKJA 4Z2IA 2W91A 2VC9A 3WQ5A 3EBVA 3AMCA 3WMCA 2YIHA 2JF7A 3SURA 5I5RA 3AIVA 3TOPA 1VJZA 3UG3A 3AHZA 3CTTA 4JFUA 1VAHA 1WO2A 1GOMA 4KGLA 3W27A 5JIWA 5IDIA 1FH7A 1BYCA 1OWQA 3BCDA 3KL3A 4WK9A 4MJ4A 1AVAA 1VEMA 3ZJ6A 4C7DA 1KR0A 2OYLA 2E8ZA 4RE2A 1UWSA 4BZYA 4UZUA 1K9DA 1UH3A 2BY3A 4MNLA 3N18A 2VCBA 1E6ZA 2NSXA 5E9AA 3UEQA 2GK1A 5A6BA 3RM8A 1W91A 1H2JA 2DGAA 3W6LA 1MVYA 3TP4A 4QAWA 3MMWA 1VENA 1DTUA 3NSXA 3U57A 3AMDA 1OM0A 4IISA 1MW0A 1WP6A 1CXIA 5AYBA 1KXTA 5LA1A 4L4PA 5F7UA 1FH9A 3MV01 2V3FA 3AS3A 4GZJA 1H5VA 3D3AA 4AIEA 2BNJA 4PSRA 1QOXA 2HVMA 2B31A 4FK9A 2PBGA 1FFRA 3CUFA 3O2LA 1EIBA 1JI2A 3HJEA 2J7BA 4LYRA 1A47A 1ZS2A 1GJWA 3WUGA 1CGTA 4YHGA 1HKJA 3ARYA 3F5JA 2V3DA 4HOWA 3M7SA 2VI0A 3N12A 1PIGA 2VRJA 1CXFA 5CSUA 3VIJA 5JBDA 1ISXA 1JDCA 3AMKA 4CKQA 2GSJA 2J47A 3APGA 1KXQA 4JKMA 1EH9A 4CU6A 2CITA 4A3YA 1FFQA 1EDTA 4CU8A 3VD5A 4H2CA 3ARWA 2GUYA 1E6XM 2ZUUA 3WUEA 4E8CA 7TAAA 1G01A 4OOUA 1ISZA 1V0NA 2O92A 5A2AA 3QHOA 4D6DA 2O9RA 2GDVA 2GJPA 2XG9A 3ARXA 3OGSA 1BVZA 1WZAA 3MMDA 1E6RA 3OZOA 3NYDA 4PRWA 1E56A 3PZQA 2W92A 3GTNA 3MSGA 3WBAA 2YL6A 1I1XA 1TVNA 3CZGA 2ZXBA 4AEFA 3T2QA 2C7FA 4ZEPA 2XVGA 4QLKA 2YL5A 1J0YA 3RJYA 1F4AA 1NARA 3AYRA 3ZR6A 4B16A 2WNWA 1BGAA 2GFTA 1GCYA 2DPEA 4UQ9A 3WD3A 1DWGM 1BPLB 4AZCA 1NQ6A 3RMEA 3TTOA 3VGHA 4CN4A 1KFWA 3WUFA 4EANA 3W6MA 1W2PA 3BCFA 3FN9A 3FXYA 3QHNA 6A3HA 4JKLA 1AQ0A 5M3WA 1KR1A 1E72M 2VZOA 1R7OA 5C70A 5HXMA 5I3DA 3WQ8A 1PZ2A 2O9TA 3DC0A 2IXVA 3UR8A 5A6KA 1KWGA 2D23A 4AZ5A 3U7BA 1WZMA 5AC4A 1R7AA 1YQ2A 2QMJA 4F8XA 2WVSA 2PF0A 4MB4A 5A8PA 1JD7A 3A3HA 2X2YA 2CNCA 4D6JA 1DWJM 1PIFA 1US2A 4XV0A 3ZQ9A 1DWAM 1UD8A 2A3BA 3CZJA 3CUJA 1E6QM 3O6AA 5KZ6A 3PZVA 1EOMA 5D8ZA 3VIMA 3TA9A 1QHZA 4H41A 3BLKA 3T0BA 2D3NA 1E15A 3PZNA 2JF6A 3VIOA 5FCZA 1UHVA 2ZWZA 1E55A 4QFUA 3EMCA 1OT1A 4JIEA 1V3KA 3B9EA 3AHYA 5CLTA 1EO7A 1UKOA 1Q6DA 4B3KA 3ZT5A 1TA3A 1TCMA 1CEOA 2J7EA 2XWEA 4X0VA 1MFVA 2QPSA 5EFDA 1KXHA 3MUZ1 3CGTA 4CGTA 3RM4A 4CUCA 1NM9A 3VM5A 3KL0A 3J7HA 1QI4A 1UZ4A 5AYIA 1H0GA 2X0YA 3THCA 3WEMA 3MUAA 1CXHA 5BRPA 4AIUA 5CLWA 4CD7A 3OB8A 3VX0A 4CN1A 3QR3A 1UWQA 3ARRA 3ARZA 1OGSA 3VGFA 1HJQA 3VIFA 1VFFA 1WKYA 1XGZA 2BY1A 2WWDA 4HZ6A 3VDCA 1KCKA 1JI1A 4P8VA 3SIMA 1WDQA 3NIYA 1NWSA 3CBWA 1G94A 1C3FA 1MXGA 3AIEA 5A6LA 1VJSA 2CPUA 7A3HA 3SCUA 3UETA 4W7WA 2WVVA 3MSDA 3WFZA 4Q22A 4V2XA 1PPIA 4P7NA 3AIRA 3U5UA 5CPSA 4HA4A 3WF4A 3PTMA 1XSKA 2D3LA 1VBRA 3HN3A 4C7GA 1B90A 1J11A 4JCLA 1LWHA 4MB5A 1UQYA 2WYSA 4U2YA 2UY5A 1WE5A 1UR0A 2DDXA 4AISA 1EGZA 1J9YA 2WZEA 4FLOA 1OD8A 4BQ5A 2E9BA 4PTWA 1Q6EA 2E3ZA 3PZGA 4Z2KA 1GOQA 2WXDM 3IJ7A 4IUGA 5D9OA 1GQKA 2VCCA 3E1F1 1JF5A 5FL0A 5LA0A 3ZSTA 4AC1X 3AHVA 4J27A 1EOKA 3KE0A 2ZUNA 4PMZA 3GBDA 1W9BM 2JIEA 2EPOA 1L8NA 3W28A 2BY2A 1HJWA 2Q8XA 4UFMA 3UG5A 2YA1A 3PTKA 4PMRA 2JFEX 2XWDA 1NOWA 2GJXB 5IXEA 3WUBA 1WZLA 4B3LA 3GNRA 2W4XA 3VMOA 2OYKA 4KGJA 1SMAA 2XGIA 4TX6A 2CHOA 1ZBWA 2DQXA 2CXGA 2WW5A 1DWHM 4MNKA 5D9PA 2FH6A 4F79A 3AHTA 1HN1A 3CZKA 1GUVA 1HJSA 2TAAA 1FA2A 2YKKA 4ACYA 2J79A 2ZUTA 1Q6CA 3MUY1 1RPKA 3CHEA 5DEZA 3M46A 1MW1A 3VDHA 3LPOA 1IT0A 1R8LA 2BVDA 4ATLA 4D1JA 1E73M 4XX6A 1JYXA 1H4PA 4AYSA 2XFFA 3IJ9A 3ZJ7A 3RCNA 3VDBA 2XSAA 2Y8VA 3ECQA 3WELA 4K68A 3W4RA 4ACZB 1K9TA 1LG1A 4FLSA 5JBEA 1D7FA 3GH4A 2VCAA 3ZT6A 1S46A 2F2HA 4Z2HA 2PWFA 1VF8A 1UKSA 1H49A 3LPFA 1BSIA 1GORA 1HT6A 4GXPA 3WMSA 1BQCA 1XC6A 1F4HA 2UY4A 4MDPA 4Z2GA 4AZIA 2WHLA 4KMQA 1CDGA 1YHTA 3A4WA 3WEZA 1GOWA 2W61A 2W5FA 4KH2A 1JNDA 4Z2LA 1QNSA 4H8VA 1IZJA 2YDRA 3CUGA 4HA1A 1W9UA 2XGBA 2GVYA 1QI5A 5A8NA 3AIUA 2YA2A 3UR7A 2WSPA 3L4XA 1XYZA 2WWCA 1W2VA 1QW9A 1D2KA 1HL8A 1QI2A 5DFAA 1HKIA 4QCFA 4OOZA 3GBEA 3VD3A 1X6NA 1PX8A 4M81A 3IAQA 4B15A 2DSVA 4KRTA 4DUXA 1G0CA 3WIJA 3NJ3A 2VZTA 2YOCA 4PUEA 2A3HA 1HNYA 2YLAA 1TG7A 4D6CA 2X8RA 2OSYA 1EXPA 2WHJA 3VIKA 1IV8A 1U2YA 4AD4A 3S6TA 4GZIA 5IFPA 2BHYA 3ZMRA 4S3JA 3ZM8A 1TR1A 4WIWA 4AD0A 3WD0A 3ZOAA 4EAMA 2PI6A 3AOFA 7CGTA 4XZWA 1JZ8A 1ZBVA 5A6MA 4W88A 3W53A 3HU7A 3WDQA 3OA5A 5A1AA 1QBBA 4A4AA 4OJYA 1UD4A 3MU7A 3WQWA 2VNCA 4AEEA 1E1FA 3ZT7A 2PWGA 3QOKA 1BG4A 1GNXA 5ABHA 1A3HA 1ITCA 3WF1A 2D22A 4LXFA 2VJXA 4H8HA 2DSKA 3I3BA 2EPNA 1W9DM 1OIFA 3SCOA 1M04A 5D4YA 4UOJA 3WH8A 4U3AA 3L4UA 1JFHA 3CHDA 3AMGA 1DP0A 3VNZA 4W8BA 5DF0A 1XD0A 4CCCA 1B2YA 4UFHA 4P7QA 4CVUA 1C90A 1PAMA 1TZ7A 3M07A 3EMQA 4D71A 1B0IA 4J7RA 1JZ5A 1E43A 2WZHA 2QMKA 1ECEA 3CUIA 3BAXA 2X0HA 3N11A 1UWIA 5DT5A 4S3KA 2WC7A 4E2OA 1UZ1A 4WKAA 2QF8A 5IHRA 2Y8KA 4E8DA 1HL9A 1CBGA 2VVSA 1MQPA 1OCQA 4FMVA 4JFSA 1LG2A 3VGDA 2VZVA 1ODUA 1VFUA 1WDRA 1UKTA 4D72A 1UD2A 5IFTA 1W9PA 1GHSA 1V6XA 1V6WA 3VM7A 3CO4A 4WSJA 1QHOA 3CMGA 2CBIA 2WMIB 4UOQA 1W1YA 5EMYA 2J7HA 1W3KA 3U5YA 3NDZA 4GI9A 3WDIA 5GNYA 4PMVA 4UFLA 3RM9A 3AROA 2VVNA 1K9EA 3WDHA 1B1YA 3W26A 2CERA 3BAWA 4MB3A 3IJ8A 3K46A 4GQQA 4FLRA 2J8GA 5E70A 2E9LA 3WF0A 2PWHA 2ZUMA 3KWXA 1XV8A 2VX5A 3EDEA 2DT1A 3WL1A 2F61A 4DWSB 5E0FA 4ZXLA 4CD4A 5I0DA 1HKMA 5A8MA 3W82A 3AIWA 1SYTA 1OINA 3AFBA 1NOFA 1H41A 1OT2A 3GNOA 1W3JA 4P8WA 3UG4A 4WLCA 1JF6A 4JHZA 2AAAA 4JAWA 4ZE5A 2GJXA 3PBGA 1FH8A 1J18A 4PMXA 2PWDA 3AISA 5CSYA 1C92A 3SCTA 3VPLA 3WQVA 5M03A 2BFGA 3CIVA 4BF7A 4MJ2A 3VD7A 4J28A 1V08A 4Y7EA 1MFUA 1XD1A 1B3XA 1FOBA 1JDDA 4JHOA 3CZLA 3ZJKA 1QI0A 3SCWA 3NSMA 1M01A 1LJYA 2BXYA 2WMGA 1OGBA 4M29A 1QVBA 2ESCA 3EYPA 4QDMA 4AZ6A 1JZ4A 1ZBCA 4MDOA 4W7VA 2DT2A 1CXKA 2XM2A 1IZKA 3BAKA 5CJ5A 1HXJA 1V6YA 6TAAA 2JIWA 1KB3A 1VEOA 1E4LA 1JD9A 1W9XA 2HISA 2EPLX 4TX8A 1UR9A 1GQIA 4ACZA 1JZ3A 2WKLA 4XUYA 2J62A 2ZX7A 5LYRA 1KBKA 5EBAA 3PZ9A 2YJQA 4UCFA 2GJRA 2UWFA 2D0GA 3F4VA 1ISYA 1GZJA 2WMFA 1TVPA 5TD4A 4HA3A 4M82A 2VURA 5A69A 1CGXA 2OSXA 3T09A 1XH0A 3TTYA 4KRUA 3MMUA 1E6SM 5EB8A 2D20A 3WQ6A 1V6UA 1C8XA 4P7OA 4AXNA 1B3VA 3GH5A 2BS9A 1E4MM 1UWUA 2CEQA 2WMJA 1WZKA 2NT0A 1J0JA 4TOQA 3JUGA 4IPLA 4DWSC 1BAGA 2VQUA 3IANA 3SCVA 4TVUA 1C91A 1W3LA 4U33A 2Y4SA 2AOSA 3L4VA 1J10A 4EK7A 2G3JA 1CYGA 1JFXA 2RGLA 3K8KA 4V28A 4GQRA 3VD9A 4PMDA 1JYNA 1HIZA 2PC8A 4WF7A 1KGUA 4Z2JA 1V3MA 1E0XA 1ITXA 5E6ZA 1RP9A 4DWSD 4QCEA 2CBVA 5GQBA 5A6SA 4HP5A 1NOUA 4W8LA 3ARQA 2WCAA 4U31A 4GI6A 4UQEA 1PZ3A 1H3GA 5GPRA 3VOCA 5HOSA 3DYPA 2ZX6A 1ZBKA 4CD8A 5KEZA 1R87A 4PBGA 3SUTA 4LYPA 1E1EA 2BVTA 1XHGA 5CGTA 2WPGA 4BS0A 4AZBA 4WSKA 1BFNA 2YDQA 3NDYA 2BVYA 1JYWA 2ZXAA 2J4GA 1C8QA 4JFTA 3L4YA 3OBAA 3GNPA 4BQ3A 1PBGA 1MWOA 1O6IA 1Q6GA 1KQZA 1E6NA 2Z1KA 2J75A 2WZIA 2EBNA 4URIA 4DM2A 4UOZA 1RD6A 1W3HA 1G9HA 4W5UA 2X09A 2C0HA 3MV11 4HZ7A 3GYCA 2WHKA 1EHNA 3BAJA 2CYGA 5HDRA 3DECA 4GIAA 3VO0A 3GDBA 4BQ2A 1UWRA 4RE3A 4GKLA 5ABFB 2V38A 5HNNA 2BXZA 1JAKA 1SR0A 1CLXA 1X6LA 3ARPA 4PYSA 1CIUA 3SCSA 3VTRA 1C7TA 3L2LA 4MNJA 5JIPA 3AIQA 3FY1A 4UQDA 4Q7NA 3PN8A 3AS1A 2W67A 1QW8A 2UY3A 1W1TA 3K4AA 1KBBA 3W37A 2OWWA 2J74A 1DHKA 2WAGA 3KZSA 1J01A 2WANA 1LWJA 3I3DA 3AS0A 5A3HA 2XFYA 2ZWYA 3WH5A 3WMBA 3PTQA 4IPNB 1CXLA 2YA0A 1GW1A 2VZSA 5M17A 3SCQA 3SCPA 1M03A 1HVQA 3L4WA 4PCTA 4HOZA 9CGTA 3EDDA 3I3EA 2WMIA 4AY1A 3AIBA 2CBUA 4LPCA 3G6MA 4YN5A 1LLOA 4H04A 3PZIA 2WVTA 5A8QA 2Y5EA 4MAZA 1V3JA 4PTVA 1C7SA 1SMDA 4OIFA 1VEPA 3B8SA 1B3YA 3F5KA 2WC4A 1OBAA 2QHAA 5I23A 1LQ0A 4LGXA 1JXKA 3SUSA 4ZXOA 3MKKA 1GOKA 2VX7A 2XPKA 3GXFA 2CESA 5CPTA 2XM1A 5ABEA 3BAYA 4ATDA 3ARSA 2PBOA 1C8YA 4FF5A 4GO8A 3AZSA 1ZJBA 4DWSA 1HX0A 4FLQA 4PCSA 2FHCA 3T2OA 2EPMX 1UD5A 1VFOA 3ARVA 3WH7A 2J78A 4M1RA 4UFJA 1E70M 5BRQA 4PTMA 5FOOA 3WY1A 3K4DA 2VQTA 3ARUA 4TXEA 4ATWA 2C8NA 4PUDA 3WH9A 1XRVA 1JZ7A 3EDKA 1BLIA 4LYQA 1BYDA 3A4XA 2WKGA 2MANA 3WSUA 1ZL1A 4PMNA 4KWUA 4B9YA 4YPJA 4W86A 2XSBA 4TTGA 3BXWA 1OGGA 1MYRA 1QNOA 3LPPA 2OYMA 3AQUA 3LMYA 2IUZA 1N82A 3ARTA 1V3HA 4N42A 2YDSA 4HMCA 4WKHA 5CXPA 3VD4A 4X9YA 2V3GA 4CN6A 1I75A 1DWIM 2XVLA 1QNRA 3ZIZA 3VUPA 1UKPA 3OLIA 1G1YA 2XFRA 3L4TA 2FDMA 3WL0A 3CH9A 4P7LA 8A3HA 3WNLA 1FP8A 3POCA 4MNMA 3VIHA 2EQDA 2DSZA 3RJXA 2JEQA 5A95A 5BXPA 1CGVA 1OIMA 2DH3A 3GXIA 4GI8A 3AYSA 5CQ1A 2WBKA 2EJ1A 1VRXA 1UA7A 4IM4A 2QPUA 3WENA 2E4TA 3T08A 3ZJ8A 2G3MA 4PTXA 2DT0A 1J0KA 1HJUA 1M7XA 1BYBA 2FHBA 3NSNA 2AMGA 2BV9A 5C8BB 2A3AA 1K6AA 3CHFA 3SUWA 1AQHA 1GQJA 3OLGA 3PHAA 4CU7A 3WEOA 2XUCA 3CZ8A 4PMQA 4BQ4A 3BGAA 3WN6A 1JZ2A 2WVVB 5JUVA 3DHUA 1JG9A 3OZPA 3SUUA 1QNQA 3CPUA 5D9NA 3MANA 1GONA 3BC9A 4MB1A 1D3CA 4HMEA 4N0RA 5AC5A 2ZICA 1UD3A 2ZX5A 1ZJAA 4DM1A 4WKFA 5HPCA 2FH8A 5D9MA 3A47A 2D0FA 1U30A 1GOIA 4J3SA 1O7AA 3OGRA 4C7FA 2VL4A 4U2ZA 2VO5A 1GPFA 2W62A 2YLLA 4J3VA 4PSPA 5I77A 2GDUA 3QHMA 2DSUA 3T0DA 4D6EA 3A4AA 4NF7A 1LL4A 2CBJA 3FNDA 4NRSA 3II1A 4U5IA 3WNMA 1U33A 2CIPA 1HP5A 3AS2A 1CWYA 1VIWA 5GNZA 4HMDA 5ABGA 4RL3A 4UZSA 2W63A 4W8AA 2F8QA 3IK2A 1BG9A 3AMLA 4QP0A 4TTUA 3TTSA 2VR4A 2EEXA 3BAIA 2ZE0A 3MO4A 4F66A 3AICA 3SUVA 3PZOA 4UNIA 1V0LA 2VRKA 4QLJA 3QGVA 3RDKA 1CENA 1EDQA
chains in the Genus database with same CATH superfamily
3LLXA 1VQTA 3QZEA 3O07A 4CVWA 1J0HA 1QDSA 2E28A 3QLLA 1L6YA 5E9XA 2ZOXA 5HQMA 3MC5A 3ENLA 3UA3A 1MNSA 2NWSA 3QV9A 1TPDA 1NWUA 3BOXA 3WQ4A 3NOYA 1AW1A 4GPNA 4TVDA 1L8PA 3UW6A 4W84A 2D2OA 1IEIA 1MW2A 3I65A 5F2GA 3OJGA 1UG6A 1Z7AA 2BDQA 4NXKA 2PDCA 3EX4A 5A6AA 3EXRA 2OT1A 1D8WA 3VZXA 2Z1SA 3TONA 3S1WA 3LBOA 3N04A 1UR2A 4Z42C 4ZB5A 1HP4A 1DJGA 4BHYA 1WQ5A 2OSWA 3VIGA 3CAQA 2ZZ3A 1G4TA 1ZP4A 2OCZA 5E6YA 1DXFA 2REQA 3SEPA 2ACUA 5A94A 1T96A 4ML4A 3RLVA 3N17A 4O28A 7REQB 3DFPA 3B9AA 1TR9A 1JXJA 5K9DA 3LHUA 4B90A 1R2RA 1OCNA 3RPDA 5D2TA 3PZTA 1QCWA 1K9FA 3LGDA 4GYPC 5DO8A 7PTDA 1E6PA 3CZEA 2C3ZA 4QLLA 4UQCA 3OGVA 3HG4A 4EXBA 1EHAA 3FFSA 4GNVA 1JCXA 4WJXA 1MMFA 1VB9A 5D2XA 4E6MA 3B3DA 3UJFA 5A8OA 1OD0A 3S3GA 2O56A 4EF9A 2I5GA 2HSAA 4LVDA 1X96A 1YDVA 4AFYA 2IS7A 3QN3A 4P8UA 2X1UA 5C54A 3M0IA 3WQDA 1CTNA 3LM3A 3S9YA 2DZXA 4ADSA 5D30A 3UPWA 5DX7A 3GTHA 4GCAA 4OUEA 2WNZA 2ZE3A 4NZCA 3E2SA 2VMFA 3GFZA 3O8AA 2H3BA 2XYLA 3PWGA 2NVDA 3NGFA 3WF3A 1OFOA 3WFAA 3IVSA 4M6UA 3N1AA 2A3EA 3U8GA 5DT7A 3VOHA 4LOCA 1JDFA 3GG0A 3GDLA 5FEPA 2F38A 5I2UA 2OWCA 2O7SA 3BLPX 3M0VA 2PWEA 4DEFA 1QJWA 4WHBA 1TV4A 4O54A 4Q4PA 4LTSA 3KDNA 4UQBA 3M41A 1MI3A 4C6DA 4KWVA 2E0PA 1WYIA 3AWOA 3F7JA 3OG3A 1C93A 2FGZA 4P8XA 5T26A 2E5CA 3QRHA 3NPUA 2YXXA 4H9VA 3WH6A 2HQAA 5E0CA 2VRQA 2V5CA 4AD3A 1A50A 1R85A 1ISVA 1CLKA 3PR2A 1TPEA 3D3FA 1O1HA 3WD2A 1LUCB 1CGUA 3B05A 2XISA 5D09A 2V8ZA 3M5XA 2BSLA 4U5KA 2W0UA 1GQLA 3NQEA 1Q8AA 5C9ZA 3TSBA 1CGYA 2EPKX 2VDGA 2ZX8A 2UV8G 1W5PA 4K7VA 4Y9PA 1DJHA 4ZFMA 1F3EA 4O13A 2DJLA 2A3CA 3B8IA 1D3GA 2F6UA 1K03A 3EKLA 1IIGA 2PEVA 1EGVA 3SO7A 5LA2A 4D1IA 2BXVA 4JYDA 4YHEA 5C2XA 1T8XA 4HU4A 2DORA 1ESWA 2EAWA 4GI4A 3NCOA 2PP1A 4RZ6A 2BHZA 2OEMA 1X1NA 2AL2A 4ZQMA 3XISA 1ZJIA 3EB2A 1W32A 1A4MA 2XIJA 1VCGA 4CNUA 2HMCA 3Q4DA 1XDMA 3KBJA 3AXXA 1FWEC 3W25A 1XBZA 3WLHA 5CPQA 5FIPA 1BYAA 4QNWA 2OTDA 4IIGA 4A29A 3IJQA 4HOXA 1JZ6A 3ANVA 1KQYA 1KCXA 3KEHA 3UZWA 3B06A 4PBFA 4V27A 2DT3A 3QR1A 4Y9OA 3WNOA 5FEWA 1P48A 4LUTA 4JTFA 2NX9A 3PUDA 3FHQA 3TYDA 1W9VA 4EIVA 7ODCA 2WM0A 4LVBA 3K30A 2JALA 1K70A 2DZUA 3POHA 1E9LA 1AMYA 3CTLA 1UOKA 3S5ZA 3WNNA 1N2VA 2NV1A 5ECUA 1AD1A 3ABSA 4AIOA 2ZZ7A 3KTXA 1TPH1 4QG6A 2R1PA 1FWWA 4DO4A 3WLKX 1WCGA 1B9ZA 4IL2A 4GINA 3WMLA 1FP9A 2Q02A 1F76A 1JVNA 4YLWA 4MGGA 4GX9A 3W1QA 1OSEA 1V7YA 3VNJA 1PYMA 4H9UA 5B7YA 3P8IA 4Q8MA 1EZWA 4X3ZA 1HKKA 4LRSA 2YL9A 2NUYA 1LBLA 3IUIA 3GKFA 3FW6A 4PFHA 4NVTA 4IG2A 1QPQA 3PZMA 2Z2UA 2XH0A 1WXYA 3P93A 1KM5A 2ACQA 3EA3A 1ELSA 3NQDA 2PGWA 4JTJA 8XIMA 4RCXA 4NNCA 2D1ZA 2E5BA 4O10A 1R38A 2Y24A 1V02A 1WDSA 4HU0A 4ZO7A 1V4YA 3GC2A 1XIGA 2V5DA 2Y63A 1ONWA 3MY9A 2JE8A 2V3EA 4XZHA 2ZRYA 3BV7A 3O1NA 1AQMA 3FVMA 5CZSA 3I6RA 2VDHA 2YCKX 1TMQA 1E5JA 4BEQA 1L6FA 1OJXA 3P7YA 1AZ2A 1LL6A 4FB7A 1UP2A 1HJXA 2YSWA 3BPWA 3VU2A 4H9YA 4YU1A 4UTHA 3BDKA 4KWWA 1T41A 4F40A 4NI3A 1Q7QA 2EXOA 3RU8X 4QM1A 2P76A 4PN2A 4JCMA 3WBXA 2H9AB 1RBOB 1J0IA 5LNSA 1XRFA 3PM6A 3VINA 3U4AA 5M5DA 1KNWA 2YCLB 2NX1A 5J5RA 3BUVA 3WNPA 4O1AA 3E5BA 3F4NA 2VGGA 3D5HA 1TWIA 1RH9A 3E12A 4CD5A 5EFFA 1XIIA 3UZJA 4E2BA 1BVNP 1F3WA 3T2PA 4PEEA 3A6OA 2IW0A 3ITVA 1V0MA 3L0KA 3ABOA 2Y7GA 3DBNA 1JUKA 1TV5A 2CKSA 2WJFA 4HTYA 3V16A 2XVNA 1TUFA 2W91A 2VC9A 3F03K 1S2TA 2B7NA 3EBVA 3AMCA 3ITXA 3WMCA 2YIHA 3SURA 4LNCA 2Y6ZA 3CPGA 3OYZA 3TOPA 3UG3A 1OF8A 1K6WA 4A2RA 4FPSA 1WO2A 2OG9A 3PPHA 4KGLA 1U1JA 3W27A 5JIWA 3BCDA 3UXAA 1SJDA 3LGEA 1UROA 4MJ4A 2FJUB 1AVAA 4RNHA 5CPLA 1EJXC 1V77A 3HB9A 2OYLA 1UWSA 3G77A 4UZUA 1GYMA 2BY3A 1ZLPA 4LS1A 3N18A 4YTRA 4GH1A 2VCBA 1K3UA 3LK6A 3FYYA 4UNLA 2NSXA 1EJSC 5A6BA 2P53A 5DRIA 1O66A 3EOEA 4E38A 1MVYA 3OZMA 3S0CA 3RX3A 4L4MA 3QKEA 3RLUA 3MMWA 1DTUA 3HURA 3F1QA 3U57A 1OM0A 4C1NB 5AYBA 5CC7A 3KBSA 1FH9A 3C3UA 3TJIA 2C79A 2B31A 3W1MA 1PKYA 3CUFA 3HJEA 4HNOA 2J7BA 4LYRA 5E5CA 1RZMA 3QTGA 5U7SA 5LXEA 4O11A 3PK7A 2XDFA 5L9FA 1HKJA 2J66A 3M7SA 2VI0A 1PIGA 3FJ6A 1OFPA 1ISXA 2OZ8A 2OJPA 1BRLA 1VFTA 2V2HA 4IIBA 1ZP3A 4NNAA 4GYJA 4JTDA 3FKKA 3NL3A 4E8CA 5LNVA 3WBYA 4RXFA 3U3HA 1V0NA 3A23A 2VFGA 5A2AA 1KFBA 1SM9A 3CV1A 5CZTA 4KWSA 4ICCX 1OG0A 3LEPA 1Z48A 2FZBA 1BVZA 5PTDA 1E6RA 3TJLA 3P5YA 1SU5A 3WBAA 1TVNA 3W7GA 3W23A 2YL5A 1J0YA 3P0WA 3ERPA 3MQTA 1F4AA 1NARA 4GISA 1GCYA 4FA3A 2RJHA 4PCNA 3WD3A 4N7QA 3GS6A 1ECQA 1ZCOA 3JZUA 3TTOA 3VGHA 1K8XA 2DZTA 4K2SA 1KV8A 3FXYA 3LHZA 6A3HA 3QY8A 1AQ0A 3MUXA 3R58A 3Q65A 1AUSL 1F8IA 3TW7A 2O9TA 1KWGA 3IIXA 1W56A 1SSDA 3SN0A 3U7BA 3UD6A 1R7AA 4Z17A 4MB4A 2BMBA 4JEJA 5XIAA 2Y62A 3VA8A 2CNCA 2XFWA 3GXPA 1DWJM 1PIFA 1US2A 3H7UA 3P61A 5H91A 4JS3A 1DJNA 1QWKA 3SRHA 3PWIA 3M5YA 2HS8A 2KX9A 3PZVA 1AZ1A 3LXAA 3QEZA 1W3IA 5I3IA 3BLKA 3CQKA 4ECLA 2GVLA 3T0BA 2CLPA 5F4XA 2JF6A 5FCZA 3P84A 2PCEA 3DERA 4UXDA 1XPYA 1FQ0A 4QFUA 3EMCA 3TC3A 1HGYA 5CLTA 3THQA 1UKOA 3DKJA 4DPPA 2YX0A 4Y9AA 4F0RA 2YR1A 2J7EA 2XWEA 1MFVA 4C6FA 2DIKA 1VH7A 4CCZA 3NQFA 3MUZ1 4CUCA 1NM9A 1WA3A 2CLEA 5F2LA 1ZPTA 1TPFA 3KL0A 4I7UA 3THCA 3WEMA 3HM7A 3KVKA 3UWVA 5BRPA 4AIUA 5CLWA 1DKWA 3ARRA 5LKYA 3E3HA 4IMDA 3XINA 3VIFA 3NEVA 2RDWA 2PLKA 1KCKA 1WDQA 1NWSA 4MM1A 3GNDA 1VJSA 2CPUA 3MP4A 7A3HA 1IWAA 4W7WA 2ZZ6A 4Q22A 4CQDA 1FWIC 3AALA 5CPSA 3QF0A 3WF4A 3UU0A 1P7TB 1FY6A 3R5EA 4E0CA 1FWNA 3T40A 4PRTA 3SR7A 1UQYA 3KVMA 2Y61A 3QM3A 1UR0A 2HCVA 4Z1DA 1NIUA 4MFEA 4FLOA 1OD8A 3EX2A 3H6OA 2WXDM 1PYFA 1FCQA 3VNIA 4H01A 3LHTA 5D9OA 2VCCA 4INFA 4DXXA 1RJRA 3AHVA 4J27A 1CI1A 1BXCA 3B9NA 1LDCA 3GBDA 2JIEA 4L65A 2BY2A 2ZDSA 2Q8XA 4UFMA 4WD0A 3UG5A 2YA1A 4LUJA 1JCJA 5AC6A 1NOWA 2GJXB 1Z6KA 3EWUA 4H1ZA 3TKFA 4DXVA 2PFHA 2W4XA 4ZR8A 9XIAA 2OYKA 3MJMA 2BG5A 1P1XA 1SMAA 3M9YA 2CXGA 4MY9A 4C5YA 3CAKA 3QXBA 3TYZA 3LYEA 2TAAA 2YKKA 4ACYA 4QX4A 2Q8LA 1Q6CA 5DEZA 4DJDD 4IL0A 4PUJA 2PDLA 1GT8A 3T05A 1LT8A 2ZZ1A 4XX6A 1PL9A 4AYSA 3WELA 3CK5A 1OYCA 2BLEA 1WDWA 4I8YA 1M7JA 2VCAA 4JQAA 1THFD 1H49A 2YPIA 2R1MA 4S2CA 1BSIA 1H1ZA 4DAFA 3KM8A 1F05A 3N3MA 3W2MA 3SFWA 3NQ2A 1FWAC 2YW3A 1YHTA 1TPUA 2W61A 2W5FA 4CQCA 2FLIA 1JNDA 4L9XA 2XGBA 1Q85A 3P67A 2GVYA 5A8NA 4JHMA 3QYSA 3V0TA 1LBFA 2WSPA 2YZRA 1I4NA 2WWCA 3UR2A 1WDDA 5HNUA 3EOLA 1J5TA 1KW1A 2VKZG 1HKIA 3KCJA 4OOZA 4DBUA 3LNPA 3DG7A 5T9CE 2QVHA 3TH6A 1TE6A 3RF9A 3T6CA 3WIJA 3HGJA 4FNSA 3DI1A 4JQ4A 1N55A 4O18A 3EZ4A 1LORA 3UBPC 3FIGA 1Q8JA 2WHJA 3VIKA 4XZLX 3TR9A 3OP2A 4KS0A 3S6TA 3VC5A 5IFPA 2BHYA 1OX4B 4WIWA 1ONXA 4EXAA 4EAMA 3AOFA 7CGTA 1JZ8A 4HBKA 1KA9F 2PUZA 3QQWA 2V9DA 3GVGA 4W88A 4PULA 4FHAA 4OE7A 3OA5A 1QBBA 2V5KA 5CC5A 2R6OA 4AH7A 3CYJA 4OJYA 1UD4A 1EL3A 1E1FA 4MHBA 3WLNA 3H2CA 3ZT7A 1BG4A 3DHFA 5DY3A 3W86A 1ITCA 3WLSA 1UASA 2OO0A 2H8ZA 1FWRA 2YYTA 2ZQ0A 3P60A 1W9DM 3L65A 2Z2BA 5D4YA 1L2UA 1NDYA 4UOJA 3L4UA 1JFHA 3CHDA 3VNZA 4KIEA 1XD0A 4CCCA 3W7EA 1XINA 2V68A 2NSOA 1HTIA 2P8CA 3C2OA 1VFLA 1TZ7A 2BP1A 4IOTA 4RX0A 3MYPA 4J7RA 1GPWA 2WZHA 3CUIA 3N11A 3BG3A 3GDKA 4DLFA 4S3KA 5KZMA 5FF2A 3UVIA 1VYPX 4GQBA 4WKAA 1WOAA 2Y8KA 4GJIA 1CBGA 3TWBA 1OCQA 4JTTA 1KRBC 4QQ3A 3PJTA 1Q4WA 1VFUA 3F4CA 1UKTA 5CAHA 4Q32A 4KCVA 4AX6A 2YBVA 3OVRA 1V6XA 3DHDA 3CO4A 4FAMA 5REQA 3CMGA 4GH3A 2PDUA 4UOQA 5EMYA 1SJAA 1FDJA 4O16A 3U5YA 3R4IA 4LALA 3WDIA 4IJBA 4PMVA 1TMHA 3AROA 1K9EA 3QVQA 4PCFA 3BAWA 2OEKA 3K46A 4GQQA 4KEVA 4L80A 4ZZ9A 4FNPA 2E9LA 2ZUMA 1X7FA 3EDEA 4MWAE 4WX2A 4KKXA 4CEXC 2V6AA 4CD4A 5I0DA 1J4EA 4GACA 4U10A 4RZBA 1W3JA 3DDMA 3UG4A 1JF6A 2AAAA 5DY2A 4Q4SA 4C6MA 4PMXA 3PBGA 4LUSA 1KRMA 4B5TA 3EOOA 2CC0A 4PTDA 3KP1A 3TN6A 2FTPA 4IJRA 3CIVA 5DN1A 4J28A 2VFIA 3AUJA 1S2WA 4Y7EA 1IGWA 1MFUA 1XD1A 2UZ9A 2BOFX 3PAOA 3SCWA 1O68A 1OGBA 1RY0A 1QK0A 3EYPA 1TWZA 4PL2A 1H51A 1ICPA 3S46A 3FSTA 1CXKA 1F3TA 4X2RA 3BAKA 3WLLA 3TTEA 3CQ0A 5MKGA 3W71A 5CJ5A 1HXJA 1QPOA 4KEMA 3GC4A 4F0KA 1JD9A 1NFBA 1W9XA 1FBAA 1UR9A 3V7PA 1H50A 3W1AA 3LQLA 1ZTVA 1XWYA 4ACZA 4JYEA 4C6CA 4F3HA 2FQIA 3VKAA 1XR2A 3G1RA 2ZX7A 3L7RA 3VFLA 3JS3A 5A69A 1CGXA 3GFXA 3T09A 3NURA 5AHFA 3MMUA 3UWZA 5EB8A 1PV8A 1NDZA 3GH5A 3XIMA 2NV9A 2BS9A 5EMKA 4HTBA 3VCCA 1ZHAA 3R6IA 1UWUA 4XVDA 3EKZA 3SZ8A 2CEQA 1VHCA 3TA6A 3VNKA 1J0JA 2OEJA 1A5SA 2VC6A 4JDBA 4TVUA 1C91A 1W3LA 3VE7A 2D2GA 5LIWX 4D9PA 4FNTA 4OQVA 3L4VA 2PRMA 2G3JA 1CYGA 1JFXA 2A7PA 1ZAJA 4TR9A 3AYVA 4GQRA 3TYAA 5J04A 3I4KA 3TZFA 4C6OA 4Z2JA 1EX1A 3PSVA 3KCLA 1NFGA 1RY8A 1TSIA 4AHQA 4Q8TA 2PZNA 4M5PA 4GQGA 4K8GA 3ARQA 4O52A 4GI6A 2WJEA 3VOCA 3DYPA 3JZEA 2ZX6A 4KPLA 1XC4A 3E0WA 3WJWA 3TZNA 1DORA 3T07A 1O4UA 1MXSA 4BS0A 4WSKA 1F73A 3PC0A 4GOAA 2Q3RA 1JYWA 1C8QA 4AEOA 2G5WA 3ITTA 4BQ3A 1PDZA 1KFKA 1QRQA 3KLKA 1FWFC 3YPIA 2WZIA 2EBNA 4JIIX 4URIA 4AU0A 4UOZA 1Q6QA 4MLJA 4GCXA 2X09A 3KHJA 1Z42A 2SFPA 1XYLA 2CYGA 5HDRA 3OO2A 2GGHA 4D8LA 1ENUA 2FVLA 3HG5A 4RE3A 2V38A 5I3JA 4YTUA 3V0UA 4QG9A 3ARPA 4PYSA 4IJCA 1C7TA 3L2LA 3P14A 1Q66A 3FY1A 4UQDA 1X8CA 2GJNA 2W67A 2QGHA 2PDKA 2UY3A 3GVWA 4ZODA 1W1TA 3UCCA 3VCNA 3KWSA 1KBBA 3P5ZA 3NO5A 3FGCB 4YCPA 3C6CA 1FCBA 4LB3A 4CQAA 3LI0A 3WYZA 1TB3A 4NIRA 1LWJA 3I3DA 3S1UA 1ZENA 4A8RA 5A3HA 5IM51 1ZY9A 3WH5A 3WMBA 1HGWA 4C1NA 4QR6A 2V69A 3ITGA 5K2ZA 2VZSA 5M17A 1TO3A 1DHPA 4GK8A 3SCPA 2XU2A 1M03A 5F2MA 4HOZA 3EDDA 5D38A 1XLBA 2OGJA 1XYBA 5ECVA 2WVTA 1TIMA 1R2SA 2Y5EA 1B3YA 4PUKA 5J8LA 4DZAA 2D2JA 1I8JA 1LQ0A 4AF0A 2HPIA 1UIPA 2P8BA 4ZXOA 3TQKA 1H62A 2VX7A 4ZQNA 2Z26A 3NGJA 2XM1A 3BAYA 4HN4A 4JNYA 4FF5A 3APTA 3AZSA 1UJPA 3BICA 2PGRA 3QW3A 2HDJA 4Z0SA 3T2OA 4EACA 2AGTA 3NXLA 3SY5A 4V33A 3B8TA 1UD5A 4GFIA 2E6FA 3IGSA 4QRNA 4UFJA 1E70M 2BGQA 3E9AA 2HV5A 1NDVA 4PTMA 5HK4A 5AHLA 1Y0EA 3NQ6A 4JIRA 2VQTA 1FWSA 1RLDA 3ABRA 4H6QA 4A2SA 1I9CB 3WH9A 3EDKA 3W7LA 2NLIA 3A4XA 1WKDA 1QK2A 4IQEA 4OGZA 1N7KA 3SBFA 4PMNA 3HOJA 4KWUA 2PLMA 5AN7A 1SW0A 4TTGA 3KVJA 3BXWA 4E2DA 2UBPC 3L68A 2B81A 1I6NA 3LMYA 3KOFA 1NFPA 2R1NA 1N82A 3ARTA 1OFRA 4AMAA 5HR6A 3OZYA 1V3HA 4IHCA 4CN6A 4B2DD 5AOUA 3TLQA 2PDPA 2Y7FA 3OLIA 5DMNA 2O4MA 1DQXA 1CX9A 4NZ4A 3W7JA 3GK0A 3WNLA 3POCA 4MNMA 3VIHA 2EQDA 3BARA 2GSEA 2F7FA 5BXPA 1CGVA 1WKEA 3BJFA 5LGXA 4P61A 1DJIA 2GQ8A 1RA5A 5BNKA 1AL7A 1E0UA 2QPUA 3ZJ8A 1KD0A 1W6TA 3OOQA 2Z1BA 3LZ3A 4XZ9A 1BYBA 2BV9A 3HQPA 5TIMA 2A3AA 4YCOA 1R3VA 3BK0A 4J4KA 3OLGA 2XUCA 3CZ8A 4PMQA 1MDRA 1EF2A 4XO7A 1O5RA 4K8EA 1UJQA 1JG9A 5D9NA 4PGLA 1GONA 4MB1A 4N0RA 5AC5A 2ZICA 5BU6A 2ZX5A 2FMOA 4H3DA 4L1WA 2PDFA 1U30A 3QMTA 1MEIA 1GOIA 1O7AA 1WX0A 4J3SA 2VL4A 4U2ZA 3S2NA 4HCLA 4US5A 3W73A 3W7QA 3VFCA 4NF7A 3SSZA 3UF9A 4U5IA 2ISWA 3HFYA 4DAIA 4EF8A 3CIWA 3CWHA 2VFEA 1B5TA 4LRTA 3NVTA 3C8FA 3QPZA 3HF3A 4MVAA 4LVAA 3AMLA 2X16A 3KHDA 1UZDA 2ZA3A 3BTNA 5C9WA 1N8FA 4UMCA 1CENA 3FK4A 3GSMA 1V02E 4QEHA 3E74A 3O6YX 1MW3A 3WFLA 1I1WA 3THDA 1DE6A 4XO6A 1QI3A 4JN7A 4UR9A 4GIYA 4ZE4A 1CNVA 4DB7A 2ZXDA 4JOMA 1Q6FA 4RXGA 1XLAA 3LPGA 1RBLA 1A5CA 1XSIA 3NQGA 4XBJA 5LIKX 4UNKA 2VOMA 2ATSA 5HWJA 5A2CA 2PWVA 2YCJA 3S4TA 3NVDA 2GWGA 3UGVA 2WLZA 5JH1A 3EPMA 2WK2A 3R89A 1LF1A 3UZZA 1O1ZA 4IIDA 4S3DA 1RV8A 5AY7A 4UFKA 4AZ7A 5DLCA 4QJ4B 4A3UA 4D6FA 3GO2A 3H2NA 4ADTA 2BY0A 2Q01A 5A2BA 2Y89A 4NYUA 4C5ZA 5DMYA 3O9NA 1HKWA 3FAWA 2DY3A 5H8PA 1TWDA 4PR4A 2VOTA 1R30A 3N9KA 3EDJA 2DIEA 3DUGA 1L0PA 4RPQA 3HPFA 3CS2A 1E4NA 3R2GA 4CD6A 3A3WA 3N15A 1YDYA 3BW3A 4HHMA 2QCCA 1A49A 4DZHA 4M8UA 4LVGA 4B5SA 3CNYA 2E9MA 3GY1A 4M51A 3NPXA 1FWGC 3BMVA 3EWCA 2ZXQA 1A4LA 1X1ZA 4UTFA 1XLLA 2VEKA 1RJQA 1ZB5A 4DUWA 4N9BA 3LXBA 3FAXA 1S2VA 6REQB 3HGRA 3GTFA 2HEJA 2QDGA 1DQUA 3VUSA 4WY0B 3QGAC 2GVJA 2IXUA 3COTA 4XKYB 1W1IE 2ALDA 3B03A 4M80A 1Y7VA 1PEZA 1A5NC 1E3ZA 4PUUA 4D6IA 3HGSA 2X1IA 1K4GA 4IUOA 2E25A 2WC3A 4GMEA 5C7VA 2L5HA 4LWWA 3RRXA 1XSJA 2PDQA 1UYQA 4IPPA 4GBUA 3CXOA 1FDYA 4LEFA 3A3XA 2NV2A 2CCRA 2AQVA 1AQFA 3WBEA 1TV7A 3GLCA 2I56A 2E1WA 1DVJA 4XISA 4GC4A 2F84A 2R91A 3C2VA 5LNRA 3RO8A 1XCWA 1J5SA 1KFJA 3NO1A 3L23A 5FF0A 4RZ4A 2WJZA 4B9ZA 4AWEA 1YNQA 1V3LA 4QJ1A 1WBJA 1S2AA 1Z32X 3NZGA 3WJZA 5HWMA 4JZ5A 4G56A 1HJVA 3NO3A 5H1WA 4B4FA 5CPMA 4DBDA 3PF3A 2XHYA 3DHPA 1OEPA 4LQ1A 3D0CA 1VD6A 2WCSA 5CKSA 4ONVA 1CT5A 4AAJA 1H09A 3CV6A 3SJ3A 3FOKA 3WQOA 4A35A 2TSYA 1J6OA 4G2DA 1KWKA 2P10A 2JK2A 1DWFM 3ALGA 4GJ1A 5HINA 1EWEA 2G37A 1V3IA 5HAOA 3BCJA 2CKRA 5BRBA 2E1DA 4MY1A 2QCEA 3W00A 1M41A 1M7PA 5D05A 5CAKA 4I9AA 6CGTA 4MSSA 5JVLA 1Q4NX 2R82A 5D2WA 1U83A 4AX7A 4F9DA 2GK1B 5EMJA 1NP2A 4Q6XA 1XCFA 2JBMA 1UA3A 3ICJA 3ZWSA 4L9YA 2ASHA 4XZBA 1BTCA 1QPNA 3UXKA 4X22A 1EJVC 3SB0A 3DXIA 1TYGA 1REQB 1CPUA 3RXZA 2BHUA 3VMPA 4W87A 3TTQA 1P6WA 3GXDA 3BQ5A 3W38A 5FJIA 1BKSA 3VIIA 5LIYX 2WBGA 4GQ0A 1NWRA 4N6FA 4RDZA 1XS2A 4GD0A 3BSGA 3KRSA 3IGHX 3O0KA 2IPGA 3LCGA 1E0WA 5EYWA 4XSLA 1LOSA 2J8FA 3I68A 2QLYA 3MS8A 3OTRA 3H12A 4CNTA 2G3NA 1JNEA 1TE1A 1LYXA 4HN8A 4D6HA 1B3ZA 3GW0A 3SY1A 3NZPA 1LROA 3AZRA 3RO6A 2ZUSA 3PAJA 2VZUA 3BMWA 1YW1A 3SN1A 3AU2A 3R8GA 3B04A 1DPMA 5TNVA 3QJAA 2XVKA 1T8QA 3HV9A 2XIIA 3DENA 4HU8A 1Y5XA 5E09A 2PP3A 2FTWA 5EBUA 3W02A 4XAZA 5JBFA 2DIJA 1PB0A 2DZBA 2GOUA 4AD2A 3VYLA 2HE8A 2DSWA 1CW2A 3TW6A 2FFCA 2EJAA 7XIMA 3G0UA 1CZ1A 3SAZA 2GDQA 3PZUA 3C5QA 2R8WA 3M1ZA 1UMLA 3LG3A 3PWAA 2Z1VA 5JH2A 4MY8A 5HQLA 2NXGA 1VKFA 3JR2A 3OLEA 4E8GA 3QY7A 3LHWA 1NF7A 1ODZA 2DEPA 4J5NA 1YDOA 1T99A 3GM8A 2WZTA 3FA5A 2DP3A 4J3TA 1MQRA 3E5PA 4WSHA 3T0AA 4LUYA 3OG2A 1XGEA 2NX3A 3EEGA 4LY4A 3KCOA 1H5YA 1KBJA 2CLIA 4D6GA 1PKLA 3H4WA 4R5EA 1JL8A 2J77A 2DUAA 1T7LA 1V03A 4AHOA 4ZOEA 4N2YA 3MDWA 4WGHA 4HGXA 1B54A 3QBUA 2DH2A 1UBSA 4NAFA 2WMHA 1M53A 1R6WA 2X7WA 5BWFA 2ZA2A 2B7PA 3GXMA 1QNPA 2DZPA 3K1DA 1FKWA 4JL2A 5HBFA 1P0BA 2VTFA 5MHBA 2ICSA 2VX6A 2CHNA 3R79A 2J7FA 1N8WA 1V6VA 4EWJA 1UH2A 1QPKA 1P0EA 4CCEA 1HL2A 3VIPA 2PDMA 2G3IA 2QUTA 1VFMA 5I24A 5G2IA 3LBCA 2XN2A 3IRDA 3WQ5A 3LZ5A 1G4SA 3RX4A 5I5RA 2DZVA 4I8DA 3ZZ1A 2CZFA 4QE1A 1R46A 2JKPA 5M1TA 3K13A 2PD9A 3CTTA 2C1HA 1JCTA 1SFJA 2PS2A 3SRFA 1GOMA 4NYYA 1AH0A 3ES7A 4IXXA 1BYCA 3M5VA 4PB4A 2CW6A 3IVUA 2IQ0A 3ZJ6A 3DGBA 5HULA 1B57A 1KR0A 1F9CA 1DE5A 1JPIA 1LRNA 1UH3A 4NILA 4MNLA 4F0HA 2TPSA 3GVVA 1AJ0A 3GHRA 4IFKB 3H55A 1JPMA 1SUXA 3C4UA 1W91A 2DU2A 2DGAA 1XG3A 3W6LA 1RBAA 1SFTA 3TP4A 5ENLA 5C6MA 2J6XA 3OBKA 1SZGA 4IISA 5C2CA 1A5BA 1WP6A 3CASA 4FNQA 3K5XA 3WQEA 2GGEA 4GZJA 3AS3A 4TO8A 1PCWA 1XKJA 1K8YA 3TJ4A 1TRDA 3O6DA 4EPBC 2HVMA 2PBGA 1OZMA 1JI2A 1H7NA 3U2ZA 1FWTA 1A47A 3T44A 1ZS2A 1W3NA 1QXLA 3ABQA 4PL1A 4YHGA 2R24A 3F5JA 2V3DA 3T4WA 4PODA 3N12A 1CXFA 3VIJA 5JBDA 1RAKA 2VUNA 4BI6A 4CKQA 2GSJA 4KEUA 5H6HA 3APGA 1KXQA 4JKMA 3AJXA 3G18A 3WCZA 4H2CA 5FJTA 2GVEA 3ARWA 1MO0A 2GUYA 2PLJA 1BWVA 2VHLA 4F2BA 2O9RA 1VLWA 2XG9A 3KAOA 3DFSA 3NYDA 1ADDA 1OY0A 3M64A 4KRZA 2PRHA 4RW5A 5F4WA 3FA3A 3GTNA 1EEPA 1I1XA 4AEFA 3GIPA 2C7FA 2Y5JA 1H60A 4QLKA 1Y5VA 3RJYA 2QR6A 3MUCA 3MHUA 3LCFA 3TXZA 4E3TA 4GY1A 3LSCA 3INPA 5FEXA 4R88A 4UQ9A 5IOBA 2AL1A 2PDYA 3W7IA 3BL3A 4AZCA 3GDRA 3WUFA 3VXGA 4EANA 3VNDA 3QHNA 3UZYA 4JKLA 2IPFA 1HG3A 1S39A 2VD8A 4XUGA 3UJRA 3LBMA 5HXMA 4XWUA 3WQ8A 4S3FA 3DC0A 1PDYA 3TE9A 6ALDA 1WZMA 2E6DA 1IZCA 5AC4A 2QMJA 2PF0A 3G3DA 3N6QA 1XPGA 1RQEA 5LIUX 4D6JA 1BF6A 3MDUA 3ZQ9A 1VFHA 4BI7A 5D33A 3I7RA 4GNKB 4MYXA 3HJZA 2Y70A 1EOMA 5D8ZA 3NPVA 2HRWA 3F4DA 4B3ZA 1QHZA 3V0SA 2JQXA 4H41A 4B92A 4AVFA 1X8FA 4V15A 2D3NA 1T40A 1TV2A 3EB3A 3FJNA 4PUNA 4U28A 3B8WA 1IWBA 1AODA 4M19A 2VEPA 3ME3A 1FWHC 1SW3A 1EPVA 3ANYA 1OT1A 2CLOA 1BWLA 1V3KA 2G0WA 2OT0A 3PBUA 4REQA 4LB4A 3AHYA 2QUNA 1Q6DA 4B3KA 1TA3A 2OB3A 2YXOA 3W1NA 3IV3A 1EKOA 4HMNA 4S3BA 3CGTA 1EJTC 4CGTA 3KOZA 4A8IA 1UZ4A 1CXHA 4Q4RA 4Y90A 4YL2A 4CN1A 1W5OA 3ARZA 3VGFA 1YPIA 3PNZA 4GYKA 3HA1A 1NTHA 4BI5A 5DMLA 1TPC1 3W7RA 3UFYA 4AVNA 3SM0A 3TQVA 1OC7A 5KINA 5LGZA 3CBWA 1MXGA 3FYOA 5A6LA 5BOOA 3MSDA 2ZRXA 2NXIA 4DVOA 4P7NA 3AIRA 2FDSA 1VBGA 1VHNA 4DI9A 5FJPA 3PTMA 1XSKA 2AAMA 2D3LA 4MZ1A 4YVXA 4QSHA 3STEA 4QEEA 1J11A 1QOQA 1R2TA 2R1LA 1S1PA 4MZ8A 5C9XA 1KRCC 4U2YA 2OLSA 3EKGA 1EGZA 3IUHA 2WZEA 1G7UA 3WLTA 1IXNA 3O16A 1T5AA 5KSWA 4Q33A 3EA2A 2E9BA 4O8AA 3NQ8A 1Q6EA 2GUBA 2E3ZA 4Z2KA 1LOQA 1GQKA 3QQ0A 1LT7A 3E1F1 1JF5A 3BZJA 4FIRA 1GKQA 3FX4A 4AC1X 1DJQA 1X39A 3ATZA 3IJDA 4UIOA 3W9ZA 2E7FA 2EPOA 1DIDA 5LIXX 4LAMA 2HROA 2ZYFA 1HJWA 2V5JA 1RCOB 2MNRA 4PMRA 4YIWA 4F2TA 4QTGA 3VE9A 5HMDA 4RJEA 4B3LA 3UWUA 3GNRA 3W7PA 3VMOA 5AYYA 1RA0A 2XGIA 4TX6A 2ISVA 1IT8A 1FWJC 4B5XA 1ZBWA 2DQXA 4L4LA 4RK8A 1EP1A 2WW5A 5EY5A 4CEUC 1DWHM 1EC7A 1GUVA 2PDXA 1HJSA 2QW5A 1VFSA 1GZGA 3IWPA 4GABA 1A80A 2J79A 1TV3A 2ZUTA 1RPKA 1IGSA 3PPFA 3VDHA 4L6OA 3CUZA 3CU2A 2BVDA 3TFCA 4D1JA 3CEUA 2XFFA 4C6LA 3IJ9A 2Y8VA 3V18A 3WJSA 1LG1A 3UG8A 3FSUA 5I3GA 3UY8A 4HU3A 2BODX 3P81A 3G24A 3VABA 4IGSA 1B3OA 2V0TA 3WMSA 4FOUA 3UR5A 3C3NA 3CJPA 4MUPA 1UPMB 1H63A 3QMRA 1IEQA 2UY4A 4Z2GA 3W7NA 4IPJA 3WEZA 1CDGA 3A4WA 1GOWA 3ITOA 4Q8OA 1QNSA 1IZJA 3CUGA 3RN6A 3AIUA 3SQSA 3QFEA 1OABA 3RCMA 3N2XA 1W2VA 1HL8A 2Z29A 4ZOBA 1OYAA 3GR4A 3H2EA 1XW8A 3A22A 1K4HA 1XLCA 1X6NA 2EKGA 2PWUA 3O6CA 4HA0A 4M81A 4WY0A 4FSAA 4ZGYA 4B15A 2DSVA 3H2OA 3BURA 2VZTA 3S9IA 2WOQA 1TG7A 3VI2A 1QOPA 1EXPA 3GC5A 1IV8A 3LSBA 3NTYA 3ABXA 4DPQA 3CUXA 2FZDA 3R11A 4KERA 3EPOA 4S3JA 3UA4A 4AD0A 5DXYA 2PI6A 4DIAA 2PDBA 4XZWA 3UZ5A 2WO5A 3LI1A 3W53A 3PUOA 4GYFA 1YXDA 4F0SA 3ITLA 5CSSA 3LLDA 4IFOA 3CHVA 3JVAA 3MU7A 3KRZA 4LAUA 4Q3MA 3NWRA 3G2GA 3QOKA 3Q2DA 5ABHA 3W2KA 4IICA 3N4AA 3WF1A 4NU7A 2D22A 2EKCA 2DSKA 1KM2A 1VLIA 4UTWC 4KFPA 3CC1A 1W8SA 2EPNA 1YTKA 1ITUA 1JUEA 4XTDA 3JU2A 4U3AA 3F2CA 1XRTA 1C8VA 4KQNA 1Z3NA 4GKTA 8XIAA 1FWCC 4CVUA 1R5YA 2DVXA 5HMSA 1L6WA 1PAMA 3BVJA 4ADUA 4DJDA 1WAUA 1W5QA 3M07A 3BSMA 3EMQA 4D71A 4V1XA 1JZ5A 1Q6RA 2PTZA 2X0HA 1GTEA 3CL8A 2Z0IA 3P82A 4ZO9A 2WSRA 3WX7A 4E2OA 1UZ1A 1OC5A 1GVSA 5IHRA 3EX6A 4ZBCA 3U9IA 3GX9A 2ZADA 4E8DA 3MB9A 3SSJA 2VVSA 4FMVA 4JFSA 3IJLA 1LG2A 3VGDA 1AW2A 1WDRA 2Z27A 4RDWA 4A22A 1UD2A 1W9PA 4I90A 1Z69A 1V6WA 4B5VA 4IIHA 4MOZA 4WSJA 4DI8A 2CBIA 4A8NA 3GTIA 3PULA 3MPGA 3MWCA 5KITA 2J7HA 3TQPA 2ZRWA 5GNYA 2CU0A 2VVNA 3SQMA 2CERA 1I45A 2NVAA 2XIOA 5E70A 2V2CA 3WF0A 4GHRA 3KWXA 3NQAA 3GVRA 1OQFA 1XV8A 2CZVA 3K1GA 3UXDA 2ZBTA 1J2BA 3N19B 3WL1A 3BLOA 4MMWA 3IK4A 4HNTA 3C0QA 4D2JA 2F61A 4QQUA 4DWSB 4ZXLA 3UWEA 1VCFA 1OINA 1QU4A 1YXYA 3A64A 3GNOA 4IXHA 4ZE5A 1J18A 3AISA 1C92A 3VPLA 3WQVA 4BWLA 4I9TA 5IRPA 2C13A 3RCYA 2R1KA 1A0EA 1PSCA 3HG2A 1YBQB 1V08A 2E6YA 3TCSA 3BJSA 2C19A 4UR7A 4ZVJA 3CZLA 3MWAA 3NSMA 4M29A 1M01A 1LJYA 4MFDA 4AZ6A 4J40A 2D2HA 2NQJA 1ZRQA 2QF7A 4X60A 1OG6A 2JIWA 3KW3A 4X63A 1VEOA 4O0KA 4KWOA 4ALDA 2HISA 4DWDA 3GWQA 4ZQRA 3NQMA 3W2JA 4MWAB 1JZ3A 5DXXA 4C1LA 1G6CA 2VEGA 3S5SA 1U5VA 4WDWA 3PZ9A 1TQXA 1PCKA 1PO9A 1ISYA 1GZJA 3NG3A 5G4EA 1TVPA 1XLDA 4HA3A 2WNNA 2ZRVA 2OSXA 1MZHA 4RNJA 3ONCA 5FF7A 2J13A 4CLMA 1E6SM 2A3LA 3WQ6A 1EIXA 1C8XA 4PRRA 1HUVA 4NAEA 1ALDA 1E4MM 1SQ7A 1M65A 1IHIA 3E2QA 2NT0A 4PFMA 4IPLA 1JDEA 1BAGA 2VQUA 3HPAA 4XK2A 4U33A 3PUEA 3O63A 1XIHA 4AC7C 2AKZA 3CL7A 3T1GA 1I2NA 2RGLA 3K8KA 5EMMA 4V28A 2QAPA 2G97A 3PPGA 1EB3A 1LOLA 4PMDA 4GY0A 1JYNA 4NHVA 4R85A 3L0NA 1KGUA 1NF0A 1V3MA 3TJXA 5E6ZA 1RP9A 2HPMA 2FIQA 3AC0A 3FV9A 4L6HA 5K7JA 3W07A 1PZ0A 4W8LA 1YE6A 2WJDA 3FDGA 2ACSA 2BASA 2I9UA 4LAZA 4U31A 1PZ3A 5GPRA 3ES8A 3N2OA 5C9RA 1ZBKA 2H3DA 5KEZA 3FA4A 1GG0A 4FO4A 4LYPA 4ZTXA 5CPOA 1XHGA 3CO8A 2WPGA 1H7XA 5AHEA 3MP3A 4HNCA 2G50A 1A3WA 3VAVA 3VOJA 3WK2A 2C18A 2J4GA 3GNPA 2NQ9A 2W6RA 1O6IA 1YPXA 1VPQA 3HGOA 4BK9A 1KQZA 1E6NA 2Z1KA 2J75A 1ME7A 4K36A 2C0HA 3W1RA 3MV11 3GHTA 3GYCA 2X2GA 2X0SA 4MPQA 3DECA 5C9UA 4H9TA 3GDBA 4WQ6A 3VO0A 1UWRA 2QZRA 4GKLA 3N2TA 3KBNA 2BXZA 1JAKA 2ISDA 1SR0A 3C8NA 1CLXA 5D02A 3VTRA 2Y7EA 1VYRA 4WOQA 4C1KA 3L9CA 1AG1O 1QW8A 2DZWA 4LJ3A 3I4EA 1ZALA 4MUZA 2OOGA 2Z1XA 3W37A 4OECA 5LNUA 4IMEA 2F2KA 2XFYA 2OMAA 3ZR4A 3UQNA 2POZA 3TDFA 1GW1A 2O7QA 1PKNA 4R9XA 4PCTA 9CGTA 2O0TA 2Q3OA 4I6KA 2BVWA 3TV8A 2WMIA 4H04A 3E2VA 4LFYA 5A8QA 2ZTKA 1VBJA 1SMDA 3WLRA 2WC4A 1A0CA 4F4RA 2FYMA 5I23A 1K1DA 2WSQA 4LGXA 1JXKA 1LRQA 1GOKA 4QJ3B 4GUJA 3GXFA 2CESA 2FB3A 5CPTA 3DEQA 1JRCA 1JPKA 4GO8A 5BOEA 2I57A 1ZJBA 3HPSA 2GOKA 4MKVA 4A05A 4O19A 3BJTA 3L21A 1W31A 4M1RA 3VK5A 3FXGA 4HYRA 3UNTA 3RG6A 5LZLA 5FJJA 3ZVHA 1IXOA 2FZ9A 1SJBA 1A5OC 4R53A 4FEZA 3K4DA 2P5NA 1E0TA 4TXEA 4ATWA 4QISA 4GG9A 1GGOA 1XRVA 3G3MA 4QS5A 4KIRA 1BYDA 1EPXA 4DJEC 2MANA 2QUUA 4XAFA 3C61A 3W1XA 2GYIA 3RLGA 3SJNA 4PE8A 5G2WA 1R3SA 2EGZA 2VC5A 4B9YA 1RVGA 4YPJA 4W86A 1EBGA 4O0QA 3NZ1A 5DBTA 3R25A 1MYRA 3L0GA 1TKKA 2AGKA 3PPCA 3HPXA 4LBUA 1A5LC 2IUZA 3U48A 4S1FA 1TPVA 2QJHA 4N42A 4JR5A 1MUWA 2YDSA 3VD4A 1OHLA 3DC8A 4DJED 2V3GA 3RGTA 1DWIM 3LX9A 3IV8A 5AHIA 3VUPA 5EGRA 1UKPA 4AWSA 1F74A 2XFRA 1G4EA 3G1DA 1K7EA 5B7ZA 3EWZA 3CH9A 4ZB2A 6XIAA 2QDEA 1TIWA 1R9ZA 2INFA 1IWPA 1F6KA 5LSMA 2J27A 5A95A 2YCIX 3K2GA 2FB2A 3TN5A 3URNA 3V3WA 3H70A 1RPXA 1H7OA 4XZMX 3TUUA 5CQ1A 2EJ1A 3H26A 1SGJA 1VRXA 5I3FA 4IM4A 2G3MA 1JCMP 1HJUA 5F2IA 4RDYA 5C2GA 1YADA 2J8TA 1LBMA 2DZSA 5C8BB 1K6AA 4L56A 4IP5A 3CHFA 1ICQA 3SUWA 2P3ZA 3PNUA 2NVCA 4E4FA 1I2OA 4Q8WA 3WN6A 2WVVB 3CMFA 3DHUA 3SUUA 1F6YA 1QNQA 4LEQA 1D3CA 4HMEA 4HSHA 4QE4A 1ZJAA 2AL2B 4DM1A 5IBXC 2RDUA 3UCDA 2FH8A 3A47A 4GIEA 4G7EB 2VD9A 1TTQA 3HQNA 4WXZA 2QXWA 2VO5A 4ORIA 4Y6GA 2W62A 2YLLA 4PSPA 3NYZA 2PRLA 3SADA 3A4AA 3FNDA 3WNMA 1U33A 3W7HA 1CWYA 1VIWA 4PA8A 4HMDA 5ABGA 2W63A 3EXTA 1X38A 3UYIA 2A85A 4QP0A 4TTUA 3C0LA 1H7PA 4LUTB 4YYFA 1EP3A 3MO4A 3SUVA 1MUCA 4KFNA 2VRKA 5RUBA 3RDKA 2QUMA 3T78A 1UQZA 2ZTJA 2C16A 3WLMA 1GEHA 5DCBA 3ZSSA 3DYMA 3NZQA 3UYCA 5ABFA 1CCWB 4ZOAA 3GQYA 4MJMA 2PF8A 2Z28A 2MUCA 4HPGA 1W1VA 4FX6M 1QHPA 2Y2WA 1PX4A 2VEFA 3HQ1A 2O9PA 1EYWA 2QUVA 4XBSA 5GNXA 2RGMA 1UZHA 4XBKA 2WQDA 3M0YA 3NL5A 4RV8A 3A5VA 4B2DA 4RUBA 4ERIA 1XYFA 1QATA 2E5DA 2PU0A 4HJFA 2O9OA 1RALA 1TFVA 1HVXA 1OF6A 4GRSA 2A1YA 1OB0A 4MPKA 2DFAA 1GYNA 3USZA 4EWND 1LZOA 1XQLA 5C0QA 1NP0A 4MTVA 4LX4A 4D8AA 1EA9C 1US3A 4A3RA 4YNGA 2Z24A 3LV6A 1PJ9A 4ERGA 1JYVA 3VILA 3IJ6A 2Z7KA 2BOEX 3KTSA 4PCPA 3AJ7A 1RQBA 2WLYA 3MI3A 4WJEA 4AMCA 2OQLA 1W1B1 1KLYA 4Q8UA 1ZUAX 1JPDX 1PWMA 4WUIA 3W7CA 3RPMA 3LMZA 5F4SA 4C6KA 3H2FA 3EX3A 5BWAA 3VKKA 3DGRA 4DF1A 3EWYA 4OHQA 3G6LA 3B8UA 4L61A 3W29A 1EQPA 3OVQA 1J12A 2NXHA 4H7VA 2J9XA 4WEVX 1IXPA 4O53A 4Q8QA 3PSWA 1ADSA 4IMFA 2JGYA 1GWJA 1TREA 4GLEA 3EOSA 1E9IA 1H11A 3IGUA 3DAQA 1VGAA 1UPPA 3O3RA 4OUIA 3RHGA 1L9WA 1NDWA 3CMJA 5CG0A 3MYOA 5DCEA 2H8XA 5FSEC 1S5TA 5HJYA 3NM1A 3AXHA 3D46A 4LV4A 3STFA 1GKPA 2E40A 1A53A 2J7CA 1FCUA 4C6BA 3TNOA 3IIZA 1KCLA 2PB1A 3RFAA 3UESA 1XISA 3QTPA 4PUWA 3KBWA 3DYOA 1CB7B 4XB3A 4HCHA 4MADA 3KS5A 1LL7A 3REQA 4G1KA 2KAUC 1O5QA 2WZMA 4RR4A 4DO6A 1QO5A 4YJ5A 1OVDA 4O57A 3RRAA 1YTDA 2HZGA 2RHGA 3P8JA 3TAOA 3WNKA 3EMZA 2ZVIA 1F5ZA 4R3UA 4N02A 3PB2A 1FTXA 1XG4A 4BEUA 2YGYA 4ZTYA 5I06A 4OKDA 1BGGA 3W76A 3PFMA 3MZ2A 2XZ7A 3FLUA 2J7GA 2ZVRA 3M0LA 1GVYA 1TWSA 4ROPA 4UTUA 4S38A 1GVQA 1OK6A 1TJ2A 4TU1A 3E0LA 3IIVA 1WDPA 1B3WA 1NWTA 3W3OA 3AHXA 1KXVA 4P7RA 2VUYA 3S5OA 4LBRA 4ENLA 1ONEA 1JDAA 4QNEA 1UP3A 1JCLA 1YDNA 3KOYA 4HNNA 2ISFA 3I6TA 4PMUA 3IAPA 3M47A 1VPXA 1XIJA 4TV5A 1EDGA 1XLJA 1J0ZA 4XD5A 3MUIA 1SVDA 2VT0A 1AFSA 3UXLA 4UTKA 3B8VA 1UH4A 2PTWA 4JTHA 1R3QA 1UOZA 1HQTA 3QMSA 1S2UA 3OIXA 5CGMA 4IQJA 3H2MA 3FEMA 1JCYA 2PLCA 3CWOX 4IGMA 1E0VA 2ZC8A 2QJGA 3ONBA 3B9DA 3VGBA 4MAVA 5FEZA 1UR1A 4G8TA 3PJWA 3UPMA 3K8LA 4DYKA 1XYCA 1XH2A 3O7UA 2QT3A 2YL8A 3PG9A 4LVFA 1CXEA 3PVFA 4YMZA 1FHLA 1H1NA 3N13A 2I1OA 2ABBA 2VDIA 2R14A 1TJ0A 1EQCA 4M6QA 1RQHA 2QS8A 1DIOA 3TYUA 3VOGA 3LHYA 3VVGA 3VKJA 5K9XA 2W66A 5EU9A 1WBHA 4JX4A 4UB9A 4DELA 3WKZA 3W74A 3QLDA 1UD6A 3LCIA 3MVTA 1BHGA 1UUQA 1E3XA 1TJPA 4A3HA 2BBFA 4JN8A 1OFBA 3L66A 1JAEA 8CGTA 5CC3A 3S47A 1JR1A 2ZX9A 1CLVA 1UWAA 2G95A 5I78A 4ZO8A 4C6EA 1DEDA 2UY2A 3N34A 4JICA 2PU1A 1RR2A 3FHAA 4G1NA 2X42A 1S1RA 5U4NA 4Z0JA 1R3YA 2JGQA 2BX7A 3AZTA 3QOMA 5IHSA 1SFLA 1EGMA 4DZIA 3V1PA 3KRUA 3OHIA 1UMYA 2OXNA 1IYXA 3NOEA 1W1PA 1RD5A 4M24A 1S3HA 4HZ8A 4B91A 2D69A 3M7WA 1YEYA 1N8IA 2GPTA 2CWXA 2NT1A 4W89A 2X41A 2FZ8A 5JMUA 4Q8VA 2V30A 5I02A 3F2BA 4FIQA 3QV8A 5HMEA 2ONEA 4W85A 1YBQA 2EPHA 1V0KA 4RE4A 3D6NA 5BXRA 1UC4A 3OA3A 1GVEA 4MF4A 4Q6JA 4DZ5A 1IEXA 3K4WA 2NUXA 4Y2WA 4XAYA 2E6AA 7REQA 4R33A 5FI8A 5KZEA 1LM1A 5HNRA 2JEPA 3VGGA 3VCRA 2QKFA 1PX3A 3TROA 1KGXA 3WLOA 2FHFA 5CZKA 1L2QA 4GGBA 5BZAA 5HATA 1KO0A 3MSYA 2YYUA 3TU9A 4F0LA 5C5YA 1JIBA 3V36A 3LTYA 3P2VA 2G96A 3WD4A 4BF9A 3C2RA 1VS1A 2VXNA 4PMOA 2HE5A 3W0KA 4LW7A 4NASA 4AYGA 2D24A 2QCHA 4H19A 2NQHA 2FGBA 1KTCA 2Q8ZA 4W7UA 3VX1A 5FJUA 1XKYA 1U5HA 4GO9A 4L6DA 3V1HA 1JEZA 2ZIDA 2VYOA 4GNJA 1IXQA 5BU9A 1JCNA 3MMTA 1JRBA 5A6JA 4DF2A 2VGFA 3MSRA 3FEQA 3BH4A 5FD0A 3W7KA 3PBVA 3WLQA 1B30A 2QV5A 1WNOA 3AO0A 4TVCA 3NFUA 3R8RA 3BSHA 2YXGA 2FVMA 4CCDA 4UTTA 1CECA 2BOGX 3URBA 4J3XA 4NRRA 4EKJA 1GOOA 1R3RA 3UNDA 4K38A 5FJRA 1W17A 4HK7A 4HHLA 3UJEA 3T7VA 2CWNA 4LNYA 3IGXA 1ME9A 4LAKA 4YVVA 3GG7A 3BLDA 4FXSA 4JFUA 4W4QA 1K7XA 5FSDC 5IDIA 1FH7A 4H8NA 3KL3A 1LUCA 3OPSA 2E8ZA 2FZMA 4RE2A 3T4CA 5LXXA 3UVAA 3TC6A 1Y65A 3KXQA 4WXYA 4RV3A 2VENA 5E9AA 3UEQA 1M7OA 4DNMA 2W3ZA 4S23A 2GWNA 4QAWA 1FXPA 1VENA 4OFCA 3T0TA 3AMDA 3URAA 1CXIA 5LA1A 2ZRUA 5F7UA 3MV01 3I7QA 1H5VA 3D3AA 3TMLA 4UWMA 1IEVA 2BNJA 1QOXA 5CSRA 4FK9A 1Q7ZA 1FFRA 3OHMB 4WDTA 1YNPA 2GQ9A 1EIBA 2QEZA 2GGIA 2ZZ4A 1J79A 1G67A 3N9SA 3HIJA 5J5DA 2PPGA 1NJJA 2VRJA 3AMKA 3EB4A 2J47A 4S3CA 2TYSA 2CITA 3G8EA 2NUWA 4HNUA 1EDTA 2OKTA 4OTKA 1E6XM 2ZUUA 4P2VA 7TAAA 1ISZA 2WSYA 2VFDA 1V93A 4ZSUA 5CBJA 1D3HA 2QJMA 2GDVA 2GJPA 2B7QA 2PODA 4Z1YA 1WZAA 3MMDA 2Z1WA 3OZOA 4PB3A 1E56A 2C1GA 3PZQA 2W79A 3LHVA 2W92A 3MSGA 2YL6A 3G1YA 4X2PA 2ZXBA 1Q63A 4XIAA 4ZEPA 3W84A 4ZOCA 4NP7A 3KTCA 3AYRA 5CPNA 4B16A 2WNWA 3D47A 3GYEA 4BKNA 2DPEA 2F9RA 4A3QA 2CXEA 1ML1A 2W27A 3M43A 2ZC1A 1DWGM 1NQ6A 4CN4A 3H21A 1KFWA 3S1GA 4TMBA 3W6MA 1W2PA 1M6JA 1P0DA 4B4HA 1KR1A 1XIDA 1Q3NA 2B4GA 1E72M 4H7ZA 1F2JA 3DFNA 2VZOA 3GIQA 2ZFAA 3LM7A 1R7OA 5C70A 5I3DA 4LH8A 4ZO6A 2VWSA 2AQWA 2D23A 3QKZA 2WVSA 5A8PA 3MVIA 2X40A 4M6VA 3AAMA 3SECA 1F07A 5L6UA 1DWAM 1UD8A 5H8UA 3ANUA 3CZJA 4TV6A 1OFAA 4QSFA 1E6QM 4EPKA 3L12A 3R7MA 3O6AA 5D32A 4EVZA 3S42A 2FMNA 1WUFA 2VC7A 4IIFA 4M3PA 1DBTA 4HSOA 3R0KA 3WLIA 1L6GA 3DCPA 2C15A 1UHVA 3OQEA 2ZWZA 1GTHA 3CH0A 1UP0A 4GVIA 5CC6A 4DYJA 1HKVA 1FVPA 4K1WA 3BZGA 1TCMA 1CEOA 4X0VA 2H9AA 1PXGA 4Q4OA 3TK7A 1FDZA 2YB1A 3B0PA 2YCLA 2VM8A 2QYGA 1YLVA 1UC5A 1QI4A 3LY0A 2AKMA 1OFQA 2Z7GA 4CD7A 3TXVA 3VX0A 1GQNA 3QR3A 4YWSA 1UWQA 3QQ1A 1OGSA 4DY1A 3NPWA 2J9ZA 5EL1A 5CH9A 4XIMA 5AYZA 1WKYA 3DESA 1XGZA 4LF1A 3G1XA 2WWDA 4QG8A 4HZ6A 3QSTA 1JI1A 4RZ5A 3S6DA 3SIMA 3NIYA 4JTEA 1G94A 4PC8A 1EXBA 4O0ZA 4BJHA 5G1TA 4LC8A 3SCUA 4DHGA 2WVVA 4V2XA 3U5UA 5IDZA 5CBBA 4WDUA 2BWGA 2XN1A 1Q2RA 3HN3A 1AMKA 1E51A 4C7GA 3PJXA 2ZZ2A 4G7EA 5REQB 4JCLA 3V5OA 3HQOA 1LWHA 4MB5A 3SIZA 1IIHA 1F6PA 1OYBA 4BFAA 5A8GA 2UY5A 1WE5A 4JTKA 1C9WA 2P0IA 4AISA 4DLMA 3GHUA 1JJKA 3GHSA 3KS6A 5D37A 1NVMA 2FJKA 4HHHA 4W9TA 4PTWA 1SZEA 3TW9A 3RR4A 4O1CA 1ZFJA 3IRSA 1GOQA 4IUGA 4K8HA 1YYAA 3W87A 4K7YA 4O12A 5FL0A 3PUGA 3ZSTA 4LANA 1EOKA 3C52A 2CLLA 3KE0A 1KM3A 2XIMA 4L64A 3W28A 2O55A 1KFLA 4LUSB 4KETA 4GUFA 3WUBA 1WOBA 1WZLA 2Q09A 4KF1A 1TTPA 1F7BA 2PZ0A 2OODA 4H83A 2HBXA 1KM0A 2PDJA 3QR0A 2XH7A 1GJPA 1C9DA 4E2VA 4KGJA 4Q4KA 1KV5A 4XD4A 2RDTA 3WQPA 2X30A 4J1OA 1YKWA 1C29A 4MNKA 5D9PA 4TX9A 3NZRA 3KP0A 2Q71A 1Q2SA 4O17A 1FA2A 3S6OA 3SI9A 2VELA 3IACA 3SW6A 3GUWA 3NQ7A 5MKGB 3MUY1 3CHEA 3UT0A 1MW1A 3VDGA 2C6QA 3AU6A 3WK1A 3BGGA 3ID7A 1POJA 3I7SA 1IT0A 1R8LA 2ANUA 4C60A 3N2BA 1F61A 4IMCA 3RAOA 1WUEA 3ECQA 3W83A 3ITYA 4ACZB 1K9TA 3QPYA 4WRHA 4IFRA 3B8DA 1D7FA 3MTWA 3GH4A 3ZT6A 3LDVA 2F2HA 4Z2HA 3LPFA 2ISSA 4XTIA 1HT6A 1BQCA 4UTLA 3BG5A 3STCA 1R9XA 1F4HA 2WHLA 4KMQA 4KH2A 3OVGA 4Z2LA 1K8CA 4H8VA 1GYLA 3H54A 1W9UA