4L4PA

The mutant(e139a) structure in complex with xylotriose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
b'TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with xylotriose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4l4pA00
2PI6A 1BTCA 3VGEA 5E0CA 1XRVA 2YLAA 1CENA 5CGMA 2YBTA 3CZJA 3GYCA 1LG2A 3SUWA 2WMFA 1C8QA 5M03A 4DM2A 2IXUA 2W4XA 3PZUA 3TOPA 5ABHA 5JBEA 4LQ1A 3WH5A 2J74A 3SUSA 1FH8A 2X0HA 3N17A 4AISA 1VRXA 3ARQA 5I5RA 2B31A 1CXLA 2J79A 2JF7A 5HDRA 4CD7A 1E71M 1FP9A 2GUYA 4C7GA 1MW0A 1ITXA 4YN5A 1W3HA 5BROA 1B3YA 4UOJA 1TUXA 1W9DM 2YIHA 1WNOA 3U7VA 3UETA 3MANA 1UG6A 3W28A 3BLKA 1XYFA 1Z32X 5BYWA 2Y8KA 2HISA 3L4UA 1R87A 3PBGA 3O6AA 4CD5A 5A6LA 4M8UA 4Z2KA 1ZJBA 1JZ5A 1NWUA 4IPNB 1EDGA 4L4OA 2WANA 3WH7A 1V0KA 3VTRA 3I3DA 1UWIA 4GI8A 2YOCA 2WMKA 4P8XA 4WKHA 1VAHA 4JFUA 3VDAA 1I1WA 2VT0A 4XUYA 1HJWA 2XHYA 4XZWA 2WMHA 1GOKA 1ISXA 3WSUA 1UKTA 2BHUA 1W1YA 2YJQA 3EDEA 3MSDA 2A3CA 5KZ6A 3VIKA 4F66A 2XGIA 3UG5A 2DSKA 2GK1A 2VC9A 5FIPA 4PEEA 3K1DA 1GVIA 3WENA 1Y7VA 1EHNA 1E15A 1H41A 3W6MA 4C7DA 1CGTA 2NSXA 2Y24A 3L4WA 1HVQA 4JFSA 3VMPA 3VPLA 5CPTA 2BS9A 2D0HA 2X0YA 4E8CA 1C3FA 3FHAA 1UD6A 1CXHA 4MNLA 3AIEA 1V0LA 5CSUA 1WDRA 4MTVA 3K46A 4JCLA 2WZEA 4IISA 2CEQA 2UY3A 3CTTA 2VX4A 1PEZA 4BF7A 5I23A 4PTWA 4W8AA 1UHVA 4UQBA 1NP2A 1BAGA 4AC1X 5LA2A 2BY0A 3RM9A 1DWGM 3CO4A 1CLXA 2VCAA 4NRRA 1AQ0A 1QHZA 3MMWA 4B9YA 2CBVA 4PMQA 1X1NA 5A94A 4U5KA 4AZIA 1KWKA 1JI1A 1GQIA 5A6MA 3T08A 4BZYA 3NSXA 4D6FA 4AD1A 4QCFA 2EPOA 4PMDA 1BQCA 3HMCA 1VENA 2DT2A 2VX7A 3IJ9A 2W63A 2O9TA 1PJ9A 5D9MA 3D5HA 2VO5A 1J12A 3IJ8A 2W92A 1K9EA 3M46A 1C8YA 4MDPA 1J01A 1E70M 3ZR5A 2BXYA 1JZ3A 2BHZA 1XCWA 1JYWA 8CGTA 1J9YA 1D3CA 3ZJ8A 4JHOA 4TVCA 2X05A 1J0ZA 3MKKA 4D72A 4HMDA 1CGUA 3VD7A 2JEPA 5HOSA 3OLEA 1ZBKA 1HXJA 1VB9A 2ZIDA 2WC3A 3UG3A 5CQ1A 1OGBA 1DWJM 4UCFA 3AHYA 2J7CA 4L4PA 3WN6A 3QHNA 1KR0A 2ZXDA 1S46A 2J75A 4W7UA 1SR0A 2EBNA 4J7RA 3W29A 3ALGA 1H0GA 3F5JA 4WK9A 2CPUA 1CGVA 2G3MA 4LX4A 3FW6A 2WVTA 4D71A 1KXVA 3MMDA 3ZSTA 1W91A 3PZIA 2V5DA 1ZJAA 2JFEX 3CUHA 1OGGA 2CCRA 1V3LA 1Q6FA 4D6DA 2WKLA 1CBGA 1E4LA 1K9DA 3SCTA 4NRSA 3EYPA 3CUIA 1IT0A 3ARTA 3CMJA 4PTMA 1DWAM 3GM8A 3FN9A 3IJ7A 2WWDA 3NSNA 4H2CA 6A3HA 2WW5A 1VF8A 2Z1KA 2WHJA 4KRTA 4F79A 3AIQA 2DSWA 5A69A 1X6LA 2PC8A 3VNYA 1AQMA 2C8NA 2VCBA 3WQ5A 2W61A 2VZSA 1Q6DA 3AZSA 1KXHA 4KWUA 4EKJA 4C7FA 4N0RA 3MV11 3MUAA 3T0AA 2PB1A 1M7XA 3QOKA 1J0HA 2VURA 3ZMRA 3MUY1 4U2ZA 2PWEA 4B15A 1ISZA 1JI2A 3WIJA 2E0PA 2AAAA 3CHCA 3WQVA 3CHFA 4DM1A 1DP0A 2FDMA 3TTOA 2CERA 2Y4SA 1W3KA 1CXKA 3KZSA 1LL4A 5AC4A 1WPCA 4KGJA 3AQUA 3GNRA 1B90A 4MNMA 2GJPA 3FHQA 3OGVA 1H2JA 5GNZA 5JIWA 4GQRA 2YL5A 2YDRA 3M7SA 4BA0A 1JF5A 7A3HA 2BFGA 2XFFA 1ESWA 1KGXA 4IUGA 3O9NA 5AYBA 2J7DA 5A6AA 5M5DA 1E4MM 1WZAA 1DTUA 3WFLA 5E9AA 1JFXA 1B9ZA 1E73M 5BWFA 4JFVA 3A6OA 2PWDA 3RCNA 2VX5A 3ARZA 3F5KA 4OJYA 5JIPA 1C92A 2VNCA 4M81A 1UR2A 2WB5A 2W62A 3ZT5A 2WCGA 3PN8A 3AIUA 2CBUA 1GJWA 2G4FA 2GJRA 1TZ7A 4XB3A 1U33A 5ABFA 1CPUA 2CXGA 4HOWA 1ECEA 4H41A 1TCMA 4M29A 4BQ5A 2UY4A 2WBKA 3LPFA 3OBAA 3EMQA 3SUUA 5TD4A 5IHSA 1V6YA 1UR4A 3WUEA 3ZIZA 2J7EA 4MJ2A 4TXEA 1XSIA 3GXDA 2C7FA 1CXFA 1GQLA 4B3KA 2RGLA 2BVYA 2W67A 2D3NA 4EAMA 1M01A 4UFLA 1H4PA 3JUGA 4HMCA 3SCWA 1JDDA 4JCMA 4HOZA 1FP8A 3MUIA 4P8WA 1UR1A 2J7FA 3VOCA 1E6PA 2PWGA 4OIFA 3MU7A 1KXQA 3B9EA 2JEQA 1NWTA 3OB8A 3SEPA 2WHMA 2ZOXA 3GNOA 1HP5A 1VBRA 2BVDA 3CPUA 1Q4NX 2WVVB 1FH7A 1KB3A 3ZOAA 4AZ7A 2VL4A 5D9PA 1BVNP 1LF1A 1UH2A 3GXIA 4LPCA 3OLIA 2WWCA 3AISA 5I77A 1OIFA 3VDHA 3POHA 4AZ5A 1CYGA 3SUVA 3VO0A 1C90A 1HKIA 1D7FA 4M82A 2D22A 3NIYA 4W86A 4AZCA 5A8NA 1VFUA 3WH8A 1JYXA 2E8ZA 3T2OA 1XH2A 1A3HA 1H5VA 3WNKA 4A3YA 4U33A 1ZS2A 1V3HA 1FA2A 1GORA 1B3ZA 3BH4A 1OD8A 1HJQA 5E0FA 2YDQA 3QOMA 3ALFA 3UESA 2WVSA 3ARVA 1FFQA 1OINA 2VZOA 4PTVA 3AIVA 3WDQA 3WQ8A 2G3JA 2WNWA 3ARWA 3WFZA 3SCQA 5FCZA 4TX6A 3WF3A 1E40A 4PSRA 3AJ7A 4H04A 1J0YA 5DFAA 3W25A 3BAIA 1V0MA 1XC6A 1GJUA 1E5NA 1BHGA 2UY2A 3WQ4A 4ATLA 4PUEA 4H8HA 4PMXA 4CD8A 5HPOA 4ACZB 3M6DA 3QGVA 4RL3A 3RM4A 3AFBA 1FOBA 3WUFA 5LA0A 1HL8A 2VQTA 2V3DA 4JAWA 1GOMA 1ITCA 4D6EA 1GOOA 3THDA 5A2AA 3VGFA 3PZOA 4AD5A 1BLIA 4P7LA 1KBBA 5ABEA 2FHCA 2DT1A 4QP0A 3N9KA 1IZJA 4W89A 1W9PA 3U5YA 4MB1A 2CNCA 3WH6A 1W9VA 5JUVA 2GFTA 4CCDA 5BCAA 1EOKA 4ATDA 1JZ8A 5CZKA 2QLYA 3AMCA 3AMKA 1CDGA 3W6LA 4NSBA 4U2YA 5ABGA 1H49A 1SMAA 3NDYA 4HA3A 5IFTA 3BCFA 3EDDA 4PYSA 3TTQA 4OZOA 1V02E 2FH6A 1ODUA 4WLCA 3NCOA 3AYRA 1OSEA 3FXYA 2WSPA 2WBGA 4MNJA 5ECUA 2Y5EA 4OBSA 5D8WA 4CN1A 4D6HA 5CG0A 4IM4A 1XH0A 3VIJA 1CGYA 2NT1A 5LYRA 2CESA 2O92A 3UR8A 4GI6A 3WD3A 1UKQA 2W5FA 4N42A 4W8LA 1UH3A 3VGGA 2XWDA 1VEPA 1KFWA 1NWSA 1ISYA 1LG1A 1NP0A 1JDAA 1F4AA 2WC4A 4Z2LA 4QLJA 3T2PA 4CCEA 4WSKA 1J0IA 3WNLA 3WBEA 4TUFA 3J7HA 2VQUA 1GVYA 1V6UA 4GZJA 3RPMA 1MFUA 4KMQA 4PMUA 2G8ZA 4CD4A 5JBFA 3VMNA 3AYSA 1V03A 4JHZA 2XPKA 3N13A 2YDSA 2DDXA 4HTYA 3CUGA 1CLVA 3U5UA 2FHFA 1OT2A 2XVLA 3W81A 1G5AA 1J10A 5E6ZA 4CU8A 1KGWA 4UFHA 5BRQA 1QPKA 2VMFA 3LPGA 3B8SA 3F5LA 1JXKA 4CU6A 5KEZA 4GO9A 3PZNA 1QBAA 4UFJA 1YQ2A 3K8KA 1UZ4A 2DH3A 2DSUA 1V0NA 1TE1A 4HZ6A 1R7OA 4TVDA 5I0DA 3N11A 2E9LA 3GDBA 3L4TA 1WP6A 2V3GA 4ATWA 2OYMA 1IV8A 3CH9A 3MUZ1 2ZXBA 3LPOA 1E5JA 3WD0A 4MB4A 1JD7A 1FH9A 1PZ2A 4MADA 4AYSA 4BQ3A 4XZBA 2YA1A 1UUQA 1LQ0A 2VZUA 3RO8A 4W8BA 2XFYA 2VZVA 4M24A 1E6NA 5A6BA 3RMEA 1R8LA 2DIEA 5I3DA 5M3WA 1OB0A 3PZVA 2A3HA 5AY7A 1AQHA 3K4DA 5EB8A 2EPKX 2WMIB 4KRUA 4OUEA 1L8NA 4PN2A 2CHNA 1QNSA 1JNEA 1TR1A 1P6WA 2E9BA 1QVBA 1GQJA 3T09A 2BNJA 4S3JA 4B3LA 1V3JA 2D2OA 4J28A 9CGTA 8A3HA 2OYLA 1K9FA 2YA0A 5BRPA 3TA9A 4GKLA 5LA1A 3L4VA 2WM0A 2XSAA 1B2YA 3ZJ6A 1CXEA 3EDFA 3UG4A 4M80A 3GNPA 3QR3A 4M1RA 4D6JA 1NOFA 1QNRA 4GINA 3CZGA 4BQ4A 4HZ7A 2OSWA 3VIHA 4UFMA 2Q8XA 4D6GA 1MW1A 3CLWA 1PIFA 3IK2A 3OA5A 1E3ZA 1OBAA 4XX6A 5DT5A 1HVXA 3N18A 1HT6A 2BY2A 1MW3A 2V3FA 3EMZA 4PSPA 4V2XA 2J77A 2X2YA 1KBKA 5D8ZA 3AIWA 4DWSB 1QBBA 1ISWA 2BXZA 1ZB5A 1PBGA 1E55A 3WL0A 1EGZA 2CKRA 2F8QA 4M56A 3BAXA 4ZXOA 3G6LA 2J7BA 4JIEA 2NT0A 3KL3A 4IPLA 4Q22A 4D1IA 1H3GA 5DT7A 2ZUVA 1EIBA 5A6JA 3WMSA 1B3XA 2OLHA 3U57A 2ZX6A 3VGBA 3AROA 5GQBA 3I3BA 1V3MA 3AXHA 3TP4A 4UOZA 3VINA 4YHGA 1WDQA 2QPSA 4KH2A 3BAJA 4FK9A 4P8UA 3AMGA 1WAWA 4UNIA 2DT3A 1DWHM 5CPQA 4NZCA 3TTYA 3NJ3A 4MB3A 3WEZA 2OWWA 5DMYA 2G41A 3AIBA 4PBGA 1JXJA 1EA9C 1RP9A 1W2VA 5A95A 4AD0A 1G94A 1UYQA 2YL9A 1CWYA 1GOWA 3WY1A 3PZQA 2GDUA 1CXIA 3OGSA 4AZHA 5CLWA 3ZT7A 3F4VA 3VM7A 1LWJA 3VX1A 2A3BA 1BYCA 4U5IA 1K9TA 2XFRA 3IANA 4MAVA 1C93A 3CUJA 3VVGA 1CGWA 1AVAA 1US2A 2RGMA 3PTMA 4DUVA 3RILA 3AS1A 2CETA 1HF6A 2XG9A 4AD3A 1QHOA 2DPEA 3BLPX 1G1YA 1HKJA 3SURA 1VFOA 1M04A 3EMCA 2QMKA 1UA3A 2ZICA 4PMVA 3L4XA 4CVUA 4PMNA 2W66A 3ZT6A 1JNDA 4E4PA 4MAZA 3WF0A 2BHYA 1LL7A 2ZX9A 4TVUA 4QFUA 1ZBCA 1UD4A 2UY5A 3D3AA 1JAEA 4AIUA 3OLDA 3ARPA 1H09A 1HNYA 1UKPA 3CMGA 4UR9A 3ZQ9A 1TA3B 4F9DA 3N12A 1K6AA 1GPFA 5EMYA 3AXIA 1CNVA 2G3IA 1VEMA 2OWXA 4HMEA 1PZ3A 4BCEA 3L2LA 1CGXA 4AZBA 3NUKA 1WCGA 1UWQA 1JYVA 5CGTA 1BG9A 2XGBA 3TONA 1LWHA 1WDSA 1CIUA 1CECA 4ZFMA 1E56A 1N82A 3AHZA 4A3HA 2ZE0A 2XVGA 1UKOA 2ZUUA 2VR5A 3BSHA 1E72M 4WJXA 1G9HA 4FLOA 2F61A 1E0WA 1GNXA 1MYRA 2OYKA 5A8OA 4E2OA 1W3LA 3PZMA 1MXDA 4QLKA 1H11A 4S3KA 1B3VA 3OLGA 4UQEA 2D1ZA 1DWIM 3AZTA 1NOWA 2D0FA 2W91A 2Y2WA 1IZKA 2EO7A 4W7VA 4X9YA 2YL8A 1HJUA 4J3SA 4PMZA 4MB5A 1CTNA 1LL6A 1OIMA 1TMQA 3PTKA 2A3AA 1JF6A 3VDCA 1QNQA 4NI3A 1DWFM 3IAQA 4AD2A 4CN4A 2ZXQA 3WQ6A 4WF7A 2IXVA 1KQZA 2GJXA 5CSYA 3ARXA 5A6SA 2DSZA 2Z1SA 1US3A 3VIPA 3VGHA 3VNZA 1TG7A 5M17A 3VIMA 2FH8A 1C7SA 1EO7A 3VD4A 2D24A 5ABFB 5DO8A 1B30A 1FHLA 3PZTA 1DEDA 2ZUNA 1UWSA 1BGAA 4YHEA 3A47A 1KWGA 4TX8A 3VDBA 4B16A 3FAWA 1OT1A 3CZ8A 2VX6A 2D20A 3VU2A 1UD3A 1D2KA 3N04A 4JKLA 1WB0A 3MMUA 3ZR6A 5BXTA 3KL0A 1QI5A 5A6BD 2EXOA 2XIBA 2QV4A 1WZMA 2FHBA 4U3AA 3AS3A 2WZIA 2DIJA 3WUBA 2GDVA 5HBFA 2EPMX 2GVYA 1U30A 4W7WA 2VZTA 4Z2HA 3LMYA 2YA2A 2X09A 4P7OA 4TOQA 3FY1A 3RJXA 4OOUA 1XSJA 3UCQA 1UA7A 2O9RA 5AYIA 4MJ4A 2E40A 4W87A 3VUPA 3CZLA 2EPLX 3VMOA 1V08A 1ZBWA 2YL6A 2GSJA 5HXMA 1F4HA 3OIHA 1QI0A 1QHPA 5BXSA 4FLQA 1B1YA 4W5ZA 1OGSA 4P7RA 1MVYA 1FHDA 3EDJA 3MO4A 3AXXA 1QW8A 1QI3A 1X6NA 1UR0A 1UD5A 3K4AA 4R5EA 4W85A 1JFHA 2FGZA 3BMWA 3HN3A 5HPCA 5GPRA 4OBRA 4J3UA 4ZE4A 3W82A 4BQ2A 2ZUWA 2VI0A 2ESCA 1L0PA 1HN1A 1PX4A 1W1TA 3BC9A 2VRJA 4HOXA 4Z2JA 4ML4A 1E4IA 1RH9A 2XYLA 3AOFA 4X0NA 2ZXAA 1MWOA 1V02A 1NH6A 4LGXA 1QI2A 2PBOA 3GH5A 2JALA 1JDCA 2F2HA 1V6XA 5D4YA 1OCQA 3GXFA 4CN6A 1W9BM 1XD0A 1CEOA 1BSIA 3B9DA 3GBEA 2DH2A 4HA4A 3CBWA 5DF0A 4AEFA 4Z2GA 4BS0A 4AXNA 2WKGA 4DUWA 4PUDA 1W1VA 4URIA 5IXEA 4UFKA 4D6CA 4AW7A 4OOZA 4E8DA 1WO2A 3A4WA 4LXFA 1JZ2A 1NOUA 1O7AA 5FOOA 4AD4A 2CKSA 1BYDA 4CGTA 4LYPA 2VCCA 3RM8A 2WCAA 3W26A 1W1PA 4GXPA 3A4AA 4AWEA 1JD9A 1E3XA 4LYQA 2OWCA 3IAPA 3FNDA 4GO8A 1H1NA 1UR9A 5EFDA 2WZHA 5C70A 3W4RA 4GQQA 3WD1A 1J11A 5E70A 5FL0A 1BYBA 5IHRA 5F7UA 3POCA 1JAKA 1HX0A 2AMGA 4CUCA 2J62A 3UERA 3WKZA 3SCSA 2VVSA 2ZX8A 3LPPA 1EO5A 3AS0A 3ECQA 3T0BA 3DHUA 1J0JA 3I3EA 3G6MA 3VILA 1HJXA 2ZUTA 1MFVA 1ZBVA 3PZ9A 3NDZA 1Q6CA 3MS8A 3DECA 4W88A 6TAAA 4WKAA 4UTFA 1UQZA 1QNPA 1VFFA 3T2QA 4CU7A 2CITA 1PAMA 1GOQA 3HU7A 4V28A 5HNNA 1JL8A 2PWFA 3WELA 3WF2A 4PRWA 1DHKA 3DYMA 3VX0A 1UZ1A 2PF0A 4J3VA 5E6YA 2XM2A 4F9JA 4FMVA 1XCXA 3WMCA 4X0VA 1EQPA 3WEOA 1V6VA 2DGAA 4UQ9A 1W32A 2WK2A 3AIRA 1W3JA 1I1XA 1BPLB 3GZAA 4PMYA 3WF4A 1XYZA 2XVPA 4KGLA 2VR4A 5AC5A 4QAWA 1YHTA 1TFVA 3PHAA 3MV01 5A8PA 4UQDA 4MNKA 1B0IA 1RP8A 1Q6GA 3GBDA 4AY1A 2ZUSA 1PX8A 4GI9A 4UFIA 2GK1B 2WMIA 2J8GA 2XUCA 4PMRA 4OKDA 4ZENA 1JZ6A 3VIFA 5IDIA 3HJEA 1WDPA 1KR1A 3FAXA 4P8VA 5EBAA 4F8XA 1W9UA 1EH9A 1UH4A 1E1EA 2OSXA 2WXDM 1E6RA 1KXTA 2WCSA 4J3WA 2QHAA 4HU0A 2J25A 2E4TA 4UQAA 5IFPA 1OD0A 3ARUA 2NW0A 3APGA 3BAYA 1E6QM 3OG2A 2DQXA 2J78A 3WBAA 2WC7A 1SFSA 1RD6A 2EJ1A 1NQ6A 1UD2A 3T0DA 2PWHA 3W27A 5FD0A 7CGTA 1QNOA 2CIPA 5CJ5A 2VOTA 3ARYA 2A3EA 3CHDA 4MDOA 3RDKA 4DWSA 1EHAA 4EANA 3ARRA 2J7HA 3CUFA 5BXRA 1R85A 3AICA 1B31A 3VGDA 3SCOA 1XV8A 1E6SM 3AHVA 1EDQA 3CGTA 5C71A 4GPNA 3PTQA 3VIGA 2ZX5A 2JE8A 4W93A 2EEXA 2X1IA 2XWEA 4AIOA 1QW9A 4AMCA 3WNNA 1C8XA 4D6IA 1GCYA 1GHRA 4QLLA 3BAWA 4EK7A 4UZSA 2ZUMA 1A47A 1JZ4A 1J18A 4UQCA 1I75A 4GZEA 3VKKA 2QF8A 1HKMA 3VD3A 2OSYA 2J8FA 2V5CA 3CIVA 3M07A 2D0GA 2XTKA 1KGUA 1ISVA 4JL2A 1MW2A 3W38A 4JL1A 1E4NA 2E9MA 1E0VA 5FL1A 3CZEA 2UWFA 1E1FA 1H0IA 3AI0A 2WHKA 4JKMA 5A6KA 2J4GA 1E0XA 1VJZA 5A2CA 2EPNA 3U7BA 2WMGA 5E09A 2X8RA 4JKKA 1OM0A 3CHEA 1GQKA 1JIBA 2O9OA 1HP4A 1WZLA 3N15A 2PBGA 1VEOA 2CBJA 4QCEA 1GHSA 2CHOA 1QOXA 4R27A 3ZJ7A 5A2BA 3BCDA 1UD8A 3WL1A 3PZGA 4QDMA 1UWRA 2J47A 3WDJA 3SIMA 4V27A 1SYTA 5A8MA 2BY1A 3WF1A 4P7QA 4W84A 4J27A 3WNPA 4DUXA 1MQQA 1GONA 3A4XA 3KE0A 2XJ7A 1EQCA 3DC0A 2JIWA 1OWQA 4CKQA 3DYOA 3GXMA 5D9NA 4EE9A 4UOQA 3WMBA 2VVNA 1G01A 4FLRA 1B3WA 1MQRA 2DT0A 4TTUA 3BMVA 2AOSA 3A3HA 3OGRA 4WKFA 3II1A 3N1AA 3AZRA 1NWRA 3MSGA 3EDKA 1KQYA 2CBIA 2FGLA 2VJXA 3AHXA 3WDPP 2V38A 2QPUA 1R86A 2WLZA 1EXPA 4AIEA 1MXGA 3BAKA 3AMLA 4JFTA 4ZE5A 5C8BB 1TA3A 2J7GA 3O2LA 4PTXA 1XHGA 3OZOA 1JYNA 4J3TA 5FKYA 5JBDA 4GZIA 3WEMA 5DEZA 3VD9A 4H8VA 1BG4A 2XVKA 3B9AA 3WDIA 1JZ7A 1HL9A 1TVPA 3ZM8A 3W53A 4RE3A 3S2CA 2JIEA 1XD1A 4FF5A 2WYSA 4LYRA 5I6SA 2EQDA 2DSVA 6CGTA 1XH1A 4YPJA 5A3HA 2TAAA 3VIIA 3ZO9A 4P7NA 4HZ8A 2VTFA 1C91A 5CLTA 3KL5A 3GH4A 1U2YA 1GOIA 1KCKA 1EDTA 2G3NA 1UWUA 2XM1A 3DHPA 4H8UA 4H7VA 5I78A 5I24A 4Q7NA 1PX3A 4HA1A 1VFMA 3VIOA 2O9PA 1E6ZA 1WKYA 3BGAA 3QHOA 3DYPA 1NM9A 3ARSA 2D23A 2DEPA 2XSBA 1UR8A 2CYGA 3SCVA 3SCPA 3KEHA 1RPKA 3ZSSA 4XV0A 3EBVA 4FLSA 4ACYA 4HPGA 2BY3A 3L4ZA 1KCLA 1PIGA 1HJSA 1HJVA 3WH9A 2XIIA 1BYAA 4ZEPA 2WHLA 4MPKA 4CVWA 1E43A 1V6WA 3W37A 4JFWA 2WMJA 4PCSA 2VRKA 3KWXA 1BF2A 2YLLA 3K8LA 5CPSA 1WE5A 2BV9A 1BVZA 4JZ5A 5EFFA 2Y8VA 2WLYA 2C0HA 4WSJA 4A4AA 2ZWYA 3GH7A 1R7AA 2D3LA 2GJXB 1SMDA 3BSGA 2WVVA 1G0CA 1PPIA 1VIWA 1ZL1A 1UQYA 4PMOA 3AMDA 3WDRA 2WPGA 3VD5A 4U3CA 1JGIA 1E6XM 3QHMA 2VRQA 2JF6A 1GZJA 4NF7A 3THCA 2ZWZA 3NYDA 1O6IA 1MQPA 2E8YA 1LLOA 4ZXLA 3SUTA 4Z2IA 2HVMA 2YKKA 4RE2A 3CZKA 4CCCA 4TTGA 1HIZA 1Q6EA 3K8MA 3L2MA 1AMYA 1E9LA 1W9XA 4GIAA 1HKKA 4J3XA 3WD4A 3UEQA 4D1JA 3AHTA 3RJYA 1W2PA 4UZUA 1C7TA 2WSKA 3WQWA 5GNYA 2BVTA 1J0KA 4DWSC 2MANA 4W5UA 4AZCB 1EOMA 3SCUA 1FFRA 2QMJA 3S6TA 5A1AA 1JG9A 3SCRA 4Y7EA 4HPHA 1ZU8A 1UOKA 5D9OA 4AZ6A 1BGGA 2YBUA 3L4YA 4DWSD 5I2UA 3TTSA 1BFNA 4ACZA 3WNOA 4RE4A 3W0KA 1UKSA 1LJYA 3GTNA 3WNMA 1V3KA 1XSKA 3E1F1 4U31A 3OZPA 1GUVA 4AZGA 5CXPA 1TVNA 1CZ1A 4HP5A 3WDHA 5I79A 2E3ZA 2VUYA 5A8QA 2WAGA 1XGZA 3UR7A 4CD6A 4HU8A 3SCNA 1GW1A 4AEEA 3BXWA 1VJSA 3RIKA 1VBUA 1M03A 3AS2A 4WIWA 1QI4A 3W24A 4PCTA 1UWTA 1NARA 5GNXA 2XVNA 4B9ZA 2V3EA 1WZKA 3ZJKA 5BXPA 3WD2A 1V3IA 1M53A 3VM5A 2ZX7A 3WUGA 2IUZA 2WVUA 4K68A 7TAAA 1ODZA 3NSMA
chains in the Genus database with same CATH superfamily
5F2IA 1X8CA 2Q3RA 2FZMA 1CENA 3C0JA 2DZBA 2YBTA 4G7FA 1LG2A 5M03A 2C14A 1KNWA 1XL9A 1NY1A 1AA1B 4DF1A 4Z1YA 3P2VA 4B5SA 3MI2A 3SUSA 3I6EA 1FH8A 2ZTJA 2X0HA 5DRIA 1CXLA 1JUEA 1EJUC 4AHQA 5K2ZA 3BANA 3NQ6A 2GUYA 1XYBA 3C3UA 4C7GA 4KWSA 2IPGA 1ITXA 3HB9A 6REQA 5BROA 2A85A 1TUXA 3KDOA 3UETA 3U7VA 1TWIA 1VBHA 1UG6A 4F4RA 4MMWA 3GX9A 1ICQA 1Q3NA 2Z00A 5A6LA 3EWCA 1ZJBA 1P1MA 2MNRA 4M7SA 1RCQA 1F2JA 4ALDA 3DDMA 1ZCCA 1EYWA 2ZZ6A 1IT7A 3VZXA 5DCBA 3NPVA 4LEQA 3I3DA 2Q8LA 5FAGA 1TIMA 1H51A 3VDAA 1IGWA 1TCDA 3HG4A 3DGRA 2G95A 2QJHA 1PYFA 4YTTA 1HJWA 2XHYA 4XZWA 2BGQA 1ISXA 1TQJA 1RXOB 1FVPA 1QW7A 5AHMA 4B2DD 2YJQA 1VYRA 3MSDA 2A3CA 4YLWA 3UPBA 4F66A 3E38A 3IRSA 4PEEA 3VKBA 1M7PA 1J5SA 3CHVA 5FJPA 2AKZA 4O12A 4BJHA 3W6MA 3LOTA 2NSXA 2Y24A 4O1EA 1JCLA 1OCNA 2UBPC 4JFSA 3VMPA 3VPLA 5LXXA 5CPTA 1D8CA 1AK5A 3QYSA 1FWBC 4E8CA 2RAGA 1C3FA 1YTEA 3FHAA 3IUDA 1V0LA 2A21A 4PRRA 3NGFA 1WBJA 4MTVA 4JCLA 3FVMA 4H9VA 2CEQA 1YPXA 3CTTA 3N9SA 3F03K 1G4EA 1UHVA 2GGGA 1FDYA 4PE8A 4R3UA 1SO3A 2AQWA 2JKAA 3M0MA 4UNLA 1XYMA 5F4XA 1NVMA 2RFGA 4I9JA 2BY0A 2Q71A 4HQVA 3CO4A 1CLXA 2VCAA 4IX2A 3BQ5A 4NRRA 1AQ0A 4B9YA 5AB3A 2I9UA 4GX8A 3T0CA 2CBVA 3QKZA 1N8FA 4ZO8A 1YPIA 1JI1A 4BZYA 4DYEA 4GACA 1XFCA 1BWLA 1TV2A 4JNZA 4BWLA 1A5LC 3E5BA 3W1PA 1SW7A 4Z08A 4PMDA 5HA7A 1CB7B 4OV9A 5BNKA 3IK4A 4TX9A 4MUZA 4PUKA 2PLKA 3UXDA 1R0MA 3TLQA 4JTAA 3P84A 4L56A 4BI6A 4O4VA 4MDPA 1E70M 1J01A 4ADUA 2BXYA 1JZ3A 1NF7A 1U5JA 1XQKA 3RPTA 1AL7A 1XCWA 3BLFA 3W7DA 4Q4SA 1I8JA 3T42A 2J9XA 3VABA 3NZGA 2QV5A 3L7RA 4O4WA 4D72A 1UC5A 4HMDA 5HOSA 3DFYA 2PTZA 2PAJA 3WJWA 4UNKA 4K39A 1RA0A 1OGBA 4WOZA 3H2MA 4CLMA 3USZA 4S3EA 2IKJA 3LQGA 1KRBC 2E1DA 1IHIA 4GG9A 5TQLA 1L6GA 2CPUA 4NNCA 4LX4A 1XKJA 3W87A 3PZIA 4LAKA 2V5DA 1UUMA 3GAKA 3FGCB 4M6VA 3OQ8A 1JPMA 4Z1CA 3NL5A 3SCTA 4F3HA 3EYPA 4O17A 3A5VA 1DWAM 4H2CA 2EPHA 5HQLA 6A3HA 3ZLHA 3CH0A 2Z1KA 4KRTA 5FF4A 3WQOA 3TYZA 2DSWA 2E5DA 4ZVJA 4GQGA 5A69A 1OADA 1X6LA 2ZRYA 2VCBA 3WQ5A 3AZSA 2CZEA 4JIPA 4C7FA 2HE5A 3MV11 4LBRA 1KFCA 4AEOA 4N4QA 2QIIA 4NYUA 1KM4A 2V8ZA 3UW6A 1EYEA 4K37A 4F2TA 4H8NA 2VURA 4QEHA 3PJXA 1K3UA 3E02A 2NQHA 4LC6A 4B15A 1S1PA 1E9YB 1RJRA 4DM1A 1M5WA 5HMSA 5HR6A 1QOQA 3C2FA 1OYCA 1UJPA 1WPCA 1EF2A 3AQUA 3GNRA 3NOEA 1KW1A 3L9CA 4RR4A 3W1NA 2DZAA 3OGVA 5RUBA 2INFA 5GNZA 5G2HA 2RJHA 5D2YA 3M7SA 7A3HA 1YLVA 4GI4A 2XFFA 3TQ0A 3O9NA 3IJLA 2J7DA 5M5DA 1E4MM 1BWKA 4LALA 1FHUA 3CB8A 1TMHA 4M6QA 4JFVA 5CZJA 1AH3A 1WV2A 5JIPA 2HE8A 3A22A 1QPNA 4I6KA 4TO8A 1XLCA 1A5CA 4N2YA 2HV5A 3PJWA 5EU9A 4NILA 2G4FA 1G6CA 1QT1A 4HIBA 3PR2A 3OOQA 3W2KA 3PPFA 5K9DA 4ICMA 2DVTA 2QAPA 5CPLA 1I2NA 2VR2A 1XSIA 3KRSA 3GXDA 3CPGA 4LTSA 1NTHA 1GQLA 1F5ZA 3CV6A 2OZ3A 5D03A 3S46A 2W67A 2D3NA 4PULA 4EAMA 1M01A 2J6VA 4EP8C 2J66A 4DZAA 3SCWA 4CQBA 3IJIA 3M16A 3MUIA 2PDKA 2VFIA 4POCA 3VOCA 5CEWA 3R2GA 1DIEA 3KOYA 2WHMA 2ZOXA 1AJ2A 4XBSA 2ZYFA 3GNOA 3LBOA 3I7SA 2BVDA 3ZOAA 3MCOA 3TOYA 3S1XA 1LF1A 3BLDA 3WQDA 3GXIA 1VHCA 3L12A 4WDWA 1RAKA 5I77A 3Q65A 4AZ5A 3VO0A 3GNXA 5A8NA 4GXMA 3WH8A 3A4JA 3P82A 2Y5SA 4QIUA 3S2NA 2OOFA 4A29A 4IMDA 3P81A 4A3YA 1ZSXA 5JH2A 4U33A 5I00A 3RFAA 4KESA 4FAMA 2VFFA 1VCGA 2G97A 3BH4A 3K13A 4A2SA 3TCSA 4A6GA 4KWVA 3ALFA 3AU2A 4KEVA 1KD0A 3RLUA 3RAOA 4MUPA 4PTVA 4Y6GA 3H54A 3KVLA 4WXZA 2G3JA 1XUZA 3BUVA 3SCQA 3PUEA 5LSMA 3WF3A 4Q8UA 3BAIA 2L5HA 1GJUA 4PA8A 3FJ4A 5IM51 2W6RA 5IBXA 3QGVA 1S2UA 4RL3A 4YTUA 1OC5A 3TN4A 4DO4A 3WUFA 1FOBA 2OO0A 5LA0A 1HL8A 4R85A 3TXZA 3UNDA 3B8IA 3TUUA 2V3DA 4JAWA 4X63A 3Q67A 4D6EA 1GOOA 2X42A 2FQIA 1SUXA 3PG8A 4RXGA 2WSYA 3HZ3A 1SZRA 1EUNA 4LUSB 4M3PA 1T0OA 3H53A 3N9KA 4QS5A 1S1RA 2OQYA 1FX6A 4MM1A 1OFDA 3M0XA 4JEQA 1TJPA 2GFTA 3LCHA 3E0WA 2R94A 2BMBA 3AMCA 1CDGA 3G1AA 3W6LA 2V68A 4MJMA 2ZA1A 1S2AA 5CKSA 5IFTA 4UXDA 3HJZA 2PWUA 3BCFA 4PYSA 3TTQA 3UZXA 3AYRA 1FWNA 5EMMA 2WBGA 1E1CB 4NIRA 4D6HA 4IM4A 3LHZA 1W0MA 1XH0A 1FCVA 4IJRA 3PUOA 3RU8X 3TYAA 4RZ6A 3E0IA 2GVEA 2XWDA 2OQHA 1VEPA 2ZDRA 4L9YA 3QPZA 1AFSA 1EWEA 2H9AB 4UTWC 1NP0A 1ZAIA 1JDAA 1F4AA 3DX5A 4HK6A 4Z2LA 5GVJA 3A13A 3DFQA 1J0IA 1VZWA 4GJ1A 4NNAA 3WBEA 4RKAA 5DXYA 1V6UA 4GZJA 3RPMA 4DJDD 4PMUA 1M7JA 4HPNA 4M6PA 4LOCA 1AODA 3VMNA 3IIZA 3L65A 1X38A 2OQLA 3ITYA 3U5UA 4PGLA 5E6ZA 3EKLA 1R3YA 4KBXA 3LY0A 1KV5A 1KBIA 3H6OA 3LPGA 3ME3A 3NL2A 3B8SA 5KEZA 4CU6A 2QDEA 4UFJA 4CCZA 2G96A 3V3WA 1W1A1 1XFBA 3SR7A 2D2JA 4MZYA 3G1RA 3UXLA 3TLLA 3UWQA 1XQLA 1XBZA 5I0DA 3D6NA 3AYVA 3KP0A 4HPJA 2V63A 3CH9A 4X2PA 4ZSUA 3CQ0A 2GJNA 4OECA 3LCIA 4GIRA 2CZFA 4C6NA 4L4MA 1RV8A 1HFBA 1F07A 4IFKA 2VZUA 4HHHA 1AH0A 3IACA 5CGQA 2VZVA 4M24A 4ERGA 4OU1A 3LXBA 1AQHA 2REQB 2WMIB 3ATYA 1L8NA 4Q4KA 4Y8FA 4ZO9A 3NEVA 2CHNA 1QNSA 3WQEA 1TR1A 1P6WA 2QJIA 2E9BA 1RSCA 4O57A 1PHWA 3AXKA 4S3JA 3LRKA 2D2OA 2ASHA 4JTRA 2OYLA 3VC5A 5CJNA 2QCCA 5I09A 1OYBA 2ACQA 1EZWA 2F7FA 2XSAA 4C1KA 1B3OA 1TWSA 2Y63A 3HQ1A 3L67A 1QNRA 4GINA 1O5XA 4BQ4A 1S2VA 3NQEA 2OSWA 2ISDA 3L5MA 3GKAA 3ZLFA 2Q8XA 5HAOA 1FWRA 2QDDA 4A3QA 1GVQA 2FVKA 4MY8A 1HT6A 4HNVA 4WJ8A 2FLIA 2J77A 5BU9A 1QBBA 4NZ5A 1J2BA 3T8QA 2G5WA 2CKRA 1LRQA 1KLYA 2OZTA 3ANYA 4G1NA 1ZZMA 4JIEA 2NT0A 2YZRA 3NQDA 5DT7A 2ZUVA 4MG4A 1YDOA 2ZX6A 3VGBA 5FESA 3DUGA 1KRMA 4K2SA 2GUUA 1V3MA 1EIXA 4LAOA 3VINA 1TJRA 4Y9MA 3RU6A 4UBPC 2PTWA 4IXXA 3DFOA 3CU2A 3VOGA 3AMGA 2A7NA 1WAWA 3S2JA 1DWHM 5LNSA 4NZCA 3UWZA 1VLIA 3ZVIA 1H61A 4G2DA 3D47A 4PBGA 1UIOA 4G8TA 1JXJA 4O1FA 1WX0A 4PRTA 5A95A 4AD0A 1UYQA 4DN1A 1CWYA 3QR1A 3UXKA 3OQEA 3HOJA 5I03A 3T4WA 1QR7A 5CLWA 2E67A 2RJGA 1GJPA 3ZT7A 6XIMA 4I9MA 3GU9A 3VX1A 4TU1A 3VKDA 3KTXA 1SSDA 3IANA 3URQA 2I9EA 4O19A 4LJ3A 3PTMA 4DUVA 3RILA 1HF6A 1VBJA 4XKYB 3WX7A 3UWEA 1ZHAA 1YNPA 1M04A 5G2IA 4H19A 2QMKA 3A9IA 3GSMA 2W66A 3FSTA 4LWWA 2TRSA 3N4FA 3N3MA 3R13A 3B3DA 3UVIA 4RJEA 4E4PA 3WF0A 2BHYA 2H3BA 4TVUA 3EXRA 2VGIA 2GGIA 4QFUA 3D3AA 4GRSA 1JAEA 4NUWA 5DCDA 3OLDA 4B90A 1Z89A 1REQA 3S47A 3GFZA 4F9DA 3N12A 1LLWA 1GPFA 1OC7A 2NLIA 3AXIA 3UY8A 2G3IA 5DY2A 3M0JA 4KEZA 3L2LA 1WCGA 3CNYA 3FA5A 2VOMA 1BG9A 1T96A 1A5NC 1LWHA 1WDSA 3TONA 4DJEC 4E6MA 4Q4QA 3V16A 2NX3A 1VD6A 4ZB5A 4S3AA 4FLOA 1E0WA 1GNXA 1MYRA 1MXDA 4QLKA 1DVJA 1H11A 4S3KA 2W79A 4S3BA 1TTIA 3OLGA 4UQEA 4C6PA 5K4XA 1O66A 4IPPA 2W91A 5IRPA 2EO7A 2Z2UA 3GY1A 4AVNA 4J3SA 1S39A 3MWAA 4PMZA 2A3AA 3E6EA 3VDCA 3INPA 4NI3A 1DWFM 4CN4A 1Z48A 3EX4A 3GS6A 3GTIA 3Q2DA 3RCYA 2I56A 3GFXA 1KQZA 1Q85A 3ARXA 5TIMA 4LV9A 1US3A 3VGHA 4JX6A 5K9XA 3VNZA 3VIMA 3PBMA 1C7SA 2HRWA 2Y7EA 5ABFB 5DO8A 4B4FA 4O1BA 4LVBA 4B16A 3VDBA 5F1VA 3RLHA 3VU2A 1D2KA 5D37A 3RUBL 1TPDA 3DBNA 3MMUA 3ZR6A 4UMCA 1QI5A 3TFXA 5E93A 2QV4A 3WQCA 1Q63A 1TTQA 2JK2A 4U3AA 4I5UA 4XAGA 4W7WA 2VZTA 2PD5A 2Y0FA 2AL2B 3LTYA 4PB3A 3K30A 4TOQA 3QH2A 4WJEA 3TXVA 3UCQA 3SRHA 2O9RA 3P60A 3CZLA 2EPLX 2ZZ5A 1BTMA 3EWXA 4O0KA 1X98A 1ZBWA 5HXMA 4MWAE 1F4HA 2YCIX 4P7RA 1TPH1 3PNZA 3NL6A 3AXXA 1YXDA 1NU5A 3BG3A 4I6VA 1B5TA 1QI3A 4DYKA 4R5EA 5D09A 1JFHA 1XG3A 2FGZA 4V15A 5HPCA 5GPRA 4EXBA 4FNRA 4BQ2A 2ZUWA 4ONVA 1DL3A 4XBJA 1PX4A 3WLRA 5LXEA 3LNMA 4ML4A 1RH9A 2J9ZA 4QSFA 3R8GA 1NH6A 3DOPA 3GH5A 1JDCA 3LD5A 3E0VA 5D4YA 4QDPA 3HMJG 3GXFA 4LUTB 4IQJA 3QC0A 3R94A 1XD0A 5C7HA 5EL1A 2XGZA 4HA4A 4KCTA 5DF0A 2B4GA 4Z2GA 4AXNA 3TU9A 2WKGA 4X3ZA 4D8LA 3WQGA 4PUDA 7PTDA 3GR8A 4UFKA 4D6CA 3MBFA 3UWYA 4E8DA 4L61A 4L9ZA 3TYDA 2OJPA 4JX5A 5EBUA 4NYYA 2PLCA 4AD4A 3JZEA 2CKSA 1BYDA 1SFJA 3O0KA 3A4AA 4AWEA 1F6PA 2QNEA 4GO8A 1H1NA 4O50A 2WZHA 1RALA 1HO4A 1RQEA 1S3TC 3KHDA 1J11A 1JQXA 3G77A 5E70A 3RX3A 2DUAA 1BXCA 5IHRA 3FYYA 4H01A 1SSGA 2HNEA 3LU2A 2AMGA 4DJFC 3CK5A 2VVSA 5DXXA 3APYA 1GTHA 3TQKA 1YDVA 3G6MA 3R8RA 3C4UA 5HMDA 3B0PA 3TW6A 4JD4A 1Q6CA 1XGEA 3M5ZA 1UQZA 3NQFA 3L0GA 1LOLA 1UP3A 1PAMA 3C3NA 3TW7A 2J9YA 3G22A 6ALDA 2DUZA 2V30A 4EPBC 1ZJHA 4U10A 2DJXA 3MP3A 4JQ3A 4UMAA 3B9OA 5BW6A 1F8MA 3WEOA 4LF2A 2WK2A 4YU1A 3P3BA 3HGJA 1BPLB 5AZ1A 3GZAA 4G56A 2VR4A 5AC5A 1PKYA 4FNQA 2DUXA 4WXYA 1R9ZA 3B9NA 1XW8A 4W9TA 4HKPA 3GFYA 3GBDA 4AY1A 3KTSA 2ZUSA 2GK1B 4ZOBA 4P61A 2J8GA 1KR1A 4P8VA 4DAFA 4JNYA 1F74A 3CQIA 3KOXA 2WXDM 1RY0A 5JXQA 2WCSA 4J3WA 2QHAA 4HU0A 2IQTA 2J25A 2IPJA 2FFIA 3H4WA 4LANA 2DQXA 4LUYA 5FJIA 1MRQA 5LIXX 4I9AA 3WBAA 4DWDA 3BJFA 1RD6A 3SFKA 4NNBA 2QULA 2EJ1A 1UD2A 3T0DA 2OX4A 3DKLA 2PWHA 5BOEA 4PUNA 3W27A 1QWGA 1KA9F 3ANVA 5FD0A 5G5IA 4MKVA 1IXQA 3GG0A 2A3EA 3GXNA 4FXFA 1J2WA 3ARRA 7REQA 1DIDA 3CAQA 5BXRA 3N2TA 1B31A 6PTDA 3EXTA 1DJHA 4IZGA 2X1TA 1X7IA 1XV8A 1E6SM 1EDQA 3ZVHA 3A64A 2VM8A 1R46A 3QN3A 4Q8TA 4GPNA 3PUGA 2ZX5A 3PUDA 2JE8A 2C3ZA 3MYPA 3ZS4A 2FPVA 3URBA 1F3XA 1QUMA 4AMCA 3WNNA 1GCYA 4QLLA 1KKRA 4O14A 1A47A 1JZ4A 1EJWC 4F2UA 4MJZA 3TN5A 1I75A 4GNJA 2E7FA 3T6CA 1HKMA 4H9MA 5LIWX 1KC7A 4Q6JA 3QGKC 4LUJA 3SO7A 2BXVA 1W8SA 2CLFA 4C6EA 1ISVA 3FCPA 3Q37A 2YW3A 5FL1A 2UWFA 4RX0A 1E9ZB 1I9CB 1ZRQA 1XYCA 1P0NA 3AI0A 4JKMA 3GTFA 1J8VA 2RH9A 3FFSA 3M5XA 4X2RA 2WMGA 1ZTVA 3EKZA 2PGFA 3GIQA 2BTMA 1V6TA 1WZLA 4LUIA 2CBJA 3GHUA 4HU4A 3ZJ7A 4HBKA 1SJBA 3PZGA 1UWRA 3O63A 2A1YA 3ZLGA 5A8MA 3WNPA 1MQQA 3H12A 1DE5A 1MNZA 4CKQA 1N2VA 1RLDA 1Q13A 3WMBA 1TPVA 3IIVA 2PS2A 3A3HA 3B8DA 1Q5MA 4WKFA 2R82A 3AZRA 4L5ZA 4L1WA 1KQYA 2FGLA 2VJXA 4RNJA 3UWVA 5FJOA 1EXPA 1LLZA 4RLIA 3TWAA 2Y7GA 4PL1A 2J7GA 4C6DA 1XHGA 3OZOA 4GBDA 3PSVA 1M6JA 3WEMA 5DEZA 4H8VA 1BG4A 1QU4A 3B9AA 3MSYA 2V0TA 2H6RA 3H2AA 3MT1A 4CNSA 3QZAA 1HL9A 1RBAA 4Q32A 5KSWA 3BDKA 3CV7A 2A79A 3CM4A 1VJIA 2EQDA 4I7WA 1O95A 1FWWA 4H83A 3KL5A 1KCKA 4H8UA 3H7UA 3ABSA 3QYQA 4DELA 3L2IA 2E28A 1WKYA 1IQ8A 3DYPA 3ARSA 2QKFA 3SCPA 1DTNA 1RPKA 1U1HA 3DG3A 3L4ZA 2ZZ4A 3QVQA 9XIMA 2P1FA 5LGZA 3JRKA 3LUTA 3LGEA 4X9SA 2WHLA 3COTA 3BV4A 3W37A 4JFWA 2NV9A 2VRKA 2QDGA 4E0CA 2YLLA 3SRDA 2VEFA 5CC5A 5HNTA 5I06A 2BV9A 3GD6A 1J79A 2O0TA 4UTUA 4HT3A 1P7TA 3M9YA 1QOPA 1R2RA 2ZWYA 4WGHA 5DLCA 1R7AA 3ZR4A 2GJXB 3BSGA 1UQYA 2QCLA 1XPYA 3AMDA 3VD5A 3BZJA 3P74A 1JGIA 3TR9A 2XINA 3GIPA 2VRQA 1OFQA 1MSSA 2JF6A 3THCA 3GUWA 1O6IA 2E8YA 4Z2IA 3S1UA 3HQOA 5HJLA 3CZKA 4TTGA 4N9CA 1HIZA 2R9RA 2Y6ZA 1Q6EA 3K8MA 1AMYA 1BF6A 3L0NA 2OZ0A 1IE7C 1W9XA 2NQ9A 1QATA 1HKKA 5M2FX 3UEQA 3O0FA 2IS7A 3QJAA 4A8LA 3W2NA 4O1CA 1EJVC 2OO6A 4W5UA 3R1ZA 2X7WA 1FFRA 2QMJA 3NWRA 2EF9A 4Y7EA 1OF6A 2BVWA 1VGAA 2OU4A 1QXLA 5D05A 1H5YA 1UKSA 4E3VA 4MFEA 1HTIA 4AZGA 3UR5A 1W1ZA 4V1YA 2WAGA 4BEQA 4HU8A 1OQFA 3VC6A 4I3GA 2FJUB 1K8YA 3RIKA 5H91A 4A22A 2PDIA 1M1BA 1QI4A 3W24A 4EXAA 1U22A 4GUHA 3M43A 1E0UA 4BY3A 1WZKA 1E0TA 4HVXA 2QT3A 3NOYA 3ZJKA 3WD2A 3RHGA 1A5BA 4BFAA 2CWXA 4PC8A 3LI0A 1H7PA 1WKEA 3BW2A 1Q7ZA 2WNQA 2ATSA 1BVWA 1U1JA 4GYFA 2YLAA 1GVFA 5CGMA 3N29A 3GYCA 1XRFA 2PGRA 1YDNA 2WMFA 1PVNA 1IXOA 5CAHA 2W4XA 2P8BA 3K4WA 5ABHA 5CC7A 1BD0A 1XIBA 3MP4A 4ASTA 3WH5A 2ISWA 3URAA 5MHBA 4RDVA 3V5CA 3DGBA 3ARQA 5I5RA 3CL7A 5HDRA 4CD7A 2PRLA 2XN1A 3W85A 3TZFA 2VXNA 3MI6A 3N3TA 2YIHA 3VOFA 5LIYX 3R12A 5AHLA 2QCHA 1DJZA 1XYFA 3BSMA 3L4UA 3VE7A 4ENLA 1G4PA 1YW1A 4F0HA 3VA8A 4FF7A 4X22A 5LNVA 4JTEA 5EPDA 3TMQA 1R38A 2WANA 2HXTA 2YOCA 4WKHA 4DBEA 1KRAC 1U5VA 3LXAA 1X6UA 1S2WA 2C6QA 3OA3A 3TC7A 3LSBA 4XUYA 1HZYA 1HKWA 4JQ1A 3W7RA 1DORA 2BHUA 1W1YA 3S0CA 3EDEA 1PUDA 1AZ1A 3U8GA 1JRBA 3OG3A 1VLWA 2XIOA 2PPGA 1EGVA 1Y7VA 1EHNA 1E15A 1H41A 4GUFA 1PDZA 4E3TA 1HVQA 2OEKA 1KBJA 4WGXA 1H1YA 2VEMA 2X0YA 4MNLA 3AIEA 4NXSA 5DBTA 4KIEA 4IISA 2HCVA 1L6FA 4P5UA 3U9IA 3M0KA 4PTWA 4W8AA 4UQBA 1TPEA 1NP2A 4QQUA 2NUYA 1BAGA 3S5YA 2P10A 1C8VA 3BICA 5LA2A 3BL3A 2R1PA 3FLUA 4N9EA 1MZHA 5F4SA 1F73A 1QHZA 2YBVA 4PMQA 3GC5A 2Z1XA 3QV8A 2DQWA 5C55A 3N4AA 3BW3A 2GLKA 2HVOA 1K7FA 3BQ6A 3LQLA 3VNLA 1BQCA 3HMCA 2ZDSA 2FB3A 2MUCA 4C60A 5AYZA 3RNDA 3TN6A 3IJ9A 2W63A 4GYPA 3DENA 1PJ9A 1S2CA 5D9MA 3BLOA 3MHGA 1SVDA 2W92A 2GVGA 1GK8A 1C8YA 1PZ0A 2BHZA 2QJGA 1LOQA 1D3CA 4GKTA 3EPMA 2A3LA 2X05A 1BRLB 1PE1A 3S1VA 3PBUA 3XINA 1XBVA 1TV8A 3EGJA 4G1KA 3F4DA 3OLEA 1KKOA 2ZIDA 4IWWA 1SZGA 1A80A 2WC3A 2VGGA 1TWZA 5CQ1A 4UCFA 2C91A 3I4EA 2J7CA 6XIAA 1EEXA 1Z3NA 2GWNA 5C9WA 3WN6A 1KR0A 4N9BA 2HBXA 3GVQA 1SO6A 3H8AA 3TFCA 3ALGA 2GQ8A 5E0KA 5JMUA 4CNOA 1CGVA 5A8GA 4LS0A 1KXVA 3MMDA 3ZSTA 2R1KA 1W91A 3OBKA 4IL2A 3DKJA 2NQJA 1ZJAA 4KKXA 2BOGX 5AVNA 3CUHA 2CCRA 3GXTA 2IPFA 1V3LA 1Q6FA 4D6DA 5I07A 4J4KA 1K9DA 1FKXA 2FDSA 3WLTA 2KAUC 2EG6A 4JIHA 3GU1A 3NSNA 2FTYA 1JUBA 2WW5A 1VF8A 4IICA 3AIQA 1PWLA 1Y8BA 4FALA 1EJXC 1JPHA 1H7WA 3TJ4A 2PC8A 3VNYA 1AQMA 2C8NA 3GIYA 1W5MA 4ROQA 5JVLA 4XZHA 3ONBA 2GGJA 4N0RA 3KDNA 1XIGA 1DHPA 1M7XA 1XIMA 1J0HA 3ZMRA 4IFRA 3I7QA 2GUBA 4HA0A 2PWEA 4UCGA 1O94A 2QVNA 1JI2A 3G3DA 2R1NA 4MIMA 1DP0A 4LVFA 3TYEA 4IG2B 4J5NA 1W3KA 1LL4A 5TAOA 4GVHA 3Q94A 1JDFA 2D69A 1RY8A 1L2QA 2GJPA 5K9CA 1WKFA 4GQRA 2YL5A 2RUSA 4JTHA 1XLBA 2FVMA 1ESWA 4IUGA 4H9TA 2VD9A 4US5A 3LHTA 4DLMA 3EWDA 1DJXA 5BWFA 3AU6A 3IGHX 1PZ1A 3F5KA 3PP7A 4OJYA 2Y89A 3VNIA 3ZXWA 2WB5A 4N6EA 3AIUA 4XB3A 4A3UA 4BKNA 3NZPA 5GJPA 1FCBA 1U33A 5ABFA 2CXGA 2BWGA 4HOWA 1ECEA 5FEZA 4Q6XA 4BQ5A 3R0DA 5C9XA 3LPFA 1W17A 5TD4A 3QQWA 2GSEA 1V6YA 3FVDA 4LRTA 2OOGA 3C8NA 4QHRA 1ME7A 1AL8A 1KV8A 4TXEA 3RK8A 3ZWSA 3KLKA 2BGNE 4B5UA 3IARA 3ONCA 3BV7A 2NUXA 3W22A 1EXBA 4QROA 3AUOA 2WJFA 2HWGA 3C0QA 2FTPA 1FP8A 1UR1A 1VFHA 2J7FA 2PWGA 4GYJA 5AHEA 4OIFA 3MU7A 1KXQA 3B9EA 2AL2A 2JEQA 1NFPA 3SEPA 4RE0A 1DIOA 2VYOA 2I16A 2WVVB 4AZ7A 5D9PA 2NVCA 4XAPA 1VCVA 2ZFAA 1BQGA 3AISA 3G8RA 3SQMA 4DY1A 4L1GA 1Z44A 5BMXA 3POHA 1CYGA 1HKIA 1D7FA 3LHUA 1K7XA 2DZUA 3PG9A 4M82A 4F2BA 4NXKA 4L6OA 1QAPA 4NT0A 4JTQA 3F2CA 2E8ZA 2HS6A 1XH2A 1ZS2A 2QIWA 3M0YA 1FA2A 1GORA 2YW4A 1KM6A 3EOEA 3IGXA 3VKCA 1OD8A 5E0FA 8XIAA 1U83A 1RVKA 3ARVA 1FFQA 4IIFA 2WZTA 4NL1A 3NM3A 4EIVA 2WNWA 3FJ6A 4TX6A 1E40A 3S8HA 4TV5A 5DFAA 1EPXA 3GDRA 3W25A 3T4CA 1BHGA 4YJ5A 4PUEA 4PMXA 4CD8A 4YVXA 3UZWA 4M0XA 4I7VA 3PVFA 4RV3A 4H9XA 3TE9A 3UJEA 1CX9A 1XP3A 1F05A 2E5CA 1KTCA 5AVHA 3VGFA 5TBOA 3IEBA 4P7LA 2EJAA 5ABEA 3HIJA 1V7YA 2FHCA 2HS8A 2DT1A 3EWUA 5FI8A 1EP1A 4QNEA 1IZJA 4W89A 1RJPA 3U5YA 3BGGA 3NQAA 3WH6A 4JEJA 4CCDA 1B4EA 4ATDA 4NJIA 4NSBA 2OFJA 4JYDA 4U2YA 3BE7A 3NZRA 3OIXA 2B7OA 1EPVA 1XGDA 4LVDA 1WXJA 2FH6A 4MF4A 2NV2A 3NCOA 1Q6RA 3FXYA 2WSPA 4R34A 3RGTA 3VIJA 1CGYA 2NT1A 3ES7A 2YFNA 1VPXA 2Y7FA 3PAJA 3OP2A 4H9YA 5IOBA 2P53A 3CTLA 3N6JA 3WD3A 2W5FA 4W8LA 4DJDC 3I10A 1R3SA 3AWNA 3TV8A 4EX4A 4R9OA 3UJRA 4Q4PA 1VC4A 2Q3OA 4FB7A 2FZ9A 5M1TA 1JRCA 1GVYA 2CWNA 3KCLA 3MUCA 3NO5A 1MFUA 2VDIA 3DG6A 3MHFA 3N34A 3ELFA 5F1UA 4LBUA 1H50A 2XPKA 4R7WA 2YDSA 3HPZA 2DDXA 3DERA 4HTYA 1CLVA 4JTFA 1OT2A 1A4LA 4UR7A 1J10A 4CU8A 1ZJIA 1KGWA 1H1ZA 1QPKA 1SFLA 1JXKA 3PZNA 2VWTA 4FR6A 4YYCA 4M5PA 4F0MA 3WBYA 3K8KA 1VPYA 3WK0A 2DH3A 3G0SA 3TR2A 4L1XA 4E4FA 1E9IA 3P67A 1KM3A 4W4QA 1R7OA 3TJIA 4ZQCA 2QDHA 2G4JA 5B7YA 4ATWA 2OYMA 4ZQOA 2ZXBA 2ICSA 4ICNA 3WD0A 4MB4A 5AC6A 4EPDC 3QXBA 1PZ2A 4AYSA 2GQ9A 4S39A 1LQ0A 3TNOA 3UJSA 2OODA 4FZIA 4JPGA 4UIOA 4Y9AA 3OPSA 1OB0A 4NZ3A 3PZVA 2A3HA 4DXVA 4S38A 3NDOA 3DFHA 4AFYA 5EB8A 4K8HA 4LS1A 4KRUA 3U4AA 1RK5A 4OWGA 1JNEA 3SGZA 3MC5A 1GQJA 3CIXA 4YTSA 3DHDA 2V81A 1V3JA 4Y9NA 3EA1A 5D2TA 3GDKA 4FEZA 2YA0A 3H22A 5BRPA 2I17A 3N2MA 5DQPA 3U3HA 2YCJA 4EWJA 2YCLA 1QK2A 4M80A 4M1RA 4XO6A 3UA3A 3CZGA 1TJ0A 2Z7GA 2AGKA 3VIHA 3HBLA 1RD5A 3WLKX 5XIAA 4D6GA 3C2YA 2ZTKA 1MW1A 1PIFA 4NAEB 3EB2A 3W7IA 1OBAA 3W02A 5KETA 1IGSA 1JULA 2VFHA 2X16A 2BY2A 4PSPA 3PPCA 2PURA 1GGOA 4LB3A 3CEUA 3F2DA 2BXZA 4X61A 3O6CA 1MMFA 3T55A 2F8QA 4ZXOA 1K1DA 3LI1A 1NF0A 3FDGA 1DXFA 2GL5A 1YADA 1L6YA 4IPLA 3FYPA 1Z42A 2OLHA 3N4EA 3U57A 2ADAA 4DBWA 3AROA 3CYVA 4L64A 5GQBA 4K38A 3I3BA 2IKGA 4S3FA 3TP4A 4GUIA 5F4WA 4NKCA 4AG0A 1MEWA 4GH1A 4KFNA 3W84A 3W1AA 3AUJA 4P8UA 1C29A 1IEVA 4IJCA 5AHFA 3S83A 1R9YA 3ZWTA 3TTYA 3NJ3A 3EX1A 5DMYA 4D8ZA 4E2DA 1Q65A 1XKYA 3GE7A 4IOTA 4QE4A 2A6LA 1Z9AA 4HHMA 1NDYA 3C52A 3UPMA 4G6CA 1S38A 4NAFB 2C71A 3F4VA 3VM7A 1LWJA 3G1FA 2A3BA 4MOZA 5JU6A 2YZ5A 1K9TA 3UYIA 2XFRA 1X97A 4O8RA 4I90A 1UR3M 3V0TA 3HV9A 2QYGA 3CUJA 1CGWA 2HBVA 3AS1A 3KCJA 2IPWA 5LZLA 3BLPX 1VCFA 3SURA 3QZEA 4EAYA 2OCZA 4HJWA 5HWNA 3C61A 4PMVA 4ZFCA 1K70A 3L4XA 4L4LA 4PMNA 4GX9A 4GUJA 4AYGA 4QX4A 1WAUA 3B03A 4XKMA 3SQSA 4ZB0A 5FF7A 1BEUA 1ZBCA 3MJYA 1UD4A 2UY5A 4LSBA 1W1IE 1PKNA 3UD6A 1UKPA 4UWMA 4UR9A 2CLMA 1GVOA 4YTQA 2V5BA 1TA3B 2OR2A 5U7SA 1W3NA 4WRHA 1CNVA 1GVSA 3L5AA 1RK6A 2OWXA 4IX0A 1ZENA 1CGXA 4LVAA 1FTXA 2V9DA 3GDLA 3CUXA 2C79A 4HJFA 2YX0A 1FBAA 2XGBA 5HQEA 1CIUA 3WZ0E 4GCXA 3AHZA 4A3HA 3UA4A 4LRSA 4DEFA 1I0BA 5FA5A 1YBQB 2F61A 3GG8A 3QQ1A 2OYKA 5A8OA 4RNHA 3PZMA 5ABTA 3MWCA 1PXGA 2FFCA 2PP3A 1B3VA 2W9MA 1KM2A 3R6IA 2PDBA 1FCUA 3AZTA 2Y2WA 5A6TC 4X9YA 4BHYA 2GQ3A 4LB4A 4MB5A 1OIMA 3PTKA 2GOUA 2ZCGA 3RRXA 4MZ1A 4Z1AA 3NZQA 4YVPA 2AL1A 4WF7A 2IXVA 1M68A 2GJXA 4JDBA 5CSYA 1G4SA 2Z1SA 4K7VA 2A7PA 3W83A 4AHPA 1TG7A 4IGHA 2OGJA 1R5YA 3G1HA 4HMNA 1DEDA 3TDFA 3CL6A 4TX8A 3PY2A 4K36A 1LUCA 1X8FA 4RZ5A 4UTTA 2C19A 4MWAA 1J4EA 3NA8A 2YR1A 5GJMA 3SAZA 2D20A 3F1QA 1UD3A 3N04A 3THAA 2C0AA 2GGHA 2R1MA 1RR2A 1EJ7L 3OO2A 3LRLA 3W7CA 1PB0A 2XH4A 3EOSA 4GIYA 1WZMA 2FHBA 3AS3A 2WZIA 2DIJA 3W74A 1O1HA 1KCXA 5HBFA 3S5OA 3CIWA 1PTGA 3H70A 4QSHA 4Z2HA 2XH2A 3UJ2A 3DCPA 3MBDA 2I5GA 5DCEA 3S2LA 1XSJA 2E40A 4W87A 1G7VA 5L9FA 3BJTA 1B57A 3TZNA 1QHPA 2VHLA 5BXSA 2RKXA 1B1YA 2JQXA 4W5ZA 2JKEA 3NGJA 1CLKA 3MO4A 1IWBA 1UD5A 3ES8A 2QZRA 4XUGA 4IIBA 3W82A 4FIRA 3IRDA 2NLYA 4I8YA 2VI0A 2ESCA 1OX4B 2CLLA 4REQA 4ZGYA 1IIGA 3O7UA 1W1TA 5JH1A 1H7NA 1E4IA 2QUVA 4S3GA 1FWCC 1OFPA 2ZXAA 2Z2BA 4LGXA 1ZALA 1H7RA 3FS2A 2PBOA 1H63A 2F2HA 1V6XA 4AC7C 4C1NA 1OCQA 4CNUA 4CN6A 3TX9A 1W9BM 1R2TA 2GZXA 4WQ6A 4YL2A 4DUWA 1W1VA 3KBJA 5REQA 1WA3A 3GZ3A 3FV9A 4AW7A 3O3RA 1WO2A 3A4WA 3U0HA 3V5FA 4RDWA 2BP1A 3C86A 2JBMA 3STFA 3WJZA 5MF5A 3ABXA 3BG5A 4JIRA 2VCCA 3M7WA 4BR1A 1JD9A 4LYQA 4G5DA 5EFDA 2JGQA 3W4RA 5DX7A 1QO2A 3WD1A 3UBPC 4FR1A 5FL0A 1R6WA 4WHBA 1XF0A 5LNUA 1OF8A 1HX0A 4CUCA 1TQXA 3MTWA 2ZC8A 3GHRA 3CB3A 4PUUA 1EO5A 4IT1A 2FMOA 3VILA 1HKVA 1EKOA 1HJXA 2ISVA 1RPXA 2ZUTA 3MO7A 4E38A 3CMFA 1ZBVA 3PZ9A 3NDZA 1WDDA 3DECA 4KRZA 3MSRA 4PUJA 3KLLA 1OABA 4UC5A 1GOQA 4V28A 8XIMA 3TAKA 1JL8A 1FWGC 1DHKA 3DYMA 1UZ1A 4OV4A 4J3VA 1P5BA 1VIZA 2EKGA 4F9JA 3D0CA 5C2GA 3W75A 1UPMB 2GJLA 4OBTA 1V6VA 3MVTA 1CW2A 4JTTA 4K8GA 3ID7A 4ZA0A 1I45A 3AIRA 3KCOA 4PFMA 1W54A 1EB3A 3WLOA 3FJNA 2NQZA 3LM7A 4OQVA 3WF4A 1XYZA 2V2HA 2Y8UA 3PHAA 4MPQA 2HPIA 2CLEA 5A8PA 2VC7A 1W8GA 4RPPA 3LLDA 3IVTA 3N14A 3QM3A 3GK0A 1PX8A 4GI9A 4UFIA 3O8AA 4H1ZA 4HK5A 4PMRA 1PCKA 3SGUA 1XLAA 3OZYA 1WDPA 4YCOA 1ICPA 4C6LA 2WJEA 1E1EA 2PRMA 1MEIA 2OSXA 1E6RA 1IYXA 2Z0IA 2DFAA 3ITGA 1YKWA 2XN0A 4UMBA 1IR1A 3ARUA 1P6BA 3RRAA 4MGGA 3SB0A 1PIIA 5AOUA 2ALDA 2B7NA 3U2CA 2QW5A 1BKSA 2NXHA 4JN8A 4J2PA 1XCFA 4NJHA 1WDWA 1QNOA 5CJ5A 2VOTA 3UP8A 4MDOA 4DWSA 2YB1A 4H2HA 4EANA 2Q01A 3CUFA 3S1GA 5CPMA 1R85A 1SZFA 4RZBA 3AICA 9XIAA 1MNSA 3AHVA 1MUCA 4PR4A 3CGTA 3HPFA 3VIGA 3SRKA 3WLLA 2F84A 3LA4A 3KRZA 3M4HA 4GD0A 2I7GA 1C8XA 5CCZA 4AH7A 4D6IA 2CZDA 4C6MA 4GZEA 4DQWA 2HMCA 5AFDA 4FSAA 2XTKA 1G4TA 4RXFA 4R7JA 3CZEA 2G3FA 3KS5A 4Z42C 5A6KA 1E0XA 5A2CA 2EPNA 7ODCA 3PNUA 5E09A 5FEXA 3VFLA 3IGUA 1NEYA 2O9OA 2HZGA 3KZPA 4CNTA 1IZCA 1VEOA 1GHSA 2FB2A 3S5SA 4DYJA 4B4HA 1UD8A 3WL1A 2PCEA 4QDMA 3NM1A 2BY1A 3WF1A 3WLNA 4P7QA 4J27A 3T78A 3KE0A 1NELA 3W1RA 3DC0A 2JIWA 3GXMA 1W1B1 4UOQA 4B5VA 2VVNA 1G01A 1VRDA 3DI1A 4LVGA 3UGRA 3AWOA 2DT0A 2PP0A 4TTUA 5DN1A 3OGRA 2V5LA 4MVAA 1NWRA 3SRFA 1OFBA 1O1ZA 2H3DA 4FNTA 4AU0A 3GDMA 4QAIA 2V38A 2QPUA 4C5ZA 2NSOA 3BAKA 4JFTA 5C8BB 1WOBA 2C1HA 2BG5A 3O2LA 3DIPA 3STCA 1EEPA 2EKCA 5FKYA 1TTPA 4GZIA 3VD9A 4DO5A 1FWSA 3LYEA 3EEZA 1TVPA 3W53A 4JGDA 3S2CA 3C6CA 3W7GA 2JIEA 1XD1A 4FF5A 2O4MA 4EXQA 4IQDA 2DSVA 1XH1A 5LHFA 5A3HA 2E6AA 3VIIA 4MSSA 1GEHA 3ZO9A 3T0TA 3RG6A 5CBBA 4P7NA 4HZ8A 3SIZA 5CZTA 5CLTA 1VKFA 1RBLA 5HNRA 4YIWA 2GSHA 2ODOA 4HD5A 5DMLA 1RCXB 1EDTA 2G3NA 3IVUA 4H7VA 4HU3A 3EEGA 4WUIA 3FEMA 5EY5A 4QISA 4C65A 3LZ3A 2F6UA 3QFEA 1UR8A 2CYGA 4J40A 3KEHA 4Q4MA 3EBVA 2X7VA 2BY3A 1KCLA 3W2LA 2BOEX 4GLEA 4RPQA 1PIGA 1TJ2A 2F9RA 5AHNA 1T8QA 3WH9A 2XIIA 1J96A 4ZEPA 2WSRA 2Z25A 4MPKA 3U48A 1E43A 4ZB2A 3P8JA 4PCSA 1FWIC 3ITTA 1BF2A 3G0UA 4R7OA 4LCRA 3EWWA 2WLYA 4A4AA 3GH7A 3R10A 1ADDA 2ZA2A 1NSJA 1SMDA 2WVVA 1PPIA 1VIWA 4Q33A 3WDRA 7TIMA 2ABAA 3M41A 3CEPA 2H90A 1E6XM 3REQA 3QHMA 3SN0A 1GZJA 4NF7A 2ZZ2A 4K8EA 4GFIA 1LLOA 5DBUA 4RE2A 1UIPA 2AKMA 3PAOA 4H6RA 4JIQA 5AZ0A 3LV5A 3LLXA 9RUBA 1M7OA 4O15A 2PDHA 1E9LA 5KITA 1LORA 4J3XA 4D1JA 3RJYA 4M19A 4HN4A 3BARA 2Y88A 4ZTYA 3WQWA 1EX5A 2BVTA 1LP6A 1Y65A 3V35A 2O56A 2MANA 5AC8A 4H6KA 1ONRA 2OEMA 3K1GA 3T8LA 3SCUA 1JCNA 4FPSA 2PCQA 2EG7A 4LC8A 3W2JA 1UOKA 1EFZA 4AZ6A 1BGGA 2YBUA 1ADOA 5I2UA 4D8AA 3TTSA 1N8WA 1X1OA 2C1GA 2E09A 5FF3A 1LJYA 3WNMA 4KCUA 4U31A 1JPKA 1F3EA 3BG9A 3TQVA 1XXXA 2Z1VA 1GUVA 1TO3A 4H00A 3M47A 2Z1BA 5CXPA 5I79A 1HGWA 3MW7A 4JQ2A 2VUYA 3FK4A 4I9TA 4KPLA 5H1WA 1GW1A 1PDYA 4JTSA 2PZ0A 4RDZA 3R5EA 3CXOA 1VJSA 1Y5VA 3E12A 1VBUA 4XK2A 4QQ3A 2OT1A 7XIMA 3AS2A 3UFYA 4O0QA 3KOFA 1NARA 3T81A 2XVNA 4B9ZA 1TRDA 1KLZA 1QMLA 3ITOA 1WYIA 1DXIA 4O1DA 1V3IA 3OYZA 3GHSA 6ENLA 3WUGA 2WVUA 3UT0A 7TAAA 1ODZA 3NSMA 4N6FA 1XLEA 3LMZA 3VGEA 3QPEA 1PV8A 4OVXA 1XRVA 4XZ9A 1S5MA 3ERPA 4QR6A 2D2HA 3SUWA 1ZAHA 3G1XA 3H7VA 2VFEA 4GJJA 1C8QA 2YSWA 2PA6A 4NJJA 4EWND 3R25A 4DM2A 2IXUA 3PZUA 3W7LA 5JBEA 4LQ1A 3TAOA 2XIJA 1UJQA 5PTDA 3LCGA 2PRHA 2J74A 5B7ZA 4GGBA 4AISA 3QMRA 1I4NA 2B31A 2J79A 4JDYA 2ZQ0A 3A24A 2JF7A 2OVLA 3WJSA 1FP9A 3W1XA 4ZODA 1MW0A 1K7EA 4YN5A 3VDGA 4F0LA 3GTXA 4UOJA 5K7JA 1GVEA 4GY0A 4FXRA 5CBIA 2FZ8A 3BLKA 1PWMA 5D2VA 1R87A 3PJTA 3W86A 3O6AA 3QTGA 4CD5A 1R3TA 3DBPA 4HHPA 4Z2KA 2PF8A 2CLIA 5BOFA 1JZ5A 1NWUA 4IPNB 5G4HC 1XRSA 4L4OA 4DHGA 2ACSA 3WH7A 3VTRA 3A23A 1UWIA 2WMKA 1A3XA 5H6HA 3NXFA 3TSMA 3KVMA 1VAHA 4JFUA 3ABQA 3O6YX 4XSLA 1I1WA 1YIXA 4DB7A 2WMHA 1GOKA 1XIJA 3O1NA 1OX6A 3BLLA 5KZ6A 3VIKA 3RR4A 1ITQA 4GK8A 2XGIA 2VC9A 1U1UA 2UV8G 3MUXA 1GVIA 3KRUA 4YVVA 4C7DA 1GG0A 3NPUA 3WQPA 3L4WA 3O6DA 3TC6A 4Z1BA 3DN5A 4ML9A 3GKFA 3MPGA 2D0HA 3MKCA 3R0UA 5CPOA 4GCAA 1CXHA 1A5UA 2OXNA 5CSUA 3G1SA 1JQVA 1WDRA 3K46A 2WZEA 2VX4A 4BF9A 4BF7A 5I23A 4R53A 2PDFA 4RW5A 1GEQA 1SJDA 3D3FA 3PC0A 4FOJA 4AC1X 2E77A 4ZO6A 4DX3A 2VDHA 3RM9A 3VCRA 3SW6A 3MMWA 3R79A 1X1NA 4NAEA 2QAFA 5A94A 3DEQA 5H2ZA 5I02A 1IEQA 4GMEA 2XISA 3G1YA 5H8UA 3EX6A 1SM9A 4CEXC 3NSXA 3LX9A 4Q8MA 4D6FA 1UPPA 3U2ZA 2NZLA 2VX7A 1OZMA 2PTDA 2O9TA 2QCDA 2VO5A 4NQ1A 1S5WA 1J12A 1US0A 4MY1A 4EOUA 1OX5A 3EOUA 3NO3A 2IQDA 4UR8A 1JYWA 3FA3A 1DJIA 3S9ZA 4GIEA 3ZJ8A 4L6HA 3Q4DA 3IV3A 4KFOA 4ORIA 3E96A 4ICCX 1CI1A 3PM6A 3MKKA 3QPYA 4V33A 3VD7A 2X0SA 2JEPA 3E5PA 1ZBKA 1HXJA 1RJQA 4O54A 3SN4A 1AH4A 1IWAA 1JDEA 3TCEA 1DWJM 1Q6OA 2OKTA 1W3IA 3QHNA 2ZXDA 2DZPA 5D32A 1ADSA 1S46A 1SR0A 2YYUA 2EBNA 1ML1A 5XIMA 4DPQA 2DJLA 3UQNA 3KHJA 2G3MA 5DMMA 2CXEA 3FW6A 1IWPA 2VP8A 2WVTA 4D71A 3W1TA 5C9ZA 4B5TA 4DXKA 2JFEX 2INZA 1GYNA 2QUMA 3CWHA 3HG3A 2WKLA 1E4LA 4NRSA 3S5ZA 4LNYA 4IMEA 3CUIA 3TNBA 3ARTA 4PTMA 3GM8A 2WWDA 3ABOA 3XISA 1SPQA 2R8WA 2Y70A 3NURA 4LW7A 3UG8A 3IPWA 1SW3A 3W7QA 4NZ1A 2VENA 2VZSA 1Q6DA 1LBLA 4UTWA 4EKJA 3T40A 1XIDA 3MHUA 4LS2A 3U2EA 3MUAA 3KVKA 1KFJA 2P5NA 4LF1A 3RO6A 3T0AA 3QY6A 1T6MA 1LT8A 1BXNA 3QOKA 1P48A 4KQNA 4RNFA 3W9ZA 1ISZA 3WIJA 1XLIA 2AAAA 2NVDA 2HPMA 5BRBA 1AW5A 1XLLA 5CBJA 3TTOA 2CERA 2Y4SA 3ENLA 3TH6A 5AC4A 1ZCOA 3P8IA 1B90A 4MNMA 3EA2A 1REQB 3FHQA 1XIHA 3E2RA 1O68A 3V36A 2OEJA 4WEVX 1GG1A 2YDRA 2BFGA 5HWJA 1KGXA 5AYBA 5A6AA 1CT5A 1P43A 1FWEC 1WZAA 1DTUA 5E9AA 1B9ZA 1E73M 2TODA 1P0EA 2IQ0A 1TSIA 3W1MA 1XPGA 3KWSA 2VNCA 4M81A 4YWIA 4C6FA 1UR2A 3A3WA 4O8AA 2W62A 3ZT5A 2INEA 1O4UA 2R1LA 5FAJA 1AJZA 1GJWA 1CPUA 3KBNA 1TCMA 2Z7KA 4M29A 1YE6A 2I5QA 1RZMA 3EMQA 3THUA 4PTNA 4DO7A 5C2XA 1YXCA 1UR4A 3I6TA 3VOIA 3WUEA 2ZE3A 3S3GA 2J7EA 2IMRA 4MJ2A 2ZVIA 1CXFA 4CQDA 5SWUA 2OB3A 4B3KA 2RGLA 2BVYA 1OFRA 1UB3A 4DLFA 4IIDA 3ZYZA 1H4PA 1NQKA 4K1WA 4CEUC 4HMCA 3QBUA 1JDDA 3QSTA 3LTSA 3R43A 4HOZA 4P8WA 5A5WA 1P4CA 1LTDA 3MZNA 5G1MA 3USBA 1BKHA 1DV7A 2HEJA 2FYMA 1VBRA 3CPUA 4FX6M 1FH7A 1KB3A 4FS9A 4Y9PA 4GVFA 2VL4A 1GZ1A 3IJ6A 3KX6A 3TA6A 3UY7A 4LPCA 2WWCA 3PS7A 3VDHA 3SUVA 2XZ7A 3MJMA 2NUWA 1ME8A 4AZCA 4BWLC 1PCWA 1V93A 1VFUA 1JYXA 1T5AA 2J27A 3UU0A 1YNQA 2QUNA 4IMGA 3B8WA 4S23A 3WNKA 1YYAA 3EWZA 2DZXA 1JCXA 4O1AA 1A5KC 1B3ZA 2POTA 4O10A 4H3DA 1HJQA 4RZ4A 2YDQA 3QOMA 2EG8A 2TPSA 4ZOCA 1Q7MA 3E0LA 1YNYA 3AIVA 3DXIA 3RXZA 3VFCA 4QG8A 3WFZA 4GBUA 4AY7A 1N55A 1OK4A 1V0MA 1Z6KA 5HNUA 1XC6A 4A8RA 3W7MA 3WQ4A 1DJNA 4IFOA 5HPOA 3H21A 3T1GA 3M6DA 3RM4A 4JX4A 3T44A 3AFBA 4LFYA 3E2SA 1ITCA 2DZWA 3QY7A 3EWYA 4JQAA 3PZOA 3SDOA 1BLIA 3H55A 1KBBA 1Z69A 2GOKA 3GQYA 5KZEA 4XIMA 1P0DA 4ZSTA 5JQ9A 4QP0A 3W7HA 1W9PA 2ZZ1A 4MB1A 3R4IA 2CNCA 3NZ1A 5CZ0A 4A2RA 3TQPA 4DUOA 5BCAA 3WMLA 1JZ8A 2QLYA 2A2IA 1F6KA 2PC4A 2Z2AA 5ABGA 1H49A 1SMAA 5K4ZA 3NDYA 4OZOA 2E5BA 4B3ZA 1ODUA 3DESA 3TC3A 3MKVA 4QG6A 4MNJA 4OBSA 5D8WA 4CN1A 1XLMA 5CG0A 3ABRA 3KTCA 4ZO7A 1HG3A 3UXAA 4FI4A 5LYRA 3RR1A 2CESA 3SM0A 3VGGA 2PDGA 3QV9A 1NWSA 2I1OA 5EA9A 1ISYA 2B7QA 4GC3A 1OFOA 4OTKA 3V1PA 3VYLA 2WJDA 5CZSA 3CWNA 2XH0A 3WNLA 4TUFA 2VQUA 1MEHA 1TV4A 4OE7A 3GC4A 4DJEA 1F3TA 1TZ9A 1O5QA 1AG1O 1ZP3A 3ORWA 3HQNA 2R14A 5JBFA 3PBWA 3AYSA 1V03A 2GVLA 3LCWA 2YXOA 1J93A 4JTCA 2G50A 2FHFA 2XVLA 4GHRA 2HROA 3W81A 1G5AA 1S5VA 2O4QA 4S3DA 4ADTA 3GWQA 3IIPA 1JVNA 4UFHA 2VMFA 1IEWA 3M5YA 4DBUA 3AC0A 3C0LA 3F5LA 3ANUA 4F0RA 1QBAA 1YQ2A 1UZ4A 2G37A 4ECLA 1QPQA 2PDJA 4UTLA 4NJKA 2DSUA 3IJQA 2E6YA 4NY2A 3N11A 4B5XA 2V3GA 4O18A 1IV8A 4XVDA 3FJLA 3ITVA 2QF7A 3LPOA 2ATMA 3WFAA 1JD7A 1FH9A 1V4YA 3VNDA 4XZBA 2YA1A 1UUQA 3N2XA 4US5D 1UCWA 1O60A 1DIKA 2PDUA 5A6BA 3RMEA 3PFMA 4IMCA 5M3WA 3WBXA 1JPIA 4HTBA 1TB3A 4G9PA 3K4DA 4H4IA 4K3ZA 4RUBA 2PLMA 3GLCA 1TV7A 4PN2A 3W2MA 2FJKA 2NQLA 2BNJA 4B3LA 9CGTA 1K9FA 3TA9A 3DHFA 3G18A 5LA1A 1EL3A 2F2KA 4I8DA 3EDFA 5CC3A 5F2GA 3UG4A 3QR3A 3UJFA 1YRRA 1NOFA 1OG0A 4HZ7A 4PCNA 1KFBA 4Q7IA 1ALDA 3A5FA 1YE4A 2QJNA 2YPIA 3IK2A 1XIFA 3OA5A 1E3ZA 4XX6A 5DT5A 2VD8A 3N18A 2CLPA 1MW3A 4GFSA 4XZMX 4WY0B 2OT0A 3B97A 2PMQA 7REQB 1ZB5A 2CLOA 1GW9A 1PBGA 1E55A 3WJXA 1EF3A 1GOXA 1EGZA 4M56A 4KETA 3BAXA 5LNWA 2DV0A 3G6LA 2PU0A 3ZVHB 5FJTA 2J7BA 1OCJA 3DG7A 4UUIA 3KL3A 4Q22A 3UZYA 4D1IA 1EIBA 3R58A 3WMSA 1B3XA 4JTUA 3IUIA 4XVEA 1PO9A 3EB3A 3AXHA 5KZMA 1RVGA 4UOZA 3UWUA 4XISA 1WDQA 4YHGA 2QPSA 1ZGDA 1B4KA 4ZMGA 3BAJA 4OHQA 4FK9A 4RK8A 5D30A 3MQTA 1FRBA 4QEEA 4UNIA 4GE8A 2QVHA 1LWIA 4JR5A 3GNNA 3APTA 1G67A 3FGCA 3WBWA 4ERIA 3WEZA 2J24A 1EA9C 1MRAA 5IBXC 2F6KA 3WY1A 2O7QA 1XINA 4JTIA 1V77A 2GDUA 4S2BA 3VCNA 3RN6A 5J8LA 4GXWA 5BOOA 3W1QA 5TF0A 3C5QA 3LN3A 1BYCA 1UUOA 3TROA 3MCNA 5DMNA 1KFLA 2ZRZA 1JJKA 2CETA 4AD3A 1QHOA 2DPEA 1FY6A 4DJFA 3K2GA 1HKJA 2IKHA 4XTDA 2CC0A 3QKEA 4CVUA 1ZQ5A 3HFYA 1JNDA 2Y62A 3SFWA 4NASA 3NNTA 2YB4A 2FIQA 4KCWA 3U4FA 4IP7A 1DPMA 1H09A 1FWJC 4KCVA 3BMXA 3CMGA 4B92A 3ZQ9A 3TW9A 1K6AA 1GQNA 3F4NA 4LBSA 1VEMA 2BSLA 4HMEA 1PZ3A 4DF0A 1DJWA 4BCEA 3NUKA 1BSLA 1WQ5A 4N4PA 1UWQA 1X1ZA 1CECA 4IIGA 4ZFMA 1E56A 1N82A 2ZE0A 1WXYA 2Y61A 3WCZA 1E72M 2W27A 3T07A 1Z41A 2HXUA 5KMYA 1W3TA 1Q45A 2VGBA 2D2GA 2Z1WA 2D1ZA 2OG9A 1NOWA 2D0FA 1IZKA 3PANA 4IL0A 1K03A 3IV8A 1CTNA 1LL6A 4GH3A 4Q7BA 4AD2A 3EKGA 5AN7A 4XAFA 1I6NA 5CH9A 3HG2A 2CHRA 1EZ2A 1FWHC 2C18A 2D73A 1WUEA 4C91A 3S1WA 5M17A 4DPPA 2FH8A 4IP5A 5BZAA 2D24A 3IIXA 3CWOX 1JCYA 1UW9A 1B30A 1FHLA 4FOUA 1PL9A 1UWSA 1BGAA 4YHEA 3A47A 2PGWA 5J04A 5I3IA 3FAWA 3Q45A 2TSYA 3BLEA 1KBLA 3DH7A 1P7TB 2G0WA 3WK2A 3CO8A 4JKLA 1S2TA 1X7FA 1LBFA 2EXOA 2XIBA 3BOXA 3NPWA 3QMTA 3UCDA 2ZRVA 3HO8A 1GZGA 3LMYA 3M64A 2YA2A 2X09A 4P7OA 3FY1A