4L4PA

The mutant(e139a) structure in complex with xylotriose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with xylotriose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4l4pA00
2WKLA 3N12A 4CD5A 4MDOA 1LF1A 3T0DA 2RGMA 3WF1A 1HVQA 1AQMA 4L4OA 3WNMA 3WQ8A 4AIOA 1KR1A 2V3EA 4NF7A 2AMGA 5CPTA 1F4AA 4WKFA 3WDIA 3K46A 1UKSA 4F66A 3A6OA 3VILA 2WLYA 1JAEA 1GQIA 3EMZA 2ZUVA 5BYWA 4AYSA 2CBVA 1VF8A 2QF8A 1JDDA 3KE0A 5F7UA 3AIRA 3WEZA 1K9FA 1W9BM 7A3HA 4YN5A 5C71A 1KGWA 2WNWA 4QCEA 3WUFA 3N04A 3ARYA 2VCBA 4M29A 4UOQA 1XYFA 4MB4A 1HKKA 5A2BA 1MW2A 5JIPA 1G94A 1CZ1A 3MUZ1 1JZ5A 4RE4A 2Y4SA 1JF6A 4D72A 3VIMA 3N13A 1MQRA 4UFIA 4N0RA 3VD9A 1NOWA 2D3LA 1OGBA 1W9VA 1W3LA 3WFLA 2VVNA 6A3HA 3OIHA 2D20A 5JBDA 2WZEA 4DWSC 4CVWA 1CYGA 3DYPA 1SR0A 3RCNA 1UR8A 4JFVA 2ZX9A 3SCUA 2J8FA 4GO9A 1UUQA 2XIIA 1LLOA 4AZCB 1LG2A 1CTNA 4PUEA 4AZGA 1TG7A 1DWIM 3AHTA 1H2JA 2ZWYA 1V3HA 4NSBA 1LL4A 4ZENA 1WDSA 1GJWA 3B8SA 3OGSA 2IXUA 2X8RA 2XIBA 1WDPA 5LYRA 1VENA 3GNPA 4D6CA 2XSBA 1GUVA 1OSEA 2VJXA 1NOFA 1HNYA 1JYWA 3CLWA 2G8ZA 1KCKA 3W24A 4D6HA 1M7XA 1H3GA 4W89A 4KH2A 2OYMA 1G9HA 2XHYA 3AXIA 4PBGA 1ZBVA 3GM8A 3ZSTA 3PZVA 3IJ9A 1B0IA 1KBBA 1E55A 1W1YA 3DYMA 5JBEA 5KZ6A 2ZUWA 4OOZA 4W88A 4KGJA 2BY3A 3BSGA 4PMDA 1OWQA 3K4AA 5D9MA 4UR9A 5I2UA 3ZT7A 1RD6A 1WAWA 3AS3A 2VRJA 4J28A 2VX5A 4AISA 3OLGA 3MSGA 5BXSA 3WUGA 1GHRA 1VIWA 1VRXA 3CHFA 4PEEA 2ESCA 2XVKA 2V5CA 1B3VA 4FLOA 1CXIA 1QNSA 1B3WA 1PJ9A 3BLKA 3CUFA 1UKQA 2EPOA 1CECA 1WZMA 2HISA 2W91A 1BTCA 1E6NA 4OOUA 3GDBA 1H4PA 2JFEX 1E6ZA 3WH7A 5E0FA 3PTKA 3U5UA 1RPKA 1E4LA 4AIUA 5A69A 2VQUA 4URIA 5CZKA 3S2CA 2WMIB 4FF5A 3WMCA 3WUBA 2WWDA 5DF0A 1EDQA 5FCZA 1VJZA 1VFFA 5LA0A 1RP9A 1NWTA 2BNJA 1HKIA 1GONA 2PB1A 1L8NA 3WIJA 1XSJA 4D6JA 1XSKA 3VNYA 2D0GA 3WFZA 2D0HA 1MFVA 3GBDA 1BG9A 3TTYA 1E3ZA 2JIWA 1TA3B 5IFPA 2DH2A 3CO4A 2VCAA 3POHA 3GTNA 2FHCA 1Q6DA 4MB1A 3OLIA 2A3EA 4HMDA 4JL2A 2Y8VA 1E0XA 3F5JA 4EANA 1G0CA 2CKSA 2PWDA 2QLYA 4JFWA 1OT2A 1UWTA 2XG9A 1KWGA 4W86A 3WD2A 3DC0A 4W8BA 7TAAA 2C8NA 1JG9A 5EB8A 2GVYA 4E8DA 1HP5A 1ZS2A 3K4DA 2ZXQA 3W29A 2W5FA 4D6IA 1CDGA 2UY4A 4AZ6A 4WJXA 3VIHA 2WLZA 3GH5A 2EBNA 3K8MA 1BHGA 1LL6A 1PAMA 3MV11 2J7HA 4HZ8A 1KXHA 2DQXA 4LQ1A 4Z2LA 1JL8A 3L2LA 4FMVA 1OD8A 9CGTA 1B3XA 1NOUA 2J25A 3BXWA 4AD4A 1BYBA 5A1AA 3MS8A 4PMZA 4CCCA 3QHMA 3WL1A 2IUZA 3AS1A 4YPJA 4JFTA 2E40A 1GQJA 1UR9A 3PTQA 4KRTA 5I79A 4TVCA 2WMIA 3T0BA 2EXOA 1M01A 1QNQA 2YDRA 3RM9A 5ABEA 2UY2A 5HPCA 3AIEA 3CH9A 4UQ9A 1J01A 5CG0A 1XD0A 3L4XA 2QPSA 2O9PA 5A6BA 4JFSA 4QFUA 3ZT5A 5FL1A 1V0KA 4MB3A 4R27A 3CBWA 5A2CA 1ISYA 1P6WA 2WAGA 5M5DA 1C92A 3G6LA 1UG6A 1Z32X 3QHNA 4PN2A 3OG2A 1Q6CA 3VU2A 3UETA 1ESWA 3AFBA 4IISA 1HKMA 4OBSA 1TVPA 1OGSA 5AY7A 1NH6A 1XGZA 5ABGA 2OSXA 3ZO9A 2QV4A 1I1XA 2WVTA 4JCLA 1DHKA 3SUVA 2VZOA 4D1IA 1GVIA 3WNLA 1HX0A 2GJXB 1FP9A 3W28A 3WEMA 2DGAA 2BHUA 1FH8A 1GOQA 3O9NA 2FGLA 3BGAA 4AZ7A 4WIWA 1UKTA 1QI4A 1V3JA 3SCRA 5DMYA 1HP4A 2IXVA 1NQ6A 1M03A 4TTGA 5A6AA 2XFRA 3EBVA 2YA0A 3MMUA 1UD3A 2Y24A 3MSDA 4ACZA 1E6XM 4HPHA 4H41A 3EDJA 5A8MA 1GOOA 3VTRA 2G3NA 4AZ5A 1QNOA 1VBUA 1WE5A 1D3CA 1ZBKA 3SCVA 5I0DA 1OGGA 1XH2A 3T2QA 1EH9A 3QR3A 1RP8A 3WF0A 2VRKA 2PF0A 3RMEA 4JHZA 2XVPA 1XRVA 4OBRA 2PI6A 1QHPA 3VIKA 2DT0A 3EDKA 4GI9A 1VEOA 4V2XA 3AZSA 4TOQA 4JAWA 3MO4A 1BVZA 2EJ1A 3L2MA 4TX6A 2VCCA 4KMQA 2D2OA 3PZMA 1JNEA 4R5EA 3WY1A 4ATWA 2J79A 2XWDA 4FK9A 3RM8A 5M03A 4W5UA 4CN1A 3W26A 3TTSA 3QOKA 4KWUA 5EMYA 3IANA 5HXMA 3NJ3A 2GDUA 5AC4A 4W85A 2DH3A 1W3JA 3HU7A 4BF7A 2VOTA 1B9ZA 4MAZA 2BY2A 1UYQA 4PRWA 1MXDA 3TONA 2Q8XA 4U33A 3N11A 4AMCA 4H8UA 3WNNA 1VJSA 1V0MA 5BRPA 1CIUA 3U5YA 4D71A 4C7FA 1UOKA 1VFMA 3W37A 3PZ9A 1J11A 1CXHA 1TVNA 3GXFA 1FP8A 4PTVA 3ZIZA 3AMDA 4DUVA 1E4NA 2CBIA 1C93A 1H09A 3MKKA 4QLLA 4UQCA 4W8AA 4TTUA 1AQ0A 1KXQA 4JKMA 4Z2HA 2XWEA 3BAKA 3B9DA 3A47A 1O6IA 4H8HA 2QHAA 1DWGM 2C7FA 1HL8A 2WVUA 5HDRA 1KXTA 4MAVA 3VMNA 1H0IA 3WDQA 2ZUMA 2UY5A 4OZOA 1ZB5A 1NM9A 3FHAA 2FH6A 3UG5A 1CGWA 3VM5A 2DSUA 4Z2GA 2D1ZA 1PX4A 1BYAA 3ARTA 1LWJA 1NP0A 2WVSA 3WBEA 4BQ3A 5C8BB 4FLQA 2WYSA 4L4PA 3N1AA 3VPLA 1I75A 2PC8A 3AISA 1EOKA 5A8NA 3DYOA 3VDCA 1BYDA 3AIVA 4OUEA 1ECEA 2ZUTA 2DSZA 3IAQA 1K9DA 1GPFA 1UA3A 1E56A 2G4FA 5IDIA 1V3KA 2XJ7A 2XVLA 2YL6A 3F5LA 3AMKA 1E4MM 1GORA 3LPOA 3PZTA 3HJEA 1GQLA 1JDAA 3VO0A 3EDDA 1KQYA 1UR0A 2YJQA 3WF4A 2J77A 1K6AA 5AYIA 4Z2JA 3AS2A 1MXGA 1HL9A 3WL0A 1LJYA 3BC9A 2EQDA 3AI0A 4CD8A 2CCRA 3UESA 3L4YA 1CGXA 2EEXA 3PHAA 1QNPA 4A4AA 8CGTA 5E6YA 1CWYA 4F8XA 3S6TA 4AW7A 2DDXA 3ARUA 4Q7NA 5BROA 1CXEA 3M07A 1GCYA 5ABFA 1SMDA 5A6MA 2DSWA 5DT7A 5CPQA 3WDRA 3FHQA 4UFKA 2QPUA 4PSPA 2XTKA 1TUXA 2W62A 3WD1A 1U2YA 2W66A 1UWQA 1JZ6A 4JHOA 1BQCA 2JEQA 4HA4A 5I24A 2OYLA 1CNVA 5A3HA 3WUEA 3CUGA 1DWAM 1QBBA 2YL5A 3EMQA 5IHRA 4IM4A 1NARA 1VEMA 2CEQA 4AC1X 4B9ZA 4GI8A 1C8QA 3UEQA 2WBKA 3GH4A 1FH9A 4ATLA 1IT0A 4M24A 3PN8A 3MUIA 1G1YA 1MW3A 2YOCA 3GYCA 2EPLX 4J7RA 4UQBA 2J7EA 1B3ZA 1XC6A 1BFNA 3AJ7A 1LWHA 2PBOA 3LPGA 2DSKA 1OB0A 3UERA 1E0WA 4GZIA 1Q4NX 1U33A 4PMVA 1XHGA 1CGTA 4BCEA 2JEPA 4YHGA 2E8ZA 3CHEA 2D23A 1HJUA 3WH5A 1ZU8A 2WC4A 3VIJA 1WZLA 1UZ1A 3NDZA 2VC9A 3CTTA 1VB9A 3OLEA 1QPKA 1MYRA 4LYPA 4ML4A 4W8LA 1GW1A 5CLWA 2A3HA 1ISZA 1MQPA 4PSRA 4B3KA 5FIPA 3VD7A 3SCNA 4RE2A 2YKKA 4N42A 4P7NA 1WNOA 2J7CA 5CXPA 1QW8A 1V6XA 2J4GA 2WVVA 4QAWA 3AICA 1OT1A 1BAGA 1W1VA 3QOMA 1H41A 3WQVA 3AIBA 3PZUA 1JYNA 2E9LA 3RPMA 5CLTA 5I23A 4UOJA 1A47A 2DIJA 2PWEA 4GI6A 3ZSSA 3VMOA 3A3HA 1W9PA 1HKJA 1YHTA 4MB5A 1ODUA 3OA5A 1C8XA 4GINA 3WH6A 3W6LA 3WMBA 2J7GA 3EDFA 1H11A 2OWXA 1GOMA 4FLRA 4V27A 4D1JA 2XSAA 1Q6GA 1N82A 1E70M 2J7BA 2J7FA 1NWRA 1UWSA 4HMEA 1BSIA 2CNCA 2UY3A 2CBJA 1X1NA 4CD4A 3PZIA 3VGGA 3DHPA 1V03A 3THCA 1E6QM 3RILA 1R8LA 4M8UA 3SCWA 1WO2A 1UD5A 3L4ZA 4JFUA 2CKRA 4CGTA 3OZPA 5DEZA 1SYTA 1CEOA 2FGZA 2A3CA 4IPNB 3WQ4A 3WENA 4KGLA 1D2KA 3K8LA 2G41A 4BQ5A 1EQCA 1B1YA 1QI2A 1W2VA 3IK2A 1UH2A 1HVXA 4WSKA 4CVUA 1JZ2A 3ARZA 4OKDA 1WPCA 4AZCA 3SCQA 4XV0A 2PBGA 1PX3A 3ALGA 3ZR6A 1CGVA 3MV01 3MUY1 1QI3A 4CN6A 3ZQ9A 1E6PA 2OLHA 1VEPA 2ZE0A 1V3MA 3D5HA 1GQKA 5D9NA 3RDKA 2DT1A 3AIWA 3MMDA 3AHZA 4JKKA 1W32A 3HN3A 2BVTA 1KCLA 1CPUA 2CESA 1KB3A 3NSNA 4UNIA 2XGBA 1NWSA 1WZAA 2CPUA 2NT0A 3W82A 5E70A 2UWFA 4D6GA 1HN1A 3RIKA 2WHKA 1H5VA 4UCFA 4UZSA 4QLJA 1R87A 2W67A 1JXJA 1TFVA 3GZAA 5FKYA 1EO5A 2WM0A 5EFDA 4M80A 1QHZA 1GNXA 2VR4A 2CERA 3WSUA 3T2OA 2G3JA 1KFWA 3WD4A 4AD2A 4TX8A 5GPRA 1ZBCA 3EYPA 6CGTA 3AOFA 4UFHA 2ZWZA 5HNNA 1KR0A 3BAWA 4DWSD 1MWOA 2JF6A 1QHOA 2J8GA 3N18A 4HA1A 4PUDA 3VINA 1EIBA 3CMGA 2VMFA 4GQQA 2ZXDA 2YLLA 3CIVA 2WPGA 1XD1A 1R7AA 3W81A 1JZ8A 1UQYA 2GSJA 3PZNA 2O9OA 5AYBA 3VKKA 1E73M 4XB3A 3VGBA 4J27A 3IJ7A 4GO8A 4UFLA 4S3JA 5GNZA 2W63A 4JCMA 3LMYA 2WHJA 2ZUNA 2ZUUA 4QLKA 3CZGA 2CHOA 1TA3A 1L0PA 1JAKA 3WD0A 3BAJA 4NI3A 2EPNA 1KGUA 3GH7A 4XZBA 2ZXAA 3AIUA 1ITCA 3ZOAA 4XZWA 3VIPA 4IPLA 5KEZA 4J3TA 5E9AA 5A2AA 3UCQA 1G5AA 3ECQA 4GZJA 2E4TA 5BXPA 1WDRA 4HP5A 5HOSA 3F5KA 3SUUA 1EHNA 4PTXA 1JYVA 1QBAA 2YL9A 2XFYA 4W93A 1W91A 1DEDA 3PZGA 3GNRA 4HOXA 5AC5A 2PWFA 1JI2A 3BAIA 5A94A 1UWRA 1ISVA 3BMWA 4P7QA 1HJQA 5CJ5A 4AZBA 1MFUA 3J7HA 1B3YA 3B9EA 4X0NA 5M17A 4MPKA 1UHVA 3RJXA 1BYCA 3VDAA 1HXJA 2QMKA 1DWJM 3W38A 1ITXA 1FOBA 3TA9A 5HPOA 2W4XA 4C7GA 5C70A 2XM1A 3FN9A 1OD0A 1E3XA 4DUWA 5JBFA 1X6NA 3ALFA 3WDPP 2J78A 5A6JA 2CIPA 2D24A 1PBGA 2DSVA 1UQZA 5FOOA 2OYKA 1ZBWA 1OINA 3OGVA 3M46A 2XYLA 4BZYA 1EDTA 4MNJA 4HU8A 2EO7A 2TAAA 4H2CA 2X1IA 2XVNA 1XYZA 4EE9A 5BRQA 4AEEA 2OSWA 1J0YA 3FXYA 3WNOA 5D9PA 3QHOA 3ZR5A 3BCFA 3LPPA 1PZ3A 4TVUA 1H0GA 4QDMA 2XM2A 1IZKA 3I3BA 1V6UA 4DM1A 4BQ4A 4MJ4A 1JGIA 3CGTA 4Z2KA 3VNZA 3UR7A 2Y2WA 1J18A 2GJXA 1R85A 2BXZA 2WKGA 3VMPA 3KZSA 2DT2A 4PMOA 3II1A 5LA1A 1FH7A 4W7UA 3POCA 5A8OA 3NSMA 1CLVA 3L4WA 1PIFA 5D8ZA 3SUTA 3CUIA 1R86A 1ZJBA 2V5DA 1TE1A 3O6AA 1E6RA 3OBAA 3VIIA 4HOZA 3BAXA 1GZJA 3UR8A 4PMNA 4C7DA 3NIYA 2BHYA 4WK9A 1MW0A 2BFGA 3FAWA 2VX7A 2WSKA 3NDYA 3N15A 3I3EA 1UD6A 1E0VA 1JIBA 2Y5EA 1E6SM 1BGGA 4M56A 4PCTA 1ISWA 1FHLA 4CD6A 4H8VA 4HU0A 1UD4A 4H7VA 4U2YA 4OJYA 3WKZA 1B30A 3WD3A 4AD5A 2A3AA 5BCAA 3A4XA 2V3GA 1PPIA 2VT0A 4LGXA 2WMFA 3VD5A 2X2YA 4ZXOA 2HVMA 2YBTA 4F9JA 1CBGA 3MUAA 2YL8A 2QMJA 1E4IA 1GOKA 3ARPA 3VDHA 4MNLA 2VR5A 4YHEA 3SCOA 3AZTA 3AMCA 2ZX5A 1UA7A 2WXDM 4AXNA 4GZEA 4V28A 2WB5A 5IHSA 1VBRA 1IV8A 2OWCA 2BV9A 4CCDA 4CCEA 4J3UA 1JI1A 3ZJKA 2J75A 5E0CA 1J9YA 1O7AA 3ARXA 3EDEA 4W7VA 1JYXA 1GOWA 4XUYA 4PMRA 3PZOA 4P7LA 4M81A 1M53A 2F2HA 1GVYA 4BA0A 3PTMA 4U31A 1KWKA 4AEFA 5JUVA 2WSPA 3BAYA 1UR2A 1US2A 2BVYA 1QW9A 1EQPA 1HT6A 4JIEA 5I77A 3WH8A 1QOXA 2DPEA 2XGIA 4TXEA 3CPUA 3W4RA 1GHSA 3AHXA 3W6MA 1NP2A 4LYRA 1W1PA 2WMGA 3SCSA 2ZX6A 1EA9C 4LX4A 2E9MA 4U5KA 2WBGA 3CZEA 3QGVA 1EDGA 3O2LA 3THDA 1J0HA 4W84A 2VUYA 5I6SA 1PEZA 4U5IA 4A3HA 1BGAA 3PBGA 2W92A 3RO8A 4UZUA 3DHUA 2O92A 4B16A 1AMYA 3UG4A 2CHNA 4EK7A 2CETA 3APGA 1EGZA 1A3HA 2JE8A 5DO8A 3AIQA 3F4VA 2GJPA 1J0JA 1UR4A 1CLXA 3ZJ8A 1JZ3A 3T09A 1S46A 3W25A 1H49A 2YLAA 4D6FA 1H1NA 2F8QA 4BQ2A 5A6SA 2FHBA 3MANA 4PTWA 3SIMA 1C7TA 3M7SA 2ZUSA 2O9TA 3KL3A 4W87A 1I1WA 2G3MA 1MW1A 3VD4A 2FHFA 4H04A 4JL1A 4MTVA 2VTFA 1J0ZA 1B2YA 1CXKA 1UKOA 2YDSA 4WLCA 1XCXA 3UG3A 1KBKA 4P8UA 3VX0A 3WQ6A 3EMCA 1V3LA 2BVDA 1LL7A 4NZCA 3WBAA 3L4VA 3AMGA 4DUXA 1FFQA 4AD3A 2VURA 2ZXBA 1W1TA 1J10A 2AOSA 3K8KA 1WZKA 4WKAA 1E43A 2D3NA 1VFUA 6TAAA 4AY1A 1JFXA 4WF7A 3B9AA 3ARVA 2Z1KA 4W7WA 1QI0A 4Z2IA 4X0VA 2Y8KA 3CZKA 3AYRA 3VIFA 2W61A 3VUPA 5EFFA 2C0HA 4UTFA 3WQ5A 3U7BA 1UZ4A 4HOWA 5E09A 5A6BD 3SCTA 2EPKX 1V3IA 3ZMRA 1B31A 5ECUA 2NT1A 2XPKA 1QI5A 3WELA 1JXKA 1WDQA 4HZ7A 1FA2A 4PMYA 3KEHA 3VX1A 5BWFA 1KXVA 1DTUA 1OBAA 1IZJA 2E8YA 1AQHA 1LQ0A 4CU7A 2WHMA 4RE3A 3AXHA 4UOZA 3JUGA 4UQEA 4MNKA 5CSUA 4MDPA 3TTOA 4S3KA 3U7VA 4ATDA 5HBFA 1LG1A 1OM0A 4GXPA 2OSYA 3ZM8A 5A6KA 1E71M 1WKYA 1UD2A 2X0HA 5LA2A 2GJRA 3KWXA 3CZJA 2WC7A 4F79A 1HIZA 2VL4A 1WP6A 2VRQA 4B15A 2NW0A 4ZEPA 4U3AA 1JZ4A 1MQQA 2WMJA 2BXYA 3W0KA 2X0YA 2CYGA 3OLDA 1FHDA 3CZLA 1WCGA 2YIHA 3AZRA 4FLSA 2GDVA 3VD3A 1QNRA 2AAAA 2VZTA 4XX6A 1K9TA 2PWHA 3VVGA 2WCGA 3HMCA 2WCAA 1ODZA 4D6EA 1C91A 5I78A 2WHLA 1EO7A 2RGLA 4F9DA 1EOMA 4Q22A 4MNMA 4PCSA 1FFRA 1XH0A 3IAPA 1D7FA 1V0NA 4WKHA 3T2PA 2E3ZA 4K68A 7CGTA 2CXGA 2J74A 1Q6FA 5IFTA 5D4YA 3NSXA 3DECA 1E9LA 2GFTA 1TZ7A 3CUJA 1KGXA 3VIOA 2VX4A 4D6DA 1BF2A 5IXEA 4AD1A 1CENA 2WMKA 3SUSA 1HF6A 4NRSA 2E0PA 4CU6A 2WZHA 2V38A 3VGDA 3D3AA 4HPGA 4EKJA 2XUCA 1PIGA 4W5ZA 1JZ7A 3L4UA 2NSXA 1RH9A 3BH4A 5CGMA 4TVDA 3AS0A 1GJUA 1V02A 1W2PA 2V3DA 3WN6A 1CGUA 3A4AA 3BSHA 4EAMA 2VI0A 5CSYA 1PZ2A 4E4PA 1V6YA 3RM4A 4ACZB 1SMAA 1TMQA 5E6ZA 1OCQA 1W9UA 1Y7VA 4HZ6A 4PYSA 1JNDA 5GNXA 3U57A 5A8PA 2WANA 2FH8A 2GK1B 3SURA 3LPFA 3TP4A 5A95A 2ZICA 1QVBA 5EBAA 3ARSA 3WNPA 3SUWA 4ZXLA 4E8CA 1E40A 3VGEA 4AWEA 3VGFA 1YQ2A 1V6VA 3FW6A 1VFOA 1J0KA 2A3BA 4LYQA 2D22A 4M82A 1HJXA 1B90A 4DM2A 3AHVA 3CHDA 2BY0A 3E1F1 4AZIA 3WMSA 1BLIA 1OIFA 1V6WA 1DP0A 4GQRA 5GNYA 4GPNA 4DWSB 2WMHA 1DWFM 2BY1A 2D0FA 4J3VA 1JD9A 3AROA 4U3CA 2VVSA 1EXPA 3AYSA 3MU7A 5JIWA 4AZHA 1EHAA 3G6MA 1V02E 4ACYA 2VZUA 2X05A 1XSIA 5M3WA 3GNOA 3KL5A 2B31A 1JF5A 3AQUA 2F61A 4PMQA 1UH4A 3N17A 2MANA 4JKLA 4U2ZA 3WNKA 1C3FA 1J0IA 4M1RA 4RL3A 4AD0A 1JFHA 1CXFA 1J12A 1W9XA 4P7OA 3PZQA 4ZFMA 5ABHA 3M6DA 2VQTA 3GXMA 2Z1SA 1BVNP 3ZT6A 4WSJA 5CPSA 4QCFA 1OIMA 2JIEA 2XFFA 3A4WA 1R7OA 1E72M 1UD8A 4P8XA 3FY1A 4IUGA 2WCSA 1Q6EA 1XH1A 3WDHA 5GQBA 1CGYA 1ZJAA 2GK1A 3ZJ7A 3CZ8A 4CKQA 5D8WA 3BCDA 3OGRA 1E1EA 1W3KA 2YBUA 3N9KA 1UWUA 2FDMA 3SEPA 1X6LA 2G3IA 3WQWA 1E15A 3MMWA 3T0AA 3CMJA 1UH3A 3CHCA 8A3HA 1HJVA 4LPCA 3TOPA 2JF7A 5BXTA 3SCPA 1ISXA 1US3A 1XV8A 1E1FA 4J3WA 3VGHA 1BPLB 4DWSA 1XCWA 1BG4A 2XVGA 5I5RA 3NUKA 4HA3A 1KQZA 1M04A 1GOIA 4UFJA 2BS9A 1E5JA 2WC3A 3VIGA 1NWUA 3FAXA 5FD0A 1UR1A 4ZE5A 2YDQA 1SFSA 2VZVA 3NCOA 4BS0A 3WF2A 2VNCA 2VO5A 2WW5A 2ZIDA 4PMXA 3AHYA 2GUYA 1U30A 2BHZA 1V0LA 3KL0A 5A8QA 2ZX8A 4CD7A 4J3XA 2ZOXA 4PMUA 4GIAA 5D9OA 1K9EA 4MJ2A 5TD4A 2E9BA 3WEOA 2YA2A 1TR1A 4AIEA 5ABFB 1ZL1A 3FNDA 2EPMX 3BMVA 1TCMA 1HJWA 1MVYA 3NYDA 5BXRA 2V3FA 1DWHM 3IJ8A 3WDJA 4J3SA 2J7DA 2VX6A 3ARQA 2OWWA 4JZ5A 4QP0A 3W27A 3TTQA 4TUFA 2WZIA 4CUCA 1WB0A 3VM7A 1F4HA 3VOCA 1VAHA 3ARWA 1C90A 3WH9A 3RJYA 3AMLA 1C7SA 4OIFA 1G01A 4HTYA 4MADA 4P8VA 5I3DA 4A3YA 4UQAA 1HJSA 3BLPX 2WWCA 2DEPA 4CN4A 3CUHA 3WF3A 1V08A 2O9RA 3GXIA 4E2OA 4ZE4A 3T08A 3ZJ6A 3AXXA 5CGTA 5DFAA 4PTMA 4LXFA 4CU8A 5CQ1A 1E5NA 2WK2A 2J62A 2DIEA 1JDCA 4HMCA 4UQDA 4Y7EA 1C8YA 1PX8A 2VZSA 1CXLA 2CBUA 3OZOA 3VDBA 3GXDA 4X9YA 2PWGA 2X09A 2ZX7A 4P8WA 2YA1A 2JALA 4KRUA 1UWIA 3L4TA 4B3LA 4NRRA 3GBEA 1AVAA 4GKLA 1UKPA 2CITA 4P7RA 2J47A 5FL0A 3K1DA 1W9DM 5DT5A 5A6LA 1JD7A 1W3HA 3ARRA 4UFMA 3W53A 4B9YA 3OB8A 2DT3A 2WVVB 3I3DA
chains in the Genus database with same CATH superfamily
4MDOA 2HVOA 2RKXA 3H4GA 3GG0A 1W1B1 1WQ5A 3WNMA 2NQHA 3WQ8A 2AMGA 3UPMA 1F4AA 3K46A 2GPTA 1FY6A 3KS6A 4NJHA 2PLJA 4HNOA 4JTIA 2ZUVA 4YS1A 3ZVHA 1ADDA 2CBVA 2NLYA 4Q7BA 4IP7A 4DJDC 5H2ZA 1JDDA 4GYPA 5F7UA 3AXKA 3O6CA 5FEPA 1K9FA 4UMBA 3LCXA 2DVXA 2ODOA 3KTSA 4Q8UA 3WUFA 1MRQA 3NZRA 3W85A 4HHLA 2PGWA 3BQ5A 1AA1B 4MB4A 3KZPA 3QTPA 1HQTA 5A2BA 3KHJA 3PK7A 1TIWA 1CZ1A 3BSMA 1DJGA 4BJHA 2C1HA 3B05A 1JF6A 3NQGA 3B4UA 3P3BA 1V8EA 4NZ4A 4A6GA 3DGRA 4EX4A 4DVOA 2D20A 1H51A 2PS2A 3COTA 4GYFA 3R10A 1ONWA 1KRMA 2NLIA 5EU9A 3ITXA 2J8FA 3NURA 1LG2A 1CTNA 1DWIM 4NSBA 4B90A 1LL4A 5KSWA 1WDSA 3B8SA 3U3HA 2X8RA 1W3TA 2Q8ZA 4LAMA 5F1UA 1UJPA 1MUCA 2REQB 2XSBA 1GUVA 5C2CA 3M5VA 3RHGA 3W7OA 3VNKA 3FYYA 4HD5A 5E93A 9XIMA 4FEZA 5I09A 2AAMA 4D6HA 3L5AA 4KH2A 1G9HA 4NAEB 2XHYA 4FHAA 2C14A 4M7TA 2FZNA 1OJXA 2HZGA 1PZ1A 3DYMA 3LLFA 3ZR4A 2ZUWA 3R94A 1QUMA 2P8CA 1WAWA 1XLEA 3AS3A 1JCNA 1YE4A 3NVDA 9XIAA 4J28A 4WJEA 5D2TA 3OLGA 4RUBA 3MSGA 1JPMA 3WUGA 3CHFA 1PWLA 3DUGA 2ESCA 3HO8A 3LCWA 5C6MA 3ABXA 3GZ3A 4HA0A 1CXIA 1K7FA 4MUPA 3FXGA 3IIPA 4CNUA 2PDPA 2PLMA 2X30A 5G2WA 3SY1A 1E6NA 4ERIA 3SBFA 4KEZA 4NNAA 3R58A 3PTKA 4JNYA 4MWAC 4AIUA 1E4LA 3G8EA 5A69A 3LENA 4FF5A 1BTMA 5DF0A 4IPJA 1MDRA 1VFFA 5LA0A 2IPFA 3IUIA 3C8NA 1RSCA 1RP9A 2BNJA 1GONA 1K02A 4NQ1A 1R3VA 3VNYA 2D0HA 1KTNA 1KD0A 1BG9A 3TTYA 1E3ZA 4H9MA 1F6PA 3W87A 2FHCA 3IK4A 5J5RA 1Q6DA 3OLIA 4JL2A 1E0XA 4RDZA 2V81A 4EANA 4IXXA 2DV0A 2PWDA 2QLYA 3VOFA 1OT2A 2XG9A 4W86A 3G5EA 4O28A 3B06A 1EPXA 5EB8A 3IIOA 4XZIA 2QGYA 3KXQA 1NQKA 4DYKA 4GUHA 3K4DA 5FF7A 3VFCA 2ZA1A 4D6IA 3I68A 5B80A 4XVEA 5H1WA 4NZJA 2UY4A 4WJXA 1OVDA 1RA5A 3L5LA 4ERGA 2WLZA 3GH5A 1PKNA 3GXTA 3TMQA 3XIMA 2EBNA 1EUAA 4I5UA 1FWFC 1F74A 4OVXA 1PAMA 3GTFA 4Y9NA 3UWYA 5CBBA 1L2QA 1DHPA 4JYFA 5HNTA 2PDNA 4NNBA 1JL8A 4FMVA 1OD8A 2QCGA 3BG5A 4HHPA 4LAKA 4CCCA 3QHMA 3FGCB 3W9ZA 3SECA 3AS1A 4YPJA 1GQJA 1UR9A 3PTQA 1DJYA 5I79A 4KIRA 2WMIA 3T0BA 3RM9A 2OO6A 4C6JA 1RUSA 3CH9A 1DIKA 2F84A 3PPGA 5CG0A 3H4WA 2Z2AA 2QYGA 2E6AA 3W7MA 2O9PA 3HG4A 2C71A 2OJPA 1IXPA 2KX9A 5FESA 3EX2A 4LS0A 2Q8LA 1XIEA 3RK8A 1P6WA 3U4AA 3DBNA 1QOPA 3QHNA 4RW5A 3UETA 2Y70A 3AFBA 4ZO6A 4I9AA 2XIQA 1WXYA 2OSXA 2NXGA 3D6NA 2R24A 3RPTA 1GVIA 3WNLA 1HX0A 9RUBA 1AZ2A 4KEVA 3WEMA 3GWQA 4HPJA 3V75A 1UKTA 3RR4A 3RX2A 1PZ0A 3V16A 1WAUA 2RDUA 2Z4GA 4X63A 3KLLA 3EBVA 1VFTA 2YA0A 3MMUA 3MSDA 4ACZA 4GXMA 4N9BA 2WNQA 2G3NA 3LM7A 1K77A 1VBUA 5CKSA 1WE5A 3F4DA 1OGGA 4Y9OA 2E67A 4DPPA 3RMEA 4JHZA 3N3TA 2X40A 3BOXA 3EDKA 5G1YA 3DG3A 4V2XA 4TOQA 2RDWA 3RITA 3PZMA 2XWDA 4XD3A 3W70A 4FK9A 5M03A 2G0WA 4W5UA 3TTSA 2PGFA 1AFSA 4CQAA 4N02A 4KWUA 3P7YA 2GDQA 2BX7A 3HU7A 2C91A 3F4WA 5GJPA 5LHEA 4HNLA 1VBHA 3N11A 4AMCA 1ZAHA 2Z6JA 4IL0A 1AMKA 4S3CA 5AVHA 3TR2A 2NX3A 1UOKA 1CXHA 3DBPA 4PTVA 2HSAA 2OVLA 3UP8A 5EL1A 1E4NA 1C93A 2V82A 4QLLA 5KZMA 3UXLA 2GJLA 5C54A 2QHAA 1PTAA 1QK0A 1HL8A 4FR6A 3A12A 1SVDA 4GBDA 4A8IA 5CAHA 5IDZA 4NJIA 4OZOA 3KX6A 4QNEA 1SSDA 4E38A 2FH6A 4JICA 4LNYA 4Z2GA 1PX4A 3DZ1A 3QYSA 3ARTA 1LWJA 1NP0A 1BVWA 4HYVA 4L4PA 3P60A 3VPLA 3FA3A 4KQNA 3DYOA 3AIVA 4OUEA 2QEZA 1EJRC 1OFRA 4I5XA 4PB5A 5IDIA 1YIXA 3VK5A 3C2RA 2IW0A 3L21A 4L9ZA 1KTCA 3LMZA 4IG2A 4IPIA 4B5TA 3APYA 3VO0A 4RW3A 3TYZA 3WF4A 3UZ5A 4L6HA 1SM9A 3WL0A 3MZ2A 3UA3A 4PUUA 5E6YA 3S2LA 5IRPA 1CWYA 3SR7A 4HK6A 2R6OA 2ISWA 4MMWA 2O7QA 4J4KA 3M07A 5ABFA 1PIIA 2QIWA 4GY0A 2DSWA 1ITQA 5CPQA 3WDRA 1Q6OA 4PSPA 2GL5A 1IR1A 2CZ5A 3GC2A 2W66A 1JZ6A 2JEQA 4UCGA 4HA4A 2A21A 1MO0A 3P80A 4GE8A 4HN4A 3GRIA 3CUGA 4WD0A 4XIAA 1QBBA 3EMQA 3ANUA 3VOJA 4GI8A 1C8QA 3GH4A 3IGUA 2GUUA 1FH9A 2FFCA 2HCVA 4LAOA 3PN8A 1P0DA 3MUIA 1MW3A 3GYCA 2EPLX 4J7RA 2A7RA 2GJNA 2J7EA 1B3ZA 1XC6A 1BFNA 1V5XA 3LG3A 1LWHA 3VKBA 2R8WA 3NO1A 3LPGA 3PJTA 2E5DA 4YNGA 5DCDA 3LZ3A 5H8PA 4PFHA 4JQ3A 4PMVA 4YHGA 5LIWX 3EWUA 4RPPA 2ZKMX 1HJUA 2JGYA 3KDNA 1F3TA 1JUEA 2VC9A 4C6QA 3NQAA 4ML4A 4W8LA 1GW1A 2A4AA 2A3HA 4F0LA 3C3NA 4PSRA 4B3KA 4FSAA 3OVGA 4DZAA 3RAOA 2GSHA 2YKKA 1WNOA 2J7CA 1ZP4A 1QW8A 1V6XA 2J4GA 2X7WA 2QCDB 2ZZ5A 4CQ9A 1KLYA 1H41A 4M3PA 3PZUA 2E9LA 5CLTA 4QSHA 1GPWA 2PWEA 4GI6A 1GOXA 3QW3A 3A3HA 1W9PA 4MB5A 3CV2A 3WH6A 3WMBA 1AL8A 4V27A 2XSAA 4RNHA 4O0QA 1N82A 2OZTA 1ZCOA 3DN5A 5DXYA 3PUGA 2Y89A 1BSIA 5IBXC 4MLRA 3N2CA 2CBJA 1NIUA 4CD4A 3OEXA 3DHPA 2AMXA 3LBMA 1JCJA 3U8GA 3THCA 1E6QM 1R8LA 4M8UA 3LCHA 1VPQA 4IIHA 4F0RA 1H50A 3LOTA 4WDTA 4JTFA 1IGSA 2UZ9A 3W7HA 1IF2A 4G7EA 4DWDA 1HTIA 1GTHA 3IIXA 1CEOA 2DUZA 3M43A 2DW6A 3LXBA 4DZIA 1CX9A 3K8LA 4XZHA 1B1YA 3B8VA 2NWRA 3HB9A 3IK2A 1UH2A 4JTCA 4IIEA 1JZ2A 3C61A 4OKDA 1MEIA 1WPCA 4AZCA 5T26A 3ABOA 3SCQA 1OFOA 2PBGA 4FX8A 1NAL1 1E1CB 4XQ6A 4ZL1A 3B9NA 4JTUA 3LCLA 1E6PA 1VEPA 2I5GA 3D5HA 1NY1A 4LUIA 3RDKA 4JIQA 3CL6A 3DFOA 2HS8A 3AHZA 4F0MA 1W32A 2PURA 2B81A 3I6TA 2CESA 3W82A 1SGJA 2PWUA 4D6GA 4KBXA 4XD6A 2GGGA 2WHKA 1H5VA 4UCFA 3I10A 1B5TA 1R87A 1JXJA 3F2DA 2WM0A 4XK2A 5A6TC 3R8RA 2UV8G 2J66A 4ZO7A 3TYAA 4O8RA 3FYOA 4AD2A 4JTAA 1RY0A 1E51A 6CGTA 4OFCA 3PNUA 4TR9A 3UPWA 1MWOA 1QHOA 2CLIA 2J8GA 2PD9A 1KBJA 3U6WA 3W2KA 2R1KA 4JN6A 1XWYA 1E0UA 3N2BA 1EIBA 3RMJA 5FSDC 1JZ8A 1H7OA 2GSJA 3MI3A 3CO8A 1JQXA 3H4XA 1RY8A 2OB3A 4GO8A 3C3UA 4S3JA 4D8AA 1XLAA 1LLZA 2WHJA 2ZUNA 4M5PA 1TA3A 1JAKA 3WD0A 2H8ZA 3FFSA 5DANA 3TJLA 4YJ5A 4NI3A 3UT0A 1SR9A 2EPNA 3B40A 3MJYA 1ITCA 5FAGA 1XCFA 4IPLA 1IIHA 3HFTA 3TN4A 4KESA 3EXSA 4ZBCA 4GRSA 1P6BA 4LBSA 1BWVA 2HDJA 3GO2A 1QBAA 2CU0A 3TA6A 3H2CA 2XFYA 4W93A 2OPJA 4GIYA 4ZSTA 3PZGA 1H7RA 3GU2A 2PWFA 5J8LA 3V1PA 4P7QA 3CL8A 3W7JA 3A64A 1JJKA 3B9EA 1GKPA 1H62A 1OY0A 2YDAA 3DFQA 3GFZA 3EPOA 1EJWC 3BW3A 1NELA 3VDAA 1HXJA 2VWSA 4YCOA 3SRDA 3TJIA 3OPSA 1ITXA 8XIMA 1VD6A 5U7SA 1LBMA 2QDEA 1DE6A 1W1ZA 3TA9A 2W4XA 2XM1A 1OD0A 1E3XA 2EJAA 4UNKA 3KCJA 5JBFA 3E9AA 3IWPA 1KV5A 1X6NA 3ALFA 3L23A 5A6JA 3R1ZA 2OOFA 4PODA 5AC6A 3LHYA 4NJKA 3HIJA 1GG1A 2O0TA 4K7YA 1I4NA 1VYPX 4K2SA 2I5QA 1ZGDA 4AEEA 5C2XA 3LYEA 3QHOA 1DQUA 2VGGA 3ZR5A 2ZZ7A 2ZDSA 3T07A 4Y9AA 4DN1A 3WK0A 2AKZA 3HZ3A 1AJZA 3DG7A 3CGTA 2JKPA 3UR7A 3G3DA 1LWIA 1R85A 2VUNA 2WKGA 3N4EA 4F2BA 3II1A 3UG8A 1KFLA 4ZZ9A 5A8OA 4XAZA 4DI8A 5LNRA 2OGYA 3L4WA 4LC6A 3CUIA 1R86A 1ME9A 3O6AA 3T81A 2PD5A 4KKXA 1OFAA 3QPZA 5D03A 5IBXA 2VD8A 4G5DA 4C6FA 1ME8A 2A3LA 3PJXA 4N9EA 3HPZA 4QRNA 1V77A 4DF1A 1RPXA 4WK9A 2ABBA 1MW0A 3MTWA 1TZZA 7TIMA 1EGVA 1W5PA 3I3EA 1ZRQA 1S2AA 2Y5EA 1BGGA 1UWAA 3ZFHA 3JU2A 4KEUA 4H7VA 4JBRA 4U2YA 4OJYA 2WQPA 1B30A 1GVRA 1V7YA 3RXZA 5LSMA 4BR1A 1FWAC 1M68A 5AKQA 2B7PA 3OVPA 1XG3A 3VD5A 2Z7KA 4I8DA 5C2GA 2YBTA 1CBGA 3U4FA 3KRZA 3L68A 3D0CA 5D30A 4W4QA 3ARPA 2PCEA 3IJLA 4YHEA 4ZFCA 2D73A 3GFXA 3SCOA 3AMCA 4DRSA 4HK5A 3L5MA 1UA7A 4KETA 2WB5A 5IHSA 3GTHA 4O1DA 5LZLA 1JI1A 3ZJKA 1TELA 2F6KA 2PE4A 3UGVA 1A3XA 3MY9A 1O68A 4DBSA 4B5VA 1KM4A 1I2PA 4PMRA 4XUYA 4WQ6A 1TPFA 2EG8A 4FO4A 4UUIA 4RNIA 1IT8A 3TROA 1FCVA 1GVYA 4RE0A 1FWGC 1KWKA 2XSXA 1RHCA 1I2RA 1US2A 3P8IA 3IGXA 2BVYA 3MI2A 3WH8A 1QOXA 2XINA 4IMFA 1A5OC 6XIAA 4JXCA 4KW2A 2XGIA 5EMLA 1JCYA 1AUSL 1TWWA 3W4RA 1DXEA 1ZSXA 2VFFA 4YTUA 3W6MA 2WMGA 3SRHA 4MGGA 1J79A 2ZX6A 3G18A 1XIHA 4TO8A 3RFAA 4U5KA 2WBGA 2PTYA 3QGVA 4DJEC 3TLQA 4LUTB 1SW0A 1OYCA 3THDA 1R9ZA 3S83A 1J0HA 2XN1A 5I6SA 1WV2A 1Q63A 3E2VA 3E38A 4U5IA 3RO8A 4C6IA 2PZ0A 1DQWA 1QT1A 4UZUA 4B16A 1AMYA 4LW7A 4E2VA 3UG4A 4IJCA 2CHNA 2CETA 3GTIA 3GTXA 4ZB5A 1A3HA 2JE8A 1G4TA 1MDLA 2W3ZA 1J0JA 1UR4A 1VC4A 4DBDA 1VCFA 3THUA 4IGMA 3LSCA 2YLAA 1X7IA 3RLHA 4BQ2A 5A6SA 2FHBA 4NVTA 3ES8A 5AHEA 3M7SA 1KM0A 4O1CA 1I0DA 4FXFA 4W87A 5I3FA 3B03A 3B9OA 3M44A 4H04A 4JQ1A 4JGDA 4NY2A 4TX9A 4GY1A 1XLHA 4ZB0A 1Y8BA 1LM1A 2PFHA 4GY7A 1XCXA 2NQ5A 3VX0A 1NDVA 3WQ6A 1DVJA 3WLLA 2YXGA 1W31A 1EP2A 2PRMA 4FPSA 1FFQA 1ADSA 4AD3A 3WJSA 1W1TA 1J10A 3P84A 4I8YA 1E43A 3ERPA 3GB6A 3BLDA 3PANA 4EXQA 2VEGA 4ZOBA 1OEPA 3AALA 4Z2IA 2FGBA 2PDXA 3CZKA 3ABSA 4JYEA 1ZZMA 1V4YA 4IQDA 5EFFA 4PEKA 1FDZA 3WQ5A 3S2MA 3RYSA 2Q02A 3HM7A 4HOWA 5E09A 1P0EA 1Q5MA 2HQAA 1M1BA 3RG6A 2JGQA 2GGJA 2HE8A 1B31A 3FDGA 2GOKA 2XPKA 3A24A 2QNEA 1SFTA 1OX4A 3M0YA 2DVTA 3PPHA 2E8YA 5HWNA 3T8LA 4UOZA 1S39A 4PGLA 5G4EA 3BJFA 4PCFA 4ATDA 1A53A 5HBFA 3VNMA 4G1NA 1DJXA 4NXSA 5A6KA 3LRKA 3VKDA 1E71M 1WKYA 3MWCA 3QLDA 2BG5A 1EBHA 1VLIA 3FJLA 2DZPA 2QAFA 1JUKA 1IXOA 2PODA 3NZGA 4AEOA 3T44A 1REQB 3C2VA 1FHDA 3I7RA 3DU0A 3E3HA 5I3HA 3CNYA 3I4EA 4WCJA 1XUUA 3S5OA 4A2SA 2AAAA 2VZTA 1XYBA 3W73A 4QEHA 4NUWA 2RUSA 2WCGA 2YXOA 3HMCA 3EAUA 4A3UA 3SW6A 5MKGA 3G0UA 3QGKC 1EOMA 4MNMA 3ORWA 3MSRA 4GQBA 3T42A 3T2PA 3MP4A 7CGTA 1GEHA 1A5MC 3W2NA 5IFTA 3GS6A 3DOPA 4ZTYA 4E3TA 3WFAA 4AD1A 4M7SA 4PB3A 4QSFA 2BSLA 1LBLA 1XLLA 3VGDA 1UUMA 2IPJA 2XFWA 1R38A 2FQIA 1W2PA 4GUIA 4JEJA 3T05A 3LTSA 1O1HA 3AXMA 3S1GA 4RXGA 4KEMA 4LRSA 4ACZB 1P4CA 3LRLA 3V4BA 1SMAA 1FKWA 4XAFA 1SPQA 1YPFA 1OCQA 1W9UA 3QQWA 4LVAA 5AHNA 4HZ6A 5EYWA 4JYDA 1HGWA 3U57A 3VE9A 5A8PA 2WANA 2G95A 4LTSA 3W2JA 3C4UA 2QJIA 4XZ9A 3H21A 3MYOA 1XIJA 3SUWA 1O60A 3IVUA 3VGEA 4GVIA 2ZCGA 1YQ2A 4WXZA 1HJXA 4R7OA 1B90A 3AHVA 3CHDA 3LS9A 1YW1A 7XIMA 5D09A 4M1BA 1OIFA 1V6WA 2VC5A 4ZOCA 4EWJA 5KITA 4GPNA 3DFNA 1YBQA 3PJUA 1DWFM 2D0FA 4U3CA 3AYSA 1EHAA 3EPNA 3EWCA 4O4VA 2B0MA 1VCGA 3LI1A 1YNQA 4LF2A 3FJNA 3LY0A 3W3OA 2DP3A 4PBEA 3AQUA 2YCLA 2MANA 3BDKA 1QFEA 1A5CA 1XRSA 1CXFA 4GC4A 3WJXA 4WOZA 4DI9A 5ABHA 3M6DA 4YVXA 1W5NA 3LHWA 3GXMA 1BVNP 1XLBA 2YX0A 3TUUA 3AU2A 3C52A 4QCFA 2C16A 4UNLA 3KTCA 1UD8A 3PAJA 3PSVA 2WCSA 1N2VA 1XYLA 7ODCA 3IARA 4K38A 3S9IA 3OGRA 1E1EA 1U1JA 3MA8A 4Y2WA 2B7OA 4O1FA 3MMWA 2J9XA 3DESA 3NL2A 3CHCA 4AQLA 1BXBA 2ALRA 4GYKA 2JF7A 3Q94A 3GW3A 1XV8A 1E1FA 3W02A 3P0XA 3LB0A 1F5ZA 4C91A 1BPLB 1ZLPA 4FS9A 1BG4A 3E5PA 3LHZA 3NUKA 1FCUA 2WZTA 1O94A 1KQZA 5AC7A 4MWAB 1UC5A 4V1YA 3SZ8A 4IG2B 2YDQA 2ONEA 1RLDA 3KBSA 5FEWA 4BS0A 3TJ4A 3GYEA 3G22A 2VO5A 2WW5A 2ZIDA 4PMXA 3AHYA 4R88A 1NSJA 4ZA0A 2P3EA 5A8QA 4PUNA 2ZOXA 4PMUA 4GIAA 5D9OA 2QKFA 4MJ2A 5TD4A 2NX1A 2E9BA 2PTXA 1RK6A 5ABFB 1SO5A 4PL1A 3FNDA 2EPMX 3BMVA 1TCMA 1YTKA 1HJWA 1P1XA 1DWHM 4Q4QA 1W1A1 2VX6A 3O1NA 2CLHA 5C9ZA 4JZ5A 4QP0A 1SJCA 1NU5A 3SIZA 3PBUA 2ZQ0A 4HIBA 4JIIX 1VKFA 2I9EA 1PUDA 3G0XA 1HKWA 3OHMB 3SSZA 4OIFA 5A8GA 2PDMA 4A3YA 4J3ZA 3WJYA 4WGXA 2TODA 2RFGA 4CN4A 3CUHA 2A0NA 1V08A 2ADAA 2A1YA 3E6EA 3RLUA 4JS3A 3CU2A 2DZWA 1UASA 3EB2A 5CGTA 4AWTA 4KCUA 1E5NA 1I60A 2DIEA 5JU6A 1Q8AA 1TZ9A 1A49A 4HNVA 1EZ2A 1W17A 2VZSA 2CBUA 2ZZ3A 4JTRA 1BXNA 4P8WA 4F2UA 3HGSA 5AZ0A 1UWIA 2Z25A 1G69A 4Q8OA 3G0SA 1Y5VA 5RUBA 4MIMA 3K1DA 1KA9F 2V6AA 2QCHA 5I3JA 1JD7A 2CWXA 4H7CA 1W3HA 3F1QA 3GHRA 2FVKA 3STGA 3RX4A 3AWOA 3BO9A 4B9YA 3IRSA 3NL3A 4LRTA 3WLTA 3EWWA 2BGNE 3MHUA 2RGMA 4N9DA 2GGEA 1AQMA 3HPSA 4L4OA 3N6JA 3CAVA 5CPTA 1A4MA 3WDIA 3IV8A 3PS7A 1UKSA 4FNQA 3UZWA 4US6A 3B8TA 1JAEA 6XIMA 3LTPA 1VF8A 3M6YA 1IWBA 3WEZA 5HJLA 2HJPA 4YN5A 1FWBC 1W56A 5C71A 2ZA3A 4QCEA 3VUSA 2VFGA 4UOQA 1GYLA 1XYFA 1F6YA 2A79A 1SO4A 3URAA 4KFNA 4HU3A 2OQYA 1G94A 3R0KA 3UVAA 4G7EB 4RE4A 1SZRA 2DZUA 3ISIX 5HK4A 3N13A 1MQRA 4Q33A 1NOWA 3M0MA 2E09A 3SGZA 2VVNA 3OIHA 4BI5A 5JBDA 1OK4A 3BK0A 4NNCA 4IT1A 4W9TA 1UBSA 3H2FA 3LGGA 4IIDA 2W0UA 2YR1A 2DW7A 3SCUA 4N4QA 1UUQA 5HUOA 4AZCB 1TG7A 2HPIA 1KRCC 3ABQA 1SFLA 2V30A 1DJZA 2IXUA 3BW2A 3ITVA 1FWEC 1WDPA 1GYNA 1XP3A 3BANA 4AWSA 3UZYA 1EFZA 1DQXA 4D6CA 1OSEA 1QPRA 2VJXA 1NOFA 5BNKA 3H22A 1JYWA 1KCKA 1P7TB 3BARA 1T6MA 5AOUA 3T4WA 5KINA 4EACA 1S2TA 4QM1A 4ZQOA 1S2VA 3DI1A 4I9TA 3AXIA 1ZBVA 3GM8A 5FJUA 1GZGA 5AHMA 1B0IA 3JR2A 1Q65A 1QOQA 4HU4A 3S5SA 4XZNX 4OOZA 4MG4A 4LCRA 4QISA 4PMDA 3V36A 4HSNA 1OWQA 5K4ZA 4UR9A 3ZT7A 4YTTA 1LT8A 4Y9MA 4IFRA 1PXGA 5BXSA 4XKYA 1VIWA 4DEFA 2XVKA 4O14A 5D2YA 4LB3A 4X22A 1OF6A 1A3WA 2P0OA 1B3WA 2Z0IA 3CUFA 3MCOA 1B4EA 4IOTA 1UKQA 4BI6A 1CECA 4HKPA 1WZMA 4GK8A 2HISA 2JBMA 4QX4A 1ITUA 3RGTA 2BTMA 2NVAA 1MSSA 4URIA 3S2CA 1J93A 5FCZA 3N9SA 1VJZA 2REQA 1ZY9A 1XSJA 2P76A 1XSKA 2VWTA 1MFVA 3WG6A 2PGRA 4WGHA 1FHUA 3W1MA 1TA3B 4IL2A 3POHA 4MB1A 4Y9PA 1X7FA 3P62A 4HMDA 4Z0SA 4XBJA 2OGJA 5CJMA 1TYGA 4IMCA 1UWTA 4TQTA 1KWGA 4CQDA 1R5YA 4W8BA 5JXQA 3T8QA 2C8NA 3TWAA 1HP5A 3B97A 1KM6A 1OFQA 3IJ6A 3DXIA 1YEYA 1DL3A 4Q6XA 1QATA 3C0JA 4AMAA 4LVFA 2AGKA 3TCEA 1R2RA 4GBUA 1BHGA 3GHTA 2R82A 1KXHA 3MB9A 3T0TA 5TNVA 4Z2LA 4LYKA 2XGZA 9CGTA 1B3XA 1S38A 3KBNA 3H12A 3NPUA 3C0LA 2V2DA 2E5BA 3MS8A 4YCPA 3WLKX 3WL1A 2IUZA 4JFTA 3W75A 5JH2A 2EXOA 3GDRA 1QNQA 5ABEA 3UJRA 3E49A 4GQ0A 2HNHA 2Y88A 5K9XA 1XD0A 3L4XA 3VA8A 2QPSA 4QFUA 5H91A 2WSRA 4PR4A 3GUWA 2Y7DA 1V0KA 4MB3A 5A2CA 1ISYA 5B7YA 5E0KA 3H55A 5HANA 1TX0A 4PN2A 3OG2A 1Q6CA 3DERA 1X8FA 3UD6A 1Z41A 4OHQA 1FX6A 3TQKA 1ESWA 3MVIA 4GUFA 2OKOA 3EWYA 1TVPA 1KCXA 4J1OA 4QS6A 1S1PA 3MP3A 4QIUA 3W83A 2WVTA 4JCLA 3SUVA 4HNCA 3MKVA 1JUBA 4Q4KA 3O6YX 4XSLA 1I2QA 4GX9A 1FP9A 1KBIA 4G8TA 1ZP3A 1TPWA 5DMYA 4JPGA 1NQ6A 1BRLA 1AH0A 5G4HC 1EJVC 5A6AA 1E6XM 1XM3A 1KV8A 1QNOA 3CH0A 3JZUA 1D3CA 5I0DA 5CSSA 3KAOA 3T2QA 2ZE3A 3QR3A 1MMFA 1RP8A 4X3ZA 1RQEA 5HQLA 3PBWA 2XVPA 1XRVA 4IIFA 2I9UA 4FNUA 1SSGA 3AZSA 4GLEA 3MO4A 3L2MA 2D2OA 1JNEA 3WY1A 4YU1A 1AH3A 5LKYA 3RM8A 3DFPA 4CCZA 4XD4A 1I9CB 3W26A 1R3TA 4I5RA 3QOKA 4FALA 3TXZA 2ZYFA 4NG3A 3HPXA 4NZ3A 5G2IA 2D69A 2VOTA 4QDPA 1AODA 2BY2A 4YL2A 1M9HA 4DJFC 4S3AA 5HMDA 4H8UA 5AYXA 1VJSA 1V0MA 5BRPA 2HBVA 1EWDA 1H5YA 3QKZA 4CQCA 3B0XA 3TLLA 3ZLGA 4D71A 1VFMA 3PZ9A 4ZQRA 3GXFA 1FP8A 4DO6A 3AMDA 2CBIA 1NF7A 1H09A 4LFYA 3MKKA 4UQCA 4TTUA 3CM4A 2FB3A 4JKMA 3B9DA 3EB3A 2HK1A 4H8HA 1I6NA 1DWGM 2WVUA 3UJFA 2OELA 3GC5A 4QQUA 4MAVA 3JW7A 5KZDA 1BKSA 4H6EA 1H0IA 3ES7A 5FACA 4O53A 4HHMA 2UY5A 1NM9A 1F3EA 3UG5A 2BODX 3VM5A 5DCBA 3PFMA 3ATYA 4EPEC 5EY5A 2NQ9A 3WBEA 2WVSA 5C8BB 1MRAA 1VLWA 2WYSA 1TPEA 1W54A 3WO8A 5CCZA 3FEMA 1Q8JA 5A8NA 3QY7A 1BYDA 1IXNA 4IX2A 1O66A 2DSZA 4AUBA 1EIXA 4LY4A 3W7GA 4NHVA 1V3KA 2XJ7A 1SJDA 4GH3A 3CV1A 4ZR8A 2OEMA 3F5LA 5I03A 3AMKA 4S3BA 1GORA 3PVFA 3LPOA 1YXDA 3PZTA 1JDAA 1UR0A 2J77A 4Z2JA 1F7BA 4IIBA 3QKEA 1PS9A 1MXGA 5ABTA 5HMEA 3CUZA 4LEFA 3UESA 3L4YA 2EEXA 3PHAA 1TQJA 2XH4A 4F8XA 4UR8A 4QNWA 4IPPA 5DRIA 3ATZA 3QTGA 1XBZA 3ARUA 4Q7NA 2PU1A 5BROA 1CXEA 2E1WA 1SMDA 5A6MA 2QJNA 1PVNA 3TZFA 1IQ8A 4UFKA 2V69A 3ZWTA 3A22A 2BOGX 1FCQA 3WD1A 1UWQA 3KUMA 4JHOA 1BQCA 1ZQ5A 4XO7A 3KOFA 2OYLA 5A3HA 3WUEA 1AW1A 4IX0A 2HTMA 4LSBA 4YIWA 4S23A 1NARA 1VHNA 1QU4A 1VEMA 4AC1X 2Y85A 4TV6A 4B9ZA 3UEQA 5F2GA 1SZEA 1RCQA 4M51A 1SU5A 5CPMA 2V5LA 2CW6A 1G1YA 3PBVA 3QQ0A 3SN4A 4IHCA 2ATSA 3AJ7A 1DXFA 2ZRVA 4DY1A 2OLAA 2PBOA 4FAMA 2DSKA 1IEVA 4Z08A 5CC3A 4O13A 1E0WA 1SJBA 4GZIA 4LVBA 2IQ0A 3W01A 3EWXA 1IEIA 1M7OA 2DQWA 4AVOA 4P61A 1XHGA 1CGTA 4OV4A 2HXTA 1M7JA 4Q8PA 4GYJA 2WC4A 3VIJA 1WZLA 1EJTC 3U2OA 3OLEA 1OX4B 1QPKA 1MYRA 4LYPA 1O5RA 2AKMA 5CLWA 4DQWA 1Y65A 1Q45A 2YYTA 4L9XA 1WBJA 2X1TA 1ENUA 4RE2A 4L7ZA 2FLIA 3OG3A 3GHSA 5I02A 3AICA 4KWOA 4O52A 4DBEA 3AIBA 2D2JA 2VFEA 1JYNA 1OADA 3RPMA 2YPIA 5I23A 4UOJA 1A47A 2C79A 4IQEA 1UOZA 1F73A 2C15A 1YHTA 3OQEA 2GVJA 4GINA 1H11A 2OWXA 4FLRA 3W2UA 3BG3A 2JK2A 4C1NB 1XLGA 1HL2A 4R7WA 2ANUA 3TQ0A 2WO5A 3TR9A 4JX5A 3V1HA 3BLFA 2HK0A 2CNCA 3UWWA 2UY3A 1TREA 3H54A 3E96A 3EKGA 3PZIA 3VGGA 1V03A 2QPXA 2VC7A 1E9IA 5D33A 1K3UA 3L4ZA 2EKCA 4XISA 4EF9A 4CGTA 3S1UA 1G6CA 5DEZA 4MKVA 2A3CA 4IPNB 2OO0A 5MF5A 3DAQA 4ZO8A 4QJ1A 2FZ8A 1NEYA 3WQ4A 3BGJA 2HS6A 3RLGA 4KGLA 1D2KA 4HPXA 4X9SA 3LQLA 3TE9A 4BQ5A 4TU1A 4IGHA 1RBOB 1TPH1 2A6NA 3QSRA 5U4NA 3QF0A 2XN0A 1HVXA 4CVUA 4US5D 3ARZA 4H9XA 4B91A 3Q4DA 3NZPA 1PDYA 1EA0A 3HMJG 2ZADA 1O12A 4XV0A 2P0IA 2OMAA 3K30A 1PX3A 4GFIA 4CN6A 1SZGA 2OLHA 2Z24A 4NYYA 3I6RA 3VC6A 4B2DD 2FYMA 3OVQA 2DT1A 3MCMA 2KZHA 4IJRA 4B4HA 4L56A 1F8IA 1CB7B 5JMUA 4ROPA 4LS2A 1KCLA 1YDNA 1CPUA 3M0XA 1KB3A 1MNZA 3M9YA 2LLEA 2R91A 3IVSA 4DJDD 1WZAA 2CPUA 2NT0A 5E70A 2NV1A 4NU7A 1TRIA 2E5CA 4UZSA 4QLJA 1KFCA 2W67A 4CEXC 1YBQB 4L6DA 3WLPA 4DLMA 3LU2A 5PTDA 3UYCA 2CERA 3B8WA 3T2OA 3OIXA 1KFWA 1S1RA 3JS3A 4TX8A 1EUNA 5FJPA 1T0OA 3BTNA 2W6RA 1ZBCA 3H23A 4ADTA 4NZFA 1EYWA 4GOAA 5HNNA 3BAWA 2JF6A 2X1RA 1THFD 4J2MA 4PUDA 3VINA 4RDYA 4GJ1A 4V1XA 3G1YA 3SM0A 4GQQA 2CFFA 2HE5A 3EZ4A 4PTDA 3CIVA 3M0IA 1XD1A 4PTNA 3W81A 1YNYA 2VENA 3PZNA 5AYBA 1OZQA 4GUJA 4XB3A 3GAKA 3IJ7A 4UFLA 4Z1AA 1VBJA 1KW1A 5AZ1A 4L6OA 1XFCA 5CC6A 1ZHAA 5GNZA 2W63A 3FIGA 4JCMA 2WJDA 3LMYA 2CHOA 4FB7A 3N14A 3E5BA 4FXJA 2ZTJA 4XVDA 2O4QA 3W1TA 3G77A 2V0TA 3VIPA 2BBFA 5CZJA 5KEZA 1PCKA 2W9MA 3C8FA 3UCQA 4ERAA 4GZJA 1EWEA 5BXPA 1WDRA 3RLVA 4HP5A 5HOSA 3K2GA 3SUUA 1JYVA 3M16A 3KVMA 3LQGA 2PU0A 4AFYA 1DEDA 2INFA 4HOXA 1JI2A 1JCMP 3BAIA 1UWRA 1ISVA 5K9CA 1W5MA 1LZOA 3VOGA 1ZUAX 1B3YA 4GIRA 3KOYA 4LV9A 4WRHA 4MKSA 5M17A 1Q6LA 3GE7A 1UHVA 4ZOEA 4MWAD 1BYCA 2ZRXA 3T55A 3VAVA 4REQB 2XZ9A 4IMGA 3HG2A 1VR6A 1QMLA 2ON3A 1BSLA 2PP3A 3WLJA 4WOQA 3GAYA 2PLCA 2CIPA 1UC4A 2D24A 2PUZA 1UQZA 3HQNA 1ZBWA 2PSNA 1N7KA 4I7WA 1HO1A 4UTTC 2XYLA 4BZYA 1BKHA 4EXBA 3CTLA 2TAAA 4KWWA 4H2CA 1LUCB 2X1IA 3KCOA 4EE9A 5CPNA 1T40A 3GG1A 2OSWA 5FJOA 1J0YA 1TUFA 3BCFA 4J9JA 3SQSA 2Q09A 1PZ3A 4QDMA 3XISA 1Q85A 3VXGA 2F38A 4BQ4A 4Y90A 1JGIA 3TN3A 4Z2KA 3VNZA 1V6TA 2CLKA 1J18A 3BJSA 2GJXA 3WBXA 3KZSA 2VD9A 4MYXA 4PMOA 3W1AA 1SUXA 3POCA 1B3OA 3NSMA 1PIFA 5D8ZA 3LBCA 4P5UA 4GQGA 1QXLA 3C6CA 1E6RA 1R3WA 3N29A 3BVJA 3WLMA 4GXWA 3JZEA 3L0GA 4UBPC 1W3IA 3HA1A 2QS8A 3UR8A 4LV4A 3AUOA 1MEWA 4QE4A 1TV2A 3VKCA 2TYSA 3NDYA 1U5HA 1GG0A 1UD6A 3CL7A 3IJIA 1BXCA 1RVKA 4PCTA 1ISWA 4TMCA 1T8QA 2XIJA 1RLCL 4HU0A 4DNMA 3UZJA 2EKGA 3WKZA 3WD3A 2A3AA 4HK7A 4JTDA 2FFIA 2V3GA 1PPIA 3PUDA 1QO2A 2ZDRA 3G1FA 1N8WA 1W6TA 4F9JA 1WDDA 4UMCA 3KBJA 1TCDA 1YNPA 4C65A 2QMJA 1E4IA 1GOKA 1PHQA 5AHIA 1EGMA 1XBXA 2VGIA 4KERA 3DFSA 3W84A 2GWGA 4AXNA 1VZWA 3CT7A 1XIMA 3KFTA 1IV8A 3TAKA 1F61A 4BWLC 3EXRA 3QVQA 4H9UA 1JEZA 3L65A 2L5HA 2J75A 1OZMA 5E0CA 1H63A 1AK5A 1VS1A 1RBAA 1WUFA 3F4NA 3GXPA 1H7NA 1VBGA 5HQMA 4IMDA 3P82A 4BA0A 3UZXA 1XDMA 3E2SA 4AX6A 4MKNA 4AEFA 2ACSA 3BAYA 1UR2A 4OE7A 3BOFA 1EQPA 3O05A 4JIEA 1N8FA 1JR1A 4TXEA 2VFIA 1OYAA 1LDCA 1Y5WA 1J2WA 3TMLA 1Z9AA 2RHGA 1T8XA 4C6DA 1XG4A 1XGEA 3SCSA 2XH2A 3CZEA 4A8RA 4XAYA 1WUEA 3HBLA 5B7ZA 1ML1A 1LBFA 5J04A 3WQFA 2INEA 1BGAA 3PBGA 1QDSA 2NQLA 3DHUA 2R14A 3LLXA 3TN5A 2PEVA 2VDIA 1JVNA 1EGZA 4JIPA 3F4VA 3D47A 3PFRA 1KKRA 2GJPA 4R9OA 4C5ZA 3ZJ8A 3MP5A 5LNSA 2A2IA 3W25A 4C6KA 1H1NA 3IVTA 5D38A 1QO5A 3MANA 2OEKA 3GHUA 1P0KA 1KKOA 3O15A 1TO3A 4XKYB 2BMBA 1DV7A 2FHFA 4YYCA 3NM1A 3FV9A 1B2YA 2OT1A 4NJGA 4RDVA 4WLCA 4M19A 1KBKA 3LX9A 3R13A 3QLLA 1WOBA 2DZSA 3EMCA 2BVDA 1LL7A 2E6YA 3CT2A 4B3ZA 5C0QA 1H7XA 3WBWA 3ID7A 4WUIA 2ZXBA 2AOSA 5DMLA 4GVFA 1VFUA 3JVAA 4E4UA 3LUTA 4AY1A 2VXNA 4WF7A 1UMLA 4LUTA 5E5CA 2Z1KA 2IQTA 2FTPA 1U5JA 1Q3NA 1XINA 3DKLA 5TIMA 5FJJA 1XPGA 3W22A 1P0NA 4C90A 1KM1A 3O16A 3CQHA 1S2WA 3DKJA 4UTFA 4AAJA 1UZ4A 4S38A 4AXKA 4DIAA 5A6BD 3SCTA 5KZEA 3QQ1A 2PF8A 3NWRA 2Y61A 4PFMA 3CV7A 4GMEA 2NT1A 1XIDA 1AJ0A 1XL9A 1XW8A 3WELA 1JXKA 4F40A 4HZ7A 3S4TA 1FA2A 4PMYA 3KEHA 3VX1A 4YMZA 1KXVA 1DTUA 3TEVA 4BI7A 2Q6ZA 4BF5A 4FP1A 4M6QA 3C86A 1EC9A 3U2CA 3EGJA 3AXHA 3V0UA 3JUGA 4UQEA 5CSUA 4S3KA 1C8VA 1NTHA 4GXPA 3UA4A 4LCSA 2OSYA 1G7VA 3ZM8A 5HMSA 5LA2A 4Q8QA 1HIZA 3THQA 2VL4A 4NJJA 2V68A 4ONVA 1YRRA 1JZ4A 3S5NA 1YTEA 2BXYA 4ROQA 3N2TA 1R3SA 3W0KA 2X0YA 3EOUA 3OLDA 4JQAA 1WCGA 2FB2A 1Z8AA 2Y5SA 3UNDA 3R79A 3KWSA 3USBA 2YB1A 2ZRYA 3EX3A 3N6QA 4YVPA 4O1EA 4D6EA 5I78A 2WHLA 4UTWC 1EO7A 1W3NA 3OQ8A 3CXOA 1D7FA 5I06A 3SRFA 3UFYA 4R53A 2B7QA 2J74A 3N73A 4K1GA 1XQKA 5D4YA 3DECA 3AO0A 3VIOA 4D6DA 2VX4A 5IXEA 3QSTA 3L67A 1Q7QA 3SUSA 4IIGA 1HF6A 4HSOA 3KRUA 3HF3A 4NRSA 2POTA 4IMEA 7ENLA 1PIGA 3DH7A 1TPDA 2NSXA 1WXJA 5CGMA 4WDUA 1GJUA 2V3DA 1CGUA 3A4AA 4EAMA 2VI0A 4PCPA 5CSYA 1BRLB 1PZ2A 2JKEA 4UB9A 2OU4A 2AGTA 3CWNA 3TSMA 5E6ZA 2GVEA 4GNJA 4ZCWA 1FWNA 3GNNA 4PYSA 2BDQA 3UJEA 2GK1B 2CZVA 4IUOA 3G2GA 5A95A 1QVBA 3U0HA 3ARSA 1QTWA 4F0KA 3QV9A 2PDLA 4E8CA 1E40A 3TCSA 4AWEA 1REQA 2ABAA 1V6VA 5CZSA 3PBYA 3O8AA 3KM8A 2E1DA 2R94A 4AZIA 4IMAA 1BLIA 1C9DA 2GQAA 1CI1A 4ZTXA 1SW3A 5GNYA 5LIYX 4WSHA 4FNTA 3R43A 3QR1A 4QBXA 2PCQA 2VC6A 1WDWA 3TOYA 3AROA 3R25A 3AYTA 5CBIA 3EX4A 4FI4A 2TMDA 1KCZA 5JIWA 3M0LA 4AZHA 4S2CA 4O0ZA 4US5A 2IPGA 3MDWA 4L1GA 2IS7A 3GNOA 1ZJHA 2QAPA 3TFXA 2F61A 4A3QA 4JN7A 2VELA 1J0IA 1AD1A 3STEA 4K8EA 1F05A 1W9XA 3PZQA 4B2DA 2Q3RA 2VQTA 3KRBA 2Z1SA 3O3RA 5HJYA 4A8LA 4R3UA 5FSEC 4XAPA 1X6UA 1TJRA 3P93A 1D8WA 4DJDA 2JQXA 1FWTA 3BICA 1RR2A 4LWWA 1W37A 1R7OA 1E72M 4B5UA 3VI2A 4QAIA 3FY1A 1QJWA 4L64A 1Q6EA 1XH1A 3H7RA 5GQBA 4CNSA 3TYCA 3WQCA 4CKQA 2I1OA 2YBUA 4EPBC 3PWGA 4XAGA 3MPGA 3TK7A 1X6LA 3LGEA 3M5XA 5HUPA 3WQWA 2H3BA 2HBXA 3UWQA 1PHWA 4WVXA 3STFA 3CMJA 1UH3A 4F0HA 1OG0A 3APTA 5BXTA 3SCPA 1ISXA 1ZJIA 3E0IA 2FMOA 1US3A 4IQJA 4ASTA 1XCWA 3O06A 2G37A 2DZVA 4KT2A 1M04A 4NAFA 1GOIA 1TWDA 1VFHA 1XGDA 2BS9A 1NWUA 3FAXA 5FD0A 4ZE5A 1XLCA 5FA5A 3U2ZA 1SFSA 1A5UA 3NCOA 3WQOA 4A29A 3KVJA 3EKLA 1WBHA 3NL5A 2VNCA 2Y62A 3AAMA 2GUYA 1U30A 1LOQA 2Q3OA 3PPFA 4CD7A 4QR6A 3QN3A 1P43A 3MI6A 1CLKA 3VZXA 3R11A 1G4SA 1YXYA 3TH6A 4DB7A 1MVYA 3UQNA 3WDJA 2Z1BA 5AB3A 2R1LA 1TWIA 4RZ4A 3ARQA 3I7SA 4MPQA 3OYXA 3TTQA 3QW4B 3REQA 1WB0A 1F4HA 3VOCA 5F2LA 4Q4SA 1C90A 3ZS4A 3GU1A 2Z1VA 3WH9A 1XJBA 1RCXB 2FKPA 2Z2BA 1G01A 1HJSA 4G1KA 4LANA 2I7GA 4RV8A 2DEPA 5C7VA 1P6CA 3A9BA 1FWSA 2B4GA 3FA5A 4E2OA 3ZJ6A 1WA3A 5DFAA 5EMKA 4MWAA 3GKAA 4CU8A 1GEQA 4PC8A 1LQAA 2WK2A 1JDCA 3UCCA 4HMCA 1FDJA 2BASA 1I45A 4TV5A 2PWGA 4KRZA 3H2NA 1FHVA 1V7AA 4K37A 2B7NA 3TQVA 1R2SA 4NRRA 3GBEA 5C9XA 1AVAA 1K7XA 4LU0A 2J47A 1XIGA 2NXIA 3OYZA 5A6LA 2X1SA 3W53A 2ZRUA 2YGYA 4JHMA 3OB8A 3MHFA 4RXFA 5HATA 4CD5A 4OWGA 1LF1A 3T0DA 3JRKA 2OX4A 1A80A 3WF1A 4GX8A 2WJEA 1HVQA 3G1AA 5A5WA 4AIOA 2V3EA 4NF7A 3WLNA 1D8CA 4WKFA 4GVHA 1KRBC 4F66A 3A6OA 4JQ4A 3THAA 1GQIA 3EMZA 4AF0A 3G8RA 5C9WA 2A6LA 4IH3A 2QF8A 3KE0A 3AIRA 1RV8A 1W9BM 7A3HA 4UTIA 1M6JA 3N04A 1VQTA 4QS5A 1VJIA 4C6LA 2QJHA 4WX2A 4NXKA 3EOLA 4H9ZA 3E2QA 4OQVA 2AL1A 3VABA 1UPMB 3VIMA 4UFIA 1RZMA 4N0RA 2D3LA 1VGAA 3WFLA 6A3HA 3T9PA 3U9IA 3TYBA 5HWJA 3GSMA 4DWSC 4JN8A 4CVWA 1CYGA 3DYPA 4K8GA 3MDUA 3RCNA 3E74A 5FEXA 1YPXA 3ZVIA 4I6VA 4C6MA 2XIMA 3F2BA 3SB0A 2OKTA 5D05A 4AZGA 1CT5A 3R0DA 4ZENA 3KDOA 2XZ7A 2MNRA 2YCKX 3NQMA 2PDWA 1OHLA 2WQDA 2NV2A 3GNPA 3RR1A 3V0TA 2DORA 1HNYA 2JKAA 1H7WA 5DY2A 3BZGA 3S6OA 2FDSA 1NVMA 3CQJA 2VEMA 3W24A 2ASHA 3LA4A 3KCLA 4PH6A 3PR2A 2OYMA 2XH7A 2P88A 4PBGA 3ZSTA 1EJUC 4K8HA 1E55A 1W1YA 5JBEA 2FZDA 4W88A 1Z42A 5DY3A 3BSGA 3ONCA 3K4AA 3CUXA 5D9MA 3F7JA 3B04A 5I07A 4MFEA 3D3FA 3UGRA 3ZLHA 4AISA 4XKMA 4L5ZA 4DUOA 5LXXA 1GHRA 1VRXA 2CLOA 1VYRA 3IUHA 4PUKA 3P5YA 4FLOA 1PJ9A 3BLKA 2WPBA 3UVIA 5HNRA 1QW7A 3VCNA 3FEQA 1H4PA 1AW2A 1RQBA 3C2EA 1E6ZA 3CQ0A 5E0FA 3WH7A 2RAGA 3U5UA 3OA3A 3OTRA 4AH7A 5M1TA 1TJ1A 2VQUA 5CZKA 3WYZA 4RLIA 3F03K 3WMCA 3WUBA 2WWDA 1IR2A 1XKYA 1HO4A 5F4XA 1PDZA 4DJED 4G9PA 3YPIA 1HKIA 1YXCA 5AC8A 2PB1A 3WIJA 4AVFA 4D6JA 3WFZA 3QJAA 3GBDA 3Q45A 2JIWA 1XIBA 4GCXA 2DH2A 1P7TA 3CAQA 2VCAA 2HVNA 3GTNA 5JQ9A 2A3EA 2CLMA 2V9DA 5BU9A 4X2RA 2Y8VA 3F5JA 2ZZ1A 2PTWA 3QFWA 5HQEA 3WD2A 4A2RA 3QH2A 3DC0A 7TAAA 4WDWA 4RKAA 4HB7A 1JG9A 5DX7A 4O54A 4E8DA 3QC0A 3QZEA 5BOFA 1FWIC 4AHQA 4S3EA 2ZXQA 2GUBA 3Q58A 4J2PA 4AZ6A 4IF2A 4YTSA 1LL6A 4PCNA 4HZ8A 1K6WA 2PA6A 2D2GA 3IGHX 1S5TA 3FOKA 1TPVA 1Z44A 3QY8A 2DQXA 2J27A 3KW3A 4KS0A 1MNSA 5L9FA 3I7QA 4GYPC 1NOUA 3A5FA 3BXWA 4AD4A 4JTLA 3S8HA 1CB2A 7REQA 1WXZA 1Z69A 5BOEA 3BL3A 3CPGA 2ACRA 5CJNA 3T40A 2YDRA 3CHVA 2HNEA 4CQ8A 3QZAA 1K8YA 2VHLA 4DAFA 1TQXA 4XWUA 3VC5A 4QDWA 5A6BA 3ZT5A 4JY9A 5FL1A 1IIGA 5GVJA 1KRAC 3NPXA 2WAGA 4MYAA 2I57A 5M5DA 1C92A 4BK9A 2DY3A 1Z32X 5M2FX 1EC7A 4LBRA 5LNUA 1AQFA 1DKWA 3A5VA 3R12A 1EP3A 4IISA 2QDDA 1HKMA 1OGSA 3GVGA 4LBUA 3QEZA 5ABGA 3ZO9A 1O5QA 3OBKA 2QV4A 1I1XA 1DHKA 4D1IA 3GVRA 2GJXB 1M41A 1KM5A 3W86A 2G96A 1GOQA 3O9NA 3C2YA 5TAOA 3BGAA 1QI4A 2IMRA 4EPDC 5AFDA 4UTUA 1HP4A 1ADOA 1T96A 1M03A 4TTGA 4HYRA 2Y24A 4BEQA 1US0A 3EDJA 3AJXA 1FTXA 3H2AA 1XDJA 1S5VA 1RA0A 4D2JA 1HW6A 4JTEA 1ZBKA 2J9ZA 3SCVA 1XH2A 2Y6ZA 2IKHA 3ZWSA 4ORIA 4X61A 2XISA 3C2OA 1EP1A 2PI6A 1W8SA 5JVLA 2DT0A 4GI9A 4GI4A 4JAWA 2EJ1A 4KMQA 4A8NA 4ATWA 2J79A 1YADA 3ICJA 4CN1A 3MJMA 3EB4A 2FTYA 4U28A 4HTBA 5EMYA 3NJ3A 5AC4A 2G97A 4HVXA 3W23A 5HR7A 2DH3A 5BMWA 1W3JA 1B9ZA 3LEPA 4J5NA 3HG5A 3GNXA 1UYQA 4B5SA 2Z2UA 4L9YA 2PDJA 4H9VA 3TONA 2Q8XA 4U33A 2YXXA 3HQ1A 3BGGA 3S3GA 1XC4A 4HNUA 3KHDA 2VFDA 1ALDA 3QBUA 1K8CA 3R7MA 4C7FA 4BY3A 3W37A 1J11A 1LRQA 4IFKB 1TVNA 4DUVA 2G3FA 1GWJA 5T9CE 4Z2HA 3UXIA 2YSWA 3NZQA 4Q3MA 3GR4A 2C7FA 1KXTA 3CC1A 3WDQA 3LTYA 1ZB5A 2P1FA 4GG9A 2VOMA 3CAKA 2DSUA 3TSDA 2D1ZA 3RU8X 4H6RA 1IWAA 1KFKA 1MI3A 4FLQA 1NFBA 1A5BA 4HQVA 3N1AA 2PC8A 3AISA 2ZZ6A 1EOKA 3LXCA 1EKOA 2I14A 2PTDA 1TPC1 4MF4A 5FF4A 3VDCA 1ECEA 2ZUTA 4OTKA 1UA3A 1E56A 3T7VA 3FX4A 3NG3A 3EOOA 4C6NA 1G7UA 1YTDA 3KTXA 3QV6A 2H90A 1GTEA 3PPCA 4OUIA 1KNWA 3DC8A 4AG0A 3C2FA 3FDKA 2OTDA 2YJQA 4PUMA 3PG8A 4DPQA 4FOUA 1X1ZA 2Z00A 3AS2A 1TPUA 1LJYA 3BC9A 1JPDX 4RZ5A 1UCWA 4QE1A 1EB3A 5CAKA 2CCRA 1QNPA 8CGTA 1VCVA 1UIOA 3XINA 1QK2A 3TVAA 1N8IA 4PBFA 1Q7MA 1GVQA 4NT0A 1JDEA 3TC3A 1GCYA 1JCLA 5C7HA 3EA2A 2QPUA 1TPB1 1TUXA 5LXEA 2NUXA 2W62A 4Y8EA 3L7RA 1UJQA 3LBOA 2EPHA 5I24A 4PULA 1CNVA 1GT8A 3GIQA 2W27A 5IM51 4QE5A 2YL5A 3GFYA 4IM4A 5IHRA 3CK5A 5BRBA 1TJ0A 3VYLA 3LI0A 4ATLA 1H7PA 1KFBA 3A13A 3M0HA 1FBAA 4B5NA 2YOCA 2I56A 4HZMA 2ZRWA 4PRRA 4LUSB 3CIXA 4UQBA 5C9UA 4Q4OA 2A85A 1YPIA 1Z3NA 1IEQA 3UERA 4X2PA 6PTDA 2Q71A 4RV3A 2F9RA 1Q4NX 4HJFA 4AVNA 2O56A 1U33A 4KIEA 4AHPA 5CZTA 3NXLA 2ZRZA 4ZODA 2E8ZA 3CHEA 4LF1A 5D02A 2CZEA 3WH5A 1ZU8A 1VHCA 4FXRA 1UZ1A 3LV6A 4IGNA 1VB9A 3W1UA 1LT7A 1VYSX 2VDHA 3VNDA 2CXEA 1ISZA 1MQPA 2OEJA 2HXUA 5TQLA 1F2JA 5J5DA 4N42A 4P7NA 5CXPA 4DYJA 1IHIA 4QAWA 4MOZA 1BAGA 3HFYA 3QOMA 5HINA 4AU0A 3WQVA 1N55A 4DELA 1OFEA 4DF2A 1G4PA 3OZMA 3ZSSA 2ZC8A 3ITCA 3VMOA 2PDBA 1HKJA 4EF8A 3OA5A 2NSOA 1C8XA 5HJXA 2J7GA 2V5KA 1Q6GA 3LHVA 1E70M 2J7FA 2PTZA 1FWRA 2Z29A 1L8PA 3GLCA 1LOLA 1X1NA 2FZMA 3CB8A 4FF7A 2EAWA 3RILA 4LVDA 5G1TA 3P5ZA 1LQ2A 4ENLA 1BQGA 2IKGA 4O18A 1WO2A 2C1GA 2X16A 3GIPA 1NDYA 4MZYA 4FIQA 3ANVA 3O07A 4H9TA 3QR0A 3OZPA 5AHFA 1K8ZA 2Z7GA 1AG1O 4CNPA 3BV7A 3WENA 2QV5A 2G41A 2G50A 1EX1A 3C5QA 3N34A 1QI2A 1W2VA 4I7VA 4C5YA 4JTKA 5HWMA 2PWVA 4HPNA 3P74A 3WBYA 1V79A 1YDYA 4LH8A 4R7JA 2C6QA 4O1BA 1CGVA 3MV01 3MUY1 3LGDA 3I6EA 2CZDA 3ZQ9A 4F48A 2C0AA 2GSEA 1V3MA 2KAUC 5D9NA 1ZALA 3DFTA 3HN3A 3GVVA 3NSNA 2QJMA 4C1NA 1M65A 3TW9A 2GQ8A 2XGBA 1NWSA 4HHHA 1Z89A 2CC0A 4NP7A 1PTGA 4H6QA 3WJZA 1HN1A 4F2TA 5DBUA 4LALA 1KM2A 1TFVA 5REQB 3SN1A 3GZAA 1EO5A 3B0UX 5EFDA 1P5BA 2VR4A 4QG9A 2PDUA 4IJBA 1XLJA 3NQVA 4DLFA 3AOFA 2WSQA 2ZWZA 4PZVA 4WDXA 1KR0A 4DXKA 1F76A 4V15A 3E0VA 1EX5A 3LRMA 1VRDA 4RK8A 3PB2A 4UTJA 3PF3A 3B0PA 4L61A 2P8BA 4Q32A 4KF1A 1TV4A 1UROA 1PWMA 2YLLA 3W72A 4JX4A 1R7AA 1UQYA 3MVTA 2O9OA 4B5XA 2NVCA 3VKKA 1E73M 1F6KA 3VGBA 4J27A 3W7EA 1IGWA 2IPWA 1QRQA 3LSBA 2ZBTA 2QUVA 4QLKA 2ZUUA 3GIYA 3CZGA 2YB4A 1L0PA 5D04C 1XBYA 4LAZA 1UPPA 3BAJA 4R85A 4XZBA 2ZXAA 2PDCA 3TW7A 5FJRA 3AIUA 4K7VA 4XZWA 1VIZA 1NDZA 3CWOX 3P6LA 1A5AA 5E9AA 2I5IA 5A2AA 1G5AA 5LGZA 3ECQA 2E4TA 4DO7A 5FF2A 3F5KA 3S0CA 5E9XA 4PTXA 3NM3A 1WKEA 4NAFB 3PAOA 1W91A 2PZNA 3GNRA 3W76A 1QNVA 3TSBA 5AC5A 2FPYA 3MSYA 3EKZA 4QJ3B 5A94A 3BMWA 1HJQA 5CJ5A 3V5CA 4AZBA 3C0SA 1SQ7A 3ENLA 4DJEA 3NFUA 3RJXA 4ZB2A 1PL9A 3QM3A 3W38A 4LB4A 2E25A 3LD5A 5HPOA 4DUWA 4UTHA 2BXVA 1UB3A 3NQDA 1Z48A 3G1VA 2DSVA 5FOOA 1WKFA 3D46A 4G56A 1OINA 3HQPA 2E77A 3M46A 3REQB 4HJWA 3BV4A 1TWZA 4KCTA 1EEPA 3LM3A 3UPBA 3HPFA 4O8AA 2XVNA 3EOSA 1XYZA 1W5OA 5BRQA 1JCXA