4L4PA

The mutant(e139a) structure in complex with xylotriose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
TVSLTEKYKEFFKIGAAVTVKDFEGIHGRILTKHFNSLTPENDMKFERIHPKEDFYNFEATDKIKDFALKHNMQLRGHTLVWHNQTPEWVFRDNDKEAPKELVIERLREHIKTICTRYRDVVYSWDVVNAAVEDKTDVLLRDSKWRRIIGDDYIKIAFEIAKKYTGNGKLFYNDYNNEMPYKLEKTYKVLKSLLEEGTPIDGVGIQAHWNIWDKNLIDNLKRAIETYASLGLEIQITELDISVFEFEDRRTDLLEPTEEMVELQAKVYEDVFRVFREYRDVITSVTLWGISDRHTWKDNFPVIGRKDWPLLFDIDGKPKKAFFRIIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with xylotriose
rcsb
source organism Caldicellulosiruptor bescii
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2013-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4l4pA00
1WDPA 3L2MA 3CHDA 1JDAA 3SUUA 3VX1A 4ZENA 1GOOA 3WDJA 2HVMA 3KL0A 5CZKA 2XVKA 3DC0A 2WMGA 2TAAA 4PMOA 3OLIA 4Z2IA 3LMYA 2DDXA 3DHUA 1UZ1A 3WN6A 1XCXA 1KGXA 4GIAA 2JEPA 1NWTA 3N04A 4MB3A 2MANA 3AHTA 3S2CA 1E40A 2XTKA 1J11A 1UKTA 4TOQA 1J01A 2VI0A 1HJXA 3W6MA 2O9OA 1UHVA 1W1TA 1V02E 5JIPA 3AS1A 1MFVA 4NRSA 4ATWA 1D7FA 3T08A 4TVUA 3BAYA 1EO7A 4JFUA 4AIOA 1X6LA 3ZJ8A 4UOJA 4AIEA 3N1AA 1GW1A 2J62A 7CGTA 3WH8A 2OWCA 3WD4A 1M01A 2VR5A 1BG9A 3NDYA 2XM1A 1UWUA 1TA3A 2D22A 2G3MA 1KGWA 3HN3A 3WF4A 1JZ2A 3II1A 3AIRA 4UQCA 2ZUTA 2V3DA 5BRQA 4IPNB 5AY7A 1NP2A 1GCYA 5HPOA 3BAXA 1W32A 3WUBA 3T0DA 1AVAA 3NCOA 3AXXA 5BRPA 2XGIA 1ZS2A 2ZUWA 1VFMA 3EDFA 1BQCA 3CUGA 3WNMA 1U33A 3K4AA 3TTSA 2NT0A 1W3LA 4UQBA 3HMCA 3FAWA 1V3HA 2XG9A 4Q22A 5M3WA 2YA1A 1XGZA 2WMKA 3MU7A 1UUQA 5CJ5A 2D3NA 2OWXA 5CPTA 5M17A 1EIBA 1IZKA 2VCCA 1QI5A 4CKQA 4UTFA 1I1XA 4H41A 1LF1A 1XD0A 3ZIZA 5DT7A 4EKJA 4LYQA 1GHRA 1WZAA 1UQYA 2XJ7A 3MMDA 1CTNA 2YOCA 5A95A 1NH6A 3M6DA 2WM0A 3VM7A 1JL8A 5FCZA 1WE5A 1QHZA 3RJXA 2YL5A 3L4WA 3VIPA 1WAWA 1V6UA 1JZ7A 1PX8A 2ZWZA 2XSAA 1JZ5A 4TX6A 3AYRA 3K8LA 1L8NA 5M5DA 1LG1A 4PUEA 4JAWA 4RE2A 1RPKA 3B9EA 4ZEPA 2WZHA 1C7SA 3KZSA 4BF7A 4JKLA 2G4FA 1AQ0A 3A4XA 1EHAA 3THDA 4OIFA 3T2QA 3HU7A 4CD4A 3AICA 3SUVA 2CPUA 4MNJA 3UCQA 3OLGA 4PTWA 3ZM8A 3WD2A 3W25A 3W53A 1BGAA 1KR1A 2OSWA 1CENA 1C3FA 3AIEA 3ARZA 5IFTA 2Y24A 4JIEA 3QHMA 1BYCA 2QV4A 2CBJA 3MUAA 4PSPA 2WVVA 4CCCA 3VNYA 1TZ7A 2W67A 1ODZA 2J4GA 4CD8A 4OKDA 2GJRA 4UFJA 1B3YA 2WMIA 4KMQA 2VO5A 4AZIA 3EMQA 4GZIA 1FP9A 2UY2A 4KRTA 4D6FA 1GQIA 5D9PA 3PTMA 1VEOA 4DWSC 1MQRA 4MB5A 5BROA 3THCA 1B3VA 3ZSTA 2D0HA 3SIMA 3L4UA 3CUHA 5DO8A 2XFRA 1J0HA 1PBGA 1HKIA 3EMZA 3PZ9A 4BCEA 4E4PA 3MSDA 3MMWA 4PUDA 3AXIA 1V03A 2XVNA 1XHGA 1JXKA 1PIGA 3OA5A 3GM8A 3CZ8A 5A8OA 3VX0A 3W24A 5LA0A 3OB8A 3WELA 1G01A 1RD6A 5FD0A 5AYBA 2Y4SA 4QCEA 5BXRA 1ZB5A 1HKKA 3EMCA 1MW1A 6TAAA 3AS3A 4P8VA 3WMSA 2DSKA 2G3JA 3WDQA 4Z2KA 3GNRA 2O9RA 2J78A 1WO2A 3PTKA 4OOZA 4NSBA 3WDPP 3NUKA 3LPOA 2ZUUA 3ZJ6A 1C90A 3OGVA 3L4VA 3VDBA 5ABHA 3ZR5A 3SUWA 1V3IA 3W38A 1HL8A 1UD5A 4M82A 3AOFA 4D1IA 1TE1A 3QOMA 1FHDA 1GJWA 4UFIA 1M7XA 4AXNA 3GXIA 1UD4A 4EAMA 1XH1A 4L4PA 4GZEA 1UYQA 1JXJA 4JCMA 2DT3A 3POCA 4MJ4A 1VENA 2WB5A 3F5KA 2WMIB 3APGA 4ZE5A 2VTFA 1CGYA 3F5JA 3VM5A 4TUFA 1BSIA 3GDBA 4TVCA 1OSEA 1C92A 1UR9A 3TOPA 2J7DA 5I24A 1LQ0A 4ACZA 2YDRA 3WBEA 1KXQA 1KR0A 1UKQA 1BYDA 4GZJA 1U30A 1EXPA 3CO4A 5AC5A 4PMVA 3VGEA 1XRVA 1RH9A 3WY1A 1YHTA 1EDTA 1QI2A 1V3LA 3LPGA 4AC1X 1NQ6A 2WHMA 2PC8A 1K9EA 3W27A 4B3LA 4Z2GA 4F66A 1CGTA 2QPUA 2J25A 1R87A 3WEZA 2D24A 3ARVA 3AISA 1JD7A 2J7BA 3UESA 3VMNA 4BZYA 3VIMA 5DT5A 1US2A 4BQ4A 5FL1A 3RMEA 5BYWA 4J3WA 4B9YA 4CVUA 5GNZA 2V5CA 4FLSA 2JEQA 3WNLA 2CNCA 3M07A 1E1FA 1JAKA 3AZRA 1UWIA 3B9DA 1A47A 3WEOA 3PZVA 1EOMA 4PN2A 3WFZA 2IUZA 3B8SA 5JBFA 3WUEA 1GOQA 1QNOA 2OLHA 3NYDA 2BY3A 2D2OA 4HTYA 3U57A 2WMFA 2EBNA 3WH6A 3CZGA 4J3VA 3ARTA 4HA3A 3AMCA 3PTQA 3VD5A 2BHZA 1O7AA 2YA0A 1U2YA 2WMHA 4UR9A 2WYSA 1JZ3A 1DWHM 4KGJA 5A94A 2X09A 2CHOA 4WSKA 2GFTA 2VR4A 1C8YA 5E6YA 2GK1A 2V3EA 5FL0A 3N11A 5LYRA 5GPRA 1GHSA 4XV0A 4LYPA 2XVLA 4IPLA 3WQ6A 1R7AA 2CESA 1BAGA 1GVIA 2EEXA 4J3UA 3AMLA 1NM9A 1E71M 4WLCA 1TG7A 2EJ1A 1J9YA 2VL4A 3WDRA 2EPMX 1MXDA 1XSKA 2AMGA 4V28A 2WSPA 1KQYA 2J7EA 4LQ1A 1HNYA 1ISYA 1BPLB 2J74A 4AZ5A 2E9MA 2E8YA 2GDVA 1UR0A 2YKKA 1V0LA 3SUSA 3PZGA 4FLQA 4V2XA 3N17A 6A3HA 3OGSA 3LPFA 2RGLA 3A4WA 3NJ3A 2GJPA 3U5UA 1ISZA 3J7HA 4DUVA 1F4AA 3AMKA 3ZJ7A 1HKMA 4D6DA 1XSIA 4KH2A 1W9BM 4AEEA 1QW9A 3VGBA 3EDDA 1AQHA 4U31A 4Y7EA 3GNOA 1JNEA 2WWCA 4W5UA 4F8XA 4YPJA 1FOBA 2PWFA 2W4XA 4NI3A 3ZT5A 2UY5A 3WIJA 4H2CA 4GQRA 4ZXLA 3AHXA 2WC3A 1TMQA 1KWGA 5E09A 3W82A 4PMUA 1VJSA 2BNJA 3AHZA 2XYLA 1H5VA 4PTXA 1CXLA 4ZE4A 2PWGA 3WUGA 3RM8A 3QHNA 2VC9A 1BLIA 3WF3A 4PMRA 1R8LA 3WQVA 2YL8A 5A2BA 4TXEA 4PBGA 5CLWA 1BVNP 1Q6CA 1W1YA 3UEQA 3JUGA 1BYAA 1TR1A 4PRWA 2BXZA 3T0BA 5C70A 2GJXB 1WDQA 1QBAA 2DT2A 3U7BA 1JYVA 1ISXA 2Y8KA 1NOWA 1BGGA 5GNYA 2Z1SA 1VAHA 2YLAA 4B15A 2CBVA 1QVBA 1E0WA 1CGXA 2A3CA 4KRUA 1FFRA 1BG4A 2DT1A 5JIWA 1VFFA 2WKLA 2WK2A 1NWUA 4W86A 1W91A 5M03A 3SCRA 2ZUNA 4YHEA 1W3KA 5AYIA 2EPNA 2BS9A 4P8XA 2J7FA 2Y2WA 3DECA 4H8VA 2XUCA 4PYSA 2VZSA 3SCTA 3MUIA 3ZOAA 3IK2A 4J7RA 2ZUVA 2XSBA 2W66A 1UH4A 1E6NA 2BY0A 1C7TA 3ARUA 1JGIA 4LYRA 4M81A 1JFXA 3ZMRA 3CHFA 1E1EA 4M1RA 2JE8A 2YBUA 3U5YA 1EA9C 3A6OA 1GZJA 3WKZA 4PEEA 4WF7A 4E2OA 1H4PA 3AIVA 4BA0A 4TX8A 3I3BA 4C7GA 4N42A 2IXUA 1KCLA 5DFAA 1MWOA 2CERA 4U3AA 3RJYA 2WCAA 4LX4A 1UA3A 1UWSA 3D3AA 1QI0A 2YLLA 4X9YA 1WDSA 1VBUA 2WVUA 2E9LA 2FDMA 2JF7A 5D8ZA 1CXEA 5ABEA 1B2YA 5LA1A 1QHOA 3AMGA 5I3DA 2BXYA 5E70A 1BYBA 1HP5A 4RL3A 2WNWA 3CHEA 4X0NA 4L4OA 3T2OA 1C93A 4ATLA 1EDGA 1CLXA 1JAEA 1UG6A 1SYTA 2WZIA 4GQQA 3PN8A 4JKMA 2E40A 4UFKA 5CGMA 2DH3A 5D4YA 5IHRA 2ZXDA 1BF2A 1WNOA 2AOSA 1B90A 4WSJA 2VRKA 1JZ4A 1GQLA 3M7SA 4W8BA 3ZJKA 5A6KA 1UR1A 1V0MA 4M8UA 1H09A 5A6AA 2XVPA 1XSJA 1W2PA 1W9PA 3ARYA 3KL5A 1B1YA 1OM0A 3DYMA 2ZICA 1GQKA 3VU2A 2VURA 3IAQA 3PZOA 4GINA 4D6JA 1CZ1A 2WCGA 3ECQA 1NWRA 3GNPA 3BMVA 1UKSA 4H04A 1W3HA 4Z2HA 3O6AA 3VILA 2VVSA 3T0AA 2BVDA 3RCNA 1HL9A 3A47A 3OLDA 4B9ZA 3KWXA 1O6IA 2YJQA 4S3KA 4UNIA 4AZGA 1NARA 4HMDA 4W89A 1J0IA 3GTNA 3PZNA 3WH9A 3W37A 3FXYA 4W8AA 4W8LA 1HJSA 2FHCA 1V6VA 2XWDA 1EH9A 3O9NA 1B0IA 4WKAA 2DEPA 1CGVA 3FHAA 3WH7A 4A3YA 3AZTA 1MVYA 5CLTA 2Z1KA 4PMQA 1G0CA 3AROA 1CECA 1CXIA 2WHKA 1X6NA 3BCFA 1W9VA 4OOUA 4CN1A 4JFTA 1PX3A 3RILA 2WVTA 2WC4A 5EBAA 4Q7NA 9CGTA 3WDHA 1HVQA 3K8MA 4GO9A 3WQ5A 1DP0A 1CIUA 4M80A 2O9PA 5CSYA 2DPEA 1NOFA 2OSYA 1TVPA 1J12A 1CYGA 3E1F1 1QW8A 3VMOA 4D6IA 1KBKA 1BHGA 4WIWA 1KQZA 4P7RA 2XM2A 1J0YA 1X1NA 2VZOA 1EOKA 1E6XM 1BTCA 5DEZA 3GZAA 1QNSA 2J7HA 1OT2A 3WNKA 5FIPA 4RE4A 2CKSA 2WVVB 5CXPA 5A6SA 2XVGA 4CU7A 3W0KA 3AMDA 3DHPA 1EGZA 1QOXA 4GPNA 3WENA 4MTVA 4U3CA 1JIBA 4PMXA 2QMKA 1N82A 2CHNA 1B3XA 3ZO9A 1GOIA 5EFFA 1ZJAA 4W84A 1DWFM 2V38A 1DEDA 4PMYA 1E72M 5CGTA 1E4IA 3GXDA 1FA2A 3W29A 2VX4A 2WW5A 1GPFA 2V3GA 4CU6A 2YA2A 3NSMA 1H0IA 1VIWA 4QLKA 1XD1A 2DH2A 1DWJM 3G6LA 4URIA 3W81A 2G3NA 3L4ZA 1UD3A 3ARPA 3M46A 2BY2A 4D6CA 1ZBVA 1V0KA 1GOWA 1OCQA 3BSHA 4MNMA 5KZ6A 3AS0A 3BAKA 1Q6EA 1DWGM 2CIPA 3BAJA 4DM1A 4H7VA 4F79A 1V6WA 4AD4A 2JF6A 5D9MA 2EXOA 3GH5A 3MSGA 2CYGA 4PTMA 2VUYA 1AMYA 3GBEA 5E9AA 4D1JA 3MV01 1VEMA 5I23A 1E4MM 3GH4A 3OZOA 3UETA 3WF1A 4J28A 3QR3A 4R5EA 2WXDM 5KEZA 4AISA 3F5LA 1HF6A 2VX6A 3VO0A 2QF8A 3QOKA 2FH6A 4UZSA 3VDCA 1IV8A 1ITXA 4NZCA 1FH9A 3L2LA 4MB1A 1GVYA 2XWEA 5ABFB 2D3LA 1E56A 1JI1A 3N18A 2IXVA 1V6YA 1E15A 2WCSA 1QNPA 5A8NA 3WBAA 3ARSA 3VGGA 4MADA 2NW0A 3N9KA 1KB3A 5I0DA 1V6XA 4CD7A 1WCGA 3UR7A 1ZJBA 1JD9A 1XC6A 3CMGA 4WJXA 5D9OA 1UR8A 3TTOA 3CZJA 3WSUA 2WBKA 3WD1A 1CXHA 2A3AA 1WKYA 1F4HA 1PX4A 3UG5A 2WLZA 4H8UA 4WKFA 2D23A 4WKHA 3DYPA 5BCAA 4P7LA 1K9DA 3W4RA 3CUIA 1HJQA 1LL7A 5BXPA 1LWHA 4QDMA 4P7OA 2J7CA 2DSWA 1GQJA 5EMYA 3WMBA 1GOKA 1H49A 1Q6GA 3VGHA 3WNOA 4M56A 4ACZB 5A8PA 2DQXA 1UR2A 3BC9A 3VUPA 2ZUSA 3VVGA 1CBGA 3NSNA 2EPKX 4PSRA 1DTUA 1B30A 3CZLA 4KGLA 3VD4A 3VD9A 2G41A 3WDIA 1VRXA 4FLRA 3S6TA 2BHYA 1JG9A 3CLWA 1MW2A 2B31A 4JKKA 2W63A 3UERA 1H3GA 1MQQA 2O9TA 2BHUA 4QLJA 1H0GA 2Y5EA 5A6BD 3TA9A 1MYRA 5IFPA 2A3BA 4E8DA 4MAVA 1GOMA 4HA4A 3UG4A 2PBOA 2VZVA 3EDEA 1QPKA 1TFVA 2OYLA 3K4DA 4DUXA 4JCLA 1KCKA 4P8WA 1HT6A 1VBRA 2WHLA 3ARWA 1AQMA 4LPCA 1E43A 3BMWA 4ZFMA 1P6WA 1OT1A 3SCQA 5EFDA 4V27A 4QFUA 1PAMA 3RDKA 3BCDA 2NT1A 1H11A 4YN5A 2CEQA 2JALA 4JFVA 4JL2A 2D0GA 2E8ZA 1SR0A 4C7DA 5TD4A 4F9DA 2E0PA 3L4TA 4HMEA 4MDOA 1R85A 2FHFA 2VCAA 4W88A 1UWQA 3AFBA 4XB3A 5A6LA 4S3JA 1UKOA 2PWEA 3BLPX 1UD8A 2QLYA 3VIFA 3WFLA 3AIQA 4E8CA 4MNLA 3CMJA 5HNNA 3OGRA 3I3DA 4XUYA 2D0FA 3CTTA 1XV8A 1UR4A 4JZ5A 5CSUA 4OBSA 1M03A 2W91A 4UQDA 1ZBWA 4K68A 2X0YA 2WKGA 2UWFA 2VX7A 4C7FA 1OGGA 1OIFA 5A8QA 2V3FA 3BXWA 1RP8A 3EDKA 5A6JA 3VIHA 2OSXA 3T09A 5IHSA 4AD2A 3WL0A 5JUVA 1XCWA 2VJXA 3SCWA 3BSGA 1QNRA 1FH8A 1JDCA 4DWSD 4J3SA 1E4NA 4IISA 3ZT7A 2FHBA 1WPCA 5HOSA 4EE9A 5JBDA 5CPQA 2YL6A 3FY1A 1KXTA 5I6SA 1XYZA 1E6QM 1QI4A 1J10A 4FLOA 2WAGA 2BY1A 1FHLA 4LXFA 2NSXA 2WSKA 4AYSA 2DIEA 4CU8A 1E70M 3N12A 3FN9A 1WZLA 1G9HA 4QAWA 2XIIA 3GYCA 4AZHA 4MPKA 5ABFA 3TP4A 5C71A 3W26A 1KGUA 4IM4A 3L4YA 1HJUA 3TONA 4CN4A 3VIJA 5E0FA 3SCUA 1J18A 5BXSA 4J3TA 5EB8A 3CGTA 2W92A 5DF0A 5A3HA 1NP0A 2BV9A 2CKRA 4JFWA 5A6MA 1H2JA 1GORA 2J47A 3ZQ9A 4RE3A 3POHA 7TAAA 3VIOA 2GJXA 1W9UA 2JIEA 4OZOA 2ZX5A 1SMDA 1ECEA 2ZXAA 4AZ7A 1CXKA 2XPKA 2ESCA 1HX0A 4HZ7A 1Z32X 4R27A 3UR8A 2QHAA 1EHNA 2CETA 3AS2A 2YDSA 3VD3A 4AZBA 3WL1A 3OZPA 2X2YA 4HOXA 1UWRA 3KL3A 1FH7A 3ZR6A 1WDRA 4XZBA 2E3ZA 4M29A 1L0PA 3K1DA 4FK9A 4D6HA 1ZL1A 1PZ3A 1MFUA 2ZX9A 1ODUA 3WH5A 5ECUA 2A3HA 1KFWA 2WVSA 2WANA 2PWDA 3CH9A 3ALGA 1GJUA 1G5AA 3PZMA 2WLYA 3MUY1 1QBBA 1TUXA 1XH2A 3VDAA 4D6EA 2VZTA 3AYSA 2G3IA 2WWDA 4HU8A 1CLVA 1GONA 1W9DM 4PMDA 1PIFA 1HIZA 3KE0A 1MW0A 2CBIA 4TTGA 2VZUA 3AHYA 3A3HA 3CHCA 4IUGA 1LL6A 1OGSA 1WB0A 3ARQA 3NIYA 3VIKA 5HPCA 4AMCA 4MAZA 4BQ5A 1HXJA 3VPLA 2VRQA 4W5ZA 4PMNA 1E55A 1US3A 1J0JA 3QGVA 1MXGA 3IANA 2FH8A 4HPHA 2Y8VA 5I2UA 1V3KA 1UOKA 1M04A 1VEPA 4A3HA 4B16A 5JBEA 4HA1A 1RP9A 2ZXBA 1R86A 4HZ8A 2RGMA 3SURA 3ZSSA 1EQPA 2GSJA 1KXHA 2AAAA 1V08A 1WZKA 1CNVA 5BWFA 3VD7A 1K9FA 4UQAA 1JZ8A 4W87A 2PWHA 1BVZA 4CUCA 4HZ6A 4B3KA 4P7QA 3AQUA 3HJEA 1JYNA 4NF7A 4PCTA 1E3ZA 1QHPA 2F2HA 4NRRA 5D8WA 2PB1A 1B3ZA 4UQ9A 3ARXA 2OYMA 3VKKA 3WUFA 4MNKA 2WZEA 1CXFA 1E3XA 3AJ7A 4TTUA 2VNCA 4AWEA 1VJZA 2CXGA 2A3EA 2PF0A 1CGUA 3WF0A 3N13A 2WPGA 3MV11 1D2KA 1H41A 2ZUMA 2W5FA 4PCSA 4FF5A 4W7WA 3VOCA 4QP0A 4CCEA 3NDZA 1V3MA 2CCRA 2GVYA 3D5HA 1FFQA 4UQEA 3CIVA 3W28A 1UQZA 2PI6A 1DHKA 4HU0A 5HXMA 1TCMA 5HDRA 4CGTA 4AD5A 5GNXA 1J0ZA 1OD0A 3BGAA 2EO7A 1E0XA 5LA2A 3CZEA 1EQCA 5D9NA 1CEOA 3CZKA 3SCNA 1W9XA 1JZ6A 3QHOA 1IZJA 2EPOA 2ZOXA 3WNNA 1A3HA 1PEZA 4HMCA 3A4AA 4AZ6A 2UY3A 2XIBA 5A1AA 1SFSA 3PHAA 3MANA 2YDQA 1W1VA 3WF2A 1UKPA 1E5NA 3SCPA 1UWTA 3WEMA 4DWSB 2WHJA 1DWIM 4ATDA 3CUFA 4ML4A 5CPSA 2E9BA 3MS8A 2D20A 3MMUA 2OYKA 1QI3A 4AW7A 2G8ZA 4JHOA 1Y7VA 4HOWA 3RO8A 3SUTA 2J79A 3K8KA 1PZ2A 3OIHA 1OGBA 2F8QA 2O92A 1E6PA 1JFHA 2CBUA 3PZIA 4AD1A 3SCVA 2ZX8A 1VF8A 4UOZA 3VGDA 5I78A 1SMAA 2VRJA 3BAWA 4J27A 4DM2A 1JYWA 1HVXA 1JF6A 1C8QA 5F7UA 4D72A 3FW6A 5E0CA 7A3HA 3RM4A 2EPLX 1CWYA 4P8UA 3TTYA 1KWKA 1C8XA 5AC4A 4AZCB 1G94A 2GDUA 2ZWYA 1E0VA 2C0HA 4UFLA 3EYPA 2ZXQA 1LWJA 4A4AA 4UFMA 2DGAA 3TTQA 3KEHA 3OLEA 3U7VA 3RPMA 4BQ3A 2X05A 4Z2LA 2ZE0A 3BH4A 2C7FA 1PPIA 4H8HA 2XGBA 4DUWA 2JIWA 2C8NA 8A3HA 3VDHA 1JF5A 2WBGA 1HN1A 3I3EA 3VIIA 3VMPA 4U33A 2X8RA 2ZX6A 3RM9A 5I5RA 1Q6FA 4D6GA 4EK7A 2VX5A 4AZCA 1GUVA 3PBGA 5GQBA 5CQ1A 3SCSA 1ISVA 2X0HA 4AD3A 2FGZA 3GH7A 1CGWA 2UY4A 3IJ8A 2BVYA 2DIJA 1B3WA 2YIHA 1E73M 1V02A 3O2LA 1PJ9A 3BLKA 3G6MA 1W1PA 1E5JA 5IXEA 4W93A 1ESWA 1ISWA 1G1YA 3T2PA 1GNXA 2WMJA 1Q4NX 3GXMA 6CGTA 1JI2A 4FMVA 1HKJA 4HOZA 1C91A 1OD8A 3CBWA 1E6SM 2J7GA 4AIUA 3WQWA 4QCFA 4UOQA 3GXFA 4M24A 1ITCA 1ZBKA 5C8BB 3OG2A 4AEFA 3IJ7A 2YBTA 3AIBA 5A8MA 2J77A 1TVNA 1ZBCA 1UH2A 2DSVA 2XFFA 4UFHA 1MW3A 3WD3A 2VVNA 1H1NA 1WP6A 1K9TA 4CCDA 4U2YA 2VQUA 3ALFA 1B31A 4OUEA 3IJ9A 1E4LA 3VGFA 1HJWA 2DSZA 4W7VA 1XYFA 4UCFA 1Q6DA 2VOTA 1IT0A 3NSXA 4XZWA 3EBVA 4AY1A 2XFYA 3MO4A 1VFOA 3CPUA 4CD5A 4MDPA 3VINA 2HISA 2XHYA 3VNZA 2J75A 3K46A 1LG2A 4GI8A 5A69A 3RIKA 2YL9A 8CGTA 1K6AA 2W62A 3GBDA 1JDDA 1W3JA 5FKYA 3ARRA 1JYXA 3FNDA 3CUJA 3WQ4A 2F61A 1KBBA 4DWSA 1XH0A 1UD2A 4U2ZA 4P7NA 1I1WA 3MKKA 2W61A 4GO8A 1E6ZA 4EANA 2Q8XA 5I79A 1ZU8A 2DT0A 3EDJA 1OIMA 2EQDA 2VMFA 4JHZA 2VCBA 4BQ2A 1EO5A 3ZT6A 1BFNA 4U5IA 1FP8A 5ABGA 4GI6A 2ZX7A 3MUZ1 2J8GA 4XX6A 2X1IA 2BFGA 2OWWA 3W6LA 4Z2JA 2D1ZA 3B9AA 5FOOA 2QPSA 3BAIA 3DYOA 1S46A 2CITA 1R7OA 4CN6A 4YHGA 4UZUA 4X0VA 1OINA 4CVWA 3F4VA 4N0RA 4HP5A 4OBRA 3AZSA 5I77A 4ACYA 4MB4A 1YQ2A 1E6RA 1NWSA 4JFSA 1JNDA 3SCOA 1HP4A 1UD6A 2V5DA 4GXPA 3AIUA 1OB0A 3PZUA 5BXTA 1QNQA 1UZ4A 3UG3A 4TVDA 4AD0A 4PTVA 4ZXOA 1V3JA 3OBAA 3WNPA 3WQ8A 4LGXA 2FGLA 1NOUA 3AI0A 1DWAM 1CDGA 1CPUA 2WC7A 2BVTA 4JL1A 3WD0A 1V0NA 1UH3A 1VB9A 2J8FA 4U5KA 1J0KA 3WMCA 1OBAA 5DMYA 1HJVA 1LJYA 2E4TA 3LPPA 4QLLA 4CD6A 3SEPA 4W7UA 3AXHA 1D3CA 1E9LA 1KXVA 2PBGA 3AHVA 3PZQA 5A6BA 5IDIA 1LL4A 2GUYA 4KWUA 1UA7A 3VTRA 2DSUA 5HBFA 1VFUA 1MQPA 5A2AA 2GK1B 4F9JA 4WK9A 4J3XA 1LLOA 4W85A 5E6ZA 3FAXA 2ZIDA 1WZMA 1M53A 2VT0A 4D71A 1B9ZA 4OJYA 2QMJA 1OWQA 3L4XA 3IAPA 1TA3B 4GKLA 3AIWA 3FHQA 2VQTA 5A2CA 3N15A 4MJ2A 4PMZA 3PZTA 1I75A 4HPGA 4BS0A 4GI9A 2JFEX 1EDQA 3VIGA 1W2VA 5CG0A
chains in the Genus database with same CATH superfamily
3UXLA 3CHDA 4O0QA 4QTGA 3KVJA 4UR8A 2HVMA 3MKVA 3KLKA 5CZKA 3MT1A 1E9ZB 2FJUB 4IL2A 3DC0A 4Q6XA 3F4DA 2Y7GA 4YU1A 2XZ9A 2DZVA 3LHYA 1SZRA 4PUKA 1QK0A 4GMEA 5HNUA 1XCXA 1YRRA 1NWTA 2MANA 4KFNA 4MY1A 1S2WA 1Q6OA 1Q4WA 2XTKA 1UKTA 1XPGA 2O9OA 3N9SA 3LLFA 5JIPA 3AS1A 3IGUA 4IJCA 3MZ2A 4NRSA 4ATWA 2FMOA 2MNRA 4L9YA 4O50A 2B0MA 5IM51 3ZJ8A 4UOJA 4HHPA 4QM1A 3SGGA 3WD4A 4QS5A 2QJGA 2VR5A 1MEHA 5HNTA 2I56A 2D22A 3HN3A 1KGWA 1JZ2A 3AIRA 4UQCA 2ZUTA 3MHGA 3W83A 1FWJC 2VEFA 3OP2A 1GCYA 3BAXA 3W23A 3LCLA 4CCZA 2ICSA 1RVGA 4MY9A 3AXXA 4WJ8A 4K3ZA 1U33A 3TQKA 1QXLA 2JKPA 4UQBA 4Q8WA 1X39A 1WYIA 4ML9A 3C6CA 2QZRA 4V33A 4JTHA 3CV2A 2ZRVA 4MSSA 3MU7A 4HNNA 3GXTA 3ATZA 2DVXA 3WMLA 1R3YA 1KM6A 4CKQA 4UTFA 4H41A 1XD0A 3MP3A 5DT7A 3LI0A 1FWIC 5L9FA 1UQYA 4GH1A 3MMDA 2YOCA 1P0EA 1AD4A 1AZ1A 4OU1A 1JL8A 4RW3A 1LCOA 1WE5A 3B40A 3L4WA 2YCLA 1H7RA 2VENA 2ZWZA 3NFUA 5C2GA 3NOEA 1L8NA 2NQHA 4JAWA 1TPVA 3GVQA 4Q4RA 2ISFA 4JX5A 3TW6A 2A5HA 2WZHA 5G4WA 1M6JA 3GDTA 1VLWA 4JKLA 4Z0SA 2ATMA 1NTHA 1DQWA 4TV6A 3W7LA 3BL3A 4OVXA 1C8VA 3W53A 4G7EB 1YDYA 3RFAA 3C2RA 2HJPA 3GAYA 3C56A 3VNYA 2INFA 1POKA 4NZ3A 1ALDA 4GC3A 2J4GA 2ZRUA 1B3YA 2WMIA 3NZGA 4GBUA 3QBUA 3NL5A 2X1UA 4JTEA 4KRTA 1GQIA 4C1LA 5BOOA 2VR2A 2Z7KA 3PTMA 5BROA 1GZ1A 3THCA 2PDXA 1TPEA 2WZMA 4AC7C 4F0LA 3PBMA 1HKIA 4M6UA 5DBTA 5HNRA 3AXIA 1V03A 1DJZA 1IYXA 5HR7A 3KHJA 4A3RA 1F7BA 4LRSA 3GM8A 4CQ8A 1PTGA 3OB8A 1V79A 3W7QA 2A0NA 2Y4SA 3IV8A 3H4WA 1HKKA 3EWZA 2P76A 3P74A 3WMSA 3GNRA 4KPLA 2O9RA 1BD0A 3V75A 3NUKA 1XLJA 3ZJ6A 3BGGA 1L2QA 4C6CA 4GISA 1M5WA 4HCDA 3GFZA 4M82A 3AOFA 1TJPA 3ORWA 1O5QA 1QOQA 2JK2A 4YS1A 1W5PA 3QOMA 4QSFA 5HINA 1M7XA 3USBA 2XFWA 5RUBA 2QDEA 2VD8A 4C6KA 5C9XA 1VCGA 3POCA 1JPHA 3MB9A 2WB5A 3F5KA 4AHQA 1LDCA 2OCZA 1RLCL 4H7ZA 4TUFA 3H4XA 2XH7A 1OSEA 1C92A 3FEMA 5GJMA 1UR9A 1O60A 4NZ4A 2J7DA 1NEYA 4XAZA 1XICA 2E77A 3NURA 1GVOA 1BYDA 4GZJA 4DAIA 5AVHA 3PUDA 5AC5A 1Y0EA 2XINA 5F2LA 1XRVA 1RH9A 3CV7A 3GC2A 1EDTA 1QI2A 1V3LA 1XKJA 4AC1X 2INEA 3UWWA 2WHMA 3SGZA 3H8AA 2A6LA 2QPUA 3QH2A 2FB2A 4G7FA 4FAMA 2D24A 4PODA 3ONCA 4N9EA 5FA5A 4IIGA 3CLMA 3EX3A 3G8RA 4B9YA 2IQDA 5GNZA 2XH4A 3NPWA 1TWDA 4LS0A 1UBSA 1VRDA 3BW2A 3OVGA 3B9DA 1ME7A 3JS3A 5IDZA 4QQUA 4MLJA 4PN2A 1WBJA 3B8SA 3OW1A 4KFPA 3QQWA 3DCPA 1QNOA 2OLHA 3MSYA 4H01A 3NYDA 4GIRA 4PH6A 3QY6A 4N2YA 2TSYA 3KOXA 1YMYA 3WH6A 3W70A 2NQLA 5HMEA 5F4XA 2YA0A 1TPFA 1U2YA 4GYPC 3TQ0A 2WYSA 3PM6A 3WK3A 3WQOA 2X09A 2CHOA 2GFTA 2VR4A 2CHRA 5E6YA 5FL0A 1Z89A 3N11A 5LYRA 4GNJA 5GPRA 4XV0A 4LEFA 4F0RA 4C1NB 3RAOA 3WQ6A 1LOLA 4ICMA 2RH9A 1GVIA 2EEXA 1U5HA 2V81A 4WOZA 2QS8A 3RR1A 1E71M 1LLZA 4WLCA 2EJ1A 4GA8A 4IXXA 2EPMX 4LBUA 1XSKA 1QTWA 2Z2UA 4ERGA 1ISYA 3NL2A 2E68A 3HO8A 2HE8A 2QUVA 4NNBA 2GDVA 3U2OA 1UR0A 3XIMA 3JRKA 2GVGA 2YXGA 4FOKA 3LPFA 2RGLA 3V0UA 3A4WA 3NJ3A 2GJPA 1ISZA 4CNUA 3INPA 2HXUA 2WPBA 3W7IA 1S2VA 1L6GA 4F4RA 4AEEA 5F2IA 2TODA 4GD0A 1JNEA 3RLGA 4PTDA 5FJUA 3HGJA 3VOGA 1OX6A 4GQRA 4H2CA 4ZXLA 3LQGA 4LUYA 3AUJA 1TMQA 4J9JA 3C2OA 3WFAA 1KWGA 1CCWB 1OFEA 2OELA 1VJSA 3A64A 4PTXA 1CXLA 2AQOA 2ACUA 4JYDA 3S1XA 3WUGA 4U28A 3MY9A 1R3WA 5LIWX 3MBFA 1BLIA 2R1MA 4GFSA 4XISA 5FEXA 5A2BA 2P3ZA 4DBDA 2WSQA 3MW7A 2YZRA 1BVNP 1Q6CA 4IFKB 3ABXA 5J5RA 1TV2A 7ENLA 4LAKA 3ATYA 4PULA 1EJVC 4IGMA 3UP8A 5C70A 2FYMA 1WOAA 1QBAA 1ISXA 2Y8KA 2Z1SA 4GOAA 2CBVA 2PF8A 1E0WA 4FR1A 2A3CA 4KRUA 1FFRA 2XIMA 1QWKA 5JIWA 2WKLA 2WK2A 2YXXA 3KS5A 2ZUNA 4YHEA 1W3KA 2NXIA 4P8XA 2J7FA 2Y2WA 3DECA 4NJIA 3M9YA 3N4EA 3W6YA 1ZCCA 2DORA 2GUUA 1QATA 2CWXA 3AUOA 4J7RA 1S2UA 1IWAA 3ITLA 5FEPA 1JGIA 4LYRA 2BLEA 2WQPA 3ZMRA 1E1EA 3HPXA 1WV2A 5LNWA 4PEEA 1O5KA 1SJBA 2F2KA 5LIUX 1H7WA 4QJ3B 2ZA3A 1MWOA 1L2UA 3EGJA 4V15A 2NQZA 3D3AA 1N8IA 3QSRA 2YLLA 3LSCA 1VBUA 1Z41A 4ZB0A 4UMCA 3HJZA 4Q8NA 1UCWA 2NX1A 1RBAA 1HP5A 3U2ZA 1Y65A 4PFMA 1MUMA 4TV5A 3T2OA 1K02A 4DI9A 2IPJA 3U0HA 3G5EA 1JAEA 4HD5A 3FXGA 2PAJA 2E40A 5D4YA 2DH3A 1WNOA 1B90A 2WZTA 4BJHA 4I7WA 1CB7B 5A6KA 1OHLA 2B7OA 4M8UA 4XAGA 4DN1A 4PCPA 4ERIA 2XVPA 3GG8A 1EJXC 3TEVA 4UTTA 1B1YA 1OM0A 2ZICA 3VU2A 1AQFA 3WQDA 2VURA 3IAQA 3DG3A 3PZOA 3SRFA 3MJYA 2PRMA 4GNKB 3BMVA 1DORA 1UKSA 4DO7A 1W3HA 4Y9PA 3OHIA 3VILA 1SM9A 6XIAA 4QE1A 5EGRA 1GZGA 3M5YA 2YJQA 1O1HA 4UNIA 3W01A 4W89A 1NF7A 2PGEA 3WH9A 4ORIA 3W37A 3FIGA 3FXYA 4JTAA 4J3ZA 3HQOA 3H12A 4GY0A 2XWDA 3O9NA 1XLBA 1F8IA 3WH7A 4A3YA 3AZTA 3ZLGA 4ONVA 1CXIA 1SO6A 4EXAA 3UXDA 1KCZA 2WHKA 2Y0FA 3E2RA 1X6NA 3IVUA 4CN1A 4JFTA 2Q8ZA 2WVTA 2ZTKA 4RPQA 9CGTA 3OZYA 4M80A 2O9PA 1TTIA 1NOFA 2DPEA 1XQKA 1EUNA 3EZ4A 1Z9AA 3GVGA 2X2GA 3M0IA 1A5NC 2OZTA 3GTHA 3A4JA 1N8FA 3V0SA 3EA2A 1JDEA 1AH4A 1FWEC 3TW7A 2VZOA 1E6XM 3LHWA 1VJIA 3PPCA 5FIPA 4E0CA 2WVVB 5A6SA 3C4UA 4JTFA 3AMDA 3RMJA 3DHPA 1QOXA 3WENA 3HG4A 4GVHA 1JIBA 4LY8A 3L66A 4PMXA 3GVVA 2QMKA 1B3XA 1PSCA 2GWNA 3GS6A 1GOIA 3MCOA 5EFFA 1ZJAA 4W84A 2WJDA 3SRHA 5CGTA 1FA2A 2VX4A 4J5NA 2WW5A 3OYXA 2P50A 2REQB 2YA2A 5HAOA 4Q4PA 1VIWA 2ZRXA 1XD1A 2DH2A 1EXBA 3DGBA 3G6LA 5CZTA 4URIA 1UD3A 2BDQA 1OYCA 1VHNA 2Z2BA 2PRHA 3BAKA 5DELA 3CPGA 1DWGM 4JR5A 4F79A 3W2UA 3GH5A 2CYGA 4IWWA 5H8PA 4D1JA 1W17A 1POJA 1IWBA 2PEVA 1VEMA 2YW3A 3QPEA 2NZLA 3O05A 3PK7A 3UETA 3QR3A 1XL9A 1Z44A 3LHZA 2ABBA 1EGVA 2QF8A 3CEPA 1IV8A 4NZCA 4R53A 1FXQA 3FA3A 1VPXA 4REQA 1IZCA 1IGWA 4HCHA 2R1LA 3OVQA 4LVFA 1E56A 3N18A 4FSAA 1Z69A 2VFDA 3SW6A 1E15A 3L0KA 2O4QA 4ZCWA 3ARSA 3L5AA 5D09A 3UJEA 3GUWA 3QN3A 4FI4A 4WJXA 5FJPA 2PDHA 4PUJA 2QCEA 4C6FA 3WSUA 2WBKA 3B8IA 1A53A 2HSAA 1UC5A 2BGNE 2WLZA 3M0KA 1V51A 3EOSA 4HCLA 4WXYA 3AU2A 3L0GA 4HYWA 1P0KA 1LL7A 3LMZA 3RRAA 3NQVA 5BXPA 1K3UA 4MIMA 5EMYA 2J7CA 1GQJA 4NIRA 3WMBA 1GOKA 1KFEA 5JVLA 3VGHA 1N2VA 1I0BA 2ATSA 2O56A 4BI7A 1VH7A 2EPKX 4KFOA 2AQVA 3GC5A 4KGLA 3LHUA 2QIWA 1KTCA 2RJGA 4XVEA 4O8RA 4D8AA 4HPJA 3W7NA 4JTSA 1MW2A 3UERA 2UV8G 2O9TA 1FCQA 2BHUA 1XLIA 2TRSA 4RR4A 4NILA 1R46A 4F0KA 1GOMA 1W1ZA 4K8HA 1GPWA 2AKMA 3P2VA 4DUXA 4ZO8A 1TWZA 1KCKA 3U9IA 3W7CA 3LA4A 3ITGA 1T8XA 5HJLA 1JCTA 5HQEA 4QFUA 3Q94A 5T9CE 5KMYA 4TMCA 4H83A 1AMKA 4YN5A 4JFVA 3W1TA 2D0GA 1SR0A 5TD4A 1W8GA 1ZAJA 2E0PA 4I9MA 4HMEA 1TE6A 2FHFA 4XB3A 4QNEA 5A6LA 4C91A 2PWEA 5EPDA 2QLYA 4L56A 4H9VA 4NAEA 4XUYA 4YWSA 4XBSA 1TPUA 1UR4A 4OBSA 3OQEA 1M03A 1EJWC 3WLLA 4UQDA 4AVOA 4K68A 3TSDA 2X0YA 4JIQA 1H61A 1SQ7A 4UR7A 2UWFA 4C7FA 1OGGA 1OIFA 1ADSA 3CWHA 1WDDA 1LM1A 3BXWA 2PWVA 5A6JA 4NT0A 3GFXA 3WL0A 1XLMA 4GJIA 2I7GA 3GNDA 5JUVA 3FCPA 3BSGA 1FH8A 1QPOA 3VOIA 4DWSD 2AKZA 3PPGA 3MVIA 5CPQA 4LW7A 2A7PA 1KXTA 2GQ8A 2VELA 5I6SA 2XU2A 3ABOA 1E6QM 1J10A 4Q4SA 2BGSA 4Q4KA 4LXFA 2DIEA 4CU8A 3BJFA 1DL3A 2FVMA 3KW3A 1RR2A 3GYCA 2IKHA 3OIXA 4MPKA 4GZ7A 3TP4A 3TDFA 1XG4A 1K03A 1YEYA 5E0FA 3ES8A 5EB8A 4JQ2A 1YXYA 5DF0A 1OK6A 1F3WA 4IMFA 4LTSA 1NP0A 4N9DA 2VEKA 4JFWA 3PUGA 3MVTA 1GORA 7TAAA 3BJSA 5D2WA 3UT0A 4OZOA 2ZX5A 5K9XA 2WJEA 2XPKA 2ESCA 4V1XA 1GEHA 3CS2A 4FF7A 4R27A 1EHNA 1WXZA 3VD3A 4LUTB 3OZPA 5CPLA 1RHCA 4YTTA 2C13A 1FH7A 1K7FA 4A21A 3CIWA 3UGRA 4ROPA 1UBPC 3NO3A 1PZ3A 1MFUA 2ZX9A 4E4UA 1ODUA 2B4GA 3WH5A 1Y5WA 3JW7A 2A3HA 4C6QA 2WANA 3TN3A 3CH9A 4NY2A 3TE9A 3TYAA 3ALGA 1DIEA 1G5AA 1VZWA 4DZAA 2WLYA 3XINA 1EPXA 3W7RA 4RZBA 4D6EA 1BWLA 3SN4A 2G3IA 2WWDA 1CLVA 4IG2B 1W9DM 2PU0A 3HZ3A 3KE0A 1MW0A 2CBIA 3REQA 4TTGA 1KRBC 1GVSA 2VZUA 3VOJA 4F0SA 1Q63A 3CHCA 6ENLA 3T4WA 4HVXA 1OFDA 4PBEA 3VPLA 3B05A 3NQCA 2Z1VA 3QGVA 3RITA 5BRBA 4AF0A 3N73A 4B5WA 5JMUA 3NZQA 3WJYA 1M04A 3TZNA 4A3HA 2VC7A 3N4FA 5JBEA 3VNMA 4MY8A 3ZSSA 1EQPA 2GSJA 3WBYA 1PYMA 2AAAA 5LIYX 4O0ZA 5DMNA 3JVAA 1K9FA 2RJHA 4PB5A 2E1DA 4GJ1A 2PWHA 4CUCA 4HZ6A 4YLWA 5AYYA 2YYUA 1REQA 4PCTA 2V9DA 2D2GA 1AL8A 1G4EA 3W76A 4PB4A 1L6YA 3ANUA 3VZXA 3UXAA 1PL9A 1UWAA 5I3GA 3ARXA 3RYSA 1W5OA 1Q13A 4M5PA 1LZOA 2GJNA 2WZEA 3S6OA 3QKZA 1KBIA 3MUCA 1P4CA 3E0IA 1JDFA 3EA1A 1VJZA 1VP5A 2CXGA 4Y96A 3TYZA 4CNSA 1GKRA 2JQXA 5M2FX 3P81A 3MV11 3HV8A 4C1KA 2V30A 1D2KA 1H41A 2ZUMA 2W5FA 4PCSA 4W7WA 1UJPA 4AF0B 2PLJA 1V3MA 2CCRA 4L6OA 1FFQA 3W28A 1DHKA 2CLOA 3KRSA 4HU0A 5HXMA 1TCMA 3A3XA 5GNXA 1J0ZA 1TKKA 3BGAA 2EO7A 1E0XA 4IGNA 5D9NA 4DO4A 2Z6IA 3QHOA 2EPOA 1PEZA 4HMCA 5B80A 3R1ZA 4R34A 2HBXA 4AZ6A 3DI1A 1SFSA 1OFBA 2GVJA 3C0JA 1XYCA 1UKPA 4EPEC 2BODX 3UNTA 2NV1A 3EB3A 1DWIM 3K5XA 2A3LA 1ZGDA 1OADA 1C9DA 4HSHA 3NZRA 4S3AA 5AC6A 1JUKA 4ML4A 3PBYA 2E9BA 3MS8A 3Q65A 2ZC8A 2OYKA 4ZQRA 4P2VA 2GQ3A 2DZSA 2G8ZA 1IT8A 4RE0A 3O0KA 1EX1A 1FWAC 1CT5A 5TBOA 5CH9A 2J79A 4MM1A 2F8QA 3HPFA 2PFHA 1K70A 1E6PA 1JFHA 4AD1A 3PZIA 4LB4A 2ZX8A 3VGDA 2GL5A 4OV4A 1SMAA 2VRJA 3O15A 1JYWA 1I60A 3N6JA 5C54A 3KS6A 3AYVA 4NJJA 1TRDA 3CL7A 3EKLA 1P6BA 5CAKA 4PZVA 1CWYA 1TB3A 4P8UA 4LNYA 4HT3A 4YYFA 1YXDA 4WY0B 4BR1A 4PC8A 1DXFA 2C0HA 3GDRA 3EYPA 3K2GA 3M47A 2X16A 3R7MA 2DGAA 1HKVA 3OLEA 3RPDA 1AH3A 3NR0A 2P3EA 2X05A 4Z2LA 2ZE0A 2RDXA 1R3SA 3TNOA 3N3MA 1OYBA 1ZCOA 3PWAA 4UTTC 2JIWA 1E1CA 8A3HA 2E5DA 1SR9A 3STFA 1IWPA 2QW5A 4C1NA 3N2CA 4JYFA 3QV6A 3PBGA 2X0HA 4AD3A 1CGWA 2CZDA 4RXGA 2NV2A 3E3HA 1B3WA 1V02A 3O2LA 3PULA 4QITA 2PSNA 3KRBA 2G50A 4ICNA 2VHLA 3G6MA 3GC4A 4W93A 5HUPA 3AAMA 1M7PA 2Z28A 4LCSA 3PBUA 4FMVA 1BSLA 4HOZA 1C91A 1OD8A 4HZMA 4AIUA 1Z48A 4CLMA 1EX5A 2DW7A 3I4KA 1ZBKA 3E12A 1X7IA 4K36A 5KINA 4LT9A 3NQGA 3OBEA 3N2MA 4UFHA 5FSEC 4DZIA 1MW3A 1LBLA 4Z08A 3WJZA 1H7NA 2CLMA 1B4EA 4M19A 4U2YA 3ALFA 1B31A 2PA6A 4GXWA 1PWLA 4PL1A 1E4LA 1HJWA 1XYFA 1Q6DA 4MGGA 9XIMA 4XZWA 1AFSA 4CQBA 4MMWA 1J5SA 3VNZA 6XIMA 4LSBA 1XBYA 2GVEA 1WUFA 1LG2A 5DRCA 2YFOA 1P1XA 1TV8A 2YL9A 8CGTA 3LHTA 3ABSA 3GBDA 4KEUA 1XQLA 4MPQA 4GQBA 3ARRA 4F0MA 1OZMA 4OECA 2F61A 3WQ4A 1KBBA 2CLLA 4P7NA 4GO8A 4IFKA 3IK4A 5I79A 1EPVA 4TR9A 2DT0A 1GG0A 4IP7A 1OIMA 2EQDA 3TOYA 3TYCA 5DQPA 3PJXA 4JHZA 2VCBA 2OB3A 1EO5A 2XSXA 2OQLA 3GQYA 2GOUA 1EKOA 5ENLA 4H9YA 2BMBA 5HJYA 3EX6A 3T05A 1JGMA 3B9AA 4UBPC 4FOJA 3MI3A 3W22A 3N2OA 1IEIA 1TCDA 3DYOA 2CITA 4AHPA 4GQGA 4B5XA 2YZ5A 2R94A 1O95A 1WXYA 4K39A 2Z24A 4X0VA 4CVWA 3F4VA 3IRDA 4JTJA 4H00A 4FNPA 4HP5A 2PMQA 4OHQA 1PZ0A 3NQ6A 1WX0A 4JBRA 1KFJA 3LV5A 1HP4A 1DJYA 4GXPA 1OB0A 3PZUA 4PGLA 4UNKA 5BXTA 1UZ4A 4TVDA 5I03A 1HUVA 4ZXOA 1V3JA 3P84A 1TPH1 4ZR8A 1R0MA 4QJ4B 3PPFA 3WNPA 2FGLA 3VFCA 3GU2A 3AI0A 2HVNA 4IXHA 3M0MA 1A5AA 1CPUA 3STPA 1V0NA 1VS1A 4NNAA 1Q5MA 2ONEA 3MP5A 1Q6QA 4PR4A 5CEWA 3T44A 2X7VA 1GG1A 1M65A 1J0KA 3BUVA 1F3TA 4S3CA 1NFPA 3WMCA 3B8TA 4HB7A 3IWPA 3AALA 1LJYA 4S1FA 1TPWA 3PUEA 3AXHA 3EXRA 3EX2A 3B3DA 1UA7A 4DXXA 5HBFA 2A7NA 4GY1A 3OVPA 5A2AA 4F9JA 3M0XA 4CQAA 1LLOA 1TV7A 4W85A 2X41A 3NQ2A 1B9ZA 5DY2A 1OWQA 2V63A 2MUCA 4JTLA 3WYZA 1TA3B 3ES7A 3S5ZA 3DFNA 3N6HA 4LV4A 4QQ3A 5BW6A 5A2CA 3IEBA 4O8AA 3TV8A 3CIXA 4QE4A 4BS0A 3R13A 1HGWA 1FBAA 1PCWA 2JFEX 2V82A 4NXKA 5CG0A 1XLGA 1QOPA 5F4WA 4X2RA 3SAZA 3FS2A 2OLSA 3RR4A 4JTGA 2PDFA 2FIQA 2XVKA 2YR1A 2BSLA 3I4EA 2TAAA 4C6BA 4PMOA 3OLIA 3LMYA 1FTXA 2DDXA 1Z6KA 3DHUA 4PEKA 3SI9A 4AX6A 2YGYA 3DG7A 3VKJA 1EWEA 5G1MA 1S3TC 4X60A 3V3WA 1U1JA 1Q6RA 3E49A 1J11A 2Q3OA 2BZNA 2VI0A 3W6MA 1UHVA 4B3ZA 3P82A 2OFJA 1H51A 3BW4A 3QZEA 1D7FA 4WXZA 3MDWA 4DF1A 3LOTA 2GQ9A 3N1AA 1GW1A 1F6PA 1QW7A 1KFLA 4K1GA 3LERA 1O5RA 3NDYA 4Z1CA 1NDYA 1TREA 4WVXA 3PWGA 4IPNB 5SWUA 1XKYA 5AY7A 3QVQA 1W32A 4NAFB 1N8WA 3UCCA 1JPDX 5BRPA 3C2VA 1ZS2A 2CWNA 3THAA 2PTDA 3K4AA 2HK1A 2VDGA 2P5NA 3TTSA 1Z8AA 2NT0A 3FAWA 1P43A 3WO8A 4PCNA 2XG9A 4Q22A 4AX7A 5M3WA 3VCRA 1UUQA 3R0DA 2D3NA 2OWXA 5CPTA 5FF2A 4A05A 2VCCA 1JR1A 3SZ8A 3V35A 1I1XA 4Y2WA 1XW8A 4EKJA 4K8GA 4LYQA 1G67A 4JQ4A 1AL7A 1GHRA 2XJ7A 1OCNA 2Z4GA 1J2WA 1CTNA 1NH6A 2A21A 3F2BA 2WM0A 3EWBX 3VM7A 1XYAA 2WQDA 5FCZA 3VC5A 4JPGA 2YL5A 4FIQA 3T0TA 2A2IA 3SJNA 1V6UA 1IEVA 3LSBA 4TX6A 2QDGA 3AYRA 4U10A 3QF0A 1LLWA 5M5DA 1LG1A 4PUEA 2ZTJA 1RPKA 1WDWA 4ZEPA 5CC5A 4A8IA 1PKNA 1BTMA 3KZSA 4BF7A 3UZYA 2AGTA 1UMLA 1KM5A 4WDWA 4JHMA 1XIJA 4IGSA 1PKMA 3A4XA 3THQA 1EHAA 3GNXA 4OIFA 4CD4A 3AICA 3O0FA 4DPPA 1WKEA 2CPUA 2OKTA 3BVJA 5HMSA 5HWJA 3OLGA 4PTWA 3S1GA 3I7SA 1T96A 4M7TA 1KR1A 1C3FA 4KCTA 4PB3A 4JIEA 1KFBA 2Y88A 2OZ8A 3GKFA 1MDRA 4IFRA 2CW6A 3MUAA 2WVVA 1OABA 1N7KA 3PVFA 4IOTA 1TZ7A 2W67A 3IRSA 3V4BA 3QC0A 1I2RA 5J8LA 4AZIA 4L9ZA 1XCFA 5AHNA 4YMZA 4D6FA 5F2GA 3GYEA 4C6DA 3IV3A 1B3VA 3RU6A 4NJKA 4JTTA 3ZSTA 4C5YA 4RDWA 2D0HA 3CQIA 1GJPA 1T6MA 3L4UA 1GVQA 3CUHA 4HNVA 1P1MA 4BCEA 3JZEA 3LEPA 3KVKA 1JVNA 7REQA 3GVRA 3MSDA 4XD3A 3W72A 3AXKA 3MMWA 1E51A 1Z42A 2XVNA 1P6CA 4Z17A 4MUPA 1OX4B 3CZ8A 1B57A 3VX0A 3W24A 3EKZA 5LA0A 3GU9A 5DBUA 3LG3A 1F61A 3C0QA 3G1XA 1SZGA 4PL2A 6TAAA 1FDYA 2NSOA 2P88A 2DSKA 4R9OA 5J5DA 4LS2A 1TRIA 2YXOA 4NSBA 5D32A 2ZUUA 2HDJA 1C90A 3R2GA 1VCFA 4L4LA 7ODCA 1U1HA 1V3IA 1HL8A 1HFBA 4NAFA 2DIKA 1UD5A 3S4TA 3FDGA 1TE1A 4DBUA 3MYOA 4UNLA 1EJRC 3GXIA 1XH1A 2ZVRA 1JXJA 4JCMA 3U48A 4UTHA 3N25A 2DT3A 4KF1A 1O94A 1RJPA 1WKFA 3MHFA 1XIHA 3APGA 1D8CA 4UTLA 3C3UA 3GKAA 4RK8A 4F40A 3WBXA 3TOPA 1IEQA 1LQ0A 5BMXA 1A4LA 4IMDA 1KXQA 4BFAA 3GY1A 1QNVA 1UKQA 4HYVA 1U30A 2DQWA 2PC4A 3IJDA 3WY1A 1T41A 3RUBL 1UPMB 4LRTA 1RCOB 2B7PA 5T91A 3QY8A 5HATA 4GI4A 3ITOA 4B3LA 4Z2GA 4F66A 1CGTA 1S38A 2J25A 1R87A 3H23A 3AISA 2J7BA 3OQ8A 4BZYA 2I5GA 3V18A 3IJ6A 4EAYA 4BQ4A 5FL1A 1UP2A 4J3WA 1KRMA 3RX2A 2V5CA 4A22A 1E1FA 1JAKA 3AZRA 2R14A 4FNRA 5AZ1A 2CLIA 4XIMA 3WFZA 1S2CA 1UP3A 3MUXA 3ITYA 3WUEA 2H3BA 2D2OA 3U57A 2WMFA 3CQHA 3ARTA 3PTQA 1O7AA 3NQEA 2QKFA 5G2HA 4ADSA 1A5KC 1IT7A 1XPYA 4AYGA 2HTMA 1KLYA 1DWHM 4KGJA 3TK7A 3QW3A 3GSMA 1PKLA 2EJAA 2V3EA 5LXXA 2W6RA 3F03K 4JTIA 4LYPA 3UCDA 5JH1A 4GHRA 1RA5A 2IW0A 4O52A 1L6FA 4J3UA 4O1DA 1J2BA 3ABZA 4LCRA 3E0LA 3S47A 3CAVA 2J24A 4JIRA 3WDRA 3STCA 1XDJA 1MXDA 2HVOA 3WLQA 2V2DA 4B5TA 4V28A 3CQKA 1KQYA 2J7EA 1HNYA 3NQ8A 1D3GA 1BWVA 3KOFA 2J74A 4AZ5A 1FDZA 3BQ6A 1GQNA 2F38A 2VGFA 3PZGA 2Z00A 2BX7A 3OGSA 1M1BA 3W1RA 3U5UA 3J7HA 4YIWA 1X98A 3ZJ7A 3S9ZA 3RK8A 4KH2A 4KKXA 2IPWA 2RHGA 1NDWA 4JIPA 3YPIA 4JD4A 4F8XA 4YPJA 2QUTA 2PWFA 3CMFA 2UY5A 4BEQA 3W7PA 4ZODA 4IIDA 3M5XA 1X1ZA 3F4CA 4PMUA 5DY3A 4A2SA 4AMAA 1FWGC 2SFPA 3AHZA 4GUIA 3CO8A 1XLLA 5FEWA 4ENLA 3SY1A 5CZSA 4ZE4A 1PDZA 3CTLA 2XISA 3QHNA 2ANUA 3WF3A 4HGXA 2Y8UA 5REQB 8XIMA 2PUZA 4WDUA 2YL8A 5E93A 2WJFA 1EA0A 3CC1A 4Y8FA 5CLWA 3D47A 3PPHA 1W1YA 3K1GA 3W7MA 3UEQA 3FDKA 3IUDA 1BYAA 3P8IA 2Y7DA 4FO4A 4OQVA 1X1OA 2PD9A 2DZPA 1WDQA 1DPMA 1JYVA 1NOWA 5C55A 3P8JA 4B15A 1K77A 1XIDA 1I6NA 3GVWA 1UMYA 3VOFA 1NWUA 1W91A 2BOGX 5M03A 1WQ5A 1SW7A 3H2NA 2OQHA 1KFCA 5E1QA 5I09A 1UC4A 3TSBA 3UW6A 3P60A 3VKAA 4A8NA 2Z6JA 3B8DA 2XSBA 5F1UA 2PCEA 3LRLA 1E6NA 2BY0A 1CLKA 2VWTA 4DQWA 1C7TA 3ARUA 4K37A 4M1RA 2JE8A 3NQBA 2YBUA 2VDHA 3TKFA 3THUA 4WF7A 4QHRA 1H4PA 1AZ2A 1V77A 3T55A 3P62A 2Z1BA 5HA7A 4L9XA 4TX8A 2R24A 4N42A 2IXUA 5AECA 1TTJA 2V0TA 2CERA 3PTDA 4U3AA 3RJYA 2ZCGA 3TFCA 4S3EA 4LX4A 3TWBA 5XIMA 3SM0A 1QI0A 2HMCA 2OZ0A 3VZYA 3JR2A 1RAKA 2JF7A 4S3FA 3HFYA 1JCMP 3G3DA 3PAJA 5E70A 1BYBA 2FDSA 3H2CA 4DAFA 4U4MA 4O14A 4X0NA 4L4OA 2B81A 4MKSA 1TTPA 1OG0A 1WUEA 3N4AA 1IE7C 1SYTA 2OR2A 2WZIA 4GQQA 4JTRA 3PN8A 4UFKA 5CGMA 4JEQA 5IHRA 2Z27A 5MKGA 1TJ0A 3QTPA 2OT1A 5AOUA 2AOSA 3LTPA 4WSJA 2HS6A 4HPNA 2QUNA 2RUSA 2GVLA 1GQLA 5LIKX 1H50A 3M7SA 4W8BA 5C7VA 1QCWA 4JYEA 1UR1A 1GT8A 5A6AA 2DW6A 1JRCA 1KTNA 4PUUA 1OY0A 1W2PA 5L6UA 4DF2A 4OTKA 3HPAA 2NLIA 2QEZA 4LAOA 2YBVA 4GINA 4D6JA 1NWRA 5BU6A 3GNPA 4C6EA 1GOXA 4H04A 1UW9A 4Z2HA 3A21A 3S2MA 4B5VA 2VVSA 4YTUA 3RCNA 3A47A 4LALA 3FX4A 2PDCA 3DXIA 3GTNA 2ALRA 2QJHA 4DJFC 4OFCA 1EH9A 3MWCA 2DEPA 4MOZA 3FHAA 4FXFA 4NAEB 1MVYA 3BOFA 1HO4A 2QQ6A 3VZZA 4Y9MA 2GUBA 4IPPA 2Y1HA 2ZZ1A 1W9VA 2WC4A 3ZWTA 3K8MA 4GO9A 3WQ5A 4WY0F 3B8UA 5CSYA 5EMJA 1WXJA 4DLMA 1EC9A 2OMAA 2DVUA 1QW8A 3UPMA 1MEWA 4D6IA 4M6QA 2A85A 3H2MA 2C0AA 2XM2A 1J0YA 1X1NA 5DEZA 4GIEA 5G5IA 3W7HA 1QNSA 3WNKA 2DZBA 3GD6A 3W1NA 4CU7A 3W0KA 3UXIA 3PNUA 4GPNA 3KOWA 2HE5A 3QV9A 4U3CA 3DH7A 2VD9A 2Z25A 3QKEA 1N82A 2CHNA 2PDKA 2QNEA 3SRDA 1J96A 2V38A 2OEJA 3UNDA 4RX0A 1L6SA 2NXGA 5LNSA 3NQ7A 3GXDA 3IGSA 4GUGA 3KBWA 1B4KA 3T4CA 5BOEA 4XZHA 2QDDA 3NSMA 4GYKA 5D2TA 1DWJM 2WNNA 3S83A 2PGRA 4Z1BA 3TN5A 3W81A 2HBVA 3LK6A 3L4ZA 3M46A 3M5VA 4D6CA 1IIHA 4Z1YA 1SSDA 3BSHA 4Q8PA 3AS0A 4HMNA 2A1YA 2NUXA 4H7VA 3ERPA 1K8ZA 3HF3A 5D9MA 5AKQA 1AW1A 4L7ZA 3GBEA 1ZZMA 5E9AA 2QCFA 3MV01 5F2MA 3E5PA 2AL2B 3GH4A 1NDVA 4B91A 4HHLA 4J28A 5D30A 4FNTA 4RDVA 1EEPA 3QMTA 2VX6A 3QOKA 4UZSA 3W1QA 1BRLB 3WK0A 3MYPA 3LI1A 1O4UA 3TLLA 3FA5A 3BZJA 4HN8A 1JI1A 2ZRWA 3GZ3A 4YVPA 1I45A 2IXVA 3E02A 5ECVA 5A8NA 4NL1A 3S42A 2NW0A 3NQFA 4I7VA 1V6XA 4CD7A 4DZ5A 2PCQA 4O1AA 1EP2A 3WLIA 1ZJBA 2XN1A 1ITQA 4FZIA 1S39A 2DZUA 1GYMA 3TTOA 3CZJA 3B0XA 3LGDA 4A29A 3M0ZA 1F4HA 3WQPA 3W9ZA 4W9TA 1XM3A 2P10A 1TWIA 3ANVA 1TV5A 5B7YA 2DSWA 3WCZA 2Y85A 3WNOA 1DOSA 3KDOA 3QFEA 5A8PA 4YVXA 1A5UA 4NXSA 2GSEA 3BC9A 3VUPA 2ZUSA 3VVGA 3KCLA 3D3FA 4UUIA 3P0WA 4NUWA 1QRQA 2Y89A 3BARA 4RNFA 3GO2A 3S6TA 2BHYA 1SO5A 3KX6A 2VKZG 3CLWA 2B31A 3WLSA 4ZVJA 1B9BA 2DZXA 2H8XA 4GYJA 4I3GA 4XUGA 4DHGA 1H0GA 1G6CA 1P7TA 1MYRA 5IFPA 5FJTA 3HURA 2FPTA 4O1EA 2PBOA 2OGYA 3EDEA 2WM1A 2OYLA 4QXIA 3W1LA 2VEIA 1KC7A 4P8WA 1RK5A 1Y5XA 4LPCA 4X63A 3BMWA 1P6WA 5EFDA 4V27A 4H9XA 4JQ1A 3CYJA 3LZ5A 1S5TA 3BWWA 3BDKA 3FGCA 2JALA 4RUBA 1NY1A 4ZGYA 2ACSA 2DP3A 3SO7A 6REQA 2VCAA 3AFBA 3A22A 2WNQA 4YTRA 2FLIA 1UD8A 1DJIA 1KM1A 3VIFA 4E8CA 3CMJA 2WKJA 1OFPA 3I3DA 3LM7A 4UC5A 2G37A 1QDSA 1XFCA 4JZ5A 1UROA 5CSUA 2GSHA 3ITVA 2VP8A 3L7RA 1ZBWA 4L64A 2WKGA 1MXSA 4H6KA 1XINA 1LT8A 2VC6A 5FF0A 2V3FA 3O07A 1YPXA 4DLFA 3EDKA 2GYIA 3I65A 4WGHA 5IHSA 3FVMA 4AD2A 1EEXA 2VJXA 3QQ1A 2XIQA 1KA9F 1OFOA 5HOSA 1WPCA 1XLEA 1YE6A 2YL6A 3FY1A 1XYZA 3UA4A 1BRLA 1OYAA 4FLOA 1YW1A 2WSKA 4HBKA 4XZLX 3N12A 1WZLA 2C14A 4LCQA 2QXWA 4C5ZA 2P8BA 3T07A 1X8CA 4LFYA 2VOMA 1ZNNA 2ZADA 3UWUA 3A23A 2H9AB 3VIJA 3KTCA 3IARA 1LBFA 3DG6A 4YNGA 2YCJA 5JH2A 3CGTA 2X40A 5A3HA 3S5YA 3OYZA 1XIFA 5HUOA 1MEIA 4L1XA 2Y7FA 5EU9A 3COTA 3ZQ9A 3SR7A 5G1TA 3POHA 4HU4A 3VIOA 2F9RA 4Z1AA 3G1VA 3NNTA 1Z32X 2G95A 1YLVA 3LCGA 4KBXA 1ZY9A 4AZBA 3A5FA 4HOXA 1FWCC 1XIEA 3ZR6A 4XZBA 4HNUA 4M29A 1L0PA 3WQGA 3V5OA 1XRTA 4ZA0A 4XG1A 4N9CA 3DUGA 4I9JA 5HQMA 3TC6A 4A2RA 1QBBA 1TUXA 1XH2A 4D8LA 2VZTA 1M68A 3A13A 4ZFCA 1HO1A 4KESA 3B97A 4S38A 2NVCA 4GVFA 4LAMA 4PMDA 1U5VA 1HIZA 4QGCA 1FWTA 3OZMA 3MBDA 4WUIA 3G1SA 3OTRA 1LL6A 4M6VA 3BGJA 1OGSA 3VIKA 3NIYA 5IRPA 1R30A 1LQ2A 2HZGA 3R79A 3U4FA 1C9WA 1HXJA 4AIBA 1IGSA 4PMNA 1TVLA 1J0JA 1MXGA 3IANA 4HPHA 5I2UA 5BZAA 5CSRA 4IPIA 4B16A 4DRSA 1RP9A 4AY8A 1KXHA 2YSWA 2I9EA 4TO8A 1CNVA 1YKWA 5BWFA 4UQAA 4ZMGA 4B3KA 1YTDA 3DBNA 4NF7A 1JYNA 3A9IA 2QGHA 5KSWA 5I06A 3DZ1A 2EF9A 3KVLA 1IXPA 1ZJHA 2F2HA 4EPBC 4NRRA 4IH3A 3V7PA 4UQ9A 1ML1A 5GVJA 3VKKA 3G0XA 3GK0A 4XK2A 4MNKA 1E3XA 4WDXA 4JX4A 4LF2A 4AUBA 2P1FA 5DCEA 2A3EA 1E9IA 2PF0A 1CGUA 4GJJA 2E6DA 4D2JA 3OHMB 3VE7A 3R5EA 3R4IA 4FF5A 4GQ0A 3VOCA 3U2EA 3NDZA 3NZPA 4L80A 3D5HA 1UQZA 4G6CA 2PI6A 1ECQA 4E3VA 4CGTA 4AD5A 4WJEA 1OD0A 4Q3MA 1Q2SA 3CZKA 2C18A 1UP0A 3TSMA 5IBXC 1IZJA 1VBHA 1YTEA 3S5SA 1TV3A 2V69A 3A4AA 2Y6ZA 3UD6A 4DPQA 2UY3A 2P53A 2XIBA 3DDMA 3M7WA 2QVNA 1W1VA 3H53A 4IX2A 1R3RA 4A8RA 1XC4A 2Z1XA 1EC8A 1P48A 5D04C 3EAUA 3G2GA 5I02A 1F5ZA 4DWSB 1US0A 2WHJA 4TIMA 2NLYA 1XFBA 4H2HA 4ATDA 4DZHA 2OTDA 5C5YA 1J8VA 1EZ2A 5CPSA 3WLKX 2YCEA 3PG8A 4J4KA 2OEKA 3FJ4A 4IUOA 2GOKA 4FNSA 9RUBA 4JIHA 3MI6A 2YW4A 3OIHA 3B03A 3V16A 4E38A 1U5JA 3ZVIA 2NQ9A 4UOZA 3AO0A 3G3MA 1JF6A 5F7UA 4H9UA 1IQ8A 1E1CB 4D72A 2YFNA 1NSJA 3ZFHA 7A3HA 3EXTA 3TJIA 2HXTA 3M41A 3L67A 1YBQB 1ICPA 2GDUA 1ZRQA 4JTQA 1NAL1 1E0VA 4GUFA 3KBVA 2ZXQA 1LWJA 3M0HA 3HG2A 4UFMA 1EC7A 3U7VA 1TMHA 2IPFA 3Q4DA 4QISA 4NU7A 3UPWA 3BH4A 3QGAC 1JUBA 1I2OA 2XGBA 3TCSA 4S3DA 3CU2A 1Q2RA 4UIOA 1JF5A 3S1VA 2WBGA 4XAYA 3VMPA 2OX4A 1H1ZA 3WLNA 2X8RA 2ZX6A 4JX6A 1ONXA 3UWVA 3V5FA 4AZCA 4C6OA 5CKSA 4O12A 5GQBA 4YWIA 1GVRA 3GH7A 1LOSA 2DIJA 2PDLA 4X61A 4IFOA 2DJLA 2YIHA 1FCVA 4IJBA 4ZTXA 4HNTA 3W2JA 2F6UA 3LN3A 2RDUA 1W1PA 4ZSUA 3CH0A 5IXEA 1AW2A 1G1YA 4R85A 4G9PA 3GXMA 1HKJA 3CB8A 5D37A 2ZA2A 3CBWA 8TIMA 4UOQA 3GXFA 1SVDA 1ITCA 5C8BB 3GR4A 4AEFA 3RLVA 4EVZA 1ZBCA 4W4QA 4P61A 2DVTA 2XFFA 3LM3A 1TO3A 4PE8A 2OXNA 3QFWA 3AC0A 4KERA 1PUDA 3CAKA 1K9TA 4CCDA 1JCYA 4ZO7A 1WOBA 4OUEA 1FDJA 4PBFA 3IJ9A 2CLPA 2DSZA 2DU2A 2OGJA 2FB3A 3FJNA 4N02A 5CC3A 4UCFA 3C2YA 1NVMA 4DXKA 3R8GA 3CPUA 4G5DA 3EKGA 5F1VA 1V5XA 4Q8TA 4O28A 3K46A 4GXMA 3V1HA 4UTUA 3ELFA 1IR2A 3HQNA 4Y9NA 1JDDA 3G1FA 4F2TA 5FKYA 3G22A 3FNDA 3TCEA 3WQFA 3WLTA 1MZHA 3CB3A 1EL3A 2BP1A 4KCUA 1UZHA 1UD2A 4O53A 3QY7A 4CEUC 5F4SA 1VBJA 2VMFA 3ZT6A 1X7FA 4A35A 4U5IA 2QV5A 2V5KA 4GI6A 3G1YA 2J8GA 1R5YA 4Y9OA 2BFGA 3W6LA 2D1ZA 2IKIA 2R1PA 2CLFA 1PTAA 1J4EA 1GVEA 1SFJA 1KLZA 3EEGA 4PFHA 1R7OA 3ZVHA 3DFTA 3R6IA 2VWSA 3LV6A 4YHGA 2BOFX 2VEMA 1MO0A 4OBRA 4NVTA 5I77A 2BG5A 4CEXC 1YQ2A 1E6RA 1R2RA 1VPYA 4ZOCA 2I5QA 3VDGA 1UD6A 2V5DA 3AIUA 3MCMA 1A49A 3ME3A 1QNQA 3RCMA 1M9HA 1GKPA 1Q66A 3NO1A 3UA3A 4O1FA 2PLCA 3OO2A 4RV8A 1N55A 3WJSA 1NOUA 1CDGA 3T42A 1K8XA 1DHPA 4EF8A 2PTXA 1RJRA 3L65A 4XSMA 3Q37A 2BVTA 3SFKA 1RQBA 2OLAA 2CLKA 1XLAA 1DQXA 1TIWA 4FX6M 1TPC1 1OBAA 3NEVA 4Q4QA 3UPBA 3LENA 4ADTA 4QLLA 4MWAD 3SEPA 2F6XA 3KXQA 1D3CA 2PBGA 3PZQA 4DNHA 5IDIA 2FKPA 7REQB 3VTRA 2DSUA 2EG7A 4GUHA 2ON3A 1KCXA 1MQPA 4WK9A 3MHUA 3FAXA 1I2QA 2ZIDA 2O4MA 1M53A 3LNPA 4D71A 4DJED 2NWRA 3LZ3A 4OJYA 1K7EA 1FWWA 2QMJA 4IQEA 4O4VA 3H2OA 3KM8A 3G24A 3TIMA 4HJFA 3AIWA 2VQTA 4KT2A 1XDMA 2PWUA 5K3VA 1A50A 5EY5A 1SZFA 1Q7MA 2C15A 3PZTA 4Y6GA 4HPGA 3SECA 4G56A 3N14A 4E6MA 2R9RA 4MZ8A 2J6XA 4QG8A 3VIGA 3DHFA 2QJMA 2VUNA 5H1WA 2AAMA 3W73A 1EFZA 1OF6A 5JU6A 2C16A 1OQFA 2HNHA 1TWWA 5E9XA 4ZENA 3DN5A 2RKXA 1GOOA 1X97A 3DEQA 1P0BA 3WDJA 5I7GA 4PA8A 1S2AA 4DXVA 3A9BA 2WMGA 1XIMA 1MSSA 1MNSA 1PHWA 3OVRA 3WN6A 3ZR4A 4GIAA 4H4IA 3KVMA 3RRXA 1R3TA 1RUSA 4ZQOA 4XKYA 3N04A 4JNYA 3AHTA 4C6PA 3B0YA 2PZNA 2ACQA 3GDKA 1E40A 3UY8A 1XLCA 4GWEA 1J01A 1HJXA 3QXBA 3QQ0A 1W1TA 4X2PA 2QGYA 4I6KA 3QPZA 4QNWA 3P5YA 4WDTA 4TVUA 1OZQA 3T78A 4MJMA 1XUUA 3DFHA 1FWNA 4AIOA 2J62A 1DXEA 3WH8A 5HMDA 4UB9A 2XM1A 4ZB5A 1R47A 3UF9A 1UWUA 5AC8A 3BJTA 3WF4A 4FIRA 5I07A 4JTCA 2V3DA 5BRQA 4QAIA 2Y61A 1KFKA 3SIZA 1YIXA 2ZZ5A 5KZDA 5HPOA 2IMRA 3CUXA 2W9MA 2XGZA 1AVAA 4BI6A 4HSNA 1QT1A 3NCOA 3TU9A 1B54A 1VFMA 3EDFA 5I3KA 1O68A 1BQCA 2Y62A 1CX9A 3CUGA 3LCXA 4FXRA 3WNMA 5DMLA 2ZFAA 1FY6A 3APTA 4ZTYA 1C29A 2CLHA 4UCGA 4RDZA 3G1AA 3OOQA 3I7RA 2YA1A 1XGZA 1Q8AA 2Y5SA 2WMKA 4LNCA 3S9IA 3TFXA 5M17A 1IZKA 4EXQA 1QI5A 4MF4A 3ZIZA 4AVNA 1GK8A 2OOGA 5A95A 3C0SA 5T8GA 8XIAA 3M6DA 1OCBA 1MDLA 3MC5A 1KM2A 4B4HA 3ZLHA 1QHZA 1VYPX 3VIPA 2ZZ6A 2I17A 3FYPA 1JZ7A 3APYA 3HGOA 1JZ5A 1KM0A 2DV0A 5CBBA 1SFLA 3QZ6A 3K8LA 3QMRA 4RE2A 3LXAA 4Q8MA 4AQLA 1C7SA 4HTBA 2HROA 1DJGA 1W6TA 1AQ0A 3THDA 3GG0A 3SUVA 4MNJA 4OUIA 2PDGA 3W25A 1ONWA 2XH2A 1EJSC 1BGAA 2OSWA 1CENA 1YNYA 3FYYA 3LBOA 3PANA 1BYCA 3LRKA 2G3FA 6TIMA 4CCCA 3VA8A 5TQLA 1B3OA 2PDWA 4UMBA 4CD8A 4OKDA 2VO5A 3B4YA 4O16A 3EMQA 3MQTA 3URQA 2CZEA 1LTDA 4MUZA 3NQDA 4F0HA 1MQRA 4MB5A 2J66A 1G7VA 1AUSL 1WAUA 5DO8A 1J0HA 3IIPA 2J9XA 1EUAA 3EMZA 4F2UA 4Q4MA 1FWHC 2BXVA 4E4PA 3VE9A 4LWWA 4JDBA 1XRFA 1JXKA 1PIGA 3OA5A 3NGJA 3OEXA 3I6RA 3W75A 1W1B1 3PG9A 1H7XA 3LTYA 3WELA 1P7TB 1XYMA 1G01A 4PUMA 4DWDA 5HQLA 3CL8A 1NQKA 1ZB5A 3AS3A 3KCOA 4P8VA 4Z2KA 4Z42C 5EA9A 2J78A 1VCVA 4OOZA 1QASA 3PTKA 5I00A 3HG5A 4C60A 2Q71A 3QLLA 3OGVA 3L4VA 5ABHA 4QRNA 1TX2A 1F07A 3NOYA 3RX4A 4D1IA 3BCJA 4FX7A 5FSDC 1RPXA 3S5NA 1FHDA 4UFIA 4AXNA 3QW4B 3L2IA 1UD4A 1ZHAA 4L4PA 2TMDA 1F8MA 4X3ZA 1UYQA 2YPIA 1SGJA 1BWKA 3P93A 4MJ4A 2WMIB 3PSVA 4ZE5A 3BLEA 5AC7A 3VM5A 4JN8A 3LX9A 1FXPA 1BSIA 1NIUA 2HQAA 5I24A 3WBEA 4US6A 3H4GA 1PHQA 1EXPA 3BG5A 3UZWA 4DJDA 1UZDA 3VGEA 3BG9A 3LU2A 4DJDC 1R6WA 2VFIA 2EHHA 3LPGA 3TC7A 1NQ6A 5DLCA 5HR6A 2PC8A 1K9EA 3W27A 3ZLFA 5C9UA 3W84A 1RQHA 1EJTC 1EYWA 4J40A 3ARVA 1JD7A 4FNQA 1KO0A 2J9ZA 1E0TA 1US2A 4UTIA 3RMEA 2W3ZA 2Z29A 2DFAA 3RGTA 5BYWA 3UVAA 4B5UA 3WNLA 2JEQA 4XZNX 3R12A 2CNCA 3M07A 2J13A 1YDOA 2X7WA 3FKRA 3HB9A 5DANA 3WEOA 1JUEA 3ITTA 4Q8VA 3UWZA 1LROA 4LVBA 4KEMA 3D46A 5JBFA 3T81A 1GOQA 5LHFA 3EPMA 5C9ZA 4I7UA 4HTYA 4JIIX 5A5WA 2NQJA 2EBNA 3TAOA 3CL6A 4HA3A 3AMCA 1Q7ZA 3VD5A 1V4YA 2H3DA 4ORMA 4UR9A 4MG4A 4MFEA 2I14A 1JZ3A 1A3WA 2ADAA 1SJAA 4BKNA 3MI2A 2VC5A 1XIGA 2A7RA 5I3HA 4LB3A 2GK1A 2XVLA 4UMAA 1H1YA 3TA6A 3PBVA 2G5WA 2VFEA 5KTLA 1NM9A 3S46A 1ZFJA 4O19A 3O3RA 1WKDA 2C3ZA 4ERAA 1J9YA 1M41A 1LOQA 2VL4A 3BLLA 1SW0A 1KV8A 1O12A 2AMGA 3XISA 3GG1A 3ID7A 2WSPA 3SGUA 5I3JA 4LQ1A 4ZBCA 1BPLB 5D33A 2QIIA 2E67A 5CPMA 3HOJA 2E8YA 2PPGA 2E6AA 3N19B 4C6MA 4FLQA 3G1HA 4TX9A 6A3HA 3AWOA 3CV6A 4MYAA 3VI2A 1HZYA 1QFEA 1OFRA 2Z0IA 4JS3A 1HKMA 3FFSA 4D6DA 2BOEX 3QM3A 4RZ4A 5K4XA 1QW9A 3EDDA 1AQHA 3W02A 3BQ5A 4Y7EA 4XSLA 3UZXA 2W4XA 3ZT5A 4HJWA 2H9AA 3KCJA 5DMMA 2ASHA 3Q45A 3AHXA 5MKGB 3DIPA 2WC3A 3VFLA 1G4TA 3W82A 3UY7A 2XYLA 4GBDA 3CQJA 3GU1A 2PWGA 2ZDSA 3CPRA 4PMRA 4NX0A 1DVJA 2PTYA 3WQVA 5CBIA 2JKAA 4JICA 4PBGA 1SW3A 2YB4A 1U1UA 3L9CA 1EJUC 1LYXA 4Q8QA 2ZYFA 3KBJA 4PCFA 2BXZA 3QV7A 2VEPA 3T0BA 1KKOA 3V36A 4PUNA 2IKGA 2GJXB 2DJXA 3U7BA 2P0IA 4GACA 2VFFA 1O66A 1Q7QA 1BGGA 2ACRA 1Y8BA 1VAHA 1VIZA 3GTIA 3C3NA 2DT1A 2PDNA 4XD5A 5XIAA 2AL2A 3QEZA 3WBWA 1OX4A 3NL3A 4H1ZA 3SCRA 1S1PA 1PIIA 5AYIA 2EPNA 4MWAC 2BS9A 1TJRA 5K7JA 4CNNA 3N2TA 5FEZA 2XUCA 4PYSA 4ZO9A 3PSWA 3SCTA 3MUIA 4XAFA 3ZOAA 4GCAA 2W66A 2YCLB 4ZOEA 2ZVIA 1H7OA 4JXCA 4LAZA 4JY8A 4M81A 3EOUA 2ZZ3A 1A5OC 3CHFA 3S9YA 4C90A 3U5YA 1EA9C 2TPSA 1GZJA 2V2HA 3A6OA 3LGEA 3WKZA 4FA3A 3H2EA 1S3HA 3AIVA 3I3BA 3QLDA 4C7GA 1D8WA 5DFAA 3VXGA 2WCAA 4HIBA 1UA3A 2X1TA 3LLXA 3EWUA 4LVDA 5BNKA 4X9YA 4N7QA 3NA8A 2E28A 3W7OA 4OV9A 3OA3A 5D8ZA 1CXEA 3H24A 3H7RA 1B2YA 3AMGA 4EP8C 5I3DA 1V93A 3WLMA 3QZAA 1W5NA 1FUYA 3GHSA 4RL3A 3MCNA 1QMLA 3QJAA 5HWMA 1Q8JA 4WOQA 1V7AA 4ATLA 4TQTA 1QU4A 1EDGA 4I8DA 3WQCA 1O1ZA 1V6TA 4JKMA 1PB0A 5U4NA 1RLDA 3R58A 3PWIA 3S6DA 1BF2A 4XD4A 3RCYA 1AJ2A 3MMTA 1UOZA 3WLPA 2R6OA 3ZJKA 1ZTVA 3NGFA 1XSJA 2PE4A 4OGZA 3NYZA 4DB7A 3HG3A 4NZ5A 4O57A 1DIDA 1CZ1A 4ZQMA 2WCGA 3MJMA 3UGVA 1D3HA 1IHIA 2G96A 3VKCA 1I2PA 1NF0A 1OCJA 3O6AA 3T0AA 3V0TA 2D69A 1HL9A 3QTGA 1BKHA 2ZE3A 1DE6A 1O6IA 3M6YA 4RZ6A 2QJJA 4HMDA 3B0VC 3S2JA 4W8AA 4W8LA 5C6MA 2J6VA 4GYFA 1V6VA 1B0IA 4WKAA 1RCQA 1CGVA 2GZXA 4CNPA 4CQCA 5CLTA 1RBOB 2Z1KA 3IJIA 1G0CA 1CECA 3TLQA 1OC5A 2EKCA 2QCHA 4OOUA 3L21A 1PX3A 3RILA 1TSIA 4NZJA 3GHRA 5EBAA 2FTYA 3WDHA 1XLFA 5LIXX 1DP0A 1TVPA 1J12A 4AY7A 1REQB 3E1F1 4ZB2A 4F3HA 3D6NA 4HNLA 5AHEA 4GE8A 8RUCA 1KBKA 1BHGA 1MUCA 4DO6A 4P7RA 3TYBA 4JY9A 1EOKA 2JKEA 2J7HA 3H7VA 2CKSA 3C5QA 3MA8A 1J6OA 2PS2A 2IQTA 1GEQA 4MTVA 2IS7A 1GGOA 3ZO9A 3EX4A 3FJ6A 1DWFM 2EPHA 1DEDA 1K7XA 2I9UA 2GGHA 1YTKA 4S23A 4ASTA 5J04A 4CQ9A 3W29A 4N6EA 2V3GA 4CU6A 1OX5A 1QO5A 3IIZA 1S2TA 3QYQA 4ZL1A 1ITUA 4QX4A 3N34A 2G3NA 3ARPA 1ZBVA 1GOWA 1OCQA 1F9CA 3K13A 4HK5A 4MNMA 2FZMA 5KZ6A 4JN7A 1Q6EA 3BAJA 4DM1A 1V6WA 4J35A 2JF6A 3MSGA 1AMYA 1VFSA 4AEOA 4ICCX 1XLDA 1V8EA 4WCJA 4QDPA 5I23A 1E4MM 4HNOA 3M44A 3OZOA 3WF1A 4R5EA 5KEZA 3R11A 3F5LA 1HF6A 3C8FA 3VO0A 2FH6A 3VDCA 1ITXA 2BVWA 2PP3A 2ISDA 4HK6A 1FH9A 3MDUA 4JNMA 1GVYA 5ABFB 2YCIX 1GTEA 2NQ5A 1A5LC 2WCSA 1QNPA 1XF0A 3WBAA 2E5CA 4XVDA 5CCZA 1YNPA 4MADA 1JQVA 4QEEA 3ICJA 3GHTA 4OT7A 3TR9A 4GIYA 1XC6A 3CMGA 3RU8X 1EZWA 1UR8A 3NM1A 4REQB 3VCCA 1UJQA 2AGKA 3WD1A 1CXHA 4JTKA 1WKYA 3GNNA 1PX4A 4R88A 3TH6A 4H8UA 5H8MA 4XWUA 3DYPA 5BCAA 3KBNA 4Q6JA 4IMGA 2PTWA 2RDTA 4P7LA 3W4RA 3DHDA 3C0LA 4FP1A 1LWHA 3NPXA 4QDMA 2F84A 1DYSA 2QAPA 4DJFD 1X6UA 3W2KA 3PS7A 4IICA 1YDNA 4M56A 5G4EA 4J2PA 3B9NA 1CBGA 2B7QA 4PSRA 4S3GA 3W7DA 3QRHA 1B30A