4L4RA

Structural characterisation of the apo-form of human lactate dehydrogenase m isozyme
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
331
structure length
331
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Structural characterization of the apo form and NADH binary complex of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 118
structure length 331
sequence length 331
chains with identical sequence H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4l4rA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4l4rA02
3HQ4O 4ZRNA 4FBGA 4FS3A 1R0KA 4XIYA 1CETA 4WNCA 4J3FA 1PJ4A 5IDXA 2FZWA 5JCJA 1I3NA 2NVWA 1ISHA 3JYQA 3I1JA 2WMDA 1YRLA 1C1XB 4AJIA 4LVUA 4BNTA 2DFVA 4UUOA 2EGGA 3H2ZA 3Q6IA 4IM7A 5A9RA 3UCFA 1UXHA 3GZ4A 3WJ7A 1GYPA 4EUHA 2BMAA 3H9QA 3NT4A 5LDGA 1A5ZA 3JQDA 4AJ4A 1R4MA 3L77A 3RUIA 3UFXA 3DZFA 2F1KA 4BNZA 3T7EA 3ZV4A 1P1JA 3PWZA 4DWVA 1ZK4A 1UXJA 1QSGA 4R1UA 4XR4A 4NFYA 3E5RA 3W1VA 4DRYA 2IE0A 3H5RA 1HYEA 4PVCA 1XGKA 2DC1A 5KJFA 1NM5A 3JV7A 4XYLA 4ESOA 1SMKA 1P31A 2PD6A 4MVJH 1DHRA 2PR2A 2QQ5A 3DO5A 3ZZNA 4PLHA 4YTEA 4XIJA 4CM1A 4XX0A 3KYDB 4N5LA 3OJFA 2J3HA 5EPOA 3W8FA 1EUCA 1O89A 3I9KA 5TIIA 3WGTA 1JW9B 3U49A 1Y9EA 2VCYA 4OSPA 5GZ3A 5JAZA 1BVUA 4JJGA 4UEJA 2Y99A 1KETA 3ENKA 3GEDA 3ZW8A 4J7XA 2HRBA 2BI7A 4CLRB 1HZZA 2DAPA 2DT5A 2ZTLA 4ND4A 2ZTMA 3FBGA 1LSJA 5A04A 5DULA 1PS8A 4FSHA 4CL3A 3TL2A 1N7HA 3QIVA 3OIFA 5LCXA 3LQFA 1LRJA 4JROA 1KEPA 1NP3A 2I99A 4ND1A 3IMFA 1ID1A 3DQPA 3ZDFA 2Z95A 1ADBA 4PZCA 1VLLA 2O7QA 3R1IA 1BDBA 4N5NA 1VL6A 2GGSA 2TMDA 2W4QA 3B1JA 5BT9A 4IUYA 1DEHA 1I33A 4YJGA 5GZ6A 1K0UA 1UXGA 3H9EO 3OH8A 4PG4A 3GMSA 1X0VA 3PIDA 1PL7A 3VZPA 3DTYA 4HWKA 1KC1A 4YJFA 1VJ0A 5TQVA 1WWKA 2GNAA 3EYWA 5EERA 3GFGA 1WAMA 4BS9A 5ITVA 1WDMA 4BKQA 3F4BA 3HADA 1YBAA 1N8KA 3T4XA 2IZ1A 4MIEA 4D7AA 3GLQA 3TZHA 3ZGYA 4IDBA 3VH2A 3ZHYA 3MEQA 3CZRA 2C2YA 2NQTA 2POQX 3LLSA 1JU9A 2BGMA 1DFGA 2Q2WA 3RU7A 1PL6A 1ONPA 2RH8A 4J2OA 5T8KA 3BIOA 1HTBA 2PH5A 1BVRA 3OJOA 4BQPA 3GVCA 2BF7A 4OO3A 2VT2A 3GH3A 4PIVA 3GVHA 1ENYA 4J7CA 5CDYA 3TQHA 1M66A 4WLEA 2O2SA 4E2WA 1N5DA 2A4KA 2YV1A 4L75A 1DHTA 4AJ2A 1LDYA 2P5YA 1LSUA 2GERA 1HDOA 2Q4EA 1U4SA 1EUDA 1U7HA 3FF4A 4MOWA 4A7PA 2ZCVA 2BD0A 4NFHA 2EERA 3PHLA 1HL3A 4QTZA 4R68A 1CIVA 4HADA 3AY3A 1ZZEA 3OA0A 3JTMA 5HS4A 3DWFA 4PLYA 5JO0A 4D79A 1V3TA 1DBVO 4FN4A 3QSGA 4UVDA 3NUGA 1EMDA 4TRNA 2CFCA 1V35A 5ER6A 1X14A 4S3MA 5A9SB 5IJZA 3M1LA 3TFOA 3GA0A 2YFQA 1V9LA 2OL4A 4W6ZA 4BKRA 1I2BA 4FFLA 4Y67A 1FF9A 1KOLA 1VJTA 3X2FA 3ZWMA 1O6ZA 3JQ8A 1BXGB 3GDFA 4NJOA 2WM3A 1GYQA 4U6SA 2P91A 3VZSA 1LLQA 2YW9A 5THQA 2Y0EA 5JBIA 1DFIA 1O5IA 2EG9A 1HDXA 3ANMA 1M2WA 2ZQZA 3R3SA 4IJVA 4MKZA 4RF5A 5ILGA 1GL3A 3QW2A 2X6TA 4I5FA 4A26A 5A1TA 4U6QA 1NFFA 3RVDA 3IUSA 3PHGA 5AQ1A 3NDRA 1L1FA 2G82A 5GY7A 1RWBA 4ITUA 1B16A 2Y1DA 4IQGA 4XB1A 3PFWO 3ETDA 5AYVA 1P1KA 2VRCA 1E7QA 4ALIA 5JC1A 4LSWA 4NJMA 5L45A 4NQZA 4FDAA 1I36A 3JQGA 3AJRA 1HE3A 5IG2A 1ZUD1 1RYDA 3SJUA 3PDUA 1NVMB 3DAPA 4DBZA 1SAYA 2YHUA 4CM6A 5LDHA 1D7OA 2X5OA 1FDTA 1EDOA 1IPFA 1QP8A 2ZB7A 3DFZA 4KTVE 4RQTA 4JX8A 4GL4A 2CVOA 2ZYDA 3WYEA 1FDSA 2FR1A 2GN9A 4W7IA 3FPLA 3AUSA 3FI9A 4CUZA 3H5NA 4GH5A 3OQ6A 4ZQFA 1LXCA 4FOSA 3ZV6A 4QSMA 2W8ZA 4J1NA 2GSDA 1ZK1A 3BMCB 2JAPA 1X15A 2QIOA 3GC6A 1P77A 4YBZA 3ZI0A 3O03A 2O3QA 1BSVA 2NLOA 3I6IA 2Y0CA 1PGNA 5B4TA 3FNEA 4B4WA 4Q3BA 4J4BA 3G1UA 3CH6A 5TNXA 2C54A 4NBWA 3KHUA 5A9TA 2PTGA 2PZKA 3RFXA 2X1HA 4M55A 4MP6A 3FCOA 4XCVA 1R4NA 1A72A 4ZQBA 4KOAA 4JBHA 4RPLA 3QLJA 5IAAA 2OMEA 2DBQA 3U4DA 4RJTA 3ZHXA 3HB4X 1KC3A 1J49A 1XHLA 4IGFA 3RC7A 3WGOA 3GHYA 3WMXA 4C4OA 1GUYA 4RO0A 1EFLA 4HFRA 1JN0A 2EIHA 5KWEA 1PZGA 4IBOA 1E7RA 3Q2KA 4FC6A 1I3KA 5CPFA 1TA4A 3JQAB 4WCFB 3ZU5A 2YDYA 5L4NA 4ZHSA 3IC5A 4K1LA 3LF1A 4CV3A 5JXWA 2VHYA 3D3WB 4NK5A 1DC4A 3WQRA 4PG6A 5C7LO 4DIOA 3UOGA 5B4UA 4GLLA 5EMHA 3QVTA 4NH4A 3IJRA 3LF2A 5AXBA 4C7KA 1Y81A 4CMHA 3JYPA 3EVTA 3UCEA 2Y1GA 3ETEA 4IINA 4QFDA 5I7VA 4TWRA 4J16A 1KEWA 2B5VA 3C24A 5F3RA 1J4AA 3AOEC 3G79A 2PK3A 5KVQA 3OM9A 5CEJA 5K9ZA 5AOVA 4XDZA 2Q1TA 2BELA 1T2FA 1P3DA 1P0FA 4JXKA 2VWGA 2Q99A 1YQXA 5A02A 3HDHA 3HN7A 4BGUA 3S55A 1G0NA 4R9SA 1E5LA 4E31A 4CODB 2PH3A 4NK4A 5JS6A 3PPIA 3O8QB 3W4KA 1CERA 1F12A 1EQUA 5A03A 3FNFA 3PJEA 4LRTB 3L0DA 5BSHA 4HBGA 5KNLA 1Q2XA 3GAFA 4YJHA 3B6ZA 1GYRA 3D4PA 2VYVA 4CMIA 1R15A 2AQ8A 4IMPA 1Y5MA 4S1VA 3RBZA 1Z6ZA 1H93A 1JA9A 4E3ZA 5G2OA 2LDXA 4GBJA 4CL8A 4NFSA 3QV1A 5TF4A 1E7MA 1GADO 2JD1A 3DTTA 1ISJA 4ZQEA 1C0IA 1E3JA 1E1KA 2W2KA 2LDBA 5JMPA 2B35A 4O59O 5U1PA 1U2DA 3DBRB 3HWRA 5ENVA 2WYWA 1JKIA 2PZMA 4EI2A 5IZ4A 3B70A 2I6TA 1YJ8A 2X86A 4NDNE 3AFMA 2C5EA 2FZEA 5JAIA 2V6BA 1ZW1A 1HE5A 2Y66A 4JBIA 5I7FA 5COQA 4EBFA 2Q3EA 3TL3A 1QYVA 2A92A 4CM7A 1TB4A 4BVAA 4D45A 3RC9A 4RQUA 3ZNOA 4GKBA 2DPHA 2P4HX 4EW6A 4BOYA 4B7XA 2Q1SA 1Y8QA 1NBOA 1BW9B 2ZTUA 5BR7A 3TZQA 3DL2A 1ADCA 3BTOA 3O9ZA 1LDEA 5L51A 1EE9A 4J1TA 1H94A 5AXCA 4XQGA 1H6DA 2Q1WA 5L7YA 4GAEA 4BO8A 5L40A 3PQEA 4OKNA 4WNIA 2HK7A 1P74A 3GHHA 3GPDG 2I3GA 4E6PA 3W6ZA 4B8WA 4WE3A 1OMOA 3ZWVA 2X0JA 2YDXA 1WZEA 2GDZA 4HUJA 3ZH2A 4Q39A 2AA3A 4EYEA 1E7SA 3PGXA 1BXZA 1SEVA 4IDEA 4IJKA 2C7VA 2BGKA 4M87A 3C3XA 4CLXA 3CPSA 4F6LA 3TF5A 2NNLD 4CLHA 4Z9FA 3D0OA 3JQ9A 4PZDA 1QORA 3PIIA 5BNTA 1HYGA 1Y9AA 4A5OA 3OBBA 4NBRA 4B3JA 4Z6KA 2YJZA 4GMFA 1BWSA 3BAZA 1C1DB 3CEAA 1ZFNA 4WASA 1AGNA 1I10A 4R9RA 4YPOA 3DR3A 1HE4A 1PJLA 1YB5A 3FTPA 4RDHA 3BHIA 3WIEA 2ZYGA 3DZGA 3WFIA 4IIUA 3HDJA 2O4UX 3ZWBA 4RVHA 1U3WA 3N74A 1ADFA 2EJVA 1FK8A 3G1TA 5TRTA 2C20A 5IFLA 3JYLA 4A10A 4NR0A 4P8RA 3SC6A 4PRKA 1LDMA 3PJDA 2OZPA 4GGPA 5KVVA 3KUXA 3WTCA 3O4RA 4HY3A 5FI5A 3S1LA 2D8AA 1G6KA 1NPYA 3RI3A 1B3RA 1LNQA 3AFNA 2BHLA 2YZ7A 4XDYA 2WTBA 5IZCA 2AHRA 3DBHA 3WFJA 4CM5A 1KBZA 2JL1A 3TZKA 1DFHA 2HCTA 4YCAA 4D41A 4QEDA 2FRDA 4MDHA 4J1SA 4L9RA 3AUAA 2I9PA 2UVDA 1B8PA 2X58A 1JAYA 3ZHBA 1G0OA 1N9GB 1LEHA 2CF5A 3WICA 4O63O 3PLNA 2PD3A 5DOVA 3IL2A 3WB9A 4NPCA 5CDSA 4CMCA 2ZB8A 4CMJA 1LLDA 3H9JA 1V3UA 4LMRA 1B8UA 1P1RA 4G5HA 1A4UA 2P2SA 5A4DA 4IY1A 1N7GA 1QLJA 1VJ1A 4WOKA 2RBEA 1OZAA 4OH1A 2P4QA 3MJSA 5G4KB 4HNHA 3JQ7A 3FRJA 2PLAA 3GVXA 1GU7A 4BNNA 4DLAA 4EITA 1V3VA 4EUFA 4AJPA 3QY9A 2AW5A 4CM4A 1A4IA 4NI5A 5C7OO 3AI3A 5IF3A 4RZIA 4H15A 5CPBA 2PKQP 2X0RA 4IXWA 2X0NA 4RV9A 1IHYA 5G0SA 4J4TA 1PR3A 1XG5A 3JD0A 4Y9DA 4KWIA 1NVGA 1FJHA 2FHSA 3WWYA 1E5QA 2X22A 3JQAD 3UUWA 3NV9A 1HT0A 5ADHA 2PKRA 1IL0A 3ROMA 1E3WB 3FTNA 5C7IO 4A27A 5THKA 3DZHA 1PIWA 2PD4A 3QVWA 3KEOA 1DJNA 3CINA 2AEJA 4F3YA 5CHEA 4IS3A 2AQKA 4XYBA 4UEOA 3D5TA 4AL4A 4CM9D 5B1YA 5I7SA 2C0CA 1XWFA 4RVSA 4GX2A 1VE9A 2NTJA 1XA0A 1QLHA 3GDOA 4H16A 1B15A 3VAZA 2BFPA 1BG6A 1GCOA 1H0KA 3VPFA 5KVCA 1O9BA 1QV7A 4INAA 4MVJG 2BFMA 1V0JA 2IDZA 3F1LA 3PWKA 4G65A 4IQ8A 1PR9A 4YAKA 5IXYA 5H83A 4BNVA 3DC2A 3DFUA 4O1MA 1A9YA 4QFCA 4UVGA 4M1QA 4DPKA 4CLDA 4H3VA 4IDGA 1F17A 4OHUA 3SBOA 4BB5A 5MGBA 1T26A 4JLWA 1ZSYA 1LQTA 3LC1O 2J3IA 2PGJA 4TRJA 1LSOA 3I9OA 1LBEA 3QWFA 3JQEA 5CFZA 1GZ6A 1TLTA 4P4NA 3I3OA 2B36A 4CQMA 4EJ0A 1SB8A 3VH3A 3RFTA 3RUCA 4JJIA 4OMUA 4R54A 2O3JA 3STHA 4PG8A 1IULA 5TLSA 1ENPA 3LT2A 4BNIA 1PJSA 1RKXA 1ZK2A 4XRGA 4BNJA 5KOIA 2EKPA 1NWCA 4PLFA 1NQTA 3PDJA 3LC2O 4JK3A 1WPQA 2QYSA 1IYZA 1BXKA 3F1KA 2FPGA 3KYCA 4XKJA 4BO6A 2DTEA 2RHCA 3Q2IA 2X5KO 2VZ9A 1ZSVA 1ZSNA 3DBLA 4E33A 1KVUA 3M6IA 3C85A 3NTQA 3E18A 1PU2A 2OOSA 4P38A 4LRSB 1U9JA 4TMFA 3GUYA 3WGHA 4CUJA 3RSHA 3ULKA 3RU9A 3WNQA 5JDIC 4E2YA 1AUPA 5DBFA 4BNHA 1PGOA 4W9NC 4ZVVA 2H9IA 4Z3DA 3GZNA 3D5QA 4ALMA 3L9WA 5L53A 1PGPA 1HE2A 4DQXA 2BGLA 3RQSA 4TRMA 3RBVA 3F46A 1JVBA 1Y1PA 2HDHA 2GF2A 2GZ3A 4RPJA 3PI7A 4J9UE 1KEUA 5JCXA 1T25A 5BSEA 2ET6A 3U0BA 2CSUA 1J6UA 1Q7BA 1Q1NA 2PFGA 2P9GA 4D43A 1NASA 1BTOA 1U5CA 1QYWA 4RF2A 3I5MA 4L4XA 1PQWA 2I3AA 2E49A 2VHXA 5L4SA 3DZBA 2VZ8A 1E77A 3OFSA 3PEFA 2DQ4A 4LSMA 3PYLA 3DMTC 1YBMA 3DOJA 1PL8A 2VOEA 4FIZA 3R3JA 4R1SA 4N18A 4CM8B 3WGGA 4B4OA 5CDTA 3EHEA 4AJOA 2Y1CA 3K2BA 5LC1A 5I9LA 5G0VA 1GUFA 4R1NA 4J43A 4J7UA 3HE3A 3WQQA 3K2EA 4MVJD 5KJEA 4Z3KA 1P1HA 5B37A 1C14A 4BO4A 4I8XA 1HEUA 2X4GA 4FJ2A 3V2UA 1D3AA 3PZRA 4G81A 3TJRA 3SX2A 4CMEA 1LDGA 5JMWA 1W4ZA 3F6YA 2QZ9A 1YBVA 3H9UA 1I0ZA 2ZIZA 2Y68A 5JNLA 1MB4A 4OYRA 4RCVA 2CD9A 2QX7A 3KM0A 1LLCA 3IIEA 5JY6A 4DIBA 3PGJA 4NZ9A 5F1KA 3ROQA 4E5YA 2AQIA 1YWGO 5H81A 4YJFB 4FD3A 4LCJA 3QQPA 5T67A 4CV2A 3L4SO 1PWZA 1DXYA 3JQ9C 2P68A 1UZNA 4YQYA 4Z9YA 1QMGA 4FGWA 3UCXA 4A0SA 1VC2A 2NM0A 3LDHA 3DB2A 4WLOA 5T6BA 4HV4A 2PKQO 3SXPA 1ZO8A 2GN8A 2G1UA 1LDNA 4EJMA 4F46A 4GGOA 3B1KA 4GLOA 4KDEA 1U1IA 2WEKA 3L4BC 4U8GA 2QZZA 2PA3A 4DC0A 5HTOA 4BL5A 1T2EA 4GQAA 2VWPA 1NAHA 1DIHA 3VH4A 1LRKA 3PHIA 4RVGA 3P7MA 2BKAA 2BLLA 3E5MA 2NU9A 1HLDA 1LRLA 3I9MA 4NIMA 4GX0A 4E0BA 1TEHA 1E6UA 4UVEA 5H82A 3COSA 1MFZA 1WXDA 2IYOA 1GQYA 1KVQA 3EDMA 4CMAA 3GG9A 4CMGA 4IDAA 4B7CA 3DZKA 3JSAA 4XWYA 1N92A 3FNHA 4KQXA 1E1NA 4YAJA 3KYDA 3HFGA 3RCBA 5JYEA 1UP4A 3HN2A 5KJ6A 1Z74A 3F5QA 3TZ6A 1RM5A 2O50A 2W2LD 4OQYA 1B8VA 1T2DA 1DAOA 3AI2A 4D0SA 3OQBA 3DEYX 3WTBA 3KV3O 3OP4A 3VVBA 5IZCC 1JTVA 4JP2A 3BTUA 3SLKA 4HNGA 3N58A 1Q0QA 3RASA 4ALKA 3H6KA 4CLRA 2NTNA 4PRLA 4P4LA 1NR1A 4QX6A 2B37A 1FDWA 2CDBA 3P2OA 2Q46A 3HDYA 2OBYA 2HMTA 1MP0A 1ZK0A 5DP2A 1C0PA 4B7UA 5DCYA 1AE1A 2Y1FA 4FFRA 4I9HA 3EZYA 2Y1OA 3GGPA 4DMMA 2FSSA 2VUSA 1GV1A 3UN1A 1V8BA 4EDFA 2NU8A 1IZ9A 2UAGA 5JSFA 1O8CA 1ISMA 2D0IA 3C1OA 4YEDA 3WSWA 3WDSA 1ZVMA 3VKVA 4CPDA 1LA2A 1PQPA 4CV1A 1IUKA 3FWZA 7MDHA 1YOVB 5DCWA 1D8AA 1CRWG 1GR0A 3QWBA 5DCUA 3JQFA 4DTIA 4YT8A 1X1TA 1ZMOA 1Y8RA 4E32A 2DUWA 2J8ZA 1R37A 2XAAA 3IAHA 2P9EA 3CSDA 4WJZA 2ZYAA 1DIBA 2JCYA 1D1SA 1GDHA 2YHIA 1DSSG 3JQBA 1T4DA 1JDJA 3LK7A 1NPDA 3KEQA 4EZBA 5T64A 1NHWA 4Y8VA 2D4AA 4W7HA 1YQGA 1V6AA 1K6XA 3JQGB 3K73O 3KETA 5IN4A 1T24A 4EUEA 5K0ZA 1JVSA 1CDOA 2QRKA 1DJQA 3BYZA 4PFJA 4AJNA 5EQDA 4E2XA 3H8VA 4XYGA 2E4AA 3D4NA 3S2IA 5DF1A 1LC0A 3U4HA 3BA1A 5CDGA 5GZ1A 2WDZA 3DHEA 1I2ZA 4IMRA 3D4OA 2HMWA 1Z7BA 5K6AA 4XYMA 4DXHA 5EQFA 2B4RO 2VN8A 3HNPA 5EL0A 4OGWA 5DDIP 1KVTA 4IS2A 5JYDA 4L4RA 3LYLA 5CG2A 3AY6A 1OFGA 1HETA 3I6QA 5IDQA 3KOUA 4MVJI 1WP4A 2H6EA 4ZRMA 4NG5A 4BHTA 1PSDA 2P9CA 3ZWXA 3UGKA 3QVSA 5F5LA 1B2LA 5FF9A 4A73A 2IODA 3ICCA 2D3TA 4H7PA 2BRUA 1VRWA 2FOIA 2IXAA 3H9GA 3EAGA 3PHJA 2QW8A 3FN4A 2OHXA 5JDCC 2V7PA 3CE6A 1A27A 3NTRA 1PX0A 5BNFA 3O26A 3KVOA 4NNJA 3UICA 2XXBA 5L9AA 3W8DA 1WDLA 3NRCA 2JAHA 2Q4BA 3ROKA 3KBOA 3OA2A 1U8XX 4CR7A 1P1FA 1P44A 3BMNB 1EEHA 1XU9A 4Q3EA 3OJLA 1UUFA 5EESA 1QYDA 3GNQA 2BI8A 3TWOA 1BGVA 1W6UA 2E6UX 4KDFA 3L6EA 4AJKA 1AXEA 4RORA 4YRDA 2FPIA 4FCCA 4FB5A 2WD8A 5J23A 1B0AA 4B4VA 1PJ3A 1NTOA 2OORA 2VHVA 1ORRA 4Z0PA 2W98A 2CVQA 4CJXA 3WG9A 3QWIA 3I4CA 3OJEA 1ULSA 4NBTA 3HSKA 3D1LA 2ZB4A 4J2HA 1HDCA 5MDHA 1VL0A 2QHXA 5EINA 1SOVA 5JPIA 2XPCA 3ASVA 3BHMA 3PJFA 1F8FA 1NQ5A 4YJHB 3VZRA 4LW8A 1H2BA 5BSFA 1LLUA 5IDWA 2R00A 4RF3A 3QWAA 3V5NA 2GN6A 1HSOA 1OC2A 3H3FA 5G0TA 1U3UA 1YS4A 2NADA 3I4FA 1SC6A 1AHIA 2UV8A 2DPGA 5G0WA 9LDTA 5JO9A 4DLBA 3JYOA 1Q7GA 1OOEA 1QXSA 1LQUA 2HAEA 2E37A 2W90A 5COBA 2O48X 1LI4A 4QXMA 3M2PA 4Z9XA 5HA5A 2D1YA 3T4EA 4K26A 4MIOA 2PGLA 2WYVA 4W4TA 3FSRA 4DYDA 4L8VA 1GPDG 1ZKMA 2HSDA 4CMKA 4XGKA 5F1PA 1XEAA 3EK2A 3OMLA 3NJ4A 3WMWA 4OSOA 4OKIA 3JD4A 5A3JA 1NQAO 3B20A 2YFHA 2YUTA 1NFQA 3H5AA 4M89A 5A05A 4CR6A 1HWYA 3ZWAA 4BO1A 1W0CA 3MCVA 3P2YA 3TPCA 3I9JA 1OC4A 3PHHA 2EJWA 3NYWA 5KTKA 3GNSA 3CZMA 3G0OA 1K2WA 4XGIA 3P5SA 5L3ZA 1I32A 4R01A 2C59A 1TT5A 2TMGA 4R1TA 2EKQA 2A35A 4PN3A 1GQ2A 5L95A 1Z75A 4IDCA 3OIGA 3WXBA 3AUTA 2FY8A 5FI3A 3AUUA 4PLGA 4CM9A 1BRMA 1I01A 1GEGA 4IZHA 1H6BA 4EGFA 1R16A 4JCOA 4XJTA 2EHDA 2QRLA 4Q3CA 1RJWA 1UP6A 3WX0A 4D0RA 1OI7A 5CEFA 2HUNA 3DHNA 3EVNA 1GEEA 3ZN2A 2Q2VA 4A2CA 1HZJA 1KVSA 1UP7A 8LDHA 4EJ6A 2NVUA 4I08A 1JWAB 4Y6PA 1EE2A 1SNYA 5A3VA 1LX6A 5GMOA 1AHHA 1UH5A 4LISA 3ZWYA 4Y98A 1DIAA 2H5LA 4UUNA 1YDWA 4L76A 3T7CA 3WBFA 3INGA 5C37A 4MIYA 3BTSA 1WZIA 2J3JA 2GD1O 2GZ1A 4FFOA 4ID9A 4RVUA 2BFAA 3PQDA 4QT0A 3ANLA 4TSKA 5F21A 1ZXBA 2GYYA 3EUWA 4KTTE 4KZPA 3ZV3A 1UDCA 3QVOA 3G17A 3DBRA 3QWHA 1CEQA 1R6DA 4IXTA 3TOXA 3GG2A 2X5JO 3IP3A 2J6IA 2G0TA 1ENOA 4TVOA 1JLLA 2YV2A 3ZV5A 4ALNA 3MJCA 5DN9A 1JWBB 4IJUA 5T8KC 4JP3A 1NAIA 1DAPA 2EP5A 5G0UA 3SJ7A 4L4SA 3NEPX 2GASA 3LT4A 5ES3A 3MOIA 3FWNA 5JE8A 2CMDA 3DBHB 1NWHA 2JFGA 3UF0A 1GTMA 4LGVA 1XKQA 5KJ1A 2AEFA 2Y93A 3NDJA 3HB5X 2QG4A 1BW9A 1D1TA 4XJSA 1N1EA 4ND5A 2HRZA 4YACA 4WKGA 4CUKA 3JQFC 4WGGA 3WYCA 3AK4A 2YQ4A 5ITWA 2X0IA 2WD7A 2J3KA 3WGIA 3C1TA 4YXFA 2QYTA 3JQBC 4P4GA 4D42A 1PJ2A 1CWUA 9LDBA 6LDHA 1YDEA 3BMQA 5C3MA 1PWXA 5U9CA 4GVXA 1DPGA 4TVBA 2HK8A 3FHLA 4FW8A 4M8SA 4BV9A 3DZIA 3WJAA 3CMMA 1GZ4A 2O7SA 3PK0A 1EQ2A 1H6CA 2G5CA 1S6YA 1UXKA 3GVIA 3NAQA 4DIFA 1PS0A 3D3EA 3AWDA 1QG6A 2EWMA 3W8EA 3EC7A 5TS3A 3GF4A 1P1IA 1PJTA 2HO5A 4J4HA 4E4YA 1C3VA 1B26A 2HQ1A 3RFVA 4AJEA 4BV8A 4BNYA 3GMDA 5F5NA 3NGXA 1N2SA 3KXDA 1C1DA 3LSYA 2AG8A 4AJJA 4P22A 2RH4A 4TZTA 4TQGA 4Z0TA 5TT1A 1ULUA 2VNAA 1C0KA 1EBFA 4MP3A 1XCBA 4OQZA 4R16A 3RKRA 4AFNA 2FR0A 4RLSA 2Y1EA 2CF6A 2BH9A 4NBUA 4PZEA 4W82A 3H2SA 1WW8A 3RKUA 2VYND 5IDYA 4K6CA 2B0JA 2X7HA 4IPTA 2VZ0A 1M76A 4G2NA 3BMOA 4R5MA 2IZZA 2WYUA 4WEOA 3ENNA 1BHSA 5DT9A 1MUUA 2Q50A 1QV6A 1K6IA 4O5OA 4D3DA 2J5RA 1L7EA 1U3VA 3A06A 3C7CB 2YV3A 3UW3A 3MJEA 4L73A 2P5UA 1KY4A 3U09A 2NU7A 2VHZA 4M49A 1N9GA 3ONEA 3RJ5A 5IXSA 1KVRA 2RAFA 4TRRA 4FC7A 4J0FA 6ADHA 3PZBA 4NMHA 1VPDA 4ZICA 5ICSA 2ZCUA 4BNWA 4JGBA 3OECA 3UKOA 3CTMA 3D7LA 1OAAA 1E3EA 4AJLA 1MX3A 4CQMB 5U4QA 2RHRA 3DBVO 1NHGA 2NQ8A 3DOCA 1D4FA 1ZEJA 5G4KA 3V2HA 3VKUA 2FP4A 5DZSA 1X0XA 3V1TC 3IP1A 1X7DA 3S8MA 1H2HA 1KIFA 4DUPA 4R69A 2JCXA 2W2LA 4PVDA 4UVIA 3JYNA 4OJNA 3FR7A 4UVHA 4CQLA 4BNFA 4Q3AA 3G3EA 1MG0A 2Y67A 4I1IA 4YAEA 2ZB3A 4D3SA 3TOZA 4KWHA 1DOHA 1PJCA 4RPKA 3E82A 4YT5A 4ZU3A 4RZHA 3VOSA 1WDKA 1GCUA 2VTDA 3ONFA 3K9QO 2Q2QA 3EMKA 2R00C 3B1FA 1UZMA 3LLVA 1IB6A 3LT0A 4Y6RA 3RBXA 1R0LA 1PJQA 4OAQA 5G4LA 5IN5A 3VPGA 3R6DA 3PJGA 4RPGA 4GX5A 2R2GA 1ZK3A 5TGDA 3LC7O 1BMDA 1GQQA 4J6FA 4WLUA 2IEDA 3HDQA 3WS7A 1T4BA 4XB2A 1F8GA 1R66A 3I52A 4WOJA 3WGZA 2DKNA 4ZD6A 1CQIA 3TZCA 1SB9A 1EVJA 3INRA 5JW6A 1PJBA 3AM5A 3SLGA 3LT1A 4GWKA 3W6UA 4RDIA 3LZ6A 1KYQA 4XD2A 1H5QA 1R4MB 3AU8A 3CUKA 5TT0A 1K5HA 1WMBA 2DTDA 2CZCA 4FR5A 2EXXA 3GRPA 4YAGA 2IZ0A 2DVMA 2C07A 1E7YA 3BZUA 1H6AA 3VPXA 1YGYA 3NDIA 1N1GA 5ENDA 5HS6A 3ZWWA 3VTZA 4E5PA 4DL9A 3KLPX 1UDBA 2HLPA 3PWSA 3ON5A 3RJ9A 4ZN6A 3DMYA 3GVPA 4J0EA 2C29D 1UJMA 4TKLA 3F5SA 1U5AA 3L07A 1E3SA 1X1EA 2GO1A 1CJCA 4BIIA 5COAA 4JIGA 1GUZA 4YRAA 2CVZA 1ONNA 1IE3A 4TKMA 3U3XA 3IDSA 3DHYA 4UUPA 4CLOA 1EBUA 4FJ1A 3DONA 3KZVA 1VL8A 1UAYA 3ZU4A 4OXKA 3WIDA 1LDBA 3ITDA 1KERA 1HDGO 1GFSA 3S2GA 1VSUA 3OQ1A 1AXGA 4N5MA 3ZNNA 1GZ3A 3F4LA 3A1NA 4O6VA 4HFJA 5KKCA 3AOEA 4M86A 5KIAA 1J5PA 3RAJA 3EY4A 3H4VA 4UULA 4TZKA 4ZJUA 1I3LA 3F9IA 2WE8A 2GUGA 2I5PO 4XYEA 4U0KA 4RVDA 1IPEA 3VPHA 2JHFA 3LVFO 3ROPA 1DIGA 5A5FA 3VH1A 4DQVA 4J1QA 4BUCA 4YJGB 1ENZA 2D2IA 4JNKA 5EIOA 5B12A 1PS9A 4CLEA 4DGSA 1C1XA 2GCGA 2HJSA 2RIRA 4GX1A 2FSVA 4PGFA 3MZ0A 1F0YA 1PEDA 2AQHA 3ICPA 4RGBA 4PLVA 2RCYA 3K8ZA 1CQJA 2I66A 4K6FA 3S2EA 1KY5A 1E0DA 3GOHA 4OXNA 1ONOA 3CXRA 1NX6A 3Q11A 1K89A 5BSGA 4YYZA 5JLAA 2B4QA 2AXQA 4UREA 4BGIA 3L9XA 4KQWA 1O0SA 1NXQA 5ICMA 5CP8A 4J9VA 4YT4A 2R6JA 3A9WA 1ARZA 3I23A 1W73A 1EVZA 3GGGA 4NHEA 3RWBA 3UVEA 3VDQA 2JJYA 3HUDA 2O3SA 1X7GA 2C7GA 1LTHR 4CM8A 3KB6A 1ZJYA 5A5EA 1RYEA 5CDUA 3Q3CA 4GSKA 4R3WA 1Q0LA 2EW2A 2ILTA 4XEHA 3D64A 1ISGA 1Z82A 2V65A 4YDRA 3WGQA 2H63A 1XQ6A 3OJ0A 4HP8A 2ZK7A 3TN7A 3UH1A 4YRBA 4WEQA 5KVSA 4BNGA 2YYYA 4O0LA 2JD0A 3IKTA 1ADGA 3L6DA 3V1UA 2IEBA 1MC5A 3GT0A 3OSUA 3WOHA 3IUPA 3ZHZA 2G17A 3K31A 4QUKA 3TRIA 5JFOA 3E9QA 1GV0A 4FGSA 4IQ0A 1O95A 1Y8RB 2DBVO 3MWDB 2O3TA 2OUIA 1U2GA 1U28A 2YHIB 4UAGA 3AY7A 3JCZA 3WWZA 4PG7A 3UXYA 4MPDA 2EF1A 1M6HA 4BGEA 1Y6JA 1NQOA 2J5QA 1PZEA 3DDNA 3ABIA 2UUPA 1VI2A 4ZGWA 3VZQA 4YR9A 1HDZA 3ZNQA 2O3UA 1PGJA 4PG5A 1U4OA 4MJLA 1K3TA 3JQ8B 4HXYA 4EEXA 4U5QA 4XQCA 4CR8A 1P45A 3ZW9A 4FFMA 4LN1A 2GPTA 1HDRA 5AVOA 1YL6A 4RVFA 1A71A 3HJAA 1DRVA 2B4TO 2HMUA 1LU9A 3MJTA 2JFFA 5A06A 3WQSB 1VKOA 3OETA 1CF2O 4ONEA 4CQMD 1CYDA 1NPTO 2PZLA 2VOJA 3HZZA 1FDUA 1ZBQA 1K6JA 1GAEO 1ZNQO 4B3HA 1YXMA 1LSSA 2Z1MA 4NJMB 5ILOA 1MG5A 2HU2A 3VHRA 3GN1A 1DIRA 4ND3A 1P9LA 3DOOA 3A4VA 1XIVA 1BDMA 4B3IA 3GQVA 4JN6B 4BNXA 3C7DB 4D3FA 1SOWA 4A03A 2ZQYA 4IZIA 4BGVA 3VDRA 1ZCJA 4KUHA 4DMLA 1G1AA 4I5GA 3RUDA 4I5DA 4NU6A 5L7TA 4GPD1 3WLFA 3PYXA 2EW8A 2WSBA 5TJ9A 3OEYA 3Q9NA 1E6EA 4XQ9A 4ALLA 3GGOA 2NUAA 4ZQHA 3KYBA 1ML3A 1VM6A 3E03A 5DNAA 4FPXA 1YL7A 1L7DA 3ASUA 4PLTA 5JCJD 1DRWA 1TI7A 3AI1A 3JQCA 2XXJA 5JAMA 5ER9A 4B4UA 2PZJA 3F3SA 3GUCA 3PRJA 1YH3A 1M67A 3GR6A 4B79A 1YOVA 2VNSA 4YWJA 3U9LA 1AN9A 1WVGA 3JD1A 1R4NB 3FBTA 2O4CA 3HG7A 1E3IA 5EN4A 4YA6A 1HSZA 4AVYA 3MTJA 1MXHA 4ZQGA 5JY1A 1ZH8A 1MGOA 3V8BA 4WK6A 4BQRA 2PGDA 4MINA 5A9SA 4FOOA 4XRRA 4E5MA 5DBIA 3UHAA 3EW7A 2JCVA 1MXFA 2FN7A 1YQDA 2E82A 2V6FA 2NTVA 3I9LA 4JQCA 5CEEA 1E3LA 4QO8A 4DBVO 1BXGA 1NNUA 2DBZA 1Y5RA 2CUKA 4WECA 2DFDA 4URFA 4C7JA 1R12A 1HLPA 3ZNPA 1R0SA 3CMCO 3RUEA 4E2ZA 4WCDA 3RIHA 2GZ2A 1IOLA 4BKPA 5I7EA 4RF4A 3C1AA 3G49A 3RC2A 4J49A 4Q3NA 1UR5A 4PLZA 2PWZA 2VTEA 3K92A 3ADOA 2ZJ1A 3DAFA 3Q9UA 2VQ3A 1HDYA 3WR5A 1RM0A 4IIVA 4BO3A 3RUFA 2SCUA 3M2TA 3W4IA 4WPGA 1Z45A 4B8ZA 1E92A 3ZU2A 4Q3DA 1EK5A 3AU9A 1MC4A 2DTXA 1DRUA 2EP7A 1IY8A 5I8ZA 2VWQA 2O2YA 3OHSX 3PYMA 4JJFA 1DLJA 2XOXA 1FDVA 1TVEA 5KJCA 1I2CA 4GI2A 4CMIB 1SEPA 4BNMA 1C0LA 3GEMA 3V1YA 3K6JA 3ZWNA 2PV7A 3JD3A 2O3RA 2AE1A 1Y7TA 4HKTA 3BMCA 4ND2A 3GFBA 3JD2A 4BO9A 2DU8A 1WMAA 4RPHA 3GPIA 2EGHA 4BMVA 4OOFA 4BNLA 2CY0A 3ANNA 3NJ8A 4E12A 4IJWA 3BMNA 2W2KB 1TT5B 3ZWOA 3PTZA 3VPSA 1YJQA 4WLFA 4I5EA 1YO6A 3SEFA 2I76A 3QA9A 5I9NA 1OBFO 1E1MA 1QKIA 3VC7A 2VYNA 4XGNA 3ZWCA 3BXXA 4L74A 1B3BA 3KLMX 1M75A 2DBRA 3NKLA 4PLPA 4X54A 3VVCA 4F6CA 2DLDA 5B4VA 2B5WA 3GAZA 1PTJA 3AW9A 5DP1A 4E30A 3DXFA 1S7CA 4DYVA 2Y0DA 4PLCA 5L4LA 3JQAA 4WCFA 1J0XO 4CMEC 1YE3A 1P0CA 4F45A 2NVUB 3D3WA 3IJPA 1Y8QB 4CV0A 3WGYA 1QR6A 5EJ2A 3GN2A 1P33A 2FR8A 2D5CA 1DO8A 2G76A 3C8MA 1KEVA 4IGEA 3I83A 3V2GA 4MVJM 1T2CA 4FQ8A 1DC6A 4MVJF 3RC1A 2GR9A 1IZ0A 2NSDA 3LU1A 1UZLA 2ZJ0A 3AOGA 3GK3A 1RM4A 5JDIA 1EZ4A 3A28A 1NR7A 2OO5A 4QECA 4HFNA 4W9NA 3HFSA 1DLIA 2O23A 5FFFA 5TSDA 3ZCXA 5CG1A 1Z7EA 3AM3A 3RD5A 4ROSA 4DLLA 1E6WA 3OICA 1YL5A 2C2XA 4KUGA 1NFRA 3O8QA 1F06A 1A7AA 3QHAA 3WNVA 3U5TA 1HRDA 1PGQA 3IS3A 4L0QA 2B69A 1VKNA 3E1KA 4ZA2A 5AXDA 4IDFA 4K9DA 1F14A 4DPMA 5BQFA 3EZLA 5TC4A 2YY7A 2JKVA 3F47A 4MKXA 4YT2A 4OOEA 2OGUA 2AMFA 4II3A 1UXIA 3K96A 4I9UA 1XSEA 3NGLA 1U7TA 3DMTA 1PZFA 3GDGA 4LK3A 1FMCA 3GY0A 2FMUA 4LVCA 4YVFA 5TJHA 3TDKA 3I9NA 3DAGA 5TX7A 4BO7A 1GY8A 3WBBA 3SC4A 3U4CA 3WYBA 2AG5A 4FJ0A 2Z1NA 2X8LA 4OXYA 2WD7B 2OXIA 2OBNA 4UEKA 1SCUA 1EUZA 3U62A 1PZHA 2VRCD 3PXXA 4Q9NA 2HMSA 1EVYA 1X13A 2QRJA 3BMQB 5FEUA 1SBYA 3FNGA 3KSUA 4GWGA 5BNIA 1MFPA 4YAIA 1JKFA 2FWMX 4R5HA 3PQFA 1KS9A 1U3TA 1HF3A 1XU7A 2JHGA 4BKOA 3W4JA 1B14A 4NBVA 3KRTA 1M6WA 3MWEB 4ILKA 4CM3A 3INTA 1NYTA 3A14A 1JQBA 1GPJA 4QO7A 2JFHA 3QRWA 2OFPA 3GNTA 1DDOA 4XR9A 4FFNA 3ZWPA 3ETGA 3AM4A 2X9GA 5T5QA 3RUHA 1B7GO 1A7KA 2B83A 3NT2A 4LCEA 3P19A 1U8FO 5DOZA 4YB8A 4II2A 1IHXA 1NVTA 4N7RA 3E48A 3L4BA 5C5IA 3BHJA 4YJDA 2Q45A 2VT3A 4N54A 4JBGA 3H3JA 3JQ7B 4BB6A 2IYPA 4BO2A 3Q0EA 4BMNA 2GRAA 1Q0HA 4RLHA 3L6OO 1XR3A 3OF2A 5I9MA 3KSZO 3KTDA 1UDAA 3MJVA 4BO5A 4CM4B 4XZ3A 3IQDB 4MVJE 3MTGA 1UAGA 3MOGA 4DQUA 2Q1UA 4IDDA 2A9FA 2AE2A 3BMOB 4MVJP 5HM8A 2C82A 4OIMA 2EV9A 4BNKA 1ISIA 1ISFA 4DC1A 1JKJA 5K6AC 3ADPA 1EK6A 1HYHA 2IXBA 2AEMA 3QE3A 3UAGA 2HJRA 3TSCA 2NACA 1SZJG 1WNTA 1YB1A 1ZEMA 3E9NA 2DUUA 3R0IA 4KMSA 4EEZA 2Y05A 4MVJA 2ZKLA 1E7WA 3PFFA 2WJPA 2UUOA 1A9ZA 3QP9A 4R4JA 2D59A 3QVXA 1TT7A 7ADHA 3KSDO 3RUAA 3TFQA 1PQUA 5DBGA 4RL6A 4KP7A 2CNBA 1ZXLA 2VUTA 2X9VA 3FD8A 3OIDA 3WSVA 4DVJA 1E1LA 3E9MA 1EDZA 2PNFA 2GN4A 2VWHA 4J90A 3Q1LA 4J91A 4BO0A 4UUMA 5AXAA 5JAQA 2D5AA 1XDWA 2C5AA 3K30A 4NU5A 2ZTVA 3ONDA 4CQLB 3ORFA 4PLWA 1I8TA 2I65A 4QQRA 2H1SA 5HBRA 1YKFA 2IRWA 2DM6A 1LUAA 4E13A 3NX4A 4AJHA 2X9NA 3X2EA 2NU6A 1DC3A 3NT5A 2BFOA 2VYVD 2XF8A 3QJ5A 3HHPA 1MA0A 4ALJA 2HK9A 2V6GA 2JD2A 4M54A 3CIFA 1JAXA 4D46A 5L7WA 1HKUA 3BTVA 3C7AA 1YB4A 1Z73A 2VHWA 3OEWA 3E6AA 3FPCA 3S2FA 5HRUA 3WLEA 3PP8A 1XYGA 4OM8A 1VSVA 4GVLA 3ZU3A 5FYDA 1XELA 4GSLA 4R41A 3JQ6A 1ZJZA 1DB3A 2E48A 3FR8A 5KCZA 4KUEA 4GKVA 1LJ8A 3RROA 4MKRA 2VUUA 4U7WA 3K5PA 2WWRA 8ADHA 2HMVA 3O38A 4I9NA 1EVIA 5I8WA 2NV6A 3KYCB 4AICA 4AG3A 5JC8A 4MO2A 3DBLB 4XQEA 3H65A 4TROA 2NVBA 5F1OA 4E21A 2I67A 2CDAA 3CKYA 2VRBA 4R3NA 2EKLA 2YQ5A 1T1SA 1WLYA 4WUVA 4W99A 1SPXA 2UDPA 3E8XA 3DZJA 3H7AA 1TXGA 4DREA 1I30A 4HFMA 3ITKA 2FPPA 3GRKA 4YQZA 1E3WA 4K28A 1YVEI 1ZIDA 1T2AA 3GZNB 4DA9A 1H9AA 2GLXA 4FFPA 1Q7CA 5JDCA 2HKIA 2Q49A 3PVZA 3SVTA 3PLRA 3TNLA 1O94A 5KKAA 4MP8A 4Z0HO 4PCVA 4OL9A 1W8DA 4LMPA 4BMSA 1ZMTA 4U0JA 1EFKA 1MLDA 1I3MA 4HX5A 4CLOB 2V6MA 5T57A 2PY6A 4R51A 2OP1A 4AJ1A 3ST7A 2A94A 3EGOA 2CDCA 4CMBA 1GD1O 1MV8A 1DC5A 1I24A 3MJ4A 5HWSA 5FWNA 3U4IA 4WCFC 1HXHA 2J5KA 3KO8A 2EEZA 4GMGA 4WLVA 1SO8A 4BNUA 2NWQA 1FXSA 2X23A 3NTOA 4WLNA 3VTFA 1RPNA 1QYXA 1H9BA 1XLTA 2F00A 1I5RA 4E5KA 1T1RA 2Z5LA 3GEGA 1LC3A 1QRRA 3IOYA 1XQ1A 4E5NA 4D44A 4XA8A 4Y6SA 4BKUA 1QYCA 3IKVA 3M1AA 4DPLA 5CAEA 2UYYA 2WE7A 1RM3A 1X7HA 3N7UA 2ZATA 2OP0A 1YONA
chains in the Genus database with same CATH superfamily
2I8AA 3HQ4O 5BQXA 4FZRA 1KQOA 3EXFA 4ZRNA 4FS3A 3ZWDA 1X87A 1XEXA 1R0KA 1ETUA 3CR3C 3DP9A 3EFEA 1CETA 4KYIB 4J3FA 4WNCA 3G0GA 2R8XA 1QRUA 5JCJA 5HSGA 3DLCA 4WZAA 1UC9A 3KSBC 2BEWA 3JYQA 3I1JA 2WMDA 1X7ZA 5ALHA 4D8VA 4RFSA 3VUFA 4COKA 4LVUA 2PUFA 4UUOA 2YS6A 2ZUBA 4TGLA 3K1YA 3JRNA 3Q6IA 3UCFA 2BGWA 3KT6A 1Y5NA 3N8HA 1YRYE 4PYIA 3TI7A 4WZBB 2BMAA 3H9QA 3NT4A 3ROXA 4E3WA 1A5ZA 2XECA 3LW7A 5LSAA 3QBTA 3N3BC 3RUIA 1UJNA 1Z7YA 2JGRA 4M6WA 4BNZA 4ZGBA 1JEEA 4KAXA 2JIQA 4MUGA 5AK3A 4BBJA 2WHQA 4RY2A 4DLXA 2WPDA 3A4MA 3GGDA 1UXJA 1T0JB 3KX2A 5AKGA 1O97D 5DLEA 2IOYA 1NMXA 3E84A 4GYJA 4RGVA 1EFVA 2DUMA 2GCEA 2ZYSA 3EF3A 3N6XA 4DRYA 4YV0A 4GT1A 1U9IC 3HCCA 4A3SA 1XGKA 2ZS9A 3CG4A 3JARA 4Y30A 3A4TA 5LQUA 1TTQB 5G1OA 1D2HA 3DDUA 5KJFA 2O54A 3JV7A 4IOMA 1OI3A 2ATEA 3HZRA 1EWRA 4MRNA 2G9VA 4QRHA 3BJRA 4HNSA 3UJ8A 1G38A 2PD6A 4OLAA 1RBZA 4Q7JB 1B76A 2YRFA 3QMPA 4YBRA 4YJ2F 3ZE2B 1RYFA 2J9GA 2JLUA 1B23P 4XX0A 3TCNA 2XA1A 3IDOA 4QYSA 1KSHA 1F9AA 4KIWA 3WDLA 4WAUA 4HQLA 5EPOA 2ZAOA 3OIWA 2QRZA 1EUCA 1H1LA 2AT1A 3WGTA 3KDPA 3MWLA 2EFDB 3U49A 1NRIA 1O03A 4PQRA 2VCYA 2YASA 3G59A 4LTDA 5GZ3A 1N7JA 3MIZA 1SN7A 5F78A 1S3FA 4LEIA 1Q1GA 5LP6A 4PNHA 5IABA 4QU9A 3ENKA 1LKZA 3GEDA 3MT8A 4I1PA 2JLZA 2GJKA 2NPFA 1IRIA 1Z13A 3QMVA 1WULS 4ND4A 1MU0A 1LSJA 3FH0A 3KKQA 3VVMA 2VPYA 4FSHA 1DAGA 3VR5A 4I99A 5KEIA 1SK9A 1P9OA 3JWHA 1A96A 1LRJA 3EF1A 4JROA 4OJTA 5TVKA 3V1LA 3M5PA 2VXOA 3MRXA 3VO9A 5CBKA 5CA1B 3DQPA 3TLGA 2WIDA 2Z95A 4UTXA 3L7BA 4E94A 5DTIA 4KN9S 4PZCA 3RLIA 3G85A 1VYTA 1IHDA 3EGCA 4MQ5A 5HJ5A 4AY2A 1VMEA 2IY9A 5EE0A 2JARA 3FGNA 3H13A 3ND6A 1MO4A 1N5JA 1BD4A 2GGSA 3CLRC 2A5JA 2E2WA 3E8SA 5BT9A 4IUYA 1GNSA 4Y2XA 3RTAA 5DM60 1GA1A 2GTPA 4LDRA 2EP8A 5DNEA 4G5FA 3M6LA 3H9EO 4PHFA 4AN0A 1KEEB 3GMSA 1X0VA 3EUFA 5CW2A 3RV3A 2O07A 4WRRA 2QJTA 4O4JA 4HWKA 4YJFA 2I4NA 4UCXA 5EMLA 4Q02A 4L4ZA 1CVLA 5BWMA 2I7TA 4R31A 3G0DA 1K7XB 5ITVA 4C0QC 2IYSA 4MCJA 3CISA 4ZJPA 5J5CA 2R66A 1VSBA 5DHAA 3R0JA 2HU5A 1X7WB 3WNZA 1BKSB 4RIHA 4S1OA 1KAOA 1UKBA 1E2NA 5C34B 5HUJA 2JI7A 1OU4A 3I28A 1LPMA 3K9CA 3ZHYA 4CEHA 3LBNA 2WLTA 2C2YA 2EZUA 1E58A 3ITNA 2POQX 2OESA 4KV9A 1RAGA 2QE7D 2W6NA 4KH0A 4BNDB 2QBYA 4E5NA 1U8YA 3HM9A 3RU7A 1PL6A 1ONPA 4J2OA 3S28A 1JQLB 3BGWA 5T8KA 4DANA 5HQTA 2VATA 1Y9ZA 1J70A 1BVRA 3W9YA 5FR2A 4EA9A 3GVCA 3P9CA 2G3YA 3DLAA 3PNOA 3L06A 1ENYA 1EM8A 4MA0A 1RHUA 2W6OA 1SC4A 4J7CA 5CDYA 1JBKA 5JAPA 4ER7A 3TLCA 4CFZA 3IHWA 1HMPA 2ZBPA 4RY0A 2ZI3A 4YJ2B 2MU1A 1W1IA 1YR1A 3FCAA 2DHCA 1LDYA 2ZJZA 5ALOA 3U40A 1OXXK 2ZRQA 1EUDA 4MOWA 4FFWA 3TLYA 121PA 2BD0A 1J8VA 2AGVA 4N0PA 5K3AA 1MRZA 3N0TA 2AJLI 4UBKA 2V3VA 3MWDA 5CTJA 1XAGA 1ATZA 3T3MB 4BXOB 4RD6A 3AEKA 1N34B 1ZZEA 4EZIA 4ZP1A 1J7KA 2VLBA 1FMFA 3JTMA 3T7TA 3SHWA 1QTIA 1ZIPA 2IELA 1IIBA 4Q9IA 4BP9A 1CY2A 1JG4A 5F7JA 4RY8A 5C9ZA 2XMBA 4DLYA 1W35A 4EYQA 1FIUA 4LJYA 1FF9A 2O6LA 3KK0A 1O6ZA 4KQKA 1ZU5A 3KKLA 3I01M 4UE2A 3CVXA 3T54A 4BQSA 2AFHB 2OHGA 4D25A 3BS4A 3R5HA 4I1RA 3V6LA 2GFQA 2BPOA 5JBIA 2EG9A 1HDXA 3ANMA 3R3SA 4G6ZA 4JT9A 1KTVA 5I9SA 3RUPA 4A26A 4Q18A 3QW2A 5A1TA 1RHMA 1HNZB 1RLUA 3IUSA 3PHGA 3FPHA 5AQ1A 2R8ZA 1Z35A 4I2NA 3NDRA 3B1ZA 4L5AA 1FP2A 1TK3A 1GSAA 2G82A 1VZ2A 4QDKA 5GY7A 5SZHB 4CTJA 1B16A 4XASA 5H5JA 2Y1DA 4B3TB 2DQKA 1K7SN 3TX2A 2ZI7A 3CF4G 5DN6D 4LJ7A 2VRCA 5AYVA 3VGPA 4ALIA 3ZKAA 5A4FS 1VGQA 4LSWA 1M7HA 4R9VA 4NQZA 4ZEVA 5L45A 1I36A 3E15A 1TVKB 1ZH0A 2OK7A 4KIUA 1CY1A 2QPAA 3PDUA 3SJUA 3G2NA 1SM4A 2P7HA 1NXTA 3P9KA 3SR0A 4JZKA 4ZCQA 5CGQB 1Q6ZA 2CXPA 1P2VA 1QVWA 1D7OA 1Z8FA 2IT1A 4GR9A 2B1QA 1EDOA 1NMSA 2CXRA 3SOPA 4WNAB 4KTVE 3CZAA 4TOIA 1L6IA 3P0FA 2B94A 1H42A 1ULTA 2CVOA 3D8RA 3PT5A 4OLFA 4IIJA 4LC0A 4UFNA 2CZGA 2C2GA 2WC1A 3PEYA 4UAVA 3P4XA 4EELA 2PLRA 5DTJA 4MTLA 3E2MA 1W76A 3NXKA 5CLGA 5KVAA 3A3PA 4BJHB 3L7LA 1YFZA 2XTZA 4ZQFA 3ZV6A 3HSSA 3LOQA 3MIIA 1F7VA 2LKDA 3ENQA 3BMCB 2JAPA 3JVIA 4F9EA 4ZAVA 1KO4A 1L5RA 3KTAA 1KBQA 3QLVC 3WDMA 5K3DA 3A32A 2Y0CA 4OK6A 1PGNA 2BFNA 1FYEA 2AFVA 1PR2A 1NA5A 2FWNA 4I0WB 4KC0A 5A1JA 5CIYA 3H5VA 3RS4A 3CY6A 3ANTA 3DL0A 1RWQA 3KHUA 4KI7A 4HYTA 3EGVA 4K40A 1XZHA 4O1HA 5A9TA 4Q4JB 2WSIA 1XHFA 3SJBA 3AYXB 1T3TA 3OAAD 1Z08A 2BIFA 4QXRA 4ZQBA 4HB2A 2WHPB 3Q8MA 3B53X 3QLJA 1KJNA 3B5JA 1W4LA 2Q4OA 4ZYUA 1E96A 3FUCA 4YAUA 2H5EA 3ZHXA 3GEBA 1QIEA 3HB4X 1A5TA 3BVPA 2MIIA 2OG2A 1P9RA 3LX8A 4MUIA 1CNMA 3MAGA 4O4IA 1GUYA 3JASB 4HFRA 2EIHA 4D9CA 4KVGA 4IBOA 1E7RA 2XT0A 4TS9A 3SQNA 5A4MS 2CNNA 4FC6A 4EK9A 4L16A 3NXSA 3IAM6 3JQAB 1GTSA 2YDYA 1N0WA 4N65A 4QXAA 2Q6LA 5L4NA 1ZJJA 3LF1A 4GVPA 4IJ6A 3VR5H 1E94E 1EXWA 1EZZA 1AZLA 2GKGA 4NMMA 1IDN1 1YUNA 1ZITA 5C7LO 1B74A 2X76A 3WQRA 2R1VB 1W94A 2ZR7A 4D57A 4PEVA 3KKEA 3L82B 3B3FA 4GLLA 2BM8A 4O02B 3ISJA 3MRTA 3IJRA 4US0R 1IRXA 3UWOA 3L40A 2QMOA 1MJ5A 3JYPA 2P8SA 2Q7DA 4B48A 1NF8A 3VHXA 3DF9A 2KLBA 3N8DA 5AP9A 2F2TA 3T3HA 5CFRA 5AI0A 1G64A 2H5JA 4DIEA 1QRAA 3QVKA 4IINA 4KPGA 3FVTA 1G60A 2IXDA 2ODBA 2VPWA 4N03A 4QFMA 1QHYA 5F3RA 4CIXA 2ONKA 5K9ZA 3F4KA 2BEUB 2WMYA 4AS2A 3W6OA 2Q1TA 1WKCA 4BEBA 2QN8A 3KP1A 3EEIA 3QUTA 4JXKA 2VWGA 2Q6VA 2Q99A 3HM2A 2XDYA 4HGRA 4UDNA 3AHEA 4EYKA 1WJGA 1XJQA 1SR8A 3OO0A 1FLVA 3PQ7A 2MYTA 1E5LA 4B81A 1EFPB 3DOEA 4E31A 1AN0A 4PZAA 4RETA 4MWBA 1H2XA 5EWLB 4ZOCA 3A05A 4GOXA 3GJYA 3Q0IA 1A4RA 3VKHA 1WXQA 1CERA 1ORIA 3EGXA 3N1UA 3S99A 4AG6A 3FNFA 1XKTA 1XTKA 4LOHA 5FOUA 3BCHA 4BUZA 3QTTA 4F5WA 2VYVA 1IZ7A 2WIJA 3HP1A 4OA5A 3PFBA 1A50B 3M70A 4IMPA 2VL7A 2VYCA 4DJFC 1RIFA 4HLUA 1P0IA 3LPAA 1XRNA 1RQRA 1Z6ZA 4AZ0B 4F3CA 4E3ZA 5K3FB 4IP0A 2AKEA 4G84A 4FR2A 2VP5A 2LDXA 4GBJA 4C7KA 4HDAA 4CL8A 4DSUA 2VFAA 1GADO 2JD1A 5HPYB 4F7WA 1ISJA 5JXIA 2XR1A 4ZQEA 4RE5A 3PGLA 4HMOA 4IZ6A 1AQ6A 1C0IA 2MSLA 3LQ1A 4BAGA 3EFOB 1M8PA 4JB0A 1BH6A 1U0LA 1BS9A 1UKZA 4O59O 3B1XA 4TV8A 5LP6C 5U1PA 4ARAA 4BMOB 1M1NA 3HWRA 4RDXA 2AC2A 1YUMA 1Z56C 5ENVA 3UTCA 3U16A 4G1FA 3PNQA 4ENSA 1YJ8A 2I2CA 3S2YA 2XD4A 3E7XA 3FKSD 3SJCA 5COQA 4BLUA 4EBFA 3TL3A 2WJ3A 2WU3A 3I2GA 3GRVA 3G89A 2QSJA 2H9AA 2WFLB 3DMFA 1H2WA 4JLNA 3S8EA 5IHXA 1AKVA 1I4WA 4OF4A 2QEQA 4CM7A 1TB4A 5FQOA 3CX8A 2I7XA 1JR6A 2BKLA 2EX1A 2J4DA 3FGOA 4C07A 3OKFA 4DMRA 2AK3A 4DA6A 4GKBA 2GMWA 4XWWA 2P4HX 3Q85A 2ID8A 4HK4A 2MYPA 1GQOA 1X8LA 3E0XA 5ENZA 2OXFA 4MQ6A 2UZAA 3V8PA 4BOYA 5B6PA 1NBOA 2H1HA 2ZTUA 3AHDA 4OA8A 3H1FA 4YRTA 4K6KA 1RKQA 3EZGA 4TV9A 1G8HA 4B9AA 1SH7A 4D80A 5L51A 1EE9A 2VPQA 3SZRA 2IDKA 2FVXA 2Q9CA 2HSEA 5E1MA 5KTOA 1U28C 3A37A 4WXHA 4HJXA 4XQGA 4FWIB 3X1WA 3DDZX 3UG7A 3GRYA 3C3CA 3ITEA 1IG3A 4XOIA 5L40A 2REQB 3VYVA 2ZVPX 4ENPA 5AM3A 5DLDA 3GPDG 3GHHA 3W6ZA 4OK5A 4IRMA 4F38A 4Z3OA 4HO1X 4LX0A 3ZH2A 2QRPA 4Q39A 1XTVA 1RSZA 1OJLA 3PGXA 4AMGA 1SEVA 4QEZA 2C7VA 2X0KA 1PR0A 1XTRA 4M87A 4U2BA 2C5BA 2DT8A 3A6KA 3C3XA 3CPSA 4CLXA 3TF5A 2NNLD 4JEMA 4RABA 3HKCB 2RH5A 1OTYA 2ZBUA 4CLHA 1NU8A 1W0KD 3JQ9A 3ZEIA 4UPEA 4WVFA 5KOJA 3FSJX 3O2SB 4KQGA 4EL5A 1HYGA 3LBIA 5BNTA 1EGQA 1KE1A 3VSEA 1LTQA 5JU6A 3UC9A 2BGNA 1NVVR 4Z6KA 1LLFA 1NVVQ 1P4RA 4HDMB 1F8UA 4AKSA 5I45A 2FPSA 4CIWA 3VC2A 2AN4A 1ZFNA 3T52A 4WASA 1DKMA 1AGNA 3WYDA 2WFMA 4YDSA 4FONA 1Q1QA 4E88A 4NE7A 4X95A 4ZK6A 5HZGA 5CB4F 4RDHA 1PFGA 3BHIA 3WIEA 1TU0A 3ZHVA 5FXMA 1XTJA 2A78A 4EVSA 3M81A 4RVHA 1U3WA 1UJ6A 2A0XA 1GTJ1 1FK8A 1P8AA 1RWPA 3AF1A 5TRTA 3KEFA 5ALXA 4A10A 1RHJA 3M4ZA 1QRDA 1NSTA 1PTKA 1LDMA 3A0RB 5F35A 4GGPA 1CJBA 2C2WA 3NWJA 3DCNA 1OLUA 2CMHA 4NABA 2C7QA 3DKVA 2WWVD 4HY3A 2BEJA 2GBLC 2Z5FA 4GMHA 4ZU6X 3S1LA 2D8AA 3UATA 4C0SA 4DCPA 3L3BA 1SCJA 3Q3VA 1WXEA 1Z5WA 4R8MA 3GCWA 3UB3A 4ESEA 2WTBA 5IZCA 2AHRA 1A7JA 2KYRA 3DBHA 1AQUA 1DZIA 3G2HA 4QTTB 2HCTA 4TZ0A 2EBUA 4JAVC 4YCAA 4AKEA 4F4DA 3ETJA 4HXGA 2FRDA 4AN1A 4C7MA 3J81A 1RI5A 4UM9B 3ZUPA 4CIBA 5HK8A 1IJBA 1B8PA 2H7XA 4M7WA 1UQRA 1G0OA 1N9GB 3L8DA 2Q6TA 3W3AA 1V8PA 3UIEA 3I1IA 2PD3A 3PLNA 5DOVA 2GZDA 5IJAA 5F4BA 3IL2A 1E2IA 5BQPA 3B7GA 5JANA 4P7KA 4K2HA 3EG5A 1B8UA 1TCUA 1P1RA 3NP7A 4G5HA 4URYR 1DCFA 2P2SA 1KMCA 2P1DA 1WVMA 2EZ9A 1QLJA 2NO0A 2DULA 4OM7A 1A8UA 5CX4A 2RBEA 2XVYA 2XZDA 3TD6A 1H4QA 1DEAA 3IJ5A 4HVTA 4OP2A 4PPGA 3T7JA 3SYMA 1V2GA 2Y0PA 3TTTA 1R0ZA 2VP9A 3JQ7A 3LFUA 4RTRA 1F9EA 4G0OA 3U13A 4H0FA 3NO4A 3QY9A 3SDZA 2HYIC 1TIKA 3ZIAD 4B9EA 1VHQA 2BUAA 2WA1A 4QNMA 5CVTA 4F91B 5IF3A 4RZIA 3ZQUA 3A6JA 4H7EA 1OBOA 4Q3KA 4S2EA 3B6MA 4IXWA 4LQDA 2B2CA 2R8BA 1KZ1A 1HQYE 4MUXA 1PR3A 1Q20A 5DV9A 3DGEC 4G5RA 4NZOA 1RJFA 1NY5A 4Y9DA 5KYWA 2EFJA 3OP1A 1TO2E 3HU1A 4GPTA 3WWYA 4B75A 1E5QA 4GP9A 2RHHA 2TS1A 3JQAD 3UUWA 4V1CA 4JUBA 3QF4A 4HWOA 5FV7A 4QU8A 3RE1A 5ADHA 1O5TA 4W5QA 1WLSA 1PRYA 4HGOA 3O91A 2FUG6 4QXQA 4JDUA 1PIWA 1SVNA 4C7OB 1JHDA 3QVWA 4G1VA 4B82A 2GLUA 3N75A 3HTXA 1DJNA 4KZKA 4MUMA 2FZGA 3GA5A 3WKDA 3LPMA 5JVDB 4F3YA 3WWCA 4UEOA 3UXEA 4PX5A 3RJTA 4E1AA 1XWFA 2FLWA 1AZSC 1Q3TA 3HJUA 1VE9A 2QM7A 1Y6GA 2NTJA 3DO6A 3CF0A 2C9BA 4UM7A 2UXDB 1ONBA 1JSLA 1QHHB 2FX5A 2HF8A 2HCJB 1B15A 2IIQA 4H16A 2BFPA 1XFAA 1BG6A 1VMDA 1XZAA 1GCOA 3M6FA 1V1MA 2C96A 4Q6WA 1A9RA 5EZYF 1C8KA 2CVFA 5LP6F 4G65A 3S4YA 1PR9A 2RBGA 5F2NA 4QREA 3FG9A 4RV5A 3DL4A 3DFUA 4O1MA 2H2AA 4FDTA 4QFCA 5A04A 4LE0A 4M1QA 4ZAZA 1Z4JA 1E9AA 3GFPA 3LI2A 5JYCA 1I1OA 4H3VA 5AMXA 2H7CA 3SBOA 3QVGA 3IMKA 2A2ZA 4WZZA 5LJIA 5MGBA 5JXGA 1NW7A 1V5EA 5KOHB 1GLNA 4DB4A 4FEAA 3ZX4A 1XMJA 3ZU6A 4JLWA 4RS4A 4X97A 2J3IA 2M9MA 2QM3A 4BVJA 1LSOA 1T9CA 2HQOA 2RK6A 4CDGA 3I76A 3K6SB 2CV1A 5KDLA 3REFA 5DFAA 1EXMA 1RC8A 4FLFA 1EFTA 1KRHA 3KUDA 1FS4A 3DMHA 4IKEA 3H9CA 3K8YA 4WW0A 1PDOA 2JGDA 5FWYB 2V54A 4CQMA 1TC2A 4G8JA 4NP6A 5HFNA 4UDOA 2O3JA 4PG8A 1IULA 2REXB 3QIAA 1QO9A 3EXFB 4LHYA 3LT2A 4BNIA 1ZK2A 1RKXA 5K0SA 2AJDA 4O4JF 1C80A 1E8NA 1FRNA 1K06A 4WERA 4DIDA 4PYRA 4F3TA 1Z0IA 1D2MA 2XMSA 2DFPA 4WZAB 5CT9A 4BAZA 3DJYA 2BKXA 2N3ZA 5J47A 4N7BA 1U1EA 1X7ZB 2BBOA 4RFSB 4Y6LA 3F1KA 3AEZA 1C9YA 4QLBA 2DTEA 4E14A 3I62A 3FFTA 3KIPA 4XOUA 2VZ9A 2BGRA 1JHMA 1OASA 1T1IA 2YVKA 3CW2A 3LMKA 2P65A 5M2QA 2HA7A 3BWEA 2QLBA 2H2HA 3C85A 1VE5A 4MQUA 4TMXA 5JH7A 4F85A 4QASA 3R9WA 4P38A 4P35A 5D3KA 2Z2IA 1NUPA 2BHSA 3BXGA 3DMGA 3PA6A 3NVKI 4HLUC 2XUJA 3LP5A 1G6Q1 3IE2A 3L8EA 3NHPA 3ERCA 3ROTA 3L0YA 3N0RA 4TTVA 5E4YA 3RU9A 4QGGA 3ZDQA 4OHKA 4PQEA 5DBFA 4YV7A 5KYVA 1QH1B 3PEWA 2OC9A 1I7DA 1I51A 1KZ6A 1T8RA 3JARB 4IYRA 3BMXA 4YP5A 2JVIA 1VIDA 1KDTA 3L9WA 1XNGA 5JFTA 1FMJA 3ZR4B 5LQDA 4DUZB 4L78A 4KO8A 2WF9A 2Y77A 1JVBA 1Y1PA 4KAJA 3ZBUA 1KEUA 1L3BA 4G85A 5BSEA 3CLRD 3GEEA 4V0ME 2ECQA 3FZYA 3U44A 2C3MA 2PFGA 3GEPA 4MW7A 2NXWA 1GTZA 3C3DA 1GVNB 2IHBA 2ZR9A 4UTZA 4WY8A 5GJVC 3VI3B 4F6RA 3CO0S 1RABA 4QEKA 1QFZA 1EUCB 2VHXA 3O4GA 1YI1A 4YX9A 3DZBA 5L4SA 1ZI8A 1H2EA 3IERA 3OFSA 1L7RA 1AK9A 3PRKE 2Z2JA 3BF8A 3U9TA 1T2NA 2CXXA 3B3JA 5LP6B 2H1OA 2BE9A 2H3EA 4WNYA 4QBIA 4INZA 4DS3A 3B36A 1OYOA 5CTAA 4KAFA 4HH1A 3T7RA 2AG6A 3IAXA 1DWPA 2ZETA 3QLEA 1IEWA 4IXMA 4UARA 3I04A 4V0OA 1MCZA 4N18A 3JAMA 1OFTA 1FFGA 2B2XA 4JX9A 3ESXA 1L7XA 1W85A 1XVAA 1XNJA 1E63A 1DS6A 5I9LA 2IIVA 2GI4A 3MWJA 3WWDA 1I6KA 3CRVA 4RMGA 2YCBA 4U39A 1VE3A 3I1FA 1P1HA 2IYLD 1C14A 4AM8A 4BO4A 1HEUA 1UWKA 4BLQA 3U3ZA 2PLFA 3SX2A 1R9JA 3W3AH 3H17A 2MINA 2WP0A 4CMEA 5JMWA 4RD4A 5LU9A 3F6YA 1PFYA 2H59A 2PNJA 1CY8A 1X8JA 2OE2A 1VBMA 2XA9A 5KNDA 4XAQA 1T0UA 1KPHA 1NBWB 2YXBA 4OYRA 4XSHA 2CD9A 2P4EA 2QX7A 1UPCA 2GBGA 2P2YA 3FOAA 3KM0A 4KWEA 4TSFD 4B73A 3PGJA 4NZ9A 2W2PA 3U19A 4FMBB 1YWGO 1WF3A 4YJFB 2JB9A 2W6ZA 4FD3A 4GU5A 4LCJA 1IMOA 4NBSA 3QQPA 4BJ3A 4CV2A 2VI5A 3UJBA 5AW4A 3ZVKA 1DXYA 4X7PA 3S3TA 4F56A 4L8LA 3JQ9C 4Z9YA 5JZMA 1KDOA 5TQJA 3BOSA 1NJ1A 1C7JA 2DHDA 2X3UA 4FGWA 3UCXA 3I8SA 1YSCA 3QELA 5BSVA 1A2BA 4UTOA 1FTQA 4H4EA 1CF4A 4QOJA 4ZEOA 1LDNA 4BX8A 3FTCA 2A0WA 1L2TA 3DKIA 7REQA 2HM7A 1NE2A 3B1KA 3KNZA 4GLOA 5HTOA 4K3VA 1CY4A 2FDRA 3FUTA 4UM9D 3LO5A 4UQOA 4CEHB 4IIJF 4MVWA 4GQAA 2DPLA 2VWPA 4HN4B 4M1MA 5BR1A 1MR3F 1DIHA 4RK1A 3PHIA 3FXAA 3OOYA 2HWWA 3P7MA 2BKAA 1JP7A 3T0GA 1LRLA 1YNSA 3AB3A 3I9MA 4RTJA 4DJJA 3I9V1 3K9WA 1UKYA 4DSOA 2IYOA 2QT0A 4QPZA 5EY5B 1FTGA 3GJZA 2VT7A 3OZTA 4LXTA 3R9IA 3HR7A 4DNPA 3D8TA 3DZKA 4TMZA 1EM8B 1Q19A 3KYDA 3SQMA 1R6TA 4U02A 5AHRA 3WHKA 1VJDA 4EUHA 1YHZA 5E6SA 4DCSA 2J4CA 4TYMA 1GTVA 1RYNA 1P6XA 1B8VA 3ESDA 4EY7A 4D0SA 1EUDB 3IILA 2VAMA 3KV3O 4WZ6A 3VVBA 1ZJ5A 4JMLA 1TQHA 5IZCC 2D1FA 4JV5B 3R7DA 3NKFA 3IFSA 3N58A 3ZBQA 1JFVA 2FRDC 4FR0A 4J0KA 3BICA 4F2HA 3B9RA 1G5FA 1QGUA 4ALKA 4YNBA 5WRFA 3AEKB 4LXIA 4O4IF 3EARA 2CLIB 1V6CA 3HJNA 3VR4A 1QGZA 3D8HA 3GAMA 1FDWA 1VL1A 1ZJ4A 2CDBA 4PV7A 2W2QA 3I1YA 4ZQIA 5IK2D 5K20A 5KKNB 5CT5A 2E4YA 4YRSA 2HMTA 3DPIA 3U7GA 1S8OA 5EE3A 5DNYB 2ZP1A 4M8LA 1C0PA 2IFTA 5DCYA 1R8XA 1XAJA 3ZCTA 2HNKA 1QF6A 2NZJA 4I55B 2A5GA 1OZHA 1UBJS 1QHSA 2VUSA 3A3OA 4NWIA 4F86A 5EHXA 5GTDA 2PM8A 2CXSA 4C3VA 4JLKA 5ALRA 3C1OA 3QF7A 4OP1A 4YEDA 5J43A 3TZLA 5JR3A 3VKVA 1LA2A 3D8UA 4ZO7A 4A92A 1SCIA 1NTRA 2R11A 1FFSA 1KSGA 3FHTA 4YT8A 5DCUA 3ER9A 3Q7PA 3EQ7A 3LY7A 2WW8A 2J8ZA 5BW8A 2XAAA 2P9EA 1ESMA 1JLHA 1ABEA 1CJKC 3L7KA 3LK7A 1RYHA 2VJNA 1R8SA 2O2EA 2PSHA 5T64A 1CU1A 2DUJA 1U0NA 3GCZA 5DB4A 3V9PA 2JLYA 1K98A 4N0QA 1IM5A 4W7HA 3T7DA 1V6AA 3KQHA 5IN4A 1KH1A 1ESZA 2R4UA 1CDOA 3DDSA 2QX4A 4B80A 4NL4H 4AJNA 4E2XA 2BI4A 3G7SA 3EUAA 3HXLA 3T8YA 2IH4A 1DELA 2GBCA 3I5XA 2NTEA 4FUQA 4JB8A 1JNXX 3S2IA 1DCKA 4M22A 3TL6A 4UNSA 3H1AA 2G07A 3U4HA 5GAJA 4B6OA 3BA1A 3B12A 5BOSB 1Y7LA 4IMRA 3D4OA 3CB4A 4GGMX 4R8SA 5K6AA 4XYMA 5CFOA 5EQFA 4P53A 4EF6A 3QKRA 2VN8A 4YJ3B 2Q27A 3GJ7A 3HNPA 4QHYA 1W5AA 5EL0A 5JZBA 1BKDR 2JW5A 4DMKA 1ATIA 4CGYA 5IMBA 4YUXA 1CUXA 2QV0A 3N2IA 4IG4A 2GTIA 4TT3D 2QW0X 2C9DA 3GUUA 1GG9A 4B5KA 3KTAB 5IDQA 2GPSA 1FTSA 4MVJI 5IVKA 1JXOA 4D4MA 4HAVA 1RWOA 4YRRA 4TV8F 2P9CA 1WOMA 1J8MF 4ZVMA 3RF7A 3BERA 3FOZA 3ICCA 4BRWA 2D3TA 1O1YA 3TRDA 1LV8A 3ICQB 2YWGA 1ULZA 3H9GA 1SBZA 3CU5A 3CNLA 2FUNB 2Y92A 3ESCA 3FN4A 4DLTA 5HZMA 5JDCC 10MHA 2IHNA 1W25A 4U9HS 3ZQJA 1J1ZA 1XI2A 2K4MA 2NO1A 1PX0A 3NTRA 2QR3A 2J0VA 2NO5A 4Q47A 3O26A 5IP5A 3X1JA 3ZE1B 5JZSA 4FGLA 2WPDD 2HEGA 3OMWA 2KHZA 5E9QA 4O0MA 1S5PA 1K7CA 1ZGBA 4DA8A 4S0XA 1GZ5A 4YXWD 3O3CA 4YHHB 4MH0R 3H4TA 2ZYUX 5FLEX 2Q4BA 3CRQA 5KQSA 1Y6QA 3BEDA 1U8XX 1NW4A 1EDDA 3OCVA 4RV4A 1RQGA 1W9MA 4TV9F 2ESRA 1SVSA 1XJ5A 2RHTA 4IH4A 5EC8A 4NECA 3IT3A 3OZUA 3CH5A 3WJ2A 2WWHA 1XCMA 3KPYA 1L5MA 4C4SA 1EEHA 4Q3EA 4JASB 3TUIC 4X44A 2XSZA 2D0DA 3OLCX 3VHXB 1HMYA 2D2FA 3L6EA 3N2GB 2NYAA 4M9SA 1E2JA 1FS6A 3TM4A 1AXEA 3V7UA 1SUCA 4GO1A 1SUDA 4N76A 2M1ZA 5AW6A 4GNRA 3KAPA 1J06A 3QVLA 2J0SA 1SIBE 1V8FA 4CIDA 2NV0A 1C7ZA 1QB7A 1RRCA 1FYVA 3DE0X 2OORA 2I2AA 3FYHA 1QTRA 1NZJA 3R0XA 3P96A 1MF7A 1T36B 3KAKA 1E18A 1KEZA 2A14A 2W98A 3I34X 3I72A 4Z0PA 4DTCA 1DJLA 1LK5A 2BTQA 3WG9A 4M8KA 2R47A 3NWOA 4NBTA 4MWZA 4ZAXA 3HSKA 3V4VB 3CPJB 3LOPA 2ZB4A 6YASA 1SQ6A 2I4TA 1UFRA 1VL0A 2XF2A 3BH6A 3EGXB 3PU6A 2QHXA 5F3WB 3I2YX 4XFKA 1SOVA 1YVUA 2HJWA 2O2JA 2O7RA 2VDWB 4JLUA 4RHCA 2WKWA 5JPIA 4UCQA 3TRHA 1ZX1A 3SIWA 3WZ2A 5BSFA 1LLUA 5IDWA 1NZDA 1F0NA 2G70A 2GAAA 4RF3A 3V5NA 3FHCB 5EJ4A 2GN6A 1HSOA 5ICFA 1QQ7A 1V16B 5G0TA 1M7GA 2AZ4A 4LQCA 5FPSA 5JI2E 3I4FA 4FYVA 1IZYA 1OA0A 4C05A 2G1PA 4TS1A 1Z4LA 2YWHA 3AIKA 9LDTA 5K8JB 2Z6VA 1OOEA 1Q22A 4WK4B 4YCSA 2FEMA 4QAQA 5COBA 3B3AA 3IEXA 4TV8B 1U7UA 3H6HA 1XC7A 1CY0A 2BFBA 1Y7PA 4XM1A 4Y9UA 2WYVA 2ZU6A 3M0EA 2GCPA 2R8PA 3FSRA 4TWBA 4DYDA 4L8VA 2IL1A 2F1IA 5FI0B 1GPDG 1HBJA 4QPJC 1BAPA 3V34A 1PHPA 2DQZA 5JJBA 1T6YA 2D00A 4A6DA 5LLTA 4KRFA 2PSFA 3WA6A 2W11A 4OSOA 2CE7A 3GV0A 5AIAA 4GE3A 5KUTA 4JBNA 2YFHA 2YUTA 3BILA 4OU4A 3HLTA 4RCZA 1MD9A 4HRVA 4QPPA 2Z6AA 3AO0B 4BO1A 3CLHA 2OZLB 1OC4A 3PHHA 4IDHA 4B33A 3NYWA 1L5HB 1OLOA 2XUAA 4E1VA 1UK6A 1W93A 1TRKA 2Z5VA 2ZROA 3GNSA 1VFPA 3G0OA 4NFLA 4DIKA 4P2BA 4DG8A 1PZXA 5BN1A 2F64A 3P9XA 2EVWX 3DMRA 821PA 3M34A 4TV9B 3OQIA 4PFKA 4XWKA 2PXCA 4X0EA 3VQTA 1SQGA 4IDCA 3VSCA 3VJLA 4TL7A 3WXBA 2FY8A 3BWDD 4J0DA 5KSZA 4PLGA 2RGBA 4CM9A 3G5AA 3GZJA 3AF6A 1K3UB 2JFXA 1H6BA 1MC8A 3WGVA 3KPUA 5C18A 3LY8A 2IXEA 2LGJA 1GU0A 4UKDA 2YWBA 3TNDA 1J22A 3L6RA 4DV6B 4FZVA 3VNAA 3JWIA 5DRTA 3DHNA 3EVNA 1QMPA 2UZ0A 1PG5A 4JVMA 1OBCA 2A0YA 4I6JA 4C30A 4ZI7B 4K1XA 1UK8A 2R97A 4NEHB 4UHCA 2EYQA 5EPEA 3W77A 2R7AA 1U6KA 4I08A 1G2IA 1V7ZA 3KYJB 5KDDA 4ANFA 2XQFA 5KOJB 1QC5A 5A3VA 3ADBA 4HN9A 5GMOA 4RTOA 1E8DA 5IWAB 4MYDA 3TQCA 3SKVA 2OV2A 5I7OA 1S4QA 1QQTA 1QQAA 4B17A 1CJSA 3EHDA 4WX2B 4Y98A 3A3YA 3EQ6A 3O47A 3RVRA 1UBEA 4WADA 4C6TA 4CCYA 4UBOA 3IRVA 3BGDA 3T7CA 5C37A 4KO2S 4QM7A 1R6XA 1WZIA 4JQSA 4YGYA 2J3JA 1ZJ6A 3QEBZ 1HTWA 1CULC 1AOXA 4LNUA 4RVUA 4F84A 2KE5A 4MUYA 1YZQA 5DTRA 4TSKA 2IZOA 3EUWA 2RK4A 4KTTE 5F21A 3E7FA 5J2TA 2CKDA 1WNFA 3ID6C 2RHGB 3A1CA 2FXVA 3L5OA 1UDCA 3DBRA 1G7TA 3EVZA 4MHSA 1KI2A 4WVLA 1R6DA 4LYEA 4FS8A 1A1SA 3EPRA 2J6IA 2G0TA 4HAYA 1BDIA 1RI3A 1TYDE 5DN9A 3STXA 1JWBB 2PKCA 5K3SA 1DAPA 2EP5A 3AINA 4O2LA 5G0UA 1IN5A 3NHFA 4L4SA 1H0HA 1IXZA 4UM8B 3IXMA 2KQUA 3CNBA 1ZNWA 1UPFA 1ZLXA 1MMFB 1I1NA 2HT6A 2IYQA 3JZAA 1CBUA 1N2BA 3OY2A 4KLNA 4UXHA 3DBHB 4B3DA 1IVNA 1K75A 1NWHA 4QPNA 4F4CA 2MMCA 3X3HA 1E99A 4LGVA 1XKQA 4IXDA 1GUDA 5ARCA 5KJ1A 2P9JA 2W2TA 4QUGA 2Y93A 3L0BA 4URWR 1F2TB 2DG2A 1F20A 1N2HA 3N0VA 1BW9A 1T8YA 1D1TA 3OBIA 3TZEA 4ER3A 1GKIA 1C5KA 1N1EA 1N5OX 8ABPA 3IOEA 1O5OA 4F96A 4WGGA 4GF5A 1Z7GA 2OXCA 6REQA 3Q3JB 2WD7A 2YVUA 3O1LA 4MS4A 3WGIA 2HDNB 2PT5A 2DP4E 2YZ2A 3ZZ0A 4MQFA 4D42A 4NX2A 1CWUA 1WCV1 2P2NA 2GHTA 5C3MA 2Z30A 5AVJA 3FNQA 2ZRPA 4FW8A 4FYYA 2ATCA 3DZIA 2AN1A 1L4HA 4RH0A 3WJAA 2ZIGA 3U7IA 2CN1A 3G9ZA 3CMMA 5BN5A 1JGTA 1ZVQA 4YCJA 3CX7A 3RPEA 5B6JA 1RPTA 3ABRB 1S6YA 5JH7F 1P73A 4OGKA 3D3EA 4CTOA 2VSOA 2F59A 2NU6B 1CJTC 1ECPA 3D0KA 1JVNA 4D99A 4BMDA 4JI2B 1ZQ9A 1R6VA 4JI6B 3W8EA 1W4AA 5TS3A 3ND9A 3P94A 1PJTA 3PE6A 1AA9A 4G86A 1PVDA 3W8NA 1E1CB 4B71A 1C1DA 3LSYA 4JCCA 4AJJA 4P22A 3DQZA 2G71A 4TQGA 5ESDA 3HCAA 2G4VA 5L3QB 1WR8A 2VNAA 1C0KA 1EBFA 4C7XA 4R16A 1SUPA 1XCBA 3IO5A 1R8JA 1ZMRA 1G8FA 2CNDA 3KBBA 4DMHA 3KSAC 3ER8A 5BY2A 2BH9A 2FWJA 1IOVA 4PZEA 2XNKA 1YVRA 3S2UA 4P58A 3Q8XB 1U6IA 3O4FA 1DGQA 4Z7QB 2X7HA 4EABA 4IPTA 3BMOA 4R5MA 3DV0B 2H51A 5I7RA 1ISRA 2JI6A 5JYBA 1E1DA 1ZNXA 3NASA 4X24A 1Y1SA 3KXKA 2GCIA 4WEOA 1WV0A 4LOAA 1J1UA 2A9RA 1V1MB 1AK1A 3IMEA 4IJMA 5DT9A 5H0IA 2XKBA 2PJRA 2X6RA 2OYCA 2Y4OA 5DM4A 2D5LA 3OZCA 3M6MD 4IVPA 2PS9A 1CQWA 4MGKR 4WUTA 2CV0A 1SG0A 3CZ9A 1QFYA 1Q92A 1TKRA 2P5UA 2QDXA 3U09A 3PR2B 2NU7A 2M1XA 2ODEA 1WXHA 2VUIB 4L15A 1QS0A 5BNWA 3OPNA 4KX3A 1KI8A 5IXSA 2RAFA 1S3IA 1V6SA 1DKQA 6ADHA 2VRWA 1VPDA 4ZICA 1ZMXA 3AR4A 3HGMA 5ICSA 4JGBA 4EY8A 2GDJA 1W4CA 2FFJA 4BFLA 3CTMA 1W581 3X44A 5JOQA 1OAAA 2W93A 4CQMB 4D9BA 4DCUA 4CG1A 4HRYA 1X1DA 4IXNA 4KPUA 2YNMA 4PE5B 4PU0A 1J23A 1JLRA 3RFCA 2NQ8A 3DOCA 3IB6A 1D4FA 2OORC 2WABA 3VU3A 4EG4A 1JMYA 1CUAA 5KOYA 3M49A 2ZZMA 2DRIA 3P32A 4NNOA 4BECA 2JCXA 2HF9A 1WDWB 2V4UA 2WA2A 1UZUA 2O0KA 2AF4C 2W6CX 3JYNA 4OJNA 4PVDA 4TTAA 3NNDA 3TR0A 1SKMA 3MCWA 2EATA 3G3EA 3KPJA 5DASA 4EENA 5BR8B 2IW3A 2OM2A 1KAMA 1N9KA 1VHJA 2HXGA 2WUEA 1RXUA 3X1MA 2BONA 3TOZA 5EJ6A 3O5AA 1DOHA 3E82A 2EQ5A 2N47A 2O2ZA 4D8XA 1IVYA 4EJSA 2HIGA 2QD2A 5ALPA 1GCUA 2VDKB 5GPBA 2VTDA 4KQJA 4PHTA 3RW9A 4NOJA 2C57A 1IB6A 3RBXA 4MW4A 4L1KA 2J9YB 1KMIY 1U4NA 3P5BA 4OUDB 5K8TA 5IN5A 2OYSA 4F2GA 1VRVA 3NIGB 4RPGA 3G9UA 2R2GA 1FCJA 2AC7A 5FBKA