4L4VA

Structure of human mait tcr in complex with human mr1-rl-6-me-7-oh
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
269
structure length
262
Chain Sequence
RTHSLRYFRLGVSDPIGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of vitamin B metabolites by mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 73
structure length 262
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l4vA01
1RZ7H 3TBSA 3LY6A 4FZ8H 4D94A 4UQ3B 2AV1B 5FYLH 1TVHA 5F7WC 4O2CA 5JW5A 1WWAX 4MD5A 4PUBH 4G7VL 4XWOD 1VA9A 3Q1SH 4OCWH 5FHAL 4NFBA 1T1XA 1BZ7A 3GO1H 1S8DA 3HUJF 4Y88A 1XMWA 2A77H 3S34H 1JNJA 3QDMD 4H26B 1WICA 1A21A 4G6KL 4MAYA 4NZRL 4N0FB 1Q9OA 3P77B 3BJLA 1T7YA 4I9WD 3MRPB 4JKWA 4PRPB 4X6FA 2AQ3A 4P2YA 4BH8B 4FFVD 4ERSL 3UPCA 5HPMB 3GKWL 5I1AA 3S97C 4AEFA 1QHOA 1MCRA 3WNOA 5JZ7D 2ARWA 4PTTA 5EU7C 3SKOA 4YQXH 4MHHG 4HIHB 3KLHC 4W6WB 1U8OA 1CDJA 4JGJA 4IDJH 3QDJD 3REWA 3VFGL 4J3SA 4HJJL 1DJSA 3ERYA 2ICEA 2LE9A 1IBGL 5DMJB 3VG0H 2BXYA 5DZOA 1A6WH 4WWKA 1RUPH 2PW1A 1A6ZB 3UPRB 1HHJB 1T0MA 1F6AA 3SY0B 1JRHL 4QRPE 1A8JH 2KBGA 2YD4A 3U9PH 1KENH 4ZAKA 2AJXL 3SE3A 2DKSA 1QLRB 5E56A 5C0GA 2P8MA 3JWDH 3MPCA 3STZA 5EC2B 4KRPD 5SWQB 1FAKT 5HHME 1C1EL 4QXGH 1HINH 4GRWE 1NUFA 4PJEF 3KLDA 4R4NC 2YN5A 3AUVA 2FIRT 4KUCF 5IM7B 1G7JB 5C0IB 2W0LA 4NN5C 1CGSH 4WI3A 1U93A 4X0KA 3KDMA 1UCBH 4X7FC 1YEGL 1U58A 1FORL 4S1RH 5ILTH 3ULUF 4BFEA 4K3EH 4ZO8A 3QEUB 4X5WB 2WP3T 3SGJA 4OZGB 4A6YA 2VUOA 5F7DA 3TPUA 3ARQA 1CTOA 4R8WH 3L3JA 1KB9K 4P5MB 4PREA 3QUXC 4HH8A 4KJQD 4MJIB 4M7LT 2VLRB 1RZKL 1T0PB 1KCSL 2CUIA 2BJMH 4U1HA 3KPSE 3O3BB 1XZ0B 1QD0A 3QHFH 4QXUH 4RX4A 2Z31D 5A3IC 5F8RC 2YWYA 5C0AA 4NUGL 5DJDA 4KXZH 4XPAL 1OB1A 5F3BB 2D3VA 2HWZL 4Y5VC 3REWB 1DDHB 4PGDB 4GSDH 5JW4M 2B4CC 2HT2D 4JVUA 2QADD 4YX2H 3BXNB 3GBML 2CRMA 3VFTB 2FATL 1S5IL 2B1AH 1R3KA 5MEND 5E2UH 2MMXA 3ET9F 5ESVA 5EBGA 3RBSA 1FAIL 3L3KA 3CDYA 4LHJB 4PGCA 2VYRE 4JO3H 5LGJB 2P5WA 2HKFH 3VCLA 4WW2C 4NO3A 4NRYA 4U3XA 3UZVB 5C6PB 1FFQA 4NO0B 2DQJL 2NY1D 1H9VA 2IWGA 4I2XB 1B4JL 2BERA 5JQ6L 4FNLH 4S2SA 2QV2A 5CZKA 4MD5B 3ARTA 1FZMB 1RZKH 1HWHB 2ICES 2OSLA 2YUZA 4NQSB 3I6KA 1BLNA 4TVPD 4YHZL 2QBWA 5IVZA 3BIKB 1NEZG 3BGAA 3T0EC 1XF3A 1DSFL 3OAYK 4C56D 3QR2A 1OGAE 1I9IH 3CFEB 3D2UA 4PRIE 3MOQA 3CCHA 2NY5C 4WW1B 3TCXA 7FABH 2PTVA 4X5WA 4G6FD 5HHMD 5C0AE 3U7WH 4HKBB 3MREB 2VLJD 2W9DL 4PJGB 2CO6B 4YDIL 1HDMA 2GK0B 4K23L 5BV7B 5GS0L 5E5MA 4BZ2H 4YFEA 4LGRB 4LSVH 1DLFL 3LH2L 3BT2L 4MJ6B 4UIKH 3MLXH 4P23A 1G84A 1QUNA 5BZWB 2P46B 5KVFH 4E0RB 5GS2D 4XC1H 3HZYA 4QHMA 4DUVA 2CH8A 3FB6B 3F7RA 2YPLE 3MBED 2CXKA 3C5SB 4G43A 5CZXD 4PJGF 1OAZH 4WHYH 4OKVA 4WRLA 5BJTB 5DZNA 1QSEB 3DX9A 4ZFGL 5DD3L 3RZCB 5JOFB 4QOKB 2C7UB 4MS8D 2Q6WB 1WCQA 5D2NA 1JF5A 1N4XH 1NUDA 5JMRA 1KXVC 1INEL 2E6JA 2B0SH 1WISA 1NL0L 2VABA 2ZOKA 4I0PC 3RVWD 3BRFA 2V9RA 4UDUB 3KHOA 4ZODA 2J8UA 4RMTA 4EDWL 4LRNH 4KMTL 3K74B 1QRND 1YY8A 3BGMA 4GQ9H 3CX5J 4LBEB 5FM5O 1SVZA 4KDWA 2APWA 3BO8B 2J8UE 3DRTB 1N5YH 4FQCH 1QFWM 2DDQL 3QCVH 4PTTB 1N6QH 4YXHL 1HOCB 5D70H 3I75B 5C0GB 2AAVA 3UTTB 4G8GB 1H0DA 5EUOE 2AP2A 1Z9MA 1G6RB 5E5RB 1G7QB 1VESA 3P4MA 4LQFH 4RRPA 1JBJA 1Y6NR 2JELL 4YWGH 4X6BB 4YHPA 2JB6A 4JFOA 4FQIH 4WV1C 4OQTH 4NOBA 3TFKD 4U1JA 3JWNC 1GL4B 1CIUA 2M8XA 1UA6H 2D7QA 5TFSH 4P59H 5DEGB 2A6DB 2ZUXA 5CD3A 1AP2B 3FO2B 3VXSB 4QOKA 5FDWB 1I75A 2B5IB 2J8UF 2XTJD 3QDGB 3DSFL 3QXAA 3B4NA 3MV9D 3W9EB 1H0DB 1ZK9A 3QNYB 3H7BB 1KG0B 2FD6L 4I3RH 3C5SA 3WFBL 3QFJB 3WDJA 4M7JH 3C6LA 1GPOH 2WUBL 1RUAH 3TJHA 3S35L 5GGQH 4GS7C 2P8LB 4IRSD 1YMME 3WBDA 4IM8A 1GC1C 2G5BB 1R5IA 4LP4A 4QOKD 3VI4F 4PJHB 3O8XB 3QXDA 2F54B 5DK2A 3T0ED 4EI5C 3JWOH 3MRCA 4N0UE 2F9BT 5ALCH 1KN4H 2EIZA 1PG7W 5ERWB 2HJFB 5HGGS 4U1NA 4EI6A 4HWNA 1IC4H 1WFNA 4PG9B 3HNVL 4HIJB 1FYTB 4XX1G 4BYHA 5GZOD 2DIBA 4NQSA 1YQ2A 2FYYA 5FO9B 5A43C 2ATKB 1R0AH 5JNYB 2ZJSL 1A7PH 1H8SA 3UDWA 3T2NH 2EE6A 5GQBA 3HI5L 3ZHKA 3PQYD 3SDAB 4QRTB 5FYLE 3PF2A 1MJ8H 3A67H 1E4KA 5ETUA 3ZO0A 2APFA 4IRJC 3MUJA 1JPGB 5ICYA 1FYTE 2FDBP 4HWZB 3NVQA 1XH3A 1NDMB 5GS1C 3QWOA 2KPNA 1CFSB 4MQXC 1X5KA 3VGBA 3X3FH 1FNGA 5HYQA 1IE5A 4KK5D 5IBLD 1ZSDA 5EO0B 1S7VA 1LEGA 4JKLA 1E0OB 5J8OA 5D71L 2F8OA 3CCHB 4W6XB 4GMSH 3W0WA 4L1HA 2EH8H 2JJSA 4JDVB 3RWCA 4P23C 4U1JB 3U7YL 3RI5K 3VXSA 3QQ9C 5HHOB 1U3HC 3WJLC 3RVUD 1G6RL 1VFAB 2A0LC 4EDWH 1RUML 4O00A 3GNML 4IMKC 2CKBL 5C0FB 2NLJB 4LKCB 1A7PL 2CD0A 4JFOB 4U1IB 4L5FL 2WBJB 3RWEA 3BH8B 5FOJA 5SX4I 4EJ1C 1LP9F 5E9DE 2P5WB 3WNNA 1ZT7B 4NKQB 3RA7H 1OY3B 4I3GA 2F15A 1BREA 2CKNA 5IMOA 4LEOA 3T0EE 4DEPB 1BX2B 3EZ8A 5GIRA 3UCRA 5C08A 1J1OH 2QLVB 4WWKC 2WWMD 1EFQA 1VFOA 3NFPA 4M1CC 5E99H 1BZ9A 2ZOKB 1S7TB 4Z5RB 3C5JB 1JWSB 2PCPA 4E5XB 4BZYA 4YHLL 2EDOA 3CFIC 2CLZB 4ZD3L 5FAAA 1RUAL 2NNAB 2J12B 4RBPK 5H94A 3HAEA 2EDEA 3BYYA 1EO8L 2HTLC 4OKVB 5B3JF 1RFDH 2ZCKH 4ODUA 4XP9L 2DQEL 5EBLA 1UWGH 2GJ6D 4HFWB 3WFCL 1OAQL 1TJIL 3STZB 4YBHA 5F7NC 3IFNH 3V5KA 5K9JH 2FLRT 1X5AA 1H5BB 1B90A 1MFEH 1V7NL 1AO7A 1KN2L 1XGPB 1YEFL 4IOSD 5JW3H 1F6AB 2QHRH 3N9GL 4WUKL 3SE3C 3VXSD 3VDCA 1HYSD 1G0YR 3BEVB 1LO4L 1YEEL 4MQXD 3MREA 5IJVA 2H8PB 4ZUUB 1JTPA 5EZIH 1YEJH 2Q7NA 2NXYB 4LHUG 4X98B 5GS2H 4M5YL 1KCRH 4KU1A 3SDXB 3A0OA 5CJXA 4AQOA 4PJIA 3IDXH 3U9UB 4KKNA 1LVEA 4YDJB 3E2HA 1I9RH 2B39A 3CC5B 2HFFA 4LCCB 1B0GB 2GJJA 4PTUA 1JNLH 3GSXA 5DA0B 5E94A 5C0CA 4NZTL 1KTKE 3R4DA 4WY7L 3IS1X 3SQBA 5I1AB 3IJYB 3SDCA 5ESQB 2PXYC 2HN7A 1JZ3A 1PG7H 5C9JA 2F53D 2FL5A 3MLYL 2YRZA 3TZVA 1Q9OB 4JZNA 5EU7E 4L8SB 2ESVA 3VFVA 2EDDA 3CJJA 3RWGB 1YNTB 4Y19D 5JHDA 4PB9L 5F97E 5E08H 3EYQD 4L29B 2QKIA 5D5MA 3CVHL 5ADOL 5TDOA 3VXUA 5C0RH 2IMMA 4O02H 3SE8H 4JPVH 3ZT6A 4PJBB 4U6VL 5SX4H 1GCFA 1RJYB 1HIMH 3CFKB 5FGSA 1TCRB 5C6TH 5FXCH 3P0VL 5LAXB 3X14B 3BIAX 5IJKC 1NFDF 5I1IL 1L0XA 1U8NA 3CVHH 43C9A 5E00A 2E7LC 3WE6A 3P4NA 4GAYA 1H5BA 3RWDB 4KV5F 5T3XL 4H20H 1F6LL 3F7PC 5DTFB 5C0BB 2Q3ZA 1K4CA 2GJ6A 1NFKA 2IPUG 3MGTA 3CH8A 5KBNC 1HH6A 5ISZE 1JP5A 3P4LA 5CP3H 2A6IB 2XRAL 2VNCA 2VDQH 3C87A 1FZJA 4WV1A 1B0WA 1WIOA 5ADPL 3U6RB 1XGYL 2EDLA 3MODH 1UENA 4G9DA 2WINB 3QXWA 1I7RB 2E27H 4OFIA 4PJGA 3MROA 2FNBA 5E2VH 1AJ7H 3TWCL 1QBMH 3BD3A 4U6VH 1CG9B 1VFBB 4JFFA 4NNYB 3TO2A 1JNHA 1DBJH 4PS4H 4DCQA 1IAIM 3GK8L 2E7LA 4R7NB 1UM5H 2NY3B 5J11C 2N56A 4JY4A 3G6JB 4GKSA 5HGAB 5EZIL 5JLZB 1NAMA 3TJHC 3G6AA 1IILE 2ESVB 2NY3D 3QJFB 1DVFD 4MS8C 4X6DA 3FAXA 1C5DA 4OCNC 1NBYB 5I8KH 2VXUH 5JHDB 2C3GA 4JO1L 1IM9D 1NGYB 4MNQD 3SE9L 3R0NA 3EJYD 3MYJA 5DJ8A 1FVEB 2BX5A 5FV1L 1G9EA 2H41A 3NA9H 2R0WL 3SY0A 4F3FA 4LIQH 2VLMD 4N0YH 2VDPL 4XMLL 4KQ4H 3TZVD 1OTTD 3GO1L 4FQXB 5GGVY 4JFQB 3PP3K 3WHXB 2WANA 2B7DT 1OSPH 3V5HB 1RIUH 5L7XL 4FFZL 3MR9B 4NPYB 3F6LA 3IXTB 1CD1A 5JXAH 4XP6L 2QQLH 2Z31B 3SDAD 2EE3A 3T2QA 5EUOA 1QFWI 3MC0A 2DWEB 1E4JA 2VLRD 3QNXA 3UC0H 4OB5H 4X80L 1EHXA 1JWMB 2DKUA 2ZG2A 5E6IA 4RMQA 2N1KA 3GSUB 3MRHB 4A6YH 3LVEA 1B9ZA 2VN4A 2V7NA 1A3LL 1NSNL 3QIWA 3R06A 4WFHE 3LKNB 1F4YL 5C0RL 4RAVA 5I1HL 4U1HB 3E2HC 5HHOE 4LEXL 4BELD 1CFBA 1NPUA 5BMFL 5FEBA 3WNLA 5KTEL 5EB9A 2RAMA 2P42B 4P3CH 4NNPL 3L3GA 1NAKH 3OKLB 3LQZB 4L3CA 3S9DB 2EH7H 4Z8FL 4UQ3A 4KDTA 2B2XL 3O2DL 5JQHC 1U3HA 1KJ2A 4XP9H 4HBCH 4ONGL 2QSTA 4LHUA 4HUWA 3V0VB 1ZVSB 4JLRA 1KB5H 2NY6C 5IJVB 1I8KB 4AENB 3HPJB 3O4OC 1GZPB 1I1YB 1YNKL 3O8XA 3P0VH 2EEAA 4NM4H 5IM7A 2C3WA 1FZJB 3MJ9A 4IMLA 1P7QD 4LAQH 5BRZB 5IHUL 1OCWL 5IF0B 3I3BA 2YPLD 3VXOB 1EJOL 2A9NH 4Y4KC 4BQBA 5HYJA 5GGTH 1MJUL 3X12B 5C92A 2ZOLB 3MJ8A 3CVHB 1R0AL 2P8MB 1AE6H 2XZQH 4L9LA 5K9JL 1L7IH 1JWUA 2FEEI 3D0VB 4OF5A 1N5AA 3E6FA 4PJ8D 4S1QH 1JPTH 3DX7B 2YC1B 3GMOA 4J6RL 1ZHNB 3N9GH 4WUKH 3ME0A 3T77A 3U7AA 3VRLE 4TVPL 1JMXA 4R90H 3RWEB 1WTGT 1T1WB 1QHPA 5HYIA 3KYAA 3K0WA 4L4TD 4RGMB 5HGDA 5GS1A 2VO5A 5B38A 1SJXA 1RUMH 4ZPVB 5D1QD 3MA9L 4RAUA 4PJDB 2W59A 1QSFA 4R26L 5J13B 1MRCH 3O2WH 1XGQA 5IT2H 5F9OH 1LK2A 3VE0A 3S36L 3B2UD 3MLVH 3VGEA 4NBXB 1JNLL 5BVJA 2FB4L 5B39B 2UZIL 5TPWH 3QDMB 3O9WB 3QDGE 3CAFA 1BF2A 1UYWL 3VXNA 4XP5H 4K7FB 3MUHL 1MQKL 3VA2C 1L0YA 2NQCA 2OI9C 3KWWA 4HJGB 1EEQA 4LVEA 3DURA 4AMKH 2YSSB 3DECA 2H3NB 3HZVA 3MTRA 1IQWH 1S9XA 2XN9B 4AK1A 4KH2A 1FL5A 3G08A 1JPGA 4H8WH 1VHPA 2KDGA 2V2WB 4PJFB 4PJDA 2ED8A 5D5MF 1RJCA 1T4KA 1Z3GL 1VGKA 3MBXL 4XZUA 5DGRA 4WO4D 5JW3L 4BSWB 1EH9A 1MVFA 4Y4KB 4P3WA 4P9HL 5E6ID 4JKPL 1OAXH 2YPLA 3HNTL 3ZYZA 4P2QE 4KZEH 2CRIA 2MJWA 4G9FE 2VR5A 1B6DA 1D5XA 1I7ZA 3FT2A 2GQHA 4YIQA 3PV6B 3VGGA 1FNEB 1A02N 2NZ9C 3Q0HA 2OZ4L 4HAFA 3DYMA 4X6CF 3V52L 2AJZB 4JFZL 3GJFH 1J11A 1PZUB 3CVHA 1T1ZA 4HZAA 5I66B 4LHUD 1EFXB 1MIEL 3UTPD 1SM3L 3BPNC 3RDTC 3SO3C 1U6AL 4OLXL 1CDUA 2SEBB 4E41A 4HUXB 2O5ZH 4XNUH 3K3QA 2KZWA 3O11B 1KYOK 3FO1B 4QEGA 4EI5B 2Z8SA 5EZLA 4HFUH 1MQKH 1X5XA 5D93C 3JUZA 3W0WE 3TF7C 3MJ9L 2FRGP 1A6TA 5GGQL 1KG0A 4AH2B 3AREA 1X5IA 1G7HB 4HIEB 3V7AE 1W2KT 2V2TA 4PBVC 5TE7H 3QFJA 4RDQG 4X6CB 5IP4A 2FH6A 5F3HB 1J1PL 2JF1A 3LEYH 1FNEA 2IFFH 4OZHF 4NO0D 3QIWC 4PRDA 4ZOBA 5F96L 2ORBH 3ES6B 5JXEC 1FNHA 4JKPH 4L5FH 5E2WH 3TVMD 4ENED 1VEOA 3JUYA 3BKCH 1U2CA 2OL3B 1V05A 3CFDB 3N1QC 3NFNA 4XC1L 2VZSA 2D7OA 2BY1A 1VGKB 3AROA 5E6ZA 1OCWH 2GJZA 4MVBD 5A40E 2QTEA 3EDDA 1ZA3B 4MXWH 2GFBB 1G7IA 3DVIA 5MI0B 3D5OF 3BT2H 5FYKE 3GB7B 1FLRL 1KN4L 6FABH 1J1PH 1WBZB 4BUHA 3NIDF 1LE5B 2MTPA 4QRUB 4X7SH 2CLVB 5D7LA 4AZ8A 4F33B 1IGYB 5DQJA 1LO0H 2OR9H 4PDCE 1WCBB 2HAZA 3NGBB 3BP7B 1NC4A 2NTSP 5MENA 5DFWH 3DO3A 1FFNB 2VXSH 5DHYA 1NJ9B 5KSBE 2ZZUT 4PJ7A 5CCKH 5C0FA 3ZTJH 5DUMH 1G0XA 5MHSE 3KS0J 4NYLA 4GQ9L 1F3DH 4MLSA 4MXWL 4HKJA 4PJEB 1YEKH 4PGBB 4H5SB 2FX7L 2ESVE 1H3WM 1WK0A 4F57H 1KELL 3TGXA 3TCLB 1ACYH 5C0AB 1FL6A 4RRPG 2ZJSH 4XXCC 1HSAA 2H32B 5CZVH 3TA3A 5E9DD 1AD0A 1U3ZA 2EEBA 2PW2A 2RFXB 5T33L 3ZKXB 1MCOL 1YPZE 3N06B 3RZCA 5GSRB 1PKQE 2IAMA 3RI5F 3ARFC 1R5WB 2AKRA 3ULVF 1WBXA 4OFKA 1IQDA 3B9KD 5KTEH 4XP5L 4OZFH 3R0MA 4OD2B 3PL6D 5JO5A 3VXOA 1A6TB 4BJLA 2XNAA 3L3JB 4YO0B 5L8KB 2OXHA 2EO9A 5DFVD 5I76B 3BPLC 5BVPH 3NABH 3V6OE 4OZ4A 3PWVB 1MREH 4L4JA 3RZWA 1YJDC 1I8MA 4IMLB 2CIKB 1V3LA 2WIIA 3MRGA 1S7QA 4NKIL 2YPVL 4OLWH 1I9EA 4NN7C 2A74B 2GCYB 1R3HB 4PV9B 5F7LB 3TNMA 1DEDA 4Q0XH 3VDBA 4JO4H 3MQIA 3ZE0E 5EG6C 4G8GD 3QNZB 1IC7H 4ELMB 5C1MB 2YBRB 4JAMA 1E6JL 4GJTB 3SBWA 5DJXA 5GSVA 4BH7A 2OBGA 4N8CH 1X9QA 1L7IL 1NFDE 4I2XE 1FN4A 3E6HB 4Y5XB 2IH1A 1NGXB 4MYWB 2ITDA 3GHBH 3VXSE 4PS4L 3ORJA 1EHAA 1YYLL 2D4DA 3AC0A 4GRLD 4GT7A 4Y4FB 3HR6A 5B8CB 1HXYA 2F8XC 5I2IA 1NDGA 1DBBH 4I3SH 4NO0A 4JRXA 4XCCH 5ADOH 2Y06L 4WW1A 3GSUA 5D6DA 4MX7B 4L4VE 2LABA 3U82B 4OGXL 3IDNA 1Q0XL 3ARBB 3D25B 3FO9B 1NCNA 1NEZA 3LOWA 3QUYC 5K9OB 1C1EH 5JXAL 4X6DE 3LKOB 2DJUA 3OKDB 3TN0A 1L8JA 5JR1L 2GIYA 1UACH 2OP4H 5GRZA 1MRFH 5DHXB 4ZUWB 2GKIA 4GKNB 1DN2A 2QSQA 3BPLB 1H15A 1MAMH 2GT9B 5C8JB 5LCVL 4ODHH 4WNQA 1M7XA 3EIFA 2APVA 1ZHKB 4YUEH 1FC2D 4N0FA 4Q9QL 2O26U 4YPGA 1EVUA 5C0CE 3MYJB 5DJ8B 3QJHB 1KB9J 1NCCL 3IFPA 4GBXC 4UNUA 5DD1H 1P6AB 2EYRA 3U4EB 4P3CL 1NGPH 1VEPA 1QNZH 5KN5B 5AYQA 5IUSA 2X44D 4NC2B 3MRRB 5A2KH 2QSCL 4NHUB 4MXVF 4WUUB 1QBML 4HXBH 4LHQB 5GGRY 2HT4D 4LSTH 4P46B 4O2FB 4U6YB 1J1XL 2P5EB 3M07A 2H2SC 1FORH 3C8KA 1YY9C 4JRXE 4FFWC 4HJJH 4S1DD 4O02L 3BDXA 2NR6D 4XPAH 4NQCE 2NY1B 2ADJA 4NHUE 4HV8B 4HIIA 5CMAA 1MLBA 4NC1C 2C3XA 1QNZL 3B9DA 5E08L 4FP8H 4X5XB 4XNXL 5JOPE 4ZAKB 5FGRA 5JIKA 2R69L 4K8RD 5IVXB 5I9QC 4GSDL 1ZLWH 5E00B 2YD6A 4PRIB 2HVKB 4EKXA 3L5IA 4CN1A 4PJ8C 4LIQL 3VGAB 4OZGA 1OP5K 2XOTA 1I1AB 3I2CL 5J6GB 2BSSB 2GT9A 3LKNA 5C8JA 3QJHA 1QBBA 4JANB 4PBWD 3KPSA 3QFDA 4ODXA 3PGFL 5C0IA 4JM2A 4H5SA 5C0EA 1B4JH 1FZKA 3PQYA 3OKDA 3TN0B 3HAEH 3L3HA 4KTDH 2VXTH 5LKNA 5IMLB 2Q7YB 3NIDE 1XGYH 2XZZA 5DFTA 1VKXB 4XVSH 1AXIB 4WCYL 3DUUB 1OTUD 3O4LE 4X4ME 5I0ZA 5IBLC 1RZIB 1V7NH 2EDWA 1ORQA 5BO1H 1OQOA 5FYLD 2XA3A 3KPQB 3ESVF 5B39G 3I9GL 1UQSA 3T4AB 3TFKA 3LN5B 3LN9A 4XC3L 4YC2B 4PJXB 4LVHC 1MIMH 3AAZB 3SQOH 4S1SL 5HPMA 5JPMB 3MRNA 3O6KH 3B5HA 1CLZL 4OZIF 1ZA6B 3GJFB 5CLTA 5T1MB 4NZRH 5HGBB 1R3IH 1C5DB 5D7IB 4G6KH 4TVPE 1F8TL 3ROOA 1KEGL 3MJ6A 1MFDL 1NAMB 4EN3C 4PJ5B 1WVZA 5F6HI 1UEMA 3MGAA 4NZTH 4YDJA 2V17H 5LVEA 4PJCB 4ZFFB 4PTUB 1GZQA 4QF1B 4KRPB 1SEBB 2EXWD 1FO0A 1S7VB 3NH7H 1R3HA 1Y0LB 3QIUB 5D96C 1G7HA 1AR1C 3IXAB 1E4XL 1HIML 2P48B 3GI8H 1MCCA 1BFTA 3SDXE 4YJZL 5DDHB 2YA1A 3A6CL 4ZUUA 4F7CB 4QLRA 4BUGA 3W2DL 4HCRH 2J2ZA 1F58L 4ODHL 5GGUB 3P11H 1ZMYA 1Q9WB 1LEKA 4H0GA 3G6DH 5DJXB 1RZJC 5IB3A 2BNUB 3O6FC 4OLYL 4O9HL 2PO6D 4I48B 2F74A 3QUMA 4LDLB 2NTFA 1HSAB 2H32A 2QL1A 3JWDL 4QRRE 1QRKA 2X1WL 3KJ6H 3LEXA 2XWJB 4OFYA 5FO7B 4QHKI 5I71C 4GRMA 4DKAA 1D6EB 4JZOA 1Y18B 3V95A 1CWVA 2KQNA 2DLFH 1YEHL 3EOBA 3C6LC 4UNTA 4YZFF 4ZFZB 3MRCB 3C5ZA 5HJ3B 3SDDA 3KDMB 2HFEB 4M5YH 4R2GB 4NCDA 3L7EB 2NR6C 4IRSC 4LAJH 5DYOA 5H35A 3I6LD 3NIGE 3PHOB 3R8BB 2EH8L 4JM4L 4NO2A 3MLSH 2IJ0C 3QHTC 3RZCC 5IGXL 4PRNA 1NKRA 5TGBA 3ZYJA 2ARJQ 1N7ML 2E7CA 2AEWA 1A7NH 3OXRA 4OZFG 4P2RB 3CLEL 3BDBA 1U8IA 1FBIH 1PJ9A 2DICA 3RTQB 3T0DA 1S7WA 2R2EA 4J4PA 1I9JL 1PYWA 4V3DB 2CMRH 3W9DA 4OBRA 4LIQE 1HK6A 5JORB 2YZ1A 5ACMA 2XPGA 2D9QB 5E8DL 3MFFA 5E8OA 1IT9L 3AREC 3ULVC 4OQTA 4U6HB 4GW5A 4HS8L 1UM6L 1WBYA 1M6OB 1INQB 1PG7L 5GRJH 3UTTE 4IHOB 4DGYH 3LIZL 1EMTL 1NJ9A 4GKOA 1KEMH 2HLAA 1DQQB 4V1DE 4LCWD 3BDYL 1RSFA 2YC1A 2VITB 3DWTA 3FT3A 5TJWK 5HGHB 5AD0B 2PXYA 4QRUA 1TNNA 2ZUQC 1ED3A 4CVZB 3SGDH 4LLUA 1MCLA 4HH9A 3T0AA 3MRMB 2X89D 3MJ9H 1LO2L 1NLDH 3I3EA 4Q2ZB 4HFUL 4LVNB 2FR4A 4JFEA 4KZDL 3AY4A 5IESH 1TPXB 2NY6D 5C0AD 2I5YH 4PRNB 1WJ3A 3VRIB 2GI7A 4JY6A 1Y6KR 5E8EA 3UTPE 3RY6A 3BPOC 2LU7A 4H88L 1NMAH 4NZUH 5IVXF 3ARDD 5JIHA 1PX3A 5DC0A 1N4XL 4JJ5A 1AHWB 4PGEA 2ORBL 5F96H 3MJ7A 5FO8A 3TBSB 4G9FB 4LSPH 1Y18A 2NW3A 5CEZE 4LNRB 5D4QA 1QBAA 4H0IA 3HNVH 4CW1B 1BFOB 2Y72A 4Q6IA 2DM3A 3UJIH 2HJFA 5J9PB 2GITB 5HDBF 1QACA 5EC1B 4JREB 2VDLH 4G6ML 4K3JH 3VWJD 1N6QL 4PJFE 3KXFB 5E8EB 1DVFA 5D7JA 3TA3C 4JRYB 5DRWA 1D7FA 4E41B 1C16B 3BQUA 3PXHA 1E4KC 3PHQA 4DUWA 1WLHA 2JTDA 2WUBH 3FT4A 4QHUA 1LEIA 1BQLL 5C07A 4P2RE 1MLCB 3CIQA 1S78D 4Z76B 4XP1H 5IB2A 1S9XB 4HH9B 5TQ0H 1FL3A 1KXTB 2YMXL 4LVOB 2WBJC 2Q86A 3F7VA 1T5WB 3ULUD 3VXRD 4E41E 2J4WL 1F97A 2P7TB 4YHYC 4P57B 1CD9B 4QF1A 4YGAB 4EUPG 3WXVL 1IGJA 3OF6D 5DQ9B 4KK6C 3U0PA 4L3EB 2R0ZL 1KJ3H 4KAQL 1JK8B 4ENEC 4M48H 2NY4C 4L9LC 4GOSA 5ELIA 4L8CA 1V5JA 2JB6B 4LSUL 4XGZB 2V2WA 2CKBH 1UJ3B 4ZXBD 3G9VA 3QQ9D 5J12B 1T2JA 2DL2A 2ATPB 4J6RH 4WGVB 1S7UA 2P24B 1C08A 3PGDB 2XWTA 4OLZL 1EFXD 4NM8H 1WSST 1H3VA 4DGIH 3QUZA 4TUOA 5DLMH 3LEYL 5ALCL 2NY4B 4L9LB 3P4MB 4IBLT 3BVNB 4FXGA 5H2BB 5BS0B 4IOIB 2NY7L 1X5HA 1YECH 3HA0A 1ZHBB 4W6YB 1RIUL 4ZUSA 5KSBF 3S36H 3DETC 1CICB 4ZDHA 2YD3A 1RZIA 4R26H 3DV4B 3MA9H 4HEME 4WTWA 2UYLB 3BO8A 5GS1B 3WFHB 5ITFA 1TZGL 2HKHL 2FJHB 2V5YA 3EOBB 4IOFC 5EUOF 1IAMA 5KS9B 3VG9C 2Z31C 4J3TA 4GRMB 3MOBH 1E4XH 1KJ2B 5LBSL 2F54D 3U6RA 3S37X 3O8XD 4WHTB 4HDIB 4F7MA 4Q6IB 1AKJB 3SDYL 2NYYD 4JLRB 2NTFB 3QDJE 2BVOA 1I1AA 2HRLA 3X11A 5FO7A 5D7IE 4U3CA 3D85A 5MEOB 4PY8I 5FO8B 1K4CB 3T1FB 2GK2A 2ITCB 4WIQA 2R9HD 2FZ3B 1ZLUH 1YPZA 4V2BA 2NXZB 5KVDH 5IW3A 1FDLH 1JUFA 1Q0YL 3IKCB 1NLBL 1A7OL 3RWFA 4S1DC 3WV0A 5DRZB 1CLYL 5DJ0A 1Y0LA 3QIUA 4L4TB 4WU7B 4XNYH 1CT8B 3DX8A 4DFHA 4LLVB 5JA9A 5E70A 3RJDA 4MVBA 4Z78A 1JWMA 2BSTA 4KRNA 4NO5B 2YN3A 4HUMB 5GHWL 1XFPA 4HWBH 5FV2A 3MRIA 1J05A 1EHNA 2EDQA 4HT1H 4PLKC 5CJOH 5DURD 4P2OB 4U1SB 1T4KB 4H1LH 5EPMA 1ZLUK 3QG7L 1CGUA 1NH6A 5BRZD 1KT2A 4LU5L 1K3ZA 1RULH 4U2YA 4PJIF 4K7PH 4KK8D 1P4LA 4TVPH 3EGSA 4M9OA 2V7HA 4U6XB 2IADB 3THML 3ARED 1QO3A 4LSSL 5JLZA 1IL1A 2JJTC 3V6ZA 3QQ4A 1FVCA 1TQBB 1F6FB 4Z7QE 1T2QL 4P4KC 4ONFL 4MXQD 1OP3K 2X4PA 3KPQA 4Z18A 1XGUA 5IFHH 4X7DC 1VKXA 1S5HA 5K9OA 3WFEH 5A2JH 3RZCD 1HYSC 3BZFA 2OYPA 1HZHL 3BH9B 4QRSB 1AI1L 1Q9LB 4J3OC 4TSCH 2JK5A 3DX8B 3BPCB 3CX2A 5FA3B 2BVYA 1KCUL 5E4EC 3RFZC 5DJDB 3BZEA 5JHDE 1WUNT 4GXUM 1S9VA 1CYGA 1O7VA 4TN9A 2AW2A 4DVBB 4POYA 3AB0C 4HBCL 3WNMA 7FABL 2ENSA 3OJDB 5EU5A 4FMFA 2FZ3A 5C09D 4R0LA 2E9WA 3CSGA 2KKQA 1IM3A 3O6FD 5J11B 5HHXL 2VLJB 2DWDB 3BPOB 2G5RA 2BXZA 2ZOLA 3BKML 3EDEA 3MJ8B 5EOCL 5F7DB 3TPUB 3X11B 2V5MA 1DCLA 2WQ8A 3IDGA 4R7DB 2R39A 4R4BA 2VLKE 1JF6A 2VXTL 1I1FB 5T1LB 1JE6A 3PNWA 4PJ5E 4X0KB 1U95A 2E27L 5I1EL 1CF8H 1KTDB 3F12B 5H37H 2R56L 4GW4A 2WLZA 2VLKA 4EVNA 35C8L 5GGSB 2G75A 3CFKA 4G80B 4HS6A 4OZ4B 4TSCL 3UC0L 4OF0A 1RU9H 4JHAL 3AS0A 1AR1D 5L6YL 1U3HB 4TPRH 3PL6C 1R3JA 3MUGA 4CDGC 5C08B 3WFCH 1NCAH 5F7YC 5IFHL 3RDTB 1KPVA 2DAVA 3EJZD 1J0IA 1A4KB 3MRLA 1R5WA 5FGCE 2EDFA 4NQXB 1A7BA 3CFJA 4Z95H 3QQ4B 3MLUL 2NXZC 2DQFA 2WUCL 4IJ3B 1NCWL 2Y25A 2EZ0C 1FL6B 2CIIB 4M4RA 3SGEH 3VRJA 1JRHH 4YBQC 2Z0BA 5EN2B 1A6WL 4QRSA 4QTHA 4Y2DB 5KSBB 4LSTL 3IJYA 4HWEH 4GRWH 3V6OC 5FCUL 4U3HA 4KK5C 1V3JA 4L8BA 4GO6B 2JK5B 3BPCA 4LLWA 5CBAB 1MHEA 4LCCA 5C3LD 4Y4HB 4J2XA 5FOBB 1GC1L 2OTUB 2X4PB 1UKSA 2EIEA 5AUMB 3BEVA 1A6AB 1JNNL 3S98A 1KPRB 4I0CC 3IU4L 3O6ML 4QYOB 3EYSL 4Y16C 5HDQL 4RZCB 4PRHD 4G6AC 4LLYA 5LWYL 2COQA 1CICD 4J4PC 5SWZB 2DQTH 4FZ8L 4UOW0 5EH1A 5JR1H 1NGXA 1PD6A 4F7TB 1K8DA 3GSWB 4XHJD 3BUTA 3QNZA 4ELMA 5IR1A 3V0WL 1W8NA 4OIIH 4N0RA 3MLRH 4FABH 4OLEA 3MRIB 4LCCC 4JN1H 3DOSA 4RQQA 2AK1H 1S7QB 2PR4L 3CZFB 4X99B 3MGOB 1RZFH 4Z78B 3H6JA 4W4OC 4UTAH 2ZNWA 3MOBL 4ZXBB 2DF3A 5LBSH 1FV1B 3BP6A 2FECL 5DQDL 5LGHL 4P46A 2AEIT 3CNKA 3FO1A 5E2JA 1HCVA 1U8HB 3VXMD 3MGTB 3B5GA 1HXMA 4QXTB 5B22A 4RFNB 1JHLL 3KYMA 2WAHA 4N0CD 5IFAH 2JCCB 4S10A 2PYED 4KVCH 2XI9A 5B3NA 3O3AA 1QR1B 3O4OB 5DVOA 3V5DB 3NCYP 3DXAD 3QNYA 4XNMA 4XX1E 3QDJB 3RUGE 4NJAL 3ZE1F 2OZ4A 3TLRA 1IZKA 4Q74A 3EW3B 4FZEH 3THMH 1ZEAH 3FQTB 1PFCA 4LKCA 5D1XA 4X7CC 4APQA 3L5WA 2MCPL 1H3XA 5CIPB 1NCUA 3OHXB 1JGEA 4O58L 4PRPD 5EA0H 1HQ4B 1QPXA 4R97C 1FGNL 1LMKA 1F11B 2CLVA 4LCWE 4P2QB 4ZOCA 1IGJB 2NY0C 4YDVA 3OAZH 4I5BB 4EZMA 1MNUL 1XF5A 2VAAB 1WCBA 2XQYG 3CDFA 4YGVA 1KNOA 1BD2A 1IGIL 1YEJL 6CGTA 5K59E 4H88H 4DN3L 3PE9A 5F93C 3GIVB 4YR6A 5CIPH 2OK0L 3T0WA 3H3BC 3HC4H 3PWNA 1PQZA 4ZOAA 1J12A 3MCLH 4XGZA 1VGEL 1X5ZA 3L7FB 4O5LH 4OLXH 2F5BL 4YAQA 3TFKC 4ETYA 4H25A 3BMVA 1I4FA 2H32H 3ZE0F 4P2QD 5DXWA 1P84K 4L3EE 4DFIA 4Y1AA 2IPTH 4XRCB 5HHNA 1IGIH 1U8LB 3LIZH 1AFVH 1GOGA 2ZG3A 1PEWA 2VISB 2F19L 1T04B 5E1HB 3BKJH 4ZD3H 3S8WA 3HZMB 3SGKC 3Q5TA 1XGTA 5BQ7A 4C4KO 1MCWW 1PEZA 2VDRL 4FTVB 3U48A 4TUKL 3DXAE 5DD6B 3T3PF 4DOHE 2P8PB 4LL9A 1M05B 5FKAB 1RIVL 2AJZA 1K4DA 4BFBD 4NC1E 1IQWL 3VH8A 5E2WL 4DW2L 1N26A 3VGHA 1D6VL 3N1FC 1LK3H 5IBTL 4HUWB 2IFFL 1RD6A 2YD7A 3VXMB 1NBZA 2VISA 4P59L 5H37G 4BSJA 1ZT1B 2EDJA 1HEZB 3MV9A 4LSQL 3RVUC 4EBQL 5T3ZH 4ELKA 5KVEL 2IPTL 1WAAF 2NX5A 4RWHA 5IHLB 2W1NA 2R4RH 2ZUUA 2Y36L 3RGVA 1T83C 3P11L 5IHZB 4X7EC 4KC3B 3ULUL 1FPTL 1IEAB 4X6CE 3RNKA 3VFOB 4ALAH 3DJ9A 5T1MA 1WEJL 7CGTA 3MRFA 2AV7B 5KAQG 1QP1A 5I9QB 2HTKC 4KRLB 4DKFL 4ONHB 2V7NB 3KNBA 1IGTB 5DQDH 2X4TB 2OJZH 2ZCLH 4TUKH 3C5ZC 2AJSH 1YN7A 3ESUF 1C7SA 1AO7D 4G8GA 5T5NG 3DROB 2F19H 4YFDB 3OXRB 4P2RA 1QQDA 4OT1H 2GFBA 1CZ8L 5I15H 3SDCC 4KJYA 9CGTA 4UBDC 4R4ND 1MJ8L 3RNKB 2X7LA 5TQ2L 4JZJB 5HGDB 1VERA 3RIAF 1T2XA 1XGRA 5KSBA 2A1WL 3WFZA 3HFML 4JFPB 1UWEL 3LN4A 1ZS8B 4G3YL 1CLZH 2JELH 4YWGL 4GW5B 1FHGA 2BSED 3O6KL 2PTUA 1LD9B 3EYSH 1CBVL 4JFDD 3GUTA 3QWQB 5B4MD 2FSEA 3GMOB 2C3VA 2UWEB 2NY5L 5CJBA 1S7XB 1G9MC 4HQQH 1MFDH 5ACZA 3PXJA 3WIHH 5HGAA 3HC0B 3MV8E 1U8HA 3UO1H 3HMXA 4P23B 4HF5L 3VGDA 4AEEA 1LWRA 1Q9WA 3U30C 4BK4A 5KSAB 5T1DL 4Y16B 2VZ3A 3T65B 1HNFA 1MCKA 1YQVH 5I1EH 4W68A 1IAKB 4XPBH 4OCXL 1K8IB 1U41A 3FQRB 3N85H 3PHOA 4IEFB 4HZLB 3S37H 5FUOL 1EAPA 3RDTD 3D3VD 1A0QH 1I7UB 1H5BC 1KTDA 5J1TC 4LCYA 2FD6H 5D1ZA 2DD8L 2Q8BL 4LFHG 3B5TA 5EFIA 2A6JB 1A1MA 2OJEA 4GG6A 1CFQA 4NQTA 2IQAB 5HSFA 3MLTB 3UTSD 4ZTOL 2X6MA 5EO1B 4OV5A 1OW0C 4C57C 1CQYA 2WY3A 1MY7A 4HMDA 1A3QA 4JQXA 3TBVA 1SY6L 2X09A 1X4XA 4RCAA 3LKRA 5IK3A 4P9ML 4D8PB 3VI3E 4MJ6A 3WFDL 1KOAA 4YR6B 1GHFH 3MRHA 4F7PB 1GAFL 5LAXA 1A6ZA 3X14A 3ZTNH 5I30L 4QNPF 4HK0A 1K2DB 3O6MH 2UVFA 1XR8A 1AY1H 4LASH 3WFEL 4BQCA 3MLPA 3BP5A 4XVTL 3VFSB 1XF5B 2ENYA 3I84A 3QRGH 1UT9A 5FIEA 3BW9A 2PXYB 2B1AL 3B43A 4TUJB 3LKSA 3SCMC 4WWID 5I17A 2Y7QB 1CCZA 4Z9KB 4UV7H 4HD9A 1UB5A 3V6BR 5DD0L 2EEDA 4KMTH 3Q6FB 1BD2D 2EKJA 5HYEA 3DVFA 1RK0B 2DRUA 5T3XE 2F8VA 3S3SA 2J3SA 1MVUA 4U2ZA 1DQML 2W0KA 4OLVH 1XF1A 2E3VA 4Z0XA 3F7QA 3ZLQC 3KJ4C 1MCHA 2BOCB 1T89C 1TQCC 1B0RB 4KGLA 2VLLB 3BKMH 2BFVL 1D3CA 3EO9H 4M61B 3IKKA 2JIXA 4NDMA 5EOQL 2HP4A 4BZ2L 3DARA 4Z7VF 1MCJA 4G6FB 4APQD 3GSNA 3RL1B 2AV1A 2FLBT 5INCB 1FE8L 2K7PA 4PJXF 1RVFL 3FO0L 1P9MC 3O4LB 2I9TA 2YK1H 1CFQB 3ARFA 2WW8A 1F58H 4TULL 4JFFB 1UCBL 3TO2B 3L9RA 4Z7NE 1NGZA 3LH2H 2NY2C 4YHIB 3D18B 5IVOA 4F7EA 2WNGA 4PJ7E 4ELMF 1HZHH 5LGHH 4R96B 1YZZA 2A77L 1VACB 4MDJA 3ARBC 2K1MA 3IDMA 4BQ6A 4FFVC 1IC1A 3O6LL 3WDHA 2V9TA 1S9KC 5I1LB 2PYFA 1TTGA 2GTWB 2XA8L 4P5TC 5CSGA 3KVQA 4R4BB 3TIEA 1KCVH 2D7TL 4AEIH 4QCIB 4W4OA 1EHLH 4N8PA 5EU4A 4LSSH 3SDYH 2DD8H 3KPOB 1UADC 4RNRB 1YPZF 3GUTB 2DLHA 4JPWH 4MSWB 5F70A 4YHKL 2YUVA 1RI8A 4Q9QH 2DQJH 1MHPL 3DYPA 3PIQB 3NGBC 4X9BA 1RMFL 4XNYL 1U36A 1OARL 4JFXB 1FG2B 3U46B 3UZQA 2ID5A 3BQUD 4WDIB 2DMKA 3FN0L 5FA3A 1J87A 5J89A 1UB5B 3STLA 1T6WA 3AS1A 3JVGA 4JVPA 1FJ1B 1HI6A 3GI9H 4ZUSB 3DROA 3K8KA 3E1F1 3WHXA 1XEDA 4KVNH 3TBTA 5AAWA 2QKIB 1BVLB 3LKSB 4MB3A 4AY0A 4BH8A 3VXQB 3ZDZE 4MWFB 1CFVL 5CJ8A 3GJFA 3WFDH 3MXWL 4K94H 3FB5B 4JKKA 1FCGA 1MOEA 2R15A 3GIZH 2CDEB 4QKXB 4XHQA 5TQ2H 2HMIC 2VB5A 5D93B 5DK3A 4P23D 5IHZA 1NCWH 1UQSB 3GJEB 1HKLH 3GEWB 1EXUA 1QVOB 1TZHA 4JFYB 3RPIB 3IFNL 2LVCA 1NMCB 4N8CL 2YPKB 2CLRA 3F7YB 3MV7B 2W0FB 1MPAL 4LLVA 3HTLX 2X40A 4YHMH 5E1AB 3W0WB 3DGGA 4OZIA 1CU4H 4HUUB 4WFEE 2YD9A 1EIBA 2AGJH 3IGAB 3BFOA 4S1RL 3EYFA 4FFWD 6FABL 1RHHB 5F3BA 3F12A 4LLDB 5IB2B 4PRHE 1BOGA 1IKFL 2E5EA 3FQRA 3IS0X 5EIVA 5AG8A 2AXJA 5CGMA 3UTZB 2R4RL 1LQVA 1RULL 3PGCA 1QFWH 5DTFA 3M17A 3K1KC 1QSZA 1GSMA 5E7FA 1UB6A 3MNWA 3V6FB 2BOBB 2BNRB 4Y5YC 4JHWH 1NGPL 1C7TA 1MCPH 2VLJE 1MI5E 2XKNB 2AQ1A 3VI3F 1AD0B 2PW2B 2X41A 4ETQB 3JSSA 3WIFB 3S37L 3PWUB 1QOKA 4KPHH 5D2NE 3ZZ1A 1I7TB 4PGBA 3TVMB 1D9KA 3CZJA 4PP2A 3DIFA 1Q0YH 1T7VA 4XPHL 1ZVHA 5HYSG 4HWBL 3T65A 1TNMA 32C2A 1CE6B 2A6KA 5IG7B 3SDDD 2KH2B 5HBBA 5I76A 3QEHB 4JCLA 5TDPA 5L0QB 2IAND 4Y5VA 1X3DA 3GSNB 3QG6A 3ZE2F 2KQMA 3NACH 4IOIA 4JVWA 3EYVB 4JFFD 3VD9A 3EDJA 2AKRB 4DKFH 2IPKB 2QSVA 1BPVA 4UAOB 4EEEA 4Q9RH 1UM6H 5CIPA 4GRLC 4U1LB 3WCYA 1JHKH 1Z6JT 3HE6B 3R1GH 3MBXH 5D7JC 4AT6B 2ERJB 2XKSA 2FX7H 4P49A 4APQB 5H8DA 4HHAB 1NMAL 4NZUL 2PO6C 5GXBB 1Q1JL 4WO4C 1XGRB 1AHWC 4OT1L 1YQVL 3DVGA 5SX5K 1YDPA 1MRDH 2IF7A 4LCWB 2IBZY 3IAGC 4FQJH 3IT8D 5J57B 1M71B 4LSPL 4J12A 5T5FL 1LK3L 5IBTH 4BSVB 2DI8A 3RGVC 1QQDB 3U4AA 3BKJL 1Q72H 5D9SB 3QWOB 3VFSA 1E28B 1YECL 4Y4KD 3FFCB 1F02I 1N0XH 4GAFB 1HOCA 3C9NB 2L7JA 2E7MA 3DX6A 4ACPA 4N1HB 4HWUA 3O3EB 1PY4A 1BQHB 3D69B 4JDZB 2AXFA 3VD5A 5DVKA 1FFPB 3OX8B 2ITDB 2ZG1A 2KUTA 3OGCB 5F1IA 3ARGD 5ETUB 4PR5B 4G6MH 4QO1A 1DQDL 1BMGA 1WF5A 3CMOH 5DUBB 2VLKD 4KJPD 2YOCA 5JMOC 1HWGB 2H1PH 2ZNXA 2UZIH 1CFNA 3WS6A 1KV3A 3WYRA 4M48L 5D7JD 1Y6MR 3MV8B 2VQ1B 2NY2B 2LV4A 1M7IA 2WWKO 4YIQB 3MCG1 5F1OB 5IT2L 1NFIA 4IS6B 1J86A 2ZPKH 5IB5B 3MMEA 2WM0A 4F15C 1OGAA 3PP4L 2BNUA 2J4WH 2ICWJ 5IOPB 3EO1A 2APBA 2EKSB 4MNQA 4P5TB 2FH8A 2AJSL 4R90L 4N8VA 4NN6B 4Z77A 1HYRC 4ODBD 1E6OH 3V8CA 3E3QE 2Z91A 3H9ZA 1XGTB 5BQ7B 2I60L 2PO6B 1FGVH 2XQBH 4WEUD 5TDNA 1E4WH 4LLMA 1FIGH 2HT3D 4OJFL 3F65A 2AEPH 3W9EA 5F1KC 1UZ6E 4TSAH 5ITBH 2EDHA 3D39D 3FRPA 3B83A 4WW2F 2IBGA 4KHTH 3BAEL 4NJAH 1VPOL 3SKMB 5JA8B 1AXSB 1MUJB 3P0YL 5KSAD 3TA3D 4K55A 1HN1A 2W0FA 5FA4A 5IB1B 3JTSB 4DQOL 2JJTA 4XI5C 4L1DA 5JXEA 5AZ2H 1P53A 4I77L 1A3RL 1N64H 4MGXA 1FNSL 2A6DA 2BY0A 5BMFH 4BFIA 3GMLA 4XCYA 4XI5D 4MXVE 4YHPB 1M6OA 5J0BA 2XN9E 4GG8B 4EBQH 1FVEA 1RJZB 5MERA 4UT6H 3QIUC 3U0PB 2OMBA 2YXFA 5DMKB 1A6VH 4NGHL 3V4PH 2XN9A 1W8OA 3ZSSA 4PP1C 4EQ2A 1FVDA 4HC1H 1RUKL 2VIRB 2ZCHL 1IGCH 3NPSB 3OR6B 4K7FA 4G7YL 2M2DA 2CRYA 1WZKA 1A7NL 5FUZL 4K94C 2D2OA 2Q76A 1XT5A 3H0TB 1A9EA 3ZKXC 1BVKA 4KKCD 4UT7H 3SGEI 3UXFA 3ILQD 3PWUA 1BQLH 5CWSB 5C07E 3P30H 4CKVX 1KEGH 4F37F 1RY7B 5DR5H 1VENA 5FDYA 5D2NB 4WI2A 3QAZC 5A3ID 3KPSB 4JFDE 5HDQH 1KUMA 5L2KA 1JGLH 3PG2A 3D3VE 3HC4L 3SKNA 1MIML 5DJAB 3FN9A 4DKEL 2NW2B 3IDJB 3NCYS 2W9EH 2VKWA 3D3VA 4GAGL 5BJTA 2BNRA 4JDTH 3V7AG 4QHMB 1RZGA 3DRQA 2I9LA 1J0HA 4AH2A 1IC5H 3HI1B 3MXVL 4PY7B 1OVZA 4LLMB 4BFGA 5BRZA 4O5LL 5EZLB 4Q6IC 1ZKAA 2PYFB 1I1AD 1QEWA 3EFFB 3IYLW 1CGXA 2Z93A 3X12A 1NUNB 3PGCB 2QQQA 2CDGA 2Z4QA 4OD3H 1NEUA 4OSUH 4MNQB 4P5TA 1EEYB 4PJXE 1YNKH 1QFPA 2XACC 4XH2A 3U2SB 2DBLH 2YRPA 4N5UA 3QFJE 1W0WA 1BBJB 1M71A 1FO0B 3BEWA 4K9EL 2ZUQB 1AXTL 3VFRB 1F2QA 1T7WA 3BUYA 5C0JB 1XF4B 5INDB 1ZA6A 4YAQB 3GGWA 4OTXL 3IFPB 3ARUA 4JM2C 2RCSH 2XWBA 5I18L 2V7HB 4RFNC 1LP9B 3NA9L 4CMHB 5I16B 4GUPA 5T1LD 2BK8A 4DTGL 2DQCH 5GJSL 5LGJA 3DX6B 4GRWB 4Z7UF 4U05A 1P69B 2VXUL 1JPTL 1FJ1A 2V2XB 3T08A 3REVA 2A83A 3FO0H 3UTOA 4RGNC 5CBAA 3HR5B 2ADIA 3QUYD 2ADFL 2N7AA 4R2GC 3GSRB 3IFLH 3PUCA 1A6UH 5KZCD 2FHFA 4YFLF 2DYPB 1OB1B 3QIBD 4HHAA 1KLFA 4ONOA 1TQBC 4PJAE 5HJ3A 4XBEH 1CF8L 3SDDB 1OQXA 3C6SA 2DQCL 5GJSH 5HDOA 5IROA 2WINA 3DUSB 4X6FB 3PABA 1AC6A 3P0GB 1BEYH 2RCSL 4YHOH 4JM2D 2Q1EA 4CJ1A 3C8DA 4ODTL 4LCUA 3ARYA 5HHXH 5HHQA 1IGFH 2R69H 5DS8B 1EO7A 5INDA 3K80A 1NGWA 1NBYA 3VMPA 2JCCA 4RA0C 2WIMA 3KPRA 4JN2B 1NAMH 3MOAL 3RKPA 4Y19B 4M6MH 3AM8A 3CU7A 4NFDA 4E0RA 1K3IA 1Z9LA 4HC1A 5FUCE 3PWJB 5HHPA 1BOGB 4P0DA 3CFCH 1EEZA 1ND0B 2GSGA 1NGZB 1JGDB 4M62L 1KYOJ 1NMBL 3QUML 4M1DL 2O93L 1U95B 1NANI 3GM8A 3P4OB 3QBTB 3UYOD 2I9TB 1CE1H 3H0TA 1HHHB 4OGZA 1T5XB 4X6EB 5IEKA 2JB5L 2QR0B 1CICA 2RHEA 4JN2A 3GJFK 2X4OA 3VFWA 5T33H 3HE7C 3ARFD 4CU6A 1TZIA 1LP9E 5D7IA 4HSQA 4PB9H 2GUOA 4LPWA 4QTIH 5CUSH 4ERSH 4RAVB 1A0QL 2IGFH 4KUZH 4I0PA 1R3IL 1CK0L 1GIGL 4H8WC 1T0NB 1ZS8A 3ZKQD 2NXZD 4RISL 2VDOL 2ZUTA 5LCVH 3ZKNC 1G9MH 4MDIB 5F7HA 2Y4SA 1WITA 1UWXK 3ILQC 3CUPB 4OFYD 3L1OL 1BIHA 2VH5L 5GS0D 4V3EB 5D5MB 3GRWL 4JDVA 4XTRC 3LKOA 3TESA 3SOBH 1UXSA 5C3TA 2OQJB 3OG4B 2Y6SC 3D25A 4WDIA 1D5IL 3VD7A 4NZJA 1FRGH 3FMGH 4L29A 3CSBA 3U1SL 2H6PB 4F9PC 3JTTB 2QADC 1CLYH 4OIBA 4PP1D 1QZ1A 1OF2B 1D5MA 2R56H 4XVJL 3GDBA 4K7PL 2CGRL 5C07B 4CVWA 1DQMH 4NT6A 4U6XA 3BQUB 4XAWL 3ZE2E 1NGYA 3T3ME 3P9MA 3TBVB 1YEKL 1X4ZA 5CHNB 1AO7B 3WLBB 4B7LA 2R2CA 5D96B 2VXVL 4UUJB 1GOFA 1WIPA 3RU8H 5MEQA 3DRQB 5CCKL 5GRUH 3WSQH 1NGQL 3CFBB 4FRWA 5JOEA 1UM4H 2YD2A 4WTZG 2DKMA 1T5XA 4X6EA 5IEKB 2VZTA 3RX7A 3O0RL 4ODTH 5IVNA 3QHZH 3P4OA 3SKJL 3GKWH 1W0WB 1DFBH 2Y1VA 4OIAA 2CDGB 2YUXA 2Z4QB 3WJJA 3QH3B 4WV1B 4N1EA 2BVUA 1WFOA 5HHOD 4B7IA 4JDZA 3EZJB 2OZ4H 4HX1A 3DV4A 5EIIA 3BZDA 4HLJA 2R29L 4LSQH 2HYMA 3WJLA 4AIXA 4HUKB 1X7QA 4ZOEA 4F8QA 5GSRA 2B4CL 4EDXA 1W0VA 3LB6C 4NDMB 4RFOL 3VXRB 1SEQH 5F9JB 1KTRL 1UH3A 4PG2A 4Y5XC 4BKLA 2BY2A 3GSQB 3TT1H 3CXDH 1MJ7L 2C3VB 2UWEA 2Z92A 5T3ZD 1RFDL 1OAUH 4M43H 3EFDL 4N0CA 5I1CH 3PWLA 3T2NL 4R4FH 1NBVH 2VSCA 1U91A 1OL0A 5DVMA 3SJVA 3RTQC 1U8KA 4JFPA 1G1CA 2CK0L 3GSOA 3LCYA 3WJJC 3OJMB 2HA1A 1KJ3L 1JMZA 1HNGA 4FQ1L 1S3KH 1SYSA 4WU5B 4HG4K 2YR3A 3VXUD 3WS3B 3O4LA 4X4MA 1LDPH 3P3YA 3CH1A 4U1KA 1CQKA 4HGWA 4C55A 5INCA 3OMZA 3Q2CA 1BD2B 1JRHI 3K8MA 4DVRL 1A14L 4JFFE 4Z7NF 3B2VL 1S9YA 2AJUL 3D9AL 2BRQA 4K9EC 3ROLA 4PGJA 2X70A 2X9WA 3QIBB 4G6JL 2DYPD 4M4PA 1G7LB 2P5WE 4NM8L 3QEHA 1IEBA 3HRPA 1ROWA 1YDPB 2F53A 1ZOXA 2Z91B 1J8HE 4W4NA 1RJZA 2A1WH 1SYVA 1U0QA 3L3DA 5MERB 3LKRB 1VB9A 2VWEC 3RIFF 3NTCL 3OF6A 2OL3A 3CFDA 4XCYB 3B6SA 4G8IB 1L6XA 3C08H 3IFOA 3NN8A 1MCOH 2ZPKL 3LKPB 1H3GA 4QRQA 3TYGH 4BKLB 5FA4B 2R1YA 4ZFOA 4NSKB 1FFOB 4DKEH 2FWOB 3ZKMD 1RZ8A 1W72B 5GGTL 3TBWA 4N9GB 1W0VB 2NW3B 4G9FA 1A47A 2GHWB 4YXHH 4P2OD 4XCEA 4LAQL 3RX8A 3ZSTA 2XV6B 3HC3H 4NJ9H 4NFCA 1BOYA 2F5AH 4HPOL 3EYQC 4HPYL 2C26A 5JW4R 1OAYL 5IF0A 1MRCL 3RHWK 1FPTH 1MREL 4OLUH 4DZBB 1BJ1J 1MCDA 1SM3H 2CO7B 3O3EA 4F8TA 3IXAA 4MD4B 4X9HA 3SEPA 4XPTL 2HTKD 4FQCL 1RZ8B 3EYOA 2E6QA 2CMRL 3O2WL 3ZKSD 4YNYA 3QXVA 1CGTA 2K3TA 2NNAA 1UB6B 4PLNC 2AK4D 4FQHA 5IKCB 2F54A 4QY8B 3AB0B 3MV8A 5I1HH 43CAB 3EHBC 2ARJB 4PRAB 3FQWB 2B1HH 4IOFD 3UJTL 2I07B 4JFDB 1DVFC 5I75C 3RKDD 3GI8L 5B38G 4PJHA 3CXDL 4U1MB 2OR7A 2IALA 4KKCC 1KBGL 2VC2L 3WKML 4RGNE 1M7DA 3JV6A 3G04A 5D5ME 5I1GH 3EOAB 5GISL 1KB5L 2VXSL 2DLFL 3AM8C 1Z2KA 2X4RB 4KKLD 3FT3B 3ULVH 3LEVL 3WS3A 1E28A 1U8IB 4W70A 1JGEB 3IJHB 1AP2A 1S78C 4PB0L 2R8SL 5CILH 4CVZA 5IIEA 4K3DL 1SY6A 1LDSA 5DMGC 8FABA 3OQ3B 5I8OH 4N0YL 3MUY1 4RISH 4XPHH 4HPYH 4U0RC 4LNVA 4FQXA 4MZ3A 1VFAA 3DBXA 3JVGC 4WFFD 4BFIB 1HILA 4TRPH 4IHOA 5DF0A 4S1SH 5DVNA 1OWRM 3FQXA 4K3JL 2BNRE 1OGTB 4CVUA 3SE4C 3CLFL 3O3DB 1QFOA 4LOUD 4YDKL 1MUJA 1I9JH 1WC7B 5E8OB 2MKLC 3QO0A 5DZLA 5K33A 5E8NA 2BC4B 3U1SH 1X7QB 5CKGA 5L88L 3BN9D 5GZND 4GXUN 3TIEB 5HYSA 5HVHB 1JPFA 4OZHE 4DZBA 3L5XH 3VWJA 4KY1H 5L7XH 1BJ8A 2J8UB 3C5ZD 4Z77B 2H2SD 5FHBL 1T7XA 1DVFB 1F4WH 3GM0A 2ESVD 3LD8B 4GAJL 3WD5L 1VADA 2VDPH 5CBEA 1LO2H 1NLDL 5FO9A 5AAMA 4XPGL 3KAAA 1MFCL 3QULA 2ZKHL 1U8QB 3VW3H 4FQHB 4JHZA 1ZHLA 4Y4HC 1I8KA 4NJ9L 4G8GE 1NCBH 3B3IA 4M7ZC 3NFSL 3KGRA 2JCCE 4ZSOA 3V8OA 5BV7C 1T1YB 5T3XH 3ARDA 3MBEA 3VXRE 4E41D 1GZQB 2DOCA 3S5LB 5EO9A 3RY6C 4E42A 3K2MC 4UIMA 2Q20A 3V4VH 4KTEH 5DK2B 5T1KD 1UCTA 4PJ5A 1K4DB 2Z35B 3GK8H 1QPPA 5FYKL 3BP4A 5I1LA 2FCBA 2P8PA 2GW5A 2VL5B 5C09E 3U4BH 1V7ML 3EFDH 3EBAA 1F5WA 3OB0K 1BQHA 4YXKL 4LPCA 4IIQB 4HJGA 4RMUA 3I50H 3NCEB 1NCDL 1JL8A 2CRZA 4XCEB 3WIIH 1C8PA 4LMQE 4OZIB 4FOMA 2A9MH 1KJVB 2YD8A 5D7SL 5B39A 4BSVA 1NFDA 4HKBA 4PFEA 3EYUL 5KW9L 3LKPA 4R6UA 5FYJE 3AS3A 1INDH 4UT9L 4FFYL 3IFOB 1WAAE 1EXUB 1TZHB 4JFYA 1FNLA 5IHUH 1JYWA 4KTDL 3D85D 5IQ9A 3VGFA 1INQA 1FYHB 3HZKB 1JGUH 2C4XA 3LZFH 3GZKA 1KLGB 2UV3A 1NKOA 2Q87A 4GH7B 2IQ9L 3P77A 1T0NA 1MELA 2HFGL 4X6DB 3NOIA 2DTML 2G9HB 3GSNL 4MD0B 4WUUD 4AQ1B 1PKOA 4BZ1L 5T5NF 1H3PH 1TMCB 2HVKA 5E9DA 5M95B 3OR7A 4E42B 4HXBL 4QXTA 1JZ4A 3RBGA 4M8QA 4FXKA 4MA3B 3OG6B 1AGDA 5I17B 3WL9B 5I1JL 2XA8H 2LTQB 1QFWL 1L9NA 1WFTA 2EC9U 3FQNB 1P5VA 1FZKB 2HJLB 5TE4H 2P43B 4BA8A 1XF2B 2VKXA 4UIKL 3HCVB 1XAUA 1EEYA 2VDQL 3DO7A 2VDOH 2AEQH 1PY9A 5DI8A 3OV6A 4D0BB 1WZLA 1ZV5A 1CFTA 2ZUSA 1QSEA 1JCKA 3OTTA 4HEPG 2PTTA 4ELME 3LZFL 4XNMB 2VSDA 4K71B 4G43B 3TPUE 2OP4L 1OAKL 5EC2A 5SWQA 1BVZA 3RL1A 4RMVA 1O7SA 3MV7E 1IGFL 4HX1B 3IDMB 1QSFD 4NP4L 5MEPB 3BIBX 1U9KA 1U58B 4RMSA 5FKPB 1GGIH 4QYOA 3LD8C 3H9HB 3EO0A 4OM1H 5D2LB 3U36A 4QHLB 5I8KL 3MZTA 4WWKB 2KL6A 4XPBL 2PCPB 3LSOA 1KFAL 4PRHB 4J7RA 1OLZA 4HIXH 3ARPA 1MSPA 1SJHB 2GTZB 4UQ2A 5F72S 2WWMC 2BNQE 1NC2A 4PJIE 4JO3L 4YK4C 4KVNL 1W72L 3NCMA 2JJUA 2DLTA 1AGDB 3TYFA 3RP1A 4YQXL 1G9NC 5DD1L 1S5IH 2J5LC 1IL1B 5GPRA 2X4NA 3QQ3A 2FEEL 3OR7B 3BWUC 3F58L 3O2VH 2YD1A 4XBPB 1CD0A 2C1OB 1MCSA 4OM1L 5EBWB 3VRJB 1OP9A 1IAII 1XIWC 2AXHA 2P49B 3GGWB 3UX9B 4CMMA 1FNSH 4Z7WA 1SBSL 1CGWA 1WV7T 4OAWB 4G6AD 2X4UA 1LP9A 4YHKH 1Q38A 2P5WD 3G6AB 1ZVYA 3PL6B 2C4FT 3QEGL 2FJFB 3L3KB 4HKXA 1EGJH 4WHCA 3PV7A 3O2VL 1I1CA 1JFMA 4UT9H 1Q8MA 2XIDA 1OTSD 3BUYB 4LARH 5C0JA 1F4XH 1U8OB 4KFZC 2VDNH 4AJ0A 4PYHA 3TO4A 4DWHA 2CDFA 2OI9A 4XNZC 3WD5H 1ZTXH 2UZXB 4JFEE 1EEZB 1ND0A 2ZP0T 2VL5A 2OMNA 3KNBB 4EUPA 1I8MB 4KY1L 2HT4C 3EAKA 4O51B 2A6IA 3QG7H 2WLYA 3E6HA 3MCKB 2OL3L 4MNGB 1MWAB 4PRIA 4O2CB 3KPPB 5CJQH 5IVXA 4PRAA 3ARWA 5E8PB 3VFWB 1UH4A 5C7XL 2CUMA 2NY3C 3Q48A 4JG1H 4BH7B 1J0KA 3DHJA 4ZS6C 4JAMB 1I9RL 1MQ8A 3NN8B 2Y5EA 5I0DA 3QUKB 4JRYD 4DJMA 2ADGA 2BNQD 1VADB 2AABH 5CBEB 2AEPL 4I4WB 4X8JA 3WFHA 1BEYL 2OCFD 3VWKC 3B8YA 4XZUB 5F1NB 1ZHLB 2DL9A 2AEQL 4PJ8A 3GMRA 3L7FA 2Q76B 3KPLA 4XBEL 2VQTA 4HCRA 3AMKA 4FG6D 4LEOB 2VDLL 5KSAA 2J6EH 4YPJA 1JN6B 5DRXB 3VFGH 1U92A 5GISH 3WUWG 4FQJL 2A9ML 5D7SH 1MAJA 1TJHL 3QI9C 3C60A 5DS8A 2P1YA 5IEHA 3QXAB 3WIHA 4N5ED 2DQDH 3ARRA 4D9LL 4TOYH 2UZYB 3V4PL 1PGRB 4Q0XL 3S4SA 2QHRL 1KB5A 1JV5A 4HKJB 4CADA 4O4YH 1L7TL 3HE7A 5DWUH 3VWKA 3IU3A 3GNMH 4PJCF 4NRXB 4PLOB 1MJJB 4E9LA 4ZUWA 1KXQE 5JDSB 1OPGH 1AXSA 3IDYB 1PQZB 3AFLA 4P57A 2MPAH 1J7VR 2AJYL 4X6BA 5D7LE 2Z92B 4JO4L 1LEGB 1IAIH 1LO0L 1G6RA 2O5XL 4PJAF 5IIEB 4PJDF 2QQKL 1OT2A 3BJ91 3A6OA 1CDIA 5L88H 3M45A 1YEDA 4KDTC 5C0CD 2P7TA 4WO4B 3Q5OA 4GBXA 4U1KB 2Q86B 1K9TA 4X4YA 1OAYH 2GJZB 5I74C 3I85A 2VR9A 1DL7L 4P4KD 2FGZA 4P46C 1EJ6A 4Y1AD 4MAYD 3QUXA 4OCXH 4YBLB 4WEBH 3TF7A 3RTQD 3SDAA 1OAUL 3CSYB 3LQAH 5F1NA 1ZEAL 5EU6B 3BE1H 1ORSA 4ZFGH 4XXCA 4G59A 2H9GA 1DLHA 1R3LB 4XMPH 3T4YB 2ADGB 3HS0B 4L3AA 5DJAA 1T21B 2C3HA 1AE6L 4GRLB 5I6XC 3GMPB 2ED9A 4G6JH 5CEXB 3BAEH 2Y07H 4PJHE 2XZCL 4I48A 4TTGA 4Y2OA 2VXQL 3J7HA 3VH8G 1N8ZA 2JJVA 3EOYG 3KYMB 1WTLA 5D1QB 1KCLA 1MCWM 1NCBL 2CR3A 2FX8L 4XXDB 5F6IB 4NWUH 3PWPE 3G5VB 1A3RH 3D69A 4KUCD 2YD5A 4JFEB 1SJEA 1CDHA 3QIWB 3R06B 4POZD 1KSRA 4OM0L 3KJ4B 3HI6H 2NX5D 4F37K 5K9QI 3QEQA 1I7ZB 3EOTL 5CGTA 2BRRL 1BFVH 3T0VA 2VWEE 3IETB 4D3CL 2D03H 3C6LD 1CXFA 4OLYH 2XTLA 3TT1L 3IXTA 5MI0C 1W0YT 2FIKA 4F7MB 1PSKH 4NRXA 4DGVH 4HCRL 1OGAD 5GZOC 5I1DB 5F88A 4YK4B 4KKAC 3L5WB 2MHAB 4D0CB 1TXKA 4J1UA 5HGBA 2IPKA 3FB8A 3STBA 5ENWA 1B3JA 3FOLA 3IJHA 3S4SG 1SEQL 3T77B 4L4VA 5DA4A 4ZS7L 3IETA 2D03L 1A14H 1FO0L 3RWJB 3H8NA 5F89B 3V52H 3JWOL 1NDMA 1P6FA 1FSKB 5AZEL 2VH5H 1B6UA 3OHXA 1D6VH 5F7UA 5IFJA 1ZLSH 1G7IB 3TVMA 3M1BB 5DRXA 4F2MA 2DMBA 4IRZL 3BI9X 4X9FA 4J1UB 1T6VN 2B0SL 1Q1JH 3WIFA 1YA5A 3JZ7A 5EORL 5IW6A 1PAMA 3RKDC 3PIQA 4PD4J 4DOHB 4ZFZA 3P9LB 1MPAH 1A64A 2R1XB 3FFCE 3JV4A 5CSBA 1BFOA 5T5FH 3CZFA 3KXFD 4D9QE 1M7IB 2ZSVB 3KPOA 4KJPC 5BO1L 3RU8L 2DI7A 3TN0D 4HJ0C 4HIEA 2J8OA 1Q9KA 2GJ6E 3VXME 2XXCB 2EDNA 1MLCA 1M05A 5FKAA 2A2QT 3O9WC 3ALPA 3I02B 4AIZA 2IEPA 3MRQA 15C8H 4LF3B 5DO2D 3UJJH 3RWIA 4RZCA 1U8MA 2OI9B 2HT3C 3PWPD 3FCTB 1YEDB 3WN5B 3HZMA 3FB7A 2XRAH 4MJ2A 4MQTB 4K23H 4XMKL 3QISA 4GLRI 3RQ3A 2NY6B 1DUYA 5HHPB 2IGFL 2CLRB 5ANMA 3LMJH 1MCPL 1LO5A 2IG2H 1IM9A 1UC6A 4RSVA 5K9QG 4FTVD 5E1AA 1TQCB 4UUJA 3DSFH 4UOW1 1ORSB 2X4UB 1G9ML 5FCUH 3IJSA 3FRUA 3KPNA 3U30B 1UVQB 4CADB 4JB9H 4JGUA 1L9MA 4F3FB 3FHQA 3UBXB 4M43L 3FKUS 1S7RA 5E6IB 2FR4B 3QWRA 3KWWB 5TF1L 2X4NB 3T4AA 1E27A 3FMGL 4YGVB 1CFVH 4M03A 4Z95L 5GS0H 5I1JH 2C1OA 1FNAA 4M93B 4TULH 1N59A 3FONA 5C0BD 2XZQL 5FECA 2K9UA 2XYCA 1ZGLM 2Y7QA 1PLGH 1DBJL 1TDQA 3IRPX 1TENA 5EUOB 3BEWB 4GKZB 4FG6C 4DVRH 2DB8A 5D1XC 3TC9A 3SKOB 4NPYA 4R3SA 1AIFB 2DDQH 2XTJC 3GBMH 1R3JB 3MSPA 3TH2T 2YRLA 3VFPA 5D2LA 3O6FA 3U36B 1GHFL 2VL4A 4HMCA 3N1MC 4YUEL 3RVXC 3A6BL 3L3HB 4L4TA 4M3JA 4NKOB 4NQEA 5KJRH 1A9BB 1FG9C 3SE9H 1EZVX 2Q6WA 2DI9A 4YHNA 1CU4L 3ZDXF 5I8CA 1INEH 5F9JA 1P5UA 4LVNC 5ID0A 4UTBH 1S7SA 4GLRH 3H9SB 1H8NA 1HH6B 3BZ4A 3RUGB 1YMMD 4EDXB 4HT1L 2AXGA 3QB7C 3GFUA 3HE6C 5TDPB 3ZT7A 5EO1A 2ZSVA 2DBLL 3MCKA 3QCTH 4PJFF 3H3PH 3KPRE 3B9AA 1KFAH 2DJ4A 3FAWA 3RWHB 4LCYB 5D1ZB 1WZ1H 1N3NB 4K3EL 1CGYA 4UB0L 1CG9A 1CT8A 2PYEB 5DEZA 5DRNB 2ERJC 3G6JF 1TCRA 1A6UL 1K8IA 1MCEA 4DK3A 2AVGA 5GZNC 5I18H 3S34L 3SO5A 1QFUH 5FCSH 2AXGB 4OCYL 4GAGH 3L3GB 4L3CB 1KCSH 3RWDA 5L2KE 2YHGA 3MRRA 4QRRA 5IB3B 4YHYB 5LQBL 3G5YA 1RZ7L 1WBXB 4NRZB 2BC4A 4U6TA 5CZXC 5GGUA 1IM3B 4L4VB 4M9PA 1URLA 4L4TE 1QRNA 2R0WH 2UUDH 3T2OA 1MF2L 2VXVH 4XPGH 5CJ5A 4K7PX 4TTDD 2Q8BH 4OF7A 2P45B 3TT3L 4K8RH 3RY4A 4KK9C 3VFPB 1YUHA 4L8DA 4CU8A 4G8FB 3B9KB 1F4HA 1UZ6F 4HBQA 4NN7B 3FQUB 3MNZA 4JQIL 1P7KA 4LMQI 1ITBB 3ALWA 4KJYB 3LDBB 3HR5A 4HF5H 5BS0E 1B0GA 3QA3A 2J88H 3LAFA 2GEEA 3E2HB 2W60A 3GSVB 3HAEG 1CE1L 1YNTA 5J12C 1QVOA 1XR8B 4HIXL 3RPIA 1I8LA 3V4UH 3I6LE 3REVB 2AK4B 4Y8DC 3MRPA 2AJXH 1AY1L 3UBXG 3ZMRA 1EO8H 2H8PA 4Y5YB 2RQ8A 3MRFB 2VE6A 4OTXH 2DQFB 3MA7B 4JRXD 2JLLA 1HINL 4XBPA 2BSRB 1ZGLB 2I07A 4DQOH 4X9GA 3U83A 3S5LA 1R5VA 3D39B 3Q1SL 4OCWL 5FHAH 1KPVB 3NCJH 3GSXB 5E94B 4HAGA 1A2YB 4N0UB 4OGXH 5JIIA 3ARGC 4ZAKC 1GVIA 1KCVL 1IM9B 4DW2H 4I0KA 2WV3A 4LFHD 1FLRH 4HS6B 3MJ7B 5AG9A 4IIQA 4EVNB 4HC1L 1JGDA 4LASL 5KJRL 1A4JA 5IHBA 3PNWB 4ESKA 1HQRB 4X4XA 4JQXC 5D72L 3OAYH 3RWFB 5FUZH 1C5CH 3O45A 4HULB 2K7QA 3NFPB 1HHKA 2DLEA 3V4VL 3NPZB 2XY1A 5JHLL 3BRGC 4M6ML 3H7BA 1B88A 3FT2B 4S11A 2IH3A 5KVGH 3P0YH 4GRLA 4WI8A 1Z9SA 2DM2A 1JI1A 1J5OH 4PYGA 5CD3B 4Y1AB 3DVGB 5IVXE 1TPXC 1YJDL 5IW1B 3VFMB 3ULUH 2O61B 1C5BH 4PP8C 2RIKA 3HCVA 3LPWA 5L9DH 4I18C 1AHWA 3LRHA 3O6FB 3ARDC 4M6AA 2D31A 2R1WB 3QI9D 4OKDA 3CVIL 4RX4D 1AQDA 4R3SB 4E5XA 5TDOB 3VXUB 3KPMB 3BYTA 4YDLB 1PKQB 5GS3A 3BVNA 5H2BA 3ZTJG 1EEUA 3RVTC 2AJVL 5C2BL 5DEFA 3QO0B 3SE4A 3OKEA 3RVTD 3L6FB 1ZT7A 2EDBA 1IGYA 5MENE 1OP3H 3FOLB 4MD0A 4U1MA 2UWEF 4UT6L 3HLAB 1I1AC 3CDGB 1YMHB 3CLFH 4HKZB 2DQEH 5TE6H 3HE6D 3QZWA 5A2IH 4NO2B 3EDFA 3P40A 1JGVL 3DBXB 5BCAA 5ENWB 3B9KC 1JVKA 3OB0H 3WO3B 1UWEH 4J8RA 4I4WA 3KR3H 3HN3A 1D6EA 4JZOB 4QGTA 3TNNB 5HVGB 4O2EA 2XPGB 1HEZA 3MV9B 1DUZA 1I3GH 4MNGE 4ZUVB 3QDGD 1GPOL 4L3EA 3V79C 3BKYL 1T5WA 3QDAA 2PUQT 5D8JH 2H1PL 1KJVA 1RK1A 4UDTA 2W0PA 5I1KH 3RAJH 1FGVL 2XQBL 1MFCH 4QRRD 4LP5A 3S88L 5C0DB 5JZ7C 1QLFB 2R0KL 4JQVA 5KANG 4DN4L 2CK0H 3GMMA 1FP5A 2HKHH 4KKBC 5ICYB 3TJEL 1J1OL 1KIPA 1CDBA 2FGWL 1OW0A 2GK0A 4EXPX 3RA7L 1IC4L 1JHKL 3S88H 3VWKD 1MEXH 2YPLB 1T1YA 4LQFL 4AEHH 4KROC 1ED3B 4O58H 3LV3A 2R1XA 4PV9A 1JZ8A 2IAMD 4QRQB 2BOBA 5TE7L 4Z7OF 5DMYA 4WHTA 5HHNB 2EIZB 1WEJH 3PL6A 1YN6A 4GQPH 1YMMA 5LXGL 1F42A 4JQVC 4JZJA 4I8DA 3LS5L 3ZHDA 1FH5L 4MNHA 12E8L 5IV2A 1P2CA 2IMNA 5I8OL 4WO4A 2AERT 4Y5YA 4F7CA 4EUPB 1KPRA 5D71H 4ONGH 4UDTB 1MEXL 3LEVH 5HY9A 1HHGB 1RZFL 3QCVL 1TJHH 1KNOB 5DFVC 3KPMA 1NAKL 2FGWH 2W60B 4NN5B 5C86A 3FL7A 1DQQA 1R3KB 1RZJL 3CDCA 4YDVB 1YYML 1BGXL 5JW4N 2ICWA 2J6EL 4NOFA 5BVJB 3CH1B 5HVHC 4NQVA 4J8RB 4M6NH 1NMCC 1LNUB 3X3GH 4F80A 1E6OL 3B8SA 3AY4C 4I9WE 3KS0H 4N1CA 3GSOB 4M02A 1A7RL 1F3DJ 2NX5B 2R0LH 4JE4B 4JZJC 1EBPA 4PIRF 2V9QA 2HTLD 5FKPA 2HFTA 2CDEA 2D0FA 1H3TA 1P9MA 3GKZA 4XB7A 1ZHNA 4CDHA 2EYSA 1HHKB 5D7LB 5GJTL 4M8VA 4O9HH 5HHMA 3V9FA 2HH0H 2YKLH 4X5XA 1IAOB 1OSPL 4WWKD 4YHML 5GGTA 4KMQA 1MFBH 1JN6A 4HV8A 5JHDD 1FV1A 2IFGA 4LQ1A 1QBLH 3O45B 2EIDA 4OZHA 5KOVC 2W07A 2JJSC 2G60L 3KPLB 1HQRA 2O61A 1YMMB 4TNWK 3LRSA 3PWLB 3Q6GL 4U1GB 4Y0GA 1GC1H 2AK4E 3MLZH 3MO1B 3QUKA 4DEPC 5FGBC 3TT3H 3H9HA 4W81A 4CL7A 3MMEB 4N0UA 3U0WH 4PD4K 1AGEB 2IH3B 1H8OA 2F74B 2PR4H 2W9LA 3QUMB 3TYGL 1MWAL 1RQ5A 1F4AA 3IDUA 3C08L 1MRDL 1R3LA 1XF3B 5HI4D 3V6OA 1XR9B 3ZYOA 3BZ4B 3VG9B 4H1LG 3QXDB 5DJYA 1JHTB 2FJGB 5DC4B 5KZCB 2DJSA 3RVVC 1ONQB 4DGYL 3ROOB 3P9MB 3TBYB 3GMQA 4OQ1A 3SN6N 4M62H 4X4YB 5E5MB 3DUSA 1MVUB 4KTYA 2P5EE 4EN3A 2G2RB 2W9DH 5JPMA 3PQYE 5LQBH 1ADQA 3IGAA 3QHZL 3D18A 2RJMA 1ES0B 3Q3GA 4NO3B 4QXGL 5ESAA 4M5ZH 3UTSE 2MCG1 2P44B 1I9IL 2VR4A 3K2UH 4Z8FH 4R97B 1G9NL 4Y4HA 4O2EB 1P7KB 2J88L 1CVSC 3BGFC 2WBKA 1LHZA 3FFDB 1PZ5A 3O9WD 5AYUH 1HSBB 4NUJB 1ZWIA 1WWBX 2D7NA 2DQUL 2XZAL 5JUEH 1QSVA 3BWAA 3VFUA 1JZ7A 3VD3A 1DANU 3V2AR 4PJXA 1L0QA 5KVFL 3UBXA 4OAWA 2L0DA 3DX7A 4TNVF 5DK0A 2WK2A 4NQXA 1U42A 1MJ7H 2HN7B 1CXKA 1SMAA 3IF1A 3VXRA 3S35X 4DUXA 5DEFB 1T20B 2W65A 1NC2D 1JPST 1I8LC 3VJ6A 3NCBB 3QG6B 3VCLB 1TVHB 2QQLL 3G5YB 1GGBH 3O3UN 1J9CT 2BNQB 1NEZB 3VE0B 1SYSB 1ZLWK 1JNHB 2L4OA 1AH1A 2B20A 5AWNL 4XMLH 2GSIB 2NY0D 3HPJA 1VFBA 3AXLB 1EAPB 1MHPH 1U91B 4LKXA 3D87B 5TF1H 3DPBA 1A7QH 1K6QL 3HUJE 4P9MH 4DKDC 5JTWA 2X05A 1P7QB 3ECBB 3O0RH 1J1XH 2MNUA 5JQ6H 3SGKA 4QNPE 3ZT5A 3H9SE 2DQUH 1MF2H 1GGBL 5FGCB 1DSFH 2YS4A 3EUUA 5IK3B 4RDQF 4JGMA 1JHTA 2FJGA 4NHUA 1T7ZA 1AXTH 1S7SB 5E8PA 5GRUL 3WSQL 3V5KB 4OD2A 4YHZH 4Y19A 5KS9F 1IQDB 5IBUB 5ALBL 3D3VB 4LOUC 5DI8B 3EKCA 1KCRL 4ODUB 4ZSOB 5ILTL 1AO7E 2ILLA 1AJ7L 3K4DA 3TWCH 4LKXB 3Q5YA 3D39E 3MLWH 2BMKA 4JJHA 3FN0H 1N3NA 1A6AA 5IW6B 1Q9LA 5DD0H 2CIKA 5KSVB 3DMMD 1YNLH 3DYOA 5I6XB 3UROR 1KCUH 4TQEH 5EOCJ 4R9HA 3UO1L 4LLQB 2EXWC 1NCAL 3DGGB 1IC5L 2ICEB 3MXVH 5AWNH 4O2FA 4U6YA 1RVFH 4XVUD 4MJ4A 1A2YA 1NAML 3MOAH 2LQRA 5IBUG 4FA8A 3QHFL 3IRZA 1Q0XH 3I6KB 1RAMA 5I8EB 2CR6A 2EYSB 3QIUD 1EK3A 4JG0H 4MA8H 3RIAK 4GUPB 1UXWA 3I6GB 2YUWA 4I0PB 5DMKA 5CZVL 1OM3H 3TA3B 4I2XA 2A38A 4PJEE 1DEEB 2BOCA 3IJSB 3VG0L 1AGBB 3TZVB 3U4BL 4GKNA 3X3GL 2W91A 5AYUL 4RBPH 3MRLB 3QQ3B 1H15B 3SE8L 3SDCB 1KLGA 1KCKA 5DVLA 3G6JA 2A73A 1ZLVH 4KTEL 3MYZA 4YNYB 1ZLSL 3RJQB 5GSVB 3SKMA 1HCFX 2IBZX 4ZUTB 5GHWH 4YEEA 5F3HA 4ODSL 4XP1L 3K2UL 5IMLA 4MCZA 1K5NA 3C60D 3W11D 4F9PA 1NDGB 3B9KA 2EECA 5ESAB 3L95A 3T2PA 3IAPA 1UKTA 2YPVH 4OLWL 5EN2A 1JUFB 4JPKH 4V1DD 1C12B 1KENL 4DGIL 1CGSL 4QRPB 4ALAL 3FCTA 1UVQA 4MCYB 2Z35A 4MXQA 3IKCA 4MZ2A 3MV8D 5HHVL 3SGJC 4OLVL 3JBG7 4N90E 1D9KD 1CXEA 4PJAB 4TVSa 3FZUC 3K4AA 1YPZB 5CP7B 5C0BA 1UZ8A 3ULSB 1YN6B 3T8XB 4Y5XA 4KGJA 2NY0B 2BP3A 3T1FA 1A1MB 4Z7OE 3SKNB 5CS7A 5D2LF 4HMEA 43C9B 3SDXF 3MNVB 4HFWA 1JIBA 4HGKC 4XRCA 1CTNA 3SCMA 4DVBA 4P3DA 1MWAH 2RFXA 4GG6B 1FC1A 4AL8H 4MJID 5F9DC 5DHVA 4RGOH 5C09B