4L4VD

Structure of human mait tcr in complex with human mr1-rl-6-me-7-oh
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Recognition of vitamin B metabolites by mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vD02
3DSFL 1KN4L 3KXFA 5F9JA 4IS6B 5GRJL 1AO7D 2X5PA 4P4RA 4P5TC 2CDFB 2C1OB 1CL7H 1ZT7B 2XA8L 4U1LA 1JHLH 4Z9KB 1MI5D 2A9NH 4LQ1A 3O2WL 1EFXD 1YN7A 2QHLA 2HLAA 2VXTH 2C5DC 4CU7A 2YPVL 3V5DB 1OTUC 4NWTL 3B8YA 4PG9B 1A3LH 2FECL 4ZODA 4JDZB 3PIQA 1SM3L 3Q3GB 3DX7A 4DTGL 4JN2A 4H20L 3KXFD 1G7MA 4DKAA 5IWLA 1TZIB 5ICZB 2BVPA 1I9IH 1Z0NA 2V5YA 4HV8A 2J2ZA 4KMTH 3MRPB 5F9AC 5IV2A 2D7QA 4PJXE 4OCRH 2NY5L 2EE2A 4QCIB 1AHWA 4XI5D 2DDQL 2FWOB 5JDSA 5IEKB 1CLZL 3ZYOA 1D5BB 1OSPH 2DLFL 3BUTA 3MBXL 4PP1C 4DCQB 1F90L 2WUCL 1JWMB 1MCWW 2BVQB 1T2XA 1U8IB 1ND0B 2WP3T 5ILTH 4OZFG 1S7WB 2W38A 3GO1L 1UWGH 4Y5XC 1MREL 3MLVH 1S7UA 1NCCH 5FV2A 1CF8L 1GGTA 3MUGB 4DOHB 5IW1A 5KS9A 4DUVA 3QUYA 1KSRA 4HIHA 1IQDA 2EYRA 4PREA 4KMLB 4Y1AA 4HZLB 5IQ7H 4BQ9A 4O2FA 4GMTH 4U1NA 3P30L 2BERA 3BGFC 3MJ8A 4ONFL 2F54E 5D5MF 3VRJB 4XP6L 5GS2D 3PNWB 2R8SH 2OK0L 1J87A 4OJFH 2HJLB 3D9AL 5DA0B 3BKMH 1FFOB 1A6VH 1VADA 3HG1B 1XGRB 2GUOA 2O5XH 2WV3A 4NJAL 2LE9A 3G5ZA 4YHNA 1KENH 2F54A 4R4BA 1ZVYA 4CVWA 3BT2H 5TPWL 4FNLL 3T0XA 2DM2A 4EN3A 2HVJA 5KSAB 1HK6A 1JRHL 1LD9B 2ZUSA 4IDLA 1J0YA 5DUML 2X4NA 3P4MA 1UVQB 1LEGB 4Y1AD 1NBZA 2GSGB 5DC4B 3ZZ1A 1V3LA 3I6LD 4NKOA 4C83A 3GMLA 3DX8A 1J0HA 4FFWD 3IS1X 1AE6L 3LRSB 4POZD 5KVDH 2R1YB 4DZBA 5JXAH 1A6UH 4EXPX 1Z5LA 1MNUL 4KRNA 2P24B 3N85H 3KWWB 4WW2C 2CIKA 4GOSA 4BH8B 4X6DF 3QI9B 2VKWA 2OTUA 1IGTB 3CZFA 5D6DA 4V1DB 1W72B 2DWDB 3O2VH 3RUGA 4HCRH 2PYFA 1PEWA 5HYSA 4I2XB 1UACH 2F54D 3B2VH 5ALCL 1BVLB 4GSDL 5GJSL 3U4BH 1NMCB 4N9GA 5E6IA 4HGKC 4EN3D 4ZMAT 4GJTB 5C92A 4YHLH 2J88L 1HHKA 2GHWB 1SHMA 5DT1L 3BEVA 1GH7A 3DUHA 3FZUC 2H9GB 1HWGB 1R5IB 5F96H 3D39A 1KCRH 3UDWA 3ZE2E 4BYHA 4TQEL 4XCNA 3ETBF 4Z7UF 1ACYL 1G7PA 5BRZB 2P44B 4RAVA 3EYVB 3GGWA 4PR5B 1HOCA 4MA7H 1W72L 1ADQH 3D87B 1BVKB 1D5ZB 4JHAL 4XX1G 3AB0C 1A3QA 5I8KL 5CMAB 2E27H 5E6ID 1OM3L 3GIZL 2D7TH 5EUKB 3VDAA 15C8H 2CDGA 4HJGA 4U49A 1CFQB 3PWLA 3EJYC 3HUJF 2IANB 1F6AA 2PW1B 4CMHC 3D39D 1TZGH 2F74B 1AI1L 4NGHH 3RPIA 1I8MA 2YEZA 1IC5L 3MA9H 1D5MB 2PUQT 5KVFH 4L9LA 4Q0XL 2IBGA 2HVKB 4MWFB 5TE6H 3TP4A 1DQQB 3B43A 1HZHL 5HYQA 4X4XB 2JJTA 2XACC 1KELL 5KOVC 4HF5H 4OCXL 4JR9H 1P9MA 2NNAB 5DLML 5HDBE 5E8NA 4KKCC 3FRUA 4GS7B 3JWOC 4OTXH 4HAGA 5SV3A 4OZGA 2JELH 3QDME 1R5WB 5L7XL 4P46D 3UXFA 5EOQH 4NP4H 4KJYA 4IM8A 5HDBF 5A40E 2OP4H 3UPAA 2EH7H 1I85C 4HWEH 2ILLA 3PGCB 1MPAL 1FAIL 4ZSOA 2PYEA 4PJIA 1R3LA 5EU3A 3RL1A 3QDMA 2X42A 4P2RE 1OPGL 4LSTL 5ESAB 1WBXB 3SE9L 1N5YL 5EO1B 3ZHLA 4JFQB 3T8XA 5SWZB 4WHTA 4LVNC 5E6ZA 5GRUL 5GGSA 4MMXC 2Z8VC 3FTGB 5CIPA 4CVZA 2KUTA 4O2EB 2FX8L 1G6RB 3SY0B 4XCYB 4GG8A 1HQRA 4OD2A 4M4RA 4UQ2A 3OPZL 3TBYB 4Y5VC 1OTSC 3BKJL 3ALXA 2PYED 5F7FA 2IH1B 5HI3D 1MJ8L 2AJSH 1J05B 9CGTA 2APTA 3TESA 3QDMD 4L3CB 3RIAK 1N3NA 3ARFB 2Q8BL 2JTDA 1FE8L 3QZWB 4JFXB 4K55A 2HT3C 4I48B 1DDHB 2DL2A 4HIJA 4KVNL 4HS3B 5EWIH 1ZSDB 4ONGL 3UJTH 5LQBH 5D96B 4P2RD 1H3XA 5BMFH 3T2NL 1G6RL 4M7LT 3S5LA 2DQUL 2CKBB 1FRGL 2Z4QA 3RIFK 3AUVA 3V0WL 3L5HA 5LJYH 1REIA 4YBHA 5IBUB 1H8OA 1KIQA 1LO4H 4J3SA 1DBAH 2A73B 2GJ6A 2YHGA 5H37G 1A6TA 4DN4H 1T1YA 3MUY1 1YJDL 4YDLC 4CADB 1JPFA 3BJLA 5I1JH 3CX5J 4PJAA 3SDDB 3GB7B 4M5ZH 1LO0H 2FX7L 2XWBA 3C5ZA 2FH8A 4WEMB 5LAXA 4YDVB 4NWUL 2AJVH 3IAQA 4Q6IB 4FXGA 4XNZB 5I75C 2XZAL 4UILH 5I6XB 4RWHA 2CKBL 3AREB 3VXMB 5IESL 3ROLB 2JB6B 4HJ0D 4ZUSB 3RWIB 3UC0L 3RKDC 4BZ1L 3B5TA 4OIIL 2V5MA 3QULA 3T0AA 2C3VA 2BXZA 4ZOEA 4OZ4A 2GJ6D 3GMRA 5JW4Q 5ESQA 3SE3C 1NJ9A 5C9KA 4ZFOL 3NGBB 3DX9B 4ISVB 4PD4K 4X5WB 1NCWL 4NNPH 2Z31D 5AUMA 3FB7B 4LRIC 5ERWA 3BIBX 3C5ZD 3RJDA 5T5NF 2NY6D 3SPVA 3P0VH 3C5SB 1CDIA 1DQLH 1U36A 2Y6SC 3MOAH 5DTFB 2QTEA 2GJZA 2WLZA 2F5BH 1D9KC 2P8LA 4KH2A 3SGKC 4MDJA 1QG3A 5ICYB 3OR7A 4FA8A 1TMCB 3WSQL 4QRPE 1DUYA 3V2AR 4QT5A 4X5XA 2GYSA 2H41A 1FJ1B 4P5KA 3ZKXB 2P49B 1CFSB 2UZIH 2VDOH 4MD5A 1AD0A 1AQKH 2A6DA 5JW3H 3O0RL 4M7ZC 4PJ9C 4W4OC 1NCAH 2CLZA 4HHAA 5F8QC 1WBYB 3TO2A 1S8DB 4X83A 1GGCH 1PEZA 2YMXH 4QRPA 5B38B 3E0GA 3HCVA 3FCTA 1CICB 1ZA6B 5EIIB 1F58H 2D31B 4NNXA 3GJEB 1T0NA 4PTUB 1LP9E 5F7DB 2IMMA 3LQAC 4WGWB 5MI0C 1NFKA 4JDVA 4CU8A 1CGXA 4EUPG 1ZVHA 3CDGB 4YWGL 1XIWC 3VXPA 4QHLA 4XC1H 3H9SE 1QRNB 4LCUB 1TJIL 4XVJH 3HUJB 4LSDA 3QQ3A 4AIZB 4OLWH 5INCA 4A6YB 1LP9F 1NCBL 1YNKH 4JZNA 4OCYH 4MQ7B 2EIDA 3G04B 3QDGE 2DD8H 2NZIA 3VFWB 4GKOA 5F9DC 1MRFH 4ZFGL 4F80A 5AD0A 1UZ8B 4R26L 3H9SA 1P7KB 4ODXA 4E42A 5SX4H 4QRPD 1F4AA 1DL7H 2E9JA 5D7KE 5J6GA 2NY4D 2X44D 2W9EH 3Q6GL 1UM6L 3MRDB 2ID5A 1XGQA 3ISWA 4LGPB 1HILA 4HSQA 3L7FB 3CSPA 4G9FA 3A6CH 5EU5A 3LEVL 3ZDXF 2OI9B 1QSVA 5JHDB 1NL0L 1EA9C 5MEOA 3K7UA 3ZE1E 1ORSA 3AGVA 1CGSH 2HTKD 4L5FH 3PGDB 3BVNB 2C4FU 1Q9LA 4LCCC 3BP4B 4JFDE 3AS1A 4PV9A 1WUNT 3H9SD 5CJ8A 1ZEAL 1T5WB 3OG6B 5L9DH 4G6FD 3JV4B 2VAAA 3ZE1F 2IPTH 1S7RA 4WI7A 3RTQB 1J11A 3PL6C 4NJ9H 5E94B 5FOBA 4NQCB 5J89A 2GCYB 1PSKL 4ZAKA 1A7OH 5MP6L 1IILE 1P6FA 1QVOA 5E4IA 2FLBT 5KSBA 1IMHC 3VD9A 5GGTH 3C09C 4U1JA 2DLIA 3QUXC 1AP2A 2W60A 3D2UB 3PGFL 3O9WB 1F97A 4P5MB 3QUZA 4F9PA 4MCYA 4YK4B 1CIUA 1JE6A 1UXSA 4P2YA 4AZ8A 2IFGA 4WNQB 4WU7A 3WO4B 4IRJB 1ONQA 3JV6B 4LKCB 5BJTA 3G5XB 4I18A 1JTOA 5A1AA 4Y4FA 4HPYH 3MYZA 4ZAKD 2MKLC 1MLCB 3LD8B 2FJHB 4CDHA 2D0GA 5DRWA 1DQJB 3S35L 5KVGH 1TVHB 2AKRA 4HX1A 5ALBL 2FHFA 2R0ZH 4Y2OA 4PJDE 43CAA 4XBGA 3SKOA 1DVFA 2X4RB 5FCUH 5C0BA 2AXFB 3RVTC 3I50H 3QUZD 4BH7B 3UTZA 4TNVK 2OJZH 3NFSH 3KYNA 1U92B 5HGGS 1I7RB 4E41B 2DLTA 4PJDF 3CH1B 4L1DA 3GJFA 1MUJA 1GPOH 4M6ML 4YXLL 4P46C 1UM5H 4Z77B 2O5ZL 1ZK9A 3NZ8B 5F7LB 4Y4FD 4MZ3A 3TBTB 1S5IH 4KGJA 3OZ9L 2FBJH 2XKNB 2WUBL 1X5HA 5IB1B 3Q48A 1S78C 2VDLL 4MYWB 1IZKA 1Y18A 1SEQL 4PGCB 3QCVH 4MSWA 3OKKB 4NSKA 2CK0H 2CK2A 1FYTE 1WSST 5J1AB 2V6HA 1KYOK 1SJVA 3PF2A 1W0VB 1S9YB 5FA4B 5IP4A 4YBLC 3LIZL 4XBEL 3MA7B 2CRMA 3K0WA 4PJFA 5ETUA 4HUXA 3FOMA 3MRRA 3VFNB 4OLYH 2X4QB 1FYTA 3OAYK 1AKJB 4ZPTB 4QGYA 4XPAL 5DHYA 1G7LA 5KTEL 1TFHA 4KZDH 4XVUC 3W39A 4ZUUA 3EJZC 3IFNL 4UTBL 2JJUA 5I1LA 2V5RA 5TQ0L 3SKNB 1XGTA 1JHTB 5ACLA 3ME0A 4GW5B 4NYLB 4X4ZA 3HI5L 2OXGA 1NGZA 3MLWL 4APQA 1X3DA 3ECBA 4JY6A 3QG6A 4QHKI 3TIDB 4CU6A 5C0FA 4HXAL 5DURD 3UJJH 3HZYA 2D2OA 3BQUC 1JGLH 5AYQA 1FYTD 4QO1A 4UT9L 3TCLB 1MCCA 3X3GH 32C2B 2FSEA 1JWSB 3WL9A 4OUUA 3RZCB 4RFOH 2V2TA 1JI1A 1O0VA 5DMIL 1B2WH 3CVHH 3X14A 1WEJL 1MCPL 2QHRH 3CD4A 3TBSA 1BWWA 3T3MF 2M26A 1NLDL 4FQ2H 4WTZG 1EGJH 5E7BA 1OWWA 4EIZC 1MIEL 3RGVC 5D7IF 2IAMA 2EKSB 1RUQL 2AEIT 5DSCA 4X0KA 1S3KH 3KG5A 2OL3A 3CXDH 4HJ0C 3MCLL 4JB9H 3HC3L 3V5KB 4X6EA 2FNBA 4YDIH 1NAKL 3VG9C 3VFVB 3WD5L 2J8UF 1H8SA 4R0LA 1K5NB 4OIAA 3RVXC 5L88H 4PB9L 1HINL 3TIEB 3L6FA 1DQML 1MRCH 1GGYA 3OKOA 2DQCL 1WITA 1WQVT 1KUMA 3NVQA 4Y8DC 4PRHA 2Z31C 5C0ND 4GKSB 2E7LA 1R3HA 4IIQA 2NY6C 4O02H 1CE6B 2IAMD 4JGUA 3VRLE 1PDKA 5DFVD 4AK1A 3KYMA 2Y5TA 1CK0L 4HWZA 3ILPB 2VXVL 1GOGA 4XAWH 4NO2A 5HHQA 4YXKH 4G7VH 3BEWA 4NQUA 4Z7QF 4YNYB 1ITBB 3R06B 4MJ6A 7FABL 3MXWL 3P4OB 2DM7A 3KPSB 2D03H 3ARDB 3SO5A 4KHTH 4KKBD 4HKXA 1MFBL 4QRRE 3U4EA 1A02N 4PGEB 4NN6B 4PRHD 1J8HE 3PQYA 2A74B 5ITFB 3HR6A 3TV3H 1YY8A 3DYPA 2DLGA 3W9EA 4R90H 1QLRB 4F7MA 1IBGL 1YNTB 3BP7B 1PKOA 4QRRA 1D6VL 4KJWC 4GG6A 5F3HB 1J8HA 1T22A 3PWUA 3MREA 5DC0A 4IBLT 1NAMH 2ICWA 3GSWB 3GI9L 1EEUA 4UQ3B 3WFHA 4OM1H 3UPRB 2P8PB 5IROA 1NUGA 4RZCA 2NX5B 1NKRA 3O3AA 4NPYA 3ALPA 5HPOA 3PQYD 4S2SB 1HH9B 5AG9A 3DXAE 5GJTL 1CXLA 2GAZA 2VN4A 3P9LA 4F15C 2NY4C 1ZLWK 2H45A 4WV1C 4BQCA 4HWBA 4M1DL 3L3DB 3V7MA 4QRRD 1A4JA 1VENA 1EH9A 1JPSL 1J8HD 4F58L 1XEDA 4KAQL 3H42H 5E5MB 1UM4H 3VXSA 3MRQB 2BOBA 3MNZB 4K7PY 5CP3H 3WIHA 3OQ3B 4EI5A 3IDMB 3WYRA 4OZFA 1KCVL 3MO1B 1DP0A 3NA9H 1AXTL 5B8CA 4DGYH 2W9LA 3HMXH 1MF2L 3GHEL 1CXFA 4I77L 4D0DB 1UENA 3EYOA 4R2GD 4L3AA 4EDWL 3PDOA 5TDOA 1J1PH 5DD6A 4PJGF 1I9JL 3BRGC 3KLAA 4JJ5A 3DBXA 1ORQA 4OB5H 3T4AA 4Y19E 1BIHA 2Y5EA 3AVEA 3MGOA 4X98A 3STLB 3OF6A 4EI5D 3VXUE 5HI4C 3REWA 1MHPL 3ZL4H 1UWXH 2FEEI 1RK0B 2PO6C 1P4BL 1UFUA 4PG2A 3UJIL 4HC1H 3LKRB 2A6KA 2ZCHL 4Y19A 2Z8WC 2Y1VA 4F7EB 3VXUA 4PGBB 4MJ5B 4WFEE 5FK9B 2BRRL 3IETA 2ZWLT 5AWNH 3X17A 1F13A 5BO1L 1U3HB 2E7HA 1L4IA 2FYYB 1L7TH 4GMSL 3TBVB 3QEGL 2VDRH 4Y2DD 5TFSH 3UBXI 5KG9A 3EFDH 5KW9L 1CG9B 5B3JE 1WF5A 5DRXA 1I7ZB 2UV3A 5TJWK 3OF6D 2QR0A 4NO3A 2Q7NA 1IFHH 5TDPB 2GT9A 3O4OC 2AJZA 2H8PB 4HEPG 3R0NA 3MODL 1SY6L 2C1PA 5BZWA 3TCXA 4YFLF 3FOLA 3UTTE 5B3JF 3GSVA 4XMLH 2YPLE 4Y19D 2ADGA 4XAKE 5SWSA 1C5CL 1MCOL 1I4FB 3PDGA 3VXUD 3DVGB 2PETA 4P2OA 3QRGH 4XP1L 3LH2L 3QO1B 3SE8H 4HEME 3TO4B 1CXEA 4XGZB 2V2WB 1G1YA 1OP3K 3MBEA 1MIML 5D7IB 1ROWA 1F4XH 1U41A 1K6QL 25C8L 2J7LA 4Y8AA 1FSKC 1IRAY 4NHUA 1I3VA 2ITDB 4UNUA 4CVXA 5EA0H 2WIIB 2J8UB 2DKUA 2X1QA 5I9QC 5GS0L 5DRZB 1PQZB 5K33A 4MB4A 1RUPL 4PS4L 3C6LB 3V8OA 4PLJD 1A6PA 3NIGF 1KXQE 1QBML 2BX5A 3HNSL 4X99B 1IGIH 1SEBA 4P2OD 1BLNB 4MNGE 2DTML 1NMAL 4NRZA 3MJGX 4UDTA 5IF0B 5BZDA 3MBED 3MMEB 5FYJH 2YPLD 4KV5E 4LASH 3VGAB 2GTWB 1T5XB 5GRYA 3SDYH 1I1AB 2ZSWB 3G6JF 5C3LD 3LKOA 1HHIA 3EOYG 3WFCH 4NKDA 3MV11 3O8XC 3OWEA 3U1SL 3WIFA 1RK1B 1WCBA 1LEIA 4O9HL 5CBAB 4N0UE 1C5DB 3LMJH 4PRNA 3BAEH 3G9VA 5E8EA 2Z92A 1OW0A 2ZCLH 1XF4A 2D3VA 2FHBA 2FL5A 3GMPA 1MCDA 4NM8H 3FO1B 2ITCB 3LKNA 4PY7B 1B3JA 3T0BA 1IT9L 3OL2A 4N0UA 3GHBH 4JM2A 4PGDA 2XN9A 2XXCB 3F65A 4U31A 4DFHA 1KJ2A 3QIUA 5DJ2A 4MJ2A 2BSTA 3D85B 4YXHL 3FO2A 5L2KB 3VWJB 3N50A 3S88H 4LSUH 5F44A 2EYSB 4RISL 4AIOA 1HHHB 4GRLC 1YECL 2VXQH 4GXVH 4MA3B 3WNMA 3VGDA 1OT2A 4KPHL 5HHPA 1PVHA 5GHWL 3KPMA 2B5IB 1X5KA 1PLGH 4ELME 4WEBL 1W0WA 1QSEA 3MRIB 1N6QL 5EZIL 5F6HJ 5E8OA 2QKIB 4G7YH 4MCZB 4JM2D 4OSUL 5DJDB 2NYYC 2EDHA 4QRQA 1H8NA 2IQAA 5GGQL 3QFJA 5ISZB 1MFDL 3LQMA 1NLBL 3C8KB 3QIUD 4N0FA 3R8BB 4J3UA 2DQDL 3HKFA 4D9LL 1X5XA 5C0NC 2ED8A 1XF2B 3NPSB 1N4XH 3ORJA 1CU4H 3BSZH 3ZT5A 3MXVH 2XFXB 3SGEI 2IAMC 4KHXL 5J4MA 3GM8A 1FL3A 2ICCA 3WXWL 1LE9A 4HAFA 1OAQL 3UBXB 1CDBA 3MC0A 2A6JA 2ZKHL 2DTSA 1QSED 4Q2ZB 4N0CC 4AH2B 4ZNCD 3CMGA 3ZTJH 1IKFL 3EYUH 4F33A 3SBWA 1G7HB 2MCPH 4L3EA 4KWUA 2FEEL 1MCQA 1MLBA 4IMKC 4MQTB 5DD1H 1R3KA 3VFOA 4XCEA 5DGQA 1C5BL 3QNZB 3QFJD 4KKBC 4Y5YC 4YDJB 3BW9B 4PJGB 4NDMB 3DETC 3PABB 5C7XH 3IFPB 4TULL 4UIKL 3S7GA 1R3JB 1I9RH 1T2JA 4JE4B 4ODUA 4MNQB 5E70A 4ETYA 3VRIB 2VRAA 2DQIH 1TJGH 1IKNC 1NSNL 4MQXC 2F53B 4NQDA 2WNGA 4AYFA 3L1OH 1U8HA 3TN0C 4U1IA 1XF1A 1T66D 4ERSL 4XMKH 2J6EL 5T1DL 3CDCA 1AGDA 5TGBA 4R8WH 1CIDA 5EN2A 1BPVA 3KYOA 3OJDA 4HH9A 5FOJA 1FDLH 1T1ZA 2FCBA 5DMGC 4G42A 1OAXH 4I9WE 1BJ8A 3PHQA 5C0AB 3H9HA 4OLXL 2OSLA 2IALA 4CUCA 5EO9A 1SYVB 2AGJH 3GSNH 2ICWJ 3T09A 1YY9D 2AK4E 2AK1L 1YEJL 3RU8H 4H1LH 2DM4A 3PWVB 1B0RB 1D5XB 1YEHH 4ZO9A 3GRWA 2EKJA 4HFWB 5IVOA 5CEYA 4ALAH 4HG4K 3ZYZA 1EJOL 4NQDD 1D6EB 4MA1C 1GOHA 2ICEB 4KTDL 4UOW1 1VFAA 1NDMA 4F7CB 3VH8B 4QWWC 4KK6D 3WJJA 1OGAA 5GRVK 3S34H 2J1KA 1IJ9A 5CFHA 1G7IB 4XHJD 2VO5A 2HFFB 3G5VA 5LGJA 1Q1JH 5KS9F 2FX9H 3NBNA 2CRZA 1AQDB 1CDUA 3T0EA 1AGEB 4NUJA 4QEGA 3S36L 4I9WD 4R2GC 1B4JH 5A16B 4U6XA 3GEWB 5DJ0A 1BBJA 3IXAA 3MLUL 3QIBA 2GK0A 3WBDA 5HHXH 3BHBA 2V7HB 4HLJA 5I74B 1OGAD 3BWAB 2E7MA 5FYJE 4EUPA 4NC0B 3A6BL 4F57H 5AZ2L 1FNEB 1J1XH 3LN4B 2W65A 3UTSE 5JW4N 5F6IB 1IEBA 1EEQA 5F88A 3RWFB 3T0ED 4QF1A 1EIBA 1ZT1A 3T2OA 1T20B 4PJEA 1ZTXL 3G6JB 3BDXA 4XCFH 1O7VA 4K3EH 3UTSA 3MFFB 4L8SC 1QUNA 1BOGA 3FT4B 1DE4B 3FB6B 3QIBD 1OOAA 4ODHH 3ULVD 3JWOL 1U8MB 4QXTA 3N9GH 1FG9C 1S9WB 1NGYA 2XV6B 5CJQL 4DKFH 4Y2DC 5CSBA 3RUGF 1RULL 5ADPL 5D1XA 2VDQL 4LSRH 3OBAA 4FZEH 3TNNB 1QFPA 4GBXC 5FGCE 4ZPVB 5SX5K 3RDTB 5C0RH 3O4LE 2W0KA 5AZEL 3RKPA 5GGRB 4YQXL 5IKCA 4GFTB 5FYJD 3BP5B 3MZTA 5FYKU 3DX6B 4MX7B 5HVHC 4XVTL 3SKMA 1MAJA 3UTSD 3LS4H 5C86A 1YDPA 3O4LA 3L5XH 1YEIH 5FYLL 1IQWH 1MHHB 4Y16C 5DJAA 1A1NB 1ODAA 4XXCC 1TVBA 4NQSA 4JQVA 3B9EA 2VLRA 4Z95H 1U95B 3INUH 1N5AA 2QQNH 3NFPA 4M02A 4OCSL 3V7AE 1YYLL 3K4ZA 1A1MA 1NEZB 3B2UC 3EYSH 2EIEA 1F3JB 4QTHA 2D0FA 4Z5RB 3HC4H 1P1ZA 3WUWG 4QRTA 3EO0B 2EDKA 2Q76A 1W8NA 1E4WH 5CEXB 4ZS7L 3I6GB 4JFHE 4U6TA 4D94A 5EOTB 3W9DB 5CWSA 5DHVB 4I3SL 1CD1A 1OQXA 4WWKA 4CMMB 5E56A 4M9PA 1HN1A 3O4LD 4MZ2A 4OGZA 1YEFH 1CE1H 1JZ4A 3MBEC 1M7DA 1S7TA 3U46B 2VLRD 2ZOLB 4JZOA 4LLUA 3TH2T 2HKHL 2GITB 5HYJE 1YN6B 4NUGH 3PP4H 2A0LC 3FT2A 4HS6B 4DW2L 1TQCB 2MQ3A 3NCEB 4OCMC 2JCCE 1U8OB 3Q5YA 4GW4B 1BX2B 4NCC1 4DGIH 4OZGF 3DLQR 2DBLH 8FABA 5HYJA 3KXFB 1J0JA 5I2IA 4WWKD 5F9JB 2GKIA 4N68A 2WINA 2CXKA 4P4RB 3SQOH 4U1LB 3HPLA 1TETL 3DJ9A 3MGAA 2COQA 4PRAA 4JFHD 1HEZA 3FHQA 3FO0L 2OZ4A 4QY8B 1WWAX 3O6KL 1YN7B 2HLAB 1X44A 5IHBA 2EDRA 4I0PD 4Q74A 4OD1H 1ZLUK 3L5WA 2O61A 3DVNA 1JJUA 5D2NA 1J86A 2FR4A 3PIQB 5CGYC 3CFBA 3DX7B 2ADFL 4JN2B 5HYJD 1G7MB 4UINH 3OKDA 2BVPB 3U0TA 1MQKH 2RCSL 4HV8B 5EDXA 3WN5C 3SKJH 5IV2B 5J11B 4YE4H 4RX4A 1GIGH 1AHWB 3D3VB 5JOFA 1DSFL 5EZLA 4EQ2A 5JDSB 3H0TA 5HHOA 1K4CA 3BD3A 1GGBH 2CR6A 1AIFA 2DBJA 1A1OA 4HS8H 5DO2C 3EIFA 2JF1A 4PRPE 5C9JA 1ZVSA 2EO1A 1QA9A 2DQEH 1S7UB 2R56L 5CBEA 3NIFF 4TSBH 5KS9B 5IW1B 3RJQB 4J6RL 4PJ8A 3QUYB 4TVPD 4WO4D 4HIHB 1IQDB 2EYRB 4PREB 1I8LA 4S1SL 3ES6A 4Y1AB 3D5OF 4KI5E 5T1MA 4BELD 3MV8A 4O2FB 5TF1L 1SVCP 4RX4D 4KJPC 3ROOA 3NOIA 4U1NB 3MJ8B 1QLEH 3V4UH 3OKNA 5IFAL 3LQAL 3KLDA 3UMTA 1VADB 1TPXB 2GUOB 4KROD 3O2DH 1VA9A 4HT1H 4PJAF 4BSWA 3WJLC 2LAGB 5IBLD 2K7QA 3G5ZB 3O6LL 5HBBA 2LABA 4R4BB 4U1SA 3H2WA 1BBDL 2ZJSH 4KQ3H 4WTZA 3V6OE 4EN3B 2HVJB 2B1AL 1HQ4A 4PJ8D 2X6MA 2X4NB 1JZ8A 3P4MB 4JKKA 1NBZB 1QHOA 2V17L 4NKOB 4OF3A 4OKVA 3MV8D 4C83B 5E2TH 4G8EA 4JVPA 4LGRB 3GMLB 3DX8B 4X7FC 2ENYA 5HSFA 3V6OA 2ZPKH 4ZFZA 1U91B 4M93C 5C6TL 5T3ZD 2QSTA 4V2BA 4DZBB 5HD8C 1Z5LB 4IDJL 3C2SA 3RIFF 5F7EH 1MCWM 3ESVF 2CIKB 3FL7A 4KI5D 1A0QL 5EG6C 2OTUB 3CZFB 3O3UN 4JY5L 4X6CA 1W0YT 3RUGB 3HE7A 2PYFB 5HYSB 4LCIH 1ZA3A 2Q3ZA 5E6IB 2EICA 2DQTL 5H94A 4P2QA 5GS1A 1HHKB 3GNML 3DMMA 3UYOD 1YQ2A 3BEVB 4QXGH 3CFEA 4KK6C 2HTLD 3D39B 5JNYA 3QA3A 4XHJC 4FFYL 4XCNB 4Y4KC 4FRWA 4XNUL 4W6WB 5EO0A 4XVSH 1TQBB 3IJYA 3QNXA 4NT6A 4XPTL 1G7PB 2EDQA 3FKUS 5DEGA 1LNUA 4RAVB 3GSRA 1AR1C 3GGWB 4KDVA 1HOCB 3I9GH 3HE7D 4JPVH 5JQ6L 3RWEA 1LEKA 2DLEA 2L7UA 1KT2A 4DK3A 3SGJA 2CJUH 1SBSH 2BY2A 2IGFH 1QFWL 4P2QD 3SJVE 3OAYH 3I3DA 1OARL 3DMMD 3HMWH 4XPFL 3BN3B 5BV7B 2CDGB 3PWLB 1F6AB 1I1YA 1EHLH 1K2DA 5LBSL 3GMMA 5EB9A 5F1OB 3RPIB 1I8MB 2YEZB 2RJMA 1BECA 3MRBA 4L9LB 4PJBE 5C6PB 2W0FA 2CR3A 3SJVA 4DQOL 4M48L 4JHWL 1NFDA 5I8EA 5HYQB 5K9JL 2FGZA 1B6DA 1E0OB 2QQKL 4FQLH 4P9ML 4YO0A 5TDNB 4EBQL 2ORBH 3EDJA 1V3MA 1M6OA 3OKYA 4KKAC 4HBCH 4PJBA 1SVZA 2DI8A 4ZNEE 3ULUH 4CN4A 2WSKA 5E8NB 4AG4L 5IJKC 4FQ1L 3FRUB 3UTPE 3FQRA 1MSPA 3MOQA 5BV7L 2X9YA 4OZGB 1QRKA 3QR2A 4R96A 4YHML 1PG7L 1GHFL 1ZANL 4KJYB 4UUJA 5IB5A 1E4XI 2EIZA 4LAQL 5I30L 3SJVD 4ZSOB 2PYEB 4PJIB 3DHMA 2OMBA 1R3LB 5EU3B 2GSIA 3RL1B 3D0VA 4DUWA 3QDMB 4UB0H 2G2RB 2NY3C 4FQXC 4K7PH 4OZHA 3GIVA 2G5RA 1GZQA 5JPNA 1DN0A 2EDOA 3D0LA 3IDJA 1RHFA 3T8XB 5GSVA 5HVGB 3LZFH 4WHTB 1JF6A 2R1XA 5GGSB 1BQLL 3BGAA 5CIPB 4CVZB 4ONOA 5KSBF 5CEZE 2O5YH 5JIHA 2F19H 4N1CA 4GG8B 1HQRB 5DFTA 2DQJL 4OD2B 4UQ2B 1EO5A 1UJ3A 4B50A 3C08H 4XNXH 1OD9A 2BY1A 3V4VH 1KN2H 5BXFA 1NBVL 3AS3A 1Q8MA 1CL7L 4KDWA 4XB8A 4NC1C 4N5UA 2CKNA 1N3NB 2NY2D 1MFCH 1EHAA 3PJSA 2MNUA 1SMAA 4HIJB 3SN6N 3V95A 3WLBA 4MD0A 4JO1L 1RZFL 1A3LL 3S5LB 3GSXA 2Z4QB 1FCGA 1TTFA 2NR6D 4RGMC 3STZA 3WS6C 5D1ZA 1I9IL 3O3DA 2YD6A 1KIQB 4JFPA 3CC5A 3SDXE 3QHFL 5CEZD 4DEPC 2GJ6B 4OCRL 4HFUH 5DEFA 4Z7VA 1A6TB 3E2HB 1T1YB 1JF1A 3RQ3A 2AS5M 3I02A 4LVHC 2Y23A 1OSPL 1JPFB 1I1CA 3BH8A 1MCSA 4PJAB 5J1SC 3PP3K 3EZ8A 2XWBB 3C5ZB 5LAXB 3HAEG 3KGRA 5ILTL 1WC7A 4FXGB 4X6BA 2B2XH 3HHRB 2W1NA 4K8RH 2ATKA 1UWGL 1Q0XH 3MLVL 3C60C 5CJOL 1INQA 5T3XD 5ESVA 5D1ZD 4OLZH 4I0PC 3HI1A 1MJUH 4HMCA 3QULB 2C3VB 2E6PA 5D8JH 4MA8H 4OZ4B 4PJFF 1KEMH 3GMRB 4AL8H 3IU3A 2M8XA 5ESQB 1NJ9B 2VXSL 5JA8B 5DXWA 1ZLWH 5MEQA 2VDML 5D93C 3HNTL 1BWMA 5AUMB 1A6VL 3MTRA 1R0AL 5ERWB 4I13B 2Z93A 4KI1A 2O5XL 3SPVB 1S9VA 3SDAC 4FG6D 5EC1A 5H8DA 2VTFA 3K8MA 2GJZB 1A8JH 1OAZH 2P8LB 2R69H 3ARYA 1VGKA 3DTXA 4MDJB 2FD6H 1YQVL 3S35X 1SJHA 3OR7B 5A2JH 3U2SA 3W11D 3JVGA 1CT8A 1DUYB 1MRDH 1NBQA 1QBAA 4QT5B 4X5XB 4WTWA 5BW7C 4P5KB 3GKWH 5J12C 4Z7WE 4WO4C 4MD5B 4FTVE 4HQQL 1AD0B 2A6DB 5JXAL 1A6UL 1QO3A 2CLZB 4HHAB 4L8CA 2YK1L 3TO2B 4QRPB 3HCVB 5EZOL 3FCTB 5EULV 4FFVD 3O2VL 2Y72A 4NNXB 4HCRL 1T0NB 1ZHNA 1CZ8H 3B2VL 2VLKE 4JDVB 3U4BL 3KPOA 3QDAA 2KQMA 4C4KT 3VXPB 3DYOA 4QHLB 3O6FA 3OMZA 4ENEC 5IBLC 2EXWC 3QQ3B 4ZFOA 4F8QA 5INCB 1XR8A 1CLOH 1V05A 4JZNB 4NN5C 5EPMA 1CGYA 4G9DA 2VLKA 2BNQA 1FGNH 3AAZA 5AD0B 1C8PA 3ULUE 3H9SB 4U33A 2P5EA 1E4XL 4ODXB 4G6FB 4E42B 3Q5TA 1IAOA 1G1CA 5GPRA 5C0CA 5CGMA 1H0DA 5J6GB 4OD3H 1M1SA 4RGNB 4Z8FH 4MJIB 1IC4L 4O58H 2WQ8A 1HILB 2QADD 2CRIA 1W8OA 3SDCA 2YD3A 1MJJA 3BKCH 4G9FB 4M1CC 5EU5B 1ZGLA 3O6FD 3LDBC 5IT2H 1RZ8A 4BFBD 1WVZA 3QXVA 5JORA 5MEOB 3BE1H 1ORSB 1BJMA 3IVKA 1ZGLM 1TZGL 4ZUVA 2BNRE 5F1NA 1Q9LB 2VLKD 3WE6A 3MA9L 5TE7H 2YC1A 1WZMA 4PV9B 4KJQC 4KU1A 2ZCKL 3CDFA 3DV6B 4LHUD 3QDHA 4X9GA 2PR4H 1FZKA 3IJSA 1R6VA 4AT6A 2VAAB 1S7RB 1I7TA 2BMKA 4JKLA 4UT7H 3SOBH 3U7WL 3VXQA 1L7IH 1OP3H 4P3CL 1NC2A 2BNRA 3IDGA 5FOBB 4ZAKB 4HF5L 4LCYA 4GKZA 4CL7A 3VFMA 2QSVA 3CLEH 5F6HI 3L3OA 1TLKA 3SDCD 4U1KA 1QVOB 2H2SC 5KSBB 1QSFA 1S5HA 3JBG7 4U1JB 2BK8A 5F3BA 4BK5A 1AP2B 1PY9A 2PW2A 2W60B 1RJZA 3VW3L 2YD9A 3QUZB 5EOQL 5J13B 4NP4L 1U93A 3BZDA 1YYMH 3TYGH 4MCYB 4GG6F 4IRSC 4X4ME 2EH7L 1UXSB 1MFEL 3B9KD 1E28A 3SCMA 4Z7NE 1IGCL 1RUKH 1LE5A 3RWCA 4WU7B 4AEIH 4LNRA 1ONQB 2AJYL 3GKZA 5F7MC 3MLZL 5BJTB 1EVTC 3O3EA 4UDUA 4I18B 3JV5A 4WJ5A 1QACA 1NC2D 2EIBA 1BD2A 2BNRD 2X70A 4Y4FB 1C16A 5F7NC 4P4KC 5A2IH 1UCTA 3K80A 4MVBD 4ODSL 2RHEA 3H9YA 3VFRA 5DRWB 5I1IL 5JOEA 4Z7OE 3CNKA 2AKRB 4HX1B 3WLWC 1QSFD 43CAB 4NN7C 3U9UA 4XBGB 3SKOB 1DVFB 4XP4H 4R9HA 5C0BB 1AJ7H 3VFUA 3UTZB 5F71A 2J12B 2VIRA 3SCMD 3KYNB 4OFYA 4JZJC 4NIKB 1CYGA 3GJFB 2AJSL 1BMGA 1MUJB 4E5XA 1IC1A 1K9TA 4Y4HA 1FNSH 2DWEA 4D2NA 1BD2D 1WFOA 2LFGA 5EOCL 3A67H 4M7LL 4RDQF 1DBJH 3KAAA 3LPFA 5EWIL 1NGPL 4XC3L 1Y18B 5C2BH 4HDIA 4CJ0A 4MSWB 3BDYH 3EOBA 4PRIE 4NSKB 3KPTA 1G7QA 4KXZH 4HD9A 3QG7H 2ICWI 4HPOH 1XH3A 3IDYB 5E2VL 3OG4B 1XZ0A 1Q72H 4LNVA 2WBJC 4PJFB 5ETUB 4HUXB 2XA3A 5DURB 3FOMB 2RQ8A 1DBAL 1JPTH 1WBZA 1MWAH 1DQDH 3MRRB 4UU9A 5JDJA 1ZHLA 1FYTB 4Y4HD 2NXYD 2V9TA 1OGTA 4DN4L 4MS8D 4QOKE 5DHYB 3F7YA 1JMXA 1G7LB 3B9AA 3U0PA 3W39B 4ZUUB 1Q9WA 3VI4F 5I1LB 2ARJA 1XGTB 3BN9D 4UOJA 4QOKA 4RAUA 3BPCA 1IL1B 5I1GH 4LSVH 2VN7A 3QHZL 4X7SH 1NGZB 4APQB 3ECBB 1F00I 4JY6B 3QG6B 4X7TA 5C0FB 4PRID 2VXUH 1P4IL 2F58H 3HZYB 2HP4A 3QUMH 4JRYA 2NR6C 3VFGH 4CBPA 5JR1H 1DBKL 2DJUA 5T33H 4J4PA 2FSEB 5D1QC 3WL9B 5F9OH 3QJFA 4NNPL 1K8DA 4OUUB 5F8RC 5CILL 2SEBA 2JIXD 2V2TB 1PD6A 1KTLA 1DBMH 3P0VL 3X14B 1DQLL 1RUAH 3U7YH 3X13A 4JKWA 4QOKD 4R7NA 3TBSB 1AGBA 2D7NA 4CKVX 1BVZA 4XPBL 1XGYH 4UAOC 4D3CL 1YUHA 2AV7A 4MXWL 2BJML 4PJ7A 2B7DT 3BZFA 4X0KB 5DSCB 5GISL 3S37L 4C56A 2OL3B 4JRYD 5F9WB 5D1ZC 1NCNA 4X6EB 1WZKA 3U83A 2Z0BA 1JNNH 3NCYS 1AQKL 4ORGA 5JW3L 3IU4L 4R0LB 2CLVA 2BHZA 1GGCL 3P0YL 4JPIA 3L6FB 4LSSH 1G9NH 1ZHBA 3OKOB 3VGFA 1TVDA 3WUWA 3RHWK 1YMHA 3V6FA 1MVUA 4PBXA 1U8NA 1Q38A 4NZUH 4PRHB 1NEUA 5F7UA 1R3HB 4IIQB 4PJHE 4JRWA 4XVJL 1I8KA 2IFFH 3KYMB 2Y5TB 4JFZL 4YDKL 4P57A 1FO0B 3LPGA 4OLWL 4HWZB 5F1SA 4C56D 2GK2A 2OL3L 2YA2A 3MR9A 4OCYL 5LCVH 4NO2B 2OR8A 4WHYH 5HHQB 2DD8L 3VXOA 3BEWB 1MRFL 4G6MH 3N1GC 5MEPA 4JGMA 4MJ6B 4OKDA 1AC0A 1CFVH 5I15H 4LPYA 3EW3B 5IVXE 2W9EL 4HKXB 2WMPA 3QXAA 5JMOC 2DOCA 4J1UA 3U4EB 2OTWA 1SJEA 3BYTA 4OGXH 1UWEH 3PQYB 3MCG1 1X5JA 3RY6C 4Q9QH 1YY8B 3A6CL 2XNAA 3W9EB 1CLYH 4JM2F 4M4PA 3IYLW 4TTDC 1TZHA 1ES0A 4FMKA 4I5BA 4F7MB 5IVXA 2JK5A 2C9AA 4QRRB 4P99A 1CGSL 4L5FL 4GG6B 3I85A 2N7AA 1J8HB 1T22B 3FHAA 3MREB 3K2UH 3PWUB 4JM4L 4PPTA 4RMVA 4WUUA 3ZSSA 4J3OC 3RWGA 3U6RA 1H15A 2ICWB 2FZ3A 4AMKH 2XQBH 4FP8L 5L9DL 2HT2D 1BZ9A 3PHOA 4IRZH 3WFHB 2IPTL 1A64A 4CW1A 2APVA 2FIRT 4H5SA 3RL2A 4NJ9L 2ZUQB 4RZCB 5FGBA 3O3AB 5HHMB 2V9RA 3VFTA 1OY3B 4KUCD 2QSCL 2GAZB 4LBEA 3P9LB 2FATH 4UV4H 1IAIM 1UQSA 5HVWA 1A4JB 2LTQB 3DUUB 4G8GE 1J8KA 3MNWA 3P2TA 4IOFC 3HC0A 4LU5L 4QGTA 2HFEA 5A3IC 3VXSB 5SX5H 4UI2A 1S7SA 1PKQE 1N6VA 1MCLA 2BOBB 1CR9L 4I0KA 4C54A 4LOUC 3QIWA 5I1DA 3M8OH 4EI5B 4G8GA 1RZ7H 4OZFB 1CWVA 3FMGH 1CI5A 3EBAA 4MGXA 5B8CB 3VWKD 5KVGL 1PKQA 1ZKAA 2VZSA 2EDFA 3EYOB 2YXMA 4HWBL 3PDOB 2W59A 5TDOB 5FCUL 1WCQA 3OKMA 3ULUC 2PTTA 5DD6B 5DJZA 2Z8SA 1RI8A 1E4KA 1U8PA 1WZ1H 3KLAB 3WEXA 3DBXB 2OJZL 4NM4L 1ORQB 5E1HB 3T4AB 2C7UA 1WFNA 1GPOL 1N0XH 3WIHL 3MGOB 4M61A 4X98B 1UM5L 4G8GD 3REWB 1Z3GL 5EORL 4G6KL 2QSQA 3B9KC 3WKMH 2PXYC 1S5IL 2FBJL 3F12A 2A6KB 3NA4A 4HIXH 4Y19B 5BS0E 1EAJA 3ARXA 3NFNB 5L2JA 2MHAA 3AMKA 3GBNL 4WRLA 3EYFA 5H35A 3QCVL 3VXUB 1JHKL 2JJSA 1CGWA 2VL4A 3HE6A 1QNZH 2CK0L 3IETB 4M5YL 4MVBC 3TC9A 1KCUH 2LV4A 5FCSH 5INDB 1MFAH 1BIIA 3UTQA 4D9RE 3WO3B 3IKKA 5KG9B 4U6VH 2IPUG 5L0QB 4HKJA 5DRXB 2BVTA 2DQFA 3GSOA 2QR0B 4NO3B 5L6YH 1FN4A 2GT9B 2AJZB 4L4TE 2C1PB 5BZWB 1KN4H 4KZDL 3FOLB 3GSVB 1I9EA 1JYVA 2ADGB 2X7LA 4F7TA 1KGCE 5SWSB 1IGMH 2XA8H 3HE6D 4P2OB 3ZDYE 3QQ9C 3Q5OA 3ZKMD 1HSBA 3FO9A 3O2WH 5HHVL 1A9BA 4OFPA 2P5WE 4NHUB 1QFUH 1ZLUH 2AAVA 1MCBA 1B0WA 1NCUA 4UBDC 3WDJA 3KHOA 1JGLL 1OVZA 5KAQF 5D2LF 3HLAA 3U9PL 4YAQA 2NXZD 4TRPH 3ULVF 2H2PD 4H20H 3X3GL 4D9RD 3RY5A 2GEEA 5DJYA 1B4RA 1VGEH 5CJBA 4HMDA 1CCZA 2VH5L 1FQ9C 2P48B 2NXYC 1BZQK 1ZS8A 5AYUH 1B2WL 3L3GA 3CVHL 4JLRA 1SEBB 4N5ED 3QXWA 4MS8C 2QHRL 5E2WH 2NY5H 5CP7A 4CVUA 4NRZB 4UDTB 1YEGL 5J3HD 4FQ2L 5BZDB 1JI2A 1H5BA 3TZVA 12E8L 2GFBA 4OLEA 1KGCD 1F90H 4RQQA 4HULB 2WUCH 3D25A 4K8RC 1S3KL 4PJEF 1WIUA 3LKOB 1FYHB 1HHIB 3CXDL 3H3PH 4WI6A 3TVMC 3GO1H 4NKDB 3Q6FA 1CF8H 1IAKA 1URLA 4YDIL 2C26A 1DQTA 3WIFB 1WCBB 1YPZE 2P5WD 1LEIB 5C08A 4ZD3H 4JFFA 3VCLA 1UG9A 4OF6A 4PRNB 1GC1L 5E8EB 2Z92B 5L88L 3KJ4B 1XF4B 3GMPB 2FL5B 4LLQA 3BRDA 2AQ1A 1MRCL 2Y06L 1BQHG 1ULVA 3LKNB 3KLHD 5D7JC 4NO5A 4EOWL 4ONFH 4JREC 2E7BA 4N0UB 1F8TH 4JM2B 4XP6H 3TZVD 5DF0A 5C0GA 1DANT 4BFGA 1Y6MR 4PGDB 2XN9B 3P73A 1JK8A 4LPXA 2H32B 2EDBA 4OF0A 3T3PF 1JZ6A 2FO4A 1KJ2B 3QIUB 5DJ2B 1WTGT 4P3WA 2BSTB 1FZOA 3FO2B 5EU6E 2UYLA 4M3KB 4QRUA 4YXKL 4G7VL 4FNLH 4KRPC 2DKMA 5C08D 2XI9A 2Y9RT 2EDDA 5HHPB 4UZGA 3U48A 3KPMB 2APXA 3S36X 5DA4A 5A2KH 3TYFA 2D03L 3OR6A 4KHTL 5EU6A 1W0WB 5IMLA 1QSEB 3IDIA 5HYEA 4UMGA 4YPGA 5E8OB 3UZQA 2E9BA 3JUZA 4XMPH 1D5IH 2HG5A 3DURA 4HUUA 4AM0A 1DUZA 4QRQB 3TA3C 1U9KA 1MNUH 4R90L 2IQAB 3QFJB 1NGQH 1JPGA 2OLDA 3AMLA 1KJ2L 4PY8I 4N0FB 2R9HD 1KFAL 4OV5A 1C7TA 2ERJC 4BQ6A 2CDEA 5ALCH 4GSDH 5T5NG 1RQ5A 1GVIA 2ZUYA 4LP4A 3MV01 4S0SD 4OZIE 5H2BA 5FHAL 2HWZL 3CSYA 2ZUVA 1FL3B 4P5TA 1LE9B 3NTCH 5DT1H 1YMME 2UWEA 1KCKA 2FGWL 4GLRH 4OM1L 3KPNA 2A6JB 5MENA 5EZJA 5EU6D 2R2HA 4JKMA 3GUTA 3IJHA 1QBLL 4L3EB 2GI7A 1MLBB 3W82A 1UH2A 1R3KB 3VFOB 4XCEB 3CLFL 3RI5F 1BFSA 1E27A 1OTTD 3RVVD 2AJXH 3KPLA 1W72H 1FGVL 1RMFH 4MXQD 3ARGD 4JHAH 1NDGA 2KDGA 4FQPA 5I8KH 4ODUB 4GRWB 1UEMA 1UM4L 3ZE0E 1WWBX 3GIZH 1OM3H 4HK0A 1FC2D 4P5TD 2XTJE 3QAZB 2O26U 4NQDB 1U8HB 3HAEA 3S4SG 1CGUA 4U1IB 5MEND 2EH8L 2DN7A 1AGDB 5TGBB 1AI1H 1IC5H 1KCLA 5EN2B 3PDDA 2HT2C 3KYOB 3OJDB 4HH9B 4Q0XH 1J12A 2E9WA 1T1ZB 4EQ3A 4G42B 3PHQB 1HZHH 3H9HB 2OSLB 2IALB 3FONB 5EO9B 1WIOA 2WW8A 3PWNA 4LMQE 5ENWA 1RIVL 4Y5XA 1KELH 1EFQA 1HH6A 2AI0H 3FQTA 4OCXH 2D7PA 1G9EA 1JV5A 1GGIL 1VHPA 5IIEA 1EEYA 2R4RL 5K59E 5CEYB 1OAYH 4AEHH 1NCDH 3BOVA 1R5VA 5E0QA 1VFAB 1NDMB 5IEHB 1JWUA 5CJXC 1OGAB 4NHCL 5FXCH 3QEUA 4JQXC 4PJCE 4PP1D 1MPAH 1FAIH 5LGJB 3G5VB 1A7PL 4LEXL 2WBWB 5KSVA 3N06B 4FQQA 4MDIA 4ETQA 2W92A 5J6HA 3MLYH 1OPGH 3OAUL 3MV7A 3VG0H 4X4YA 4I1NB 3G5YA 3SE9H 3VWKC 4LCWA 3T0EB 1N5YH 4F37K 1L7TL 3QDJE 3BMVA 4NUJB 4DJMA 3I6KA 4BSVA 4RFNB 2VDRL 5C71A 2X89A 2J6EA 3GRWL 4U6XB 5D2LB 5GRUH 4EDXA 5DJ0B 4OI8A 1BBJB 3IXAB 3QIBB 3MV9A 2GK0B 4MHHG 1IFHL 2A6IA 3QDJA 3ZHDA 2EDTA 3BHBB 3FN0H 3GI8L 3TBWA 2NTSP 3WS3A 1YC8A 2EYTA 4EUPB 4MAYC 2ZUUA 4WW2A 2W65B 4K3JL 1KF9B 1QR1A 4C4KO 4ZQKA 5I1AA 5C70A 1IEBB 2D0HA 1V3JA 3MV7D 5GZOC 1B6UA 3SE8L 1KIPA 4TNWF 5F88B 3QJHA 2YUWA 4HGMA 4QF1B 1ZT1B 1F4XL 4PJEB 1Z9LA 1GZPA 2EO9A 3MACH 3UTSB 4ONGH 1BOGB 3MV9D 3T2NH 1G6RH 1JZ5A 3ULVL 4YC2C 4QNPE 5EUOE 3QDJD 4QXTB 1NGYB 4X6CF 3K8LA 2NY0B 1CLCA 4BSJA 5DYOA 5DK3A 3VMPA 5D1XB 5HTSA 3IF1A 3NCYP 5E08L 2EECA 4QNPF 5EUOA 5DR5H 4U1HA 2X40A 4K94H 5IKCB 2AJUH 3PP3H 5FYJL 4FQCH 2FECI 1L9MA 3P9WB 1ZWIA 4ELKA 2FHCA 4LASL 4DOHE 1FFQA 2EXYD 5FUZL 1INDH 3SKMB 4X80L 2FX7H 3FZUD 5FGCB 3SDYL 2VDNH 1J0ZA 1OCWL 1YDPB 2X1PA 3O4LB 4NWUH 2ATPA 4OT1H 1JTTA 5DJAB 3WFCL 1FIGH 1TVBB 1LWRA 1QYGH 1SYSA 2CKBH 2OR7A 3HFMH 2P46B 3RP1A 5IESH 4NQSB 2VLRB 1Z9MA 2FIKA 3UC0H 1N5AB 4BZ1H 3NFPB 5JUEH 4PJ5E 3LMJL 4OIIH 2VNCA 3BAEL 1N7ML 1A1MB 2ZCLL 4QTHB 4JG0L 1CDYA 3HG1E 1P1ZB 5FF6A 4QRTB 4KDTC 4QHKJ 1CDGA 2Q76B 2H2PC 3ZSTA 1X5FA 2VQUA 4YIQA 2Q20A 2HFGH 3GHBL 2A1WL 1RIUL 4PJ5A 4XWOD 1VERA 4FQHA 1NCWH 1S7VA 5CWSB 3QP3A 4JPKH 1CD1B 1HXYA 5FUOH 4WWKB 2DMKA 3CFKA 4DGVL 3FB5A 2BDNL 1NFDF 5C07A 5AAMA 4KTEL 1EJ6A 1JNLH 4GAJL 3U0WH 5CZXC 1M7DB 1S7TB 3VI3E 1I85A 1FNGA 4JZOB 2VXQL 4LLUB 5E9DA 4FS0A 2BCKA 3AS2A 3TJHC 2IJ0C 4ZS6C 2EZ0C 4BFEA 1E6OH 3FT2B 3WSQH 4EVNA 1U3JA 1PLGL 3AS0A 4V1DE 4WY7L 1KIRA 1V5JA 4I2XE 4G7YL 8FABB 4PJ5D 5HYJB 3O0RH 4KKCD 3S97C 5I2IB 4J3TA 1G9NC 1GAFH 1IGYA 2WINB 5F21B 2FJFA 5C07D 2XQYK 2UUDK 1JRHI 3HPLB 4NO0A 5E4EC 1FHGA 4PRAB 2ZNXA 1HEZB 1CU4L 4JQIL 4Y5VA 4OZHF 5E9DD 4YWGH 3T0DA 1CGTA 5KSAD 4D8PA 1EBAA 4QXUL 5BRZE 1NCBH 4HKBA 3L5WB 4LSPH 2O61B 3DVNB 5D2NB 3QEQE 2FR4B 3EYUL 4O51A 3CFBB 3TFKC 1WAAE 2VOTA 2BRQA 3MGTA 3CX5K 4R26H 3ARBC 4OUOA 3U0TB 2Y36L 2IBBA 3MUZ1 4RFEA 4F9LC 2NY1C 3QEQA 4V1DD 4NO0D 1WAAF 2APFA 2IANE 4GLRI 3MRHA 3Q6GH 1QD0A 3WDHA 2HYMA 1I9RL 5EZLB 5JOFB 4XPHL 1CD9B 3H0TB 5HHOB 1K4CB 1K3IA 1OTSD 4RGOL 3MRGB 1AIFB 4KVCL 3DRQA 1A1OB 1NL0H 3MLTA 4KROB 3L1OL 4LVOB 5C9JB 3NABH 4A6YH 4Y88A 1ZVSB 4XMKL 1QA9B 4Z76A 3BFOA 5CBEB 1AO7A 1FDLL 5E95B 4OIBA 1VFMA 5JTWA 1ZEAH 4XRCA 2O93L 4PJ8B 1MI5A 2VUYA 3MRFA 2AGJL 1UCBL 3GSNL 4U1GC 3ES6B 3Q1SL 4OGAD 2WIMA 3QEQD 2NQCA 1EFXA 5T1MB 3MV8B 1PSKH 1UB6A 5DJCA 3ROOB 2Y07H 5B39G 2XT1B 1YC7A 1PG7X 3OKNB 4Z7VF 2ZZUT 3ILQC 2H26A 3T65A 1OTTC 3F5WA 5GGRY 4ALAL 3ARGC 4DKDC 4BSWB 2BNUA 1N64H 1P5UA 4X8XA 1L9NA 4OLVL 4Q9RH 5EBMA 5D4QA 3SE3A 1F4WL 4U1SB 1L0XA 6CGTA 3T1WA 3G08A 4LRIA 1HQ4B 5SWZE 1Q1JL 1QQDA 5EBLA 4NFBA 2HRPL 1ETZA 2I25N 4LIQH 3OTTA 3LS5L 4G8EB 4X7DC 1OLZA 4UV7H 1D9KA 3RKDD 4M62L 4ZFZB 5T3ZL 3SGKA 3S35H 2P42B 2I07A 5TF0A 4G5ZL 3QO0A 4TSAL 2EDEA 3V9FA 2IEPA 4X6CB 4X6FA 1I1FA 3HE7B 1X5LA 2HT4C 4W6YB 5IOPA 1ZA3B 1DFBH 2BOCA 2E8YA 2VWEC 4PJ9A 4W4OA 1Z6JT 5DHXB 2OQJA 3X11A 3BO8A 5H94B 4P2QB 5GS1B 4F57L 3DMMB 4M6MH 4P23C 4YXLH 3CFEB 2YUZA 1VACA 2O5ZH 4D0BA 2Y6SD 4I8DA 1XGUA 3KR3H 3MJ9A 1RZKH 5JNYB 3QA3B 2R0KH 2A83A 1D9KD 2XTJC 3IFLL 3RBGA 5EO0B 1XIWA 2WUBH 4PJXA 4JO2H 3IJYB 3QNXB 1RPQA 1P6AB 4NT6B 3WMSA 2VDLH 5DEGB 3MLXH 1LNUB 4GKNA 4XPGH 3VFSA 1XT5A 3GSRB 1E6JL 5FV1L 2YWZA 2BSRB 2NW2A 5D5ME 3RWEB 1LEKB 1KT2B 5C8JA 4K71C 4PJ9D 4LSRL 5F1KC 3BPLB 1KXTB 3AC0A 2NW3A 1Y6NR 4BUHA 1VKXA 5D5MA 1I1YB 1K2DB 1Q94A 1X6LA 3GMMB 2YA1A 4FFZL 4XPAH 3VXME 3MRBB 3PE9A 5KTEH 1XIWD 1J88A 2W0FB 4J3WA 4Z78A 2PNDA 1NFDB 3RNQA 4BM7A 1LILA 3GB7A 5I8EB 1YEIL 4YO0B 1IQWL 5TQ0H 5I19L 4LCCA 1M6OB 2IH3A 2R4SH 3HI5H 4PJBB 2QQNL 3T77A 2HA1A 3MLWH 3EHBD 1G9MH 2F8VA 4X6DE 1BM3H 3FQRB 4HXAH 4HIIA 2YBRA 3HC4L 2YPKA 3PL6A 4ACPA 4R96B 1JMZA 3TLRA 4UUJB 5IB5B 5JOPE 1KTDA 2EIZB 4ZXBB 2V9QA 5E00A 4X6DA 2HFTA 2GJJA 4WEUD 1J9CT 1JFQL 2C3XA 2GSIB 2NY5C 2P1YA 3D0VB 3QUXA 3BZEA 1CE1L 1MCPH 3ARED 4OZHB 2NY2B 3GIVB 1KB5A 3QUKA 1U6AL 4Z7UE 1BEYL 3VXMD 1GZQB 1NLDH 5JPNB 2EXYC 5CD3A 1DN0B 2VZVA 5IMMA 3D0LB 3IDJB 4RBPK 5K9QG 1MIEH 5GSVB 1QFOA 2R1XB 1QFWM 3B6SA 1T21A 4KGLA 3PL6D 4EXKA 5CLTA 4AY0A 2VZ3A 1M7IA 4Z7UA 3HC3H 3QCTL 3L9RA 4JDTL 3MRCA 4UT6L 1UJ3B 2DBLL 1FZJA 3EDFA 4YEEA 3WD5H 5JHLL 1RUML 5EC2A 4L4JA 1J1OL 4N0RA 3OAZK 5BXFB 3QQ4A 4PB9H 1HINH 1QRNE 3SQOL 4NRYA 3HUJE 4Q6YA 1G7JA 3QUXD 3WFDH 2XZQH 1I7UA 1DQMH 2HH0L 2DQCH 3J7HA 4XNQA 4LK4A 4XWOC 1EAPA 5JOPD 3PJSB 4DVRL 4O00A 3C8HA 5FHBL 5M94B 1G6VK 4DFIA 1G0XA 4P46A 3WLBB 1FNFA 4MD0B 2X05A 2KL6A 1B0GA 1CN4A 1NUDA 3GSXB 1RFDL 3CZJA 1HSAA 3WIIH 3BKYH 2BY0A 3STZB 4DZ8A 4Y0GA 7FABH 3MXWH 3O3DB 4WI5A 3QRFM 4JFPB 3CC5B 5CEZL 5JHDE 5HGAA 3RVTD 1MFBH 5DEFB 1DN2A 4Z7VB 3U82B 1KPVA 1CBVH 1FH5H 3AXLA 3I02B 1GGBL 2EEDA 3QH3A 4YHIA 3BH8B 1OAUH 1HKFA 2MQ0A 4HS8L 1WC7B 3BPOB 4X6BB 3BUYA 2ATKB 3RVWC 4LIQE 4NQCE 2R0LL 5KSAC 3O41A 1CTNA 1JGVL 1INQB 4WGVB 2QV2A 1DCLA 4TSBL 5ESVB 5T3XL 5B3NA 1EERB 1A5FL 1S78D 3GI9H 4WFGE 3HI1B 3P9MA 5CUSH 5I1EH 3TEUA 3LY6A 3NCJL 5I73B 2V5TA 4K7FA 2R23A 3IU3B 4K23H 1HHGA 4MNHA 3LQZA 5MEQB 4P2RA 5GJTH 3QI9C 1WISA 5E99L 2Z93B 3BQUA 5I71B 3ABZA 1BAFL 3O2DL 5ID1A 4M1DH 4J3VA 4HT1L 1S9VB 3DROA 2DQGL 4OM0L 5DD3H 5EC1B 1JPSH 2CO7B 3F62A 3WNKA 1NMCC 3CAFA 4KAQH 3W2DH 2VDKL 5FM5M 2ZJSL 2L7JA 4KQ3L 4XVUD 1VGKB 3DTXB 2X10A 3EJZD 4KY1L 4J2XA 2R0WL 1SJHB 3RTQD 3U2SB 3G5XA 43C9A 1CT8B 2ED7A 4S1QH 4FABL 1A4KA 2ZPKL 3S3JA 1MF2H 2OM5A 3GHEH 3RWDA 3RGVA 3STBA 1QO3B 4L8CB 4OGAC 5F7EL 3BQUD 4EDWH 1HE7A 3D2UD 3O9WD 1BQHA 1ZHNB 3G6DL 4LCIL 4JAMA 5I1KH 1ZV5A 3BPNB 3BZ4A 4NBZB 5HXMA 1U0QA 2RFXA 1ZLSH 3V5HA 2QADB 3KPOB 4ONHA 1UEYA 5ACZA 5ITBH 1A3RL 4JVWA 1MY5A 4IRJD 3O6FB 3FQWA 3BDBA 3ZTNH 4NNYA 3UZEA 4IHOA 3L95A 4ZFOB 4HUKB 1RZIA 4PJ7F 1XR8B 4Z0BH 5EPMB 1TENA 4G9DB 5IW6A 1TCRA 4FN0A 1P4BH 2VLKB 2Z31A 2BNQB 5GGSY 3AAZB 5TE4H 3UJIH 3AM8C 4XVSL 2ZCHH 3RGVD 2P5EB 3JXAA 3OGCA 5DFWH 3UEZA 4JPWL 4QHNA 5IJVA 1IAOB 3BJ91 5C0CB 1H0DB 2BRRH 5DVLA 3VMNA 4H8WH 4GMSH 2HKFH 1SBSL 3WFBH 4GS7C 4LRNL 5DQJA 2IGFL 3RVXD 1IARB 1JNHA 4YHZH 3SDCB 1FORH 1YEEH 1MJJB 1ZGLB 5KW9H 1FIEA 1RZ8B 5JORB 3IVKB 1MCNA 4ZPTA 1EHLL 2GW5A 4ZUVB 3EO1A 5F1NB 3WE6B 3MODH 1SY6H 3NH7H 3F7RA 2YC1B 4FOMA 4HCRA 1LK3L 1FZKB 3IJSB 4H88L 4AT6B 1C5CH 5FAAA 4XCCL 1I7TB 2BMKB 4FQLL 2ZG3A 2LAAA 2QLVB 3VXQB 1NC2B 1G84A 3IDGB 4LCYB 1MIMH 4GKZB 3ULUL 1TNNA 3VFMB 2VYRE 1K6QH 25C8H 4RNRA 3L3OB 4U1KB 3DSNA 1QSFB 1S5HB 3M07A 2OX5A 3NZHL 5F3BB 1RJZB 4M1GH 2YD4A 4HMEA 5GS0H 5C3TA 1U93B 2EC8A 2HLFC 1CD0A 3FQNB 1AFVH 1UZ6F 3SCMB 1E28B 2J3SA 4PS4H 1LE5B 3RWCB 2G60L 4WV1A 4LNRB 1ADQA 3RHWF 4GAFB 2F8XC 4G8IA 35C8L 4L8DA 5DUPL 1QBMH 3ZMRA 4Z0XA 3ARFC 3HNSH 3O3EB 4K94C 4PV8A 4KJWD 4UDUB 4WJ5B 4UB0L 4JG1L 5CLWA 1BD2B 2DTMH 3S4SA 1DLHA 2X70B 1C16B 4K7PL 1JNJA 1LO3L 3S37X 5J06A 2VJXA 3VFRB 3VDCA 4JHZA 3SE4C 3BIAX 5BOPA 4IOIA 5D96C 5IVNA 2BVYA 1LP9A 2E8ZA 3ARSA 1HI6A 2B0SL 3U9UB 4PIRF 2VLME 5LGHH 1A47A 5K9OA 4K2UL 1BQUA 3CH8A 3VFUB 1A6WL 4ESKA 3EHBC 3U1SH 5D7LE 2VIRB 3ZDXE 4N8VG 4NQVA 1WJ3A 2CRYA 3V4VL 1KN2L 1Q9OA 3QDGA 1AR2A 1DLFL 4E5XB 4Y4HB 4RMSA 3X3FH 2DWEB 3SGDI 5GGVL 1IT9H 3B5GA 1MFCL 5D7LA 3SDDC 4LHJB 3DGGA 4Q6IC 4LEOA 3MUJA 3ZYIA 4XNZC 3LPWA 3T0VA 3EOTH 5I6XC 5DWUH 4HDIB 3AREC 1V8HA 3EOBB 2YUXA 3I3EA 3KPSE 2PO6A 1G7QB 3ZKSD 5T5FH 4RISH 1XH3B 1FG2A 2E6JA 2XZCL 4LSQH 4R4FL 5GHWH 1LQSR 2MPAH 3QDGD 3P4OA 4JFDA 1WBZB 4ZTOL 1ZHLB 4WEBH 3NGBC 2LU4A 4HFUL 4RCAA 3GJFK 1JP5A 1OGTB 1N6QH 3C5JA 1EXUA 5EZIH 5D7LD 4OSUH 3F7YB 5D7KD 3DVIA 4DKEL 2A77H 3U0PB 5GGQH 1MFDH 1P7HL 4XP9H 5C0DA 3V7AG 2ARJB 4X8JA 5HI4D 2PO6D 4K8RL 3S3SA 1Q0XL 4PTTA 2NX5E 3MQIA 2P7TA 1JYNA 4KHXH 3RWHA 3WXWH 4X7TB 4NKMA 4S10A 1OAQH 4JFDD 1I3UA 4KUZL 5D8JL 3KPSD 2ZKHH 3ZKXC 2AABL 4JRYB 5IGXL 4Y7MA 4AL8L 3DUSB 1IKFH 4GAGL 4ZTPL 3A0OA 1U42A 3R8QA 3MCKA 1CICC 3QJFB 3ZTJG 1K8DB 1YEKL 5IFJA 2SEBB 1KTLB 4FXKA 4XBPA 3I2CL 5HGDA 4R7NB 5CHNA 1AGBB 2KZ1B 4PJDA 4C57C 4NFDA 5KZCB 1YUHB 1EMTH 2EDYA 1XGPA 2X4TA 2AV7B 1NSNH 4PJ7B 5D6CA 4Z6AT 3BZFB 1JN6A 4C56B 4ERSH 1V7ML 3QWOA 2J5LB 1VB9A 4K9EL 1WFUA 4M7KL 4AQ1B 4ORGB 3IXTA 4D0DA 3QYCA 2CLVB 4N90E 4OLXH 4U0QB 1PZ5A 4JPIB 1T04A 3PWPE 4L4VB 2AP2A 1HXMA 1ZHBB 1M71A 3O8XA 3WUWB 1X7QA 1YMHB 3V6FB 1YEJH 1CZ8L 1H9VA 1MVUB 1U8NB 2EC9T 3BI9X 2OI9C 4F3FA 5IVZA 5DJ6A 3NMEA 3PWPA 1I8KB 3DPBA 1HKLH 4H1LG 4P57B 2HJKA 4M3JA 1ZHKA 4TUOA 3MR9B 3P77A 1DANU 5CZVH 1IM3B 3VXOB 1FGNL 5MEPB 3RTQC 3W5NA 5IB3A 3UO1L 3K2MC 4F7EA 2IADA 4WIQA 1LO2H 4OD3L 1MCEA 3O8XD 3QXAB 2FJGA 3K4DA 4J1UB 4BA8A 2OTWB 1SJEB 4GRLA 1MJ7L 4YHYB 3B9DA 4N90D 1BF8A 2XNAB 3PWPD 1TZHB 1I7ZA 3O9WC 1ES0B 2FEDC 4I5BB 5IVXB 2EDNA 2JK5B 4YK4C 1HCVA 3T3ME 1RIHH 2YRZA 3E6FA 4GAYB 1LVEA 5GGUA 4HUWA 4WUUB 3WO4C 4P3DA 5TE7L 4IRJC 5JXEC 3RWGB 3KYKH 3U6RB 1H15B 5D7IE 3PV7A 4X9HA 2FZ3B 4HKZA 3A6BH 2PR4L 5AZ2H 1BZ9B 3PHOB 3HR5A 1Q0YH 2D4DA 4LPWA 4UT7L 3SOBL 4CW1B 1R3IL 1RZKC 3L7EA 5TH2A 3RL2B 2ADIA 3BMWA 3LD8C 4XZUA 3QO1A 5CD5C 1DBBL 2J8UE 4GRLD 3VFTB 3FFCE 4V2CB 3N1PC 3A6OA 3CLEL 1ZTXH 4YUEL 2AXJA 1F4YH 4LBEB 4LAJH 1UQSB 3P4NA 1KG0A 3H7BA 2J8UA 3M17A 3EFFB 3MNWB 5CJQH 3FFCA 4IMKA 3HC0B 2NYYD 2HFEB 4WENB 2YWYA 2VDQH 1S7SB 2NPLX 2XRAL 4IJ3B 4Y5YA 3TWCL 1A2YA 3KJ6H 3QIWB 5F70A 1FPTH 5I1DB 4G8GB 3LAFA 2UWEF 5KVMC 2APWA 4WDIB 1YNLH 3V52H 4Z7QE 4M8QA 3EDEA 1IAIL 5L8JB 4U0RB 1PKQB 3MRMA 2X41A 1IKNA 1WT5C 5DQDH 2GQHA 2EEAA 5FO9A 3HI6L 3TN0A 3ZYJA 5FYLH 1FAKT 2XY1A 3QXDA 2B4CL 4RA0C 3GMNA 4N0CD 5ELIA 3C6SA 3OKMB 2OJEA 2PTTB 5DJZB 3FB8A 3FJTA 5D70L 1H3VA 1EZVX 1G9MC 3FFCD 5E7FA 3S96A 1U8PB 5DDHA 5B39A 5M7QA 3WEXB 3BESR 4OCSH 4XNMB 4NQXA 3SGEH 1X4XA 3DETD 2C7UB 3O11A 4M61B 5FUCE 1FNSL 4M43H 1AXSA 5E1AB 3T0WA 5JQHC 5L2KE 4GW1A 4ZS7H 5KVEL 5GGTA 1IZJA 1DBJL 2D4FA 3F12B 4I3SH 5L2JB 4MQXD 2MHAB 4YHKH 3EYFB 1I1AD 5H35B 3TN0D 2I60L 3HE6B 3MPCA 1HHJA 4HJJL 3QG7L 5IBTL 4G43A 4NKQB 1BIIB 3UTQB 1VEMA 5DMGD 3FAXA 4ODVL 2AJ3A 1OB1A 4YBQD 4HKJB 2G75A 5ISZE 1MWAL 4RIRA 3WXVL 4DW2H 1YEDA 2DQFB 3GSOB 2H3NA 5FO8A 1VDGA 2NXZB 2HN7A 3LRGA 4K3DL 1FN4B 1A7QL 3CFJA 3L3JA 2CMRL 5DJDA 3RZCC 1KIUA 5DD5L 3RAJH 1EV2E 5IEKA 1INEH 5DHVH 1KJMA 3ULSA 2R1WA 1RURL 2DYPA 5IB4A 2UUDH 1R24A 2X7LB 1FVCA 2W9DL 4F7TB 1BREA 3SO3B 4J8RA 3PV6A 1FBIL 1TETH 3F7VA 3DXAA 3KYAA 5FM5O 1GXEA 5L2KD 1JIBA 4HUMB 4QWWD 1HSBB 2RIKA 4LSVL 3FO9B 2DB8A 3O6KH 1IVLA 1A9BB 2B20A 4HZAA 4N8CL 2XWJA 4XWGL 4R97B 1RJYA 3OKEA 4PJGE 2XY2A 1CQYA 2OR9H 3HLAB 4YAQB 3VFGL 4B41A 2ADFH 2Q7YA 5JW5B 5DJYB 4D0CA 4L8SA 4LARL 4MNQE 2DYPD 1QEWA 3QFDA 2YSSA 5CSZA 5ISZD 2RCSH 1ZS8B 3L3GB 3U30B 4JLRB 2F53E 4LKXA 3DXAD 4WW2F 1NGXA 5CP7B 2A2QT 4Y2DA 1DSFH 2OBGA 1EX0A 1H5BB 5KSUA 3TZVB 4ODBD 4QRSA 2G9HA 2GFBB 2QQLH 4RQQB 4GBXA 3D25B 1I3GH 2L0DA 3HRZA 1Y6KR 1ZXQA 3AU1A 3Q6FB 2R56H 2XG4A 2XWTA 1IAKB 5C08B 3ZLQC 4JFFB 2PTVA 4WCYL 3VCLB 2DJ4A 3ARDC 2VR5A 2NZ9C 4YR6A 4KK9C 3F58L 4F37F 4Y16A 4LLQB 4XXCA 4PYHA 1TNMA 2VC2L 4MD4A 4NN6C 1UYWL 4X7EC 5TF1H 3KPQA 4NO5B 3GSUA 3V4PL 3P3YA 1HIML 2DF3A 5EOCJ 5GS2H 4TUKL 5C0GB 2XG5A 3LVEA 3P73B 1JK8B 4GBXD 4P0DA 4YZFF 2X9XA 2FO4B 4PGZA 1QLFA 5GRVL 1MFNA 5LCVL 2UYLB 3QCUL 4QRUB 1BBDH 5FKPA 3IB4A 4G6ML 4JHBA 3CVHA 2B1AH 2HFFA 1EUTA 1CFVL 4Y16D 5I15L 3TYFB 1EGJA 3OR6B 3UTTA 5IMLB 2YPLA 3OV6A 1KEGH 3T1FA 3IDIB 4NKIH 4OGXL 1UWEL 1Z0MA 3DV4A 4YPGB 5C6TH 2AEQH 4WFED 2H1PH 2HG5B 2R2BA 3DURB 4Q9QL 4HUUB 1DUZB 2MMXA 3NIGE 4UIMA 3B2UD 1UH3A 3SQBA 4A2LA 2BVOA 1JPGB 1GGUA 4OAWA 2E6QA 3M45A 4JY5H 4OV5B 5GIRB 4JO4L 3IFOA 5DS8A 1F3DJ 2CDEB 2DMBA 3U79A 5DZOA 1T89A 5DEZA 2DQTH 2GTZA 3CSYB 5H2BB 4AMKL 2XQBL 4M6OL 3G6JE 4P5TB 2UWEB 4BZYA 4R6UA 3JTTA 3KPNB 5FECA 5FYLE 3UTTD 5MENB 3CVIH 5EZJB 3GUTB 4NBYB 3LB6D 3IJHB 1FC1A 2MFNA 3WCYA 3CPLA 4XAKD 5ID0A 4XNUH 3ARWA 4M7JL 3WKNA 3G6JA 5GRXG 4MNGA 4ZUTA 4XPTH 2A0LD 4PLKC 3NIDF 1NCTA 4G8FA 5A43C 2K9UA 1E27B 4H8WC 2VMFA 1JUFA 3RX8A 3KPLB 3I84A 5IMOA 4PP2A 5JQ6H 1NDGB 4WUKL 3UYRH 1LO5A 1ZE3C 3L3HA 2HRLA 4HK0B 4P9HH 1OARH 4XPFH 3WN5A 1XF5A 4EKXA 3MRJA 3LEXA 3HAEB 1P7QA 3FMGL 2M1KA 2BVUA 1TDQA 2H6PA 5DJXA 2ZSVA 4HLZH 3DX6A 4JHWH 3HZVA 4WU5A 3PWNB 1NAMA 4LF3A 1U3HC 3QB7C 5ENWB 2AERT 4Y5XB 3CU1A 4GRMA 2IG2H 4LHUG 5CGYD 2JB5L 1HH6B 3FQTB 5E2JA 1XCQA 3V6ZA 1RD6A 1JV5B 5IIEB 2DJSA 4AG4H 1EEYB 1EZVY 3CFCH 4FQ1H 4DAGL 5HY9A 1F3JA 5BV7H 1N0XL 3S98A 3LHPH 4LLYA 5GS0C 5D71H 1P7QD 1R5VB 3BGFB 1ZANH 2N56A 1JWUB 5I17A 4ELMA 5I30H 3QEUB 1TJHH 5DO2D 1A6ZA 1OHQA 4KK8C 5KSVB 3PXJA 4FQQB 4GXUM 3WJLA 4NCDA 3TO4C 4MDIB 4ETQB 4N8PA 3TH3T 5J6HB 4X4YB 3MV7B 4RBPH 3CFIC 3G5YB 4LCWB 1MFAL 5CP3A 3I6KB 4BSVB 2C3WA 5JLZA 3X12A 3KXFE 4RMUA 3UZVB 4EDXB 1V3KA 1BQLH 4MAUL 1I3RA 3MV9B 3HMXA 1FNHA 4UTAL 4KJPD 2A6IB 1H3PL 3QDJB 4LVEA 3TBWB 3C6LC 1EBPA 4OCNC 4HXBL 4RSVA 3RA7H 3OAZH 5FEBA 3WS3B 1M05A 2QJDA 3KS0J 4P48A 2EYTB 1KPRA 1NBVH 4WW2B 4YHOL 1IGML 5ICXA 2F15A 1QR1B 4QHUA 1CXIA 4ZQKB 3MROA 5I1AB 3F6IA 1KJ3L 1KIPB 4ZFFA 3QJHB 4M6NL 5JO5A 3VGAC 3FT3A 4QY8A 4JCMA 2AQ2A 2ICES 1P84J 5GZNC 1I1AC 1GZPB 5F93C 2DAVA 1QFUL 3HNVL 4MQSB 2HJFA 2D7MA 5CIPH 4JO1H 3TH4T 1VPOH 3IRZA 1PY4A 1RZFH 2P8MA 3BD5A 4HC1A 3VFPA 3LEYH 4Y4KA 4TRPL 4BUGA 1V7NL 3D3VE 4U7SA 3BWUC 4YBQC 5HD8D 5DYOB 1VGEL 2PKDA 3ZHKA 2YKLL 1BFVH 5HI5C 1A14L 3IF1B 2LU7A 5AYUL 3QHFH 1P4LA 5EUOB 1NKOA 5E2WL 3QEHA 4U1HB 4G3YH 3D3VA 1VFOA 3AB0B 1JYWA 2KBGA 2IF7A 1TITA 1ZWIB 5CKAA 4ELKB 2AK4A 3QBTB 5FUCC 5KS9E 5I18L 4PJXF 3VWJC 2ATPB 3TT3H 4CMHB 4O4YL 4CN1A 4RDQG 3H3PL 4Y1AE 5HPMA 2NY7L 3I6LE 1SYSB 4PRBA 4Y4KD 2F5AL 4XTRC 4S1DD 5CJOH 3MLRL 2FIKB 4O5LH 5CINL 2B5IC 4ZD3L 5E6YA 3CK0L 3GK8H 3PWJA 3C87A 1JGUH 1AR1D 5FF6B 4ODWA 3ZDZE 5LWYL 3AY4C 1BFTA 1DEEA 1J5OH 3D3VD 4YIQB 2VXSH 1F5WA 1CGVA 2VDMH 1F8TL 1AC6A 2N4IA 1I8IA 4PJ5B 2AEPL 4FQHB 1S7VB 5IJKA 2WANA 3HNTH 3IRPX 1HXYB 2AK4D 3K8KA 3CFKB 1R0AH 5EU4A 3FB5B 5C07B 3ZDZF 3NPSC 4AENA 4U6HA 4C55A 3ELAT 1VSCA 1PYWA 5IUSA 1FNGB 2AEWA 4FZ8L 3HZMA 4I3RL 5E9DB 2BCKB 3QUYD 1S7QA 2B1HL 1YQVH 1UGNA 4EVNB 3BD4A 4FQXA 3SKUD 4KKAD 3RUGE 1KIRB 1U91A 4XMPL 4HQQH 1D5IL 2EE9A 4LVNB 4TSCH 4N8VA 3MLSH 2YK1H 3DIFA 1IGYB 3DOSA 1NGQL 2FJFB 5EZOH 4RWYL 1JL8A 3U4AA 4NO0B 4NC1E 2BSED 3D39E 4BZ2H 1KLUA 5DK2A 4EEEA 4XH2A 2WQRA 1X5YA 2YS4A 4Y5VB 4BKLA 3NTCL 4D8PB 1OSZA 5I8CA 5E2UL 2NY3D 4FQXD 4HKBB 2AXGA 3R4DA 4KKLD 4O51B 4HWUA 5JW4R 4ZUWA 3MGTB 3REVA 5C0EA 3TJEL 1E4XH 4G6JH 3RI5K 4RFEB 3ZE2F 2Q6WA 3QEQB 2AJXL 1C08A 1RMFL 5FYKH 5JMRA 1QHPA 3WS6A 3MRHB 1A7RH 1IC4H 1E4JA 1RV6X 4H25A 1CS6A 1T1XA 3RBSA 1G0YR 3DRQB 1PX3A 4NBXB 4LPVA 3MLTB 5IG7A 3N1FC 5E5UB 5DC9B 5KJRH 4YFDB 4J3XA 2M2DA 4Z76B 4YDLB 1AO7B 1S7XA 3CFDA 2KQNA 2ZCKH 1IGFL 4XRCB 3V79C 4WI4A 1MI5B 1CD8A 3MRFB 2YZ1A 5CS7A 3U7WH 3LB6C 5I75B 5KANG 5TDNA 4P3CH 1QFWI 4OZGE 5IHUL 1EFXB 3C60A 1UB6B 2AI0L 4YGAB 5DJCB 5HDQL 3EZJB 5ANME 2AVGA 1VFBA 1DJSA 4MMZC 2VITA 1FZMA 4ODTL 2DICA 4I0PA 5JA9A 2H26B 3GZKA 3LKQA 3T65B 3F5WB 3THML 4ZSOE 2PYEE 4PJIE 1OAYL 2I5YL 4AEHL 1NCDL 2BNUB 5I74C 5ANMA 3VW3H 5EBMB 3JTSA 3QPXH 1IM9A 1T89C 1MFEH 2JCCA 1IGCH 3G08B 4PJIF 3MRLA 1K4DA 2AJYH 5F6IC 1QQDB 4W81A 3MLZH 3SDAA 1X6NA 5EBLB 4BFIA 1FLRL 2G2RA 1IE5A 1ERNA 1ETZB 3MLYL 3VG0L 4E9LA 3C60D 4P59L 2R2EA 4OCWL 1ZMYA 1D9KB 4ODSH 5I1IH 4PB0H 2I07B 4TN9A 2Q86A 5DZNA 3QXUA 3QO0B 3HA0A 1XCTA 2EDJA 3OXRA 5IQ9A 5JIIA 4ZDHA 4X6FB 1OL0A 5BW7A 1I1FB 4G80A 2UY6A 3FN0L 1QTYT 4WO4A 1IM9D 3S3PA 5IOPB 3BX7C 2BOCB 5GRZA 3GSNA 4M7ZB 4PJ9B 2J4WL 2OQJB 3X11B 3BO8B 3RDTC 1L6ZA 3MRNA 5DVNA 3BH9A 4NZTL 1QR4A 3SDAD 1LDPH 4LQFH 1O5DT 3EUUA 1MEXH 1VACB 4PRDA 1CDJA 4H1LA 4D0BB 1XGUB 5HVFB 3NIFE 5I1HL 4TNWK 5MI0B 5B22A 5EOCH 4M7LH 2A83B 4GQ9L 1XIWB 4OGYL 4PJXB 3O6ML 3MACL 3L5IA 1RU9H 1NGPH 4XC3H 4GKNB 1OAKH 3WNNA 3VFSB 3B9VA 4B7LA 2HMID 2DMCA 5MERA 2GJ6E 4KQ4L 2NW2B 4JKPL 1CL7I 2X4SA 1RJCA 5E2VH 5C8JB 3MSPA 4PRPA 2QEJA 4NQEE 1J7VR 3JUYA 3PXHA 5D72L 4PJAE 3GJFH 5DD0L 1A7NH 2NW3B 2ENSA 1VKXB 1RVFL 4JJHA 5D5MB 5DR5L 1XR9A 1Q94B 4K94L 3MJ9L 3RVUD 3RZWA 2AJUL 4NQEA 4FQCL 4Z78B 3RNQB 1INDL 4XP5H 7CGTA 4L8BA 4ENED 2EXWD 2FRGP 2VDNL 4YHNB 3LV3A 2F54B 4ZOBA 4OT1L 2AXHA 1F3DH 1FIGL 1TIUA 2GY5A 1QYGL 4LCCB 3HFML 2IH3B 1RZJH 1MHEA 3QHZH 4PRPD 4YX2H 3T77B 3VD4A 5JUEL 3K81A 4NOBA 1TQCC 1NBYA 3UP1A 4TPRH 1P4IH 3BYYA 2YBRB 3PL6B 2YPKB 4HIIB 4KFZC 5EU7C 3EOAA 5IM7A 1A6AA 1T0PB 1DBKH 1U8JA 1KTDB 2HFGL 4NQED 5E00B 1BQSA 4JPKL 2BZDA 4M1CD 4X6DB 3T2PA 1T03L 5FUOL 4Q58C 5CILH 4XT1C 3C09B 2C3HA 3QUXB 3BZEB 4XI5C 5IMKA 3NACH 1JNLL 3U0WL 4N9GB 3QUKB 4IRSA 1KB5B 2YD2A 3EO9H 5E8DL 4PGJA 4XPBH 3E1F1 4KJQD 5CD3B 5BQ7A 1CFNA 5DJ8A 4D3CH 5IMMB 3C2AL 4MXWH 2BJMH 1T21B 3B6SB 1E6OL 4WWID 2P47B 5GISH 3S37H 5B21A 4S1DC 1M7IB 4Z7UB 5I8OH 5FYKE 4P4KA 3L9RB 3MRCB 5IWLC 1FZJB 4KZEL