4L4VD

Structure of human mait tcr in complex with human mr1-rl-6-me-7-oh
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title Recognition of vitamin B metabolites by mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l4vD02
4NKQB 5DSCB 4KJWD 1EUTA 4HUXB 5JOFB 3FFCA 4OQ1A 4WFHE 1FORL 5A2KH 3KPLA 4EUPB 1LE5B 4G5ZL 1F5WA 4KAQL 4OI7A 5E03A 1LO5B 5EIVA 1X4YA 2H2SC 1G7PA 1QLFB 3QDGD 4U31A 2GY7B 3OF6A 1WIOA 4LIQH 3X14A 3T2NH 3VXUD 4M1CD 1ES0A 4KUZH 5D2LF 1I8IA 1IAKB 1C7TA 2YRPA 3E6HB 2ARJB 4YHZH 3RUGA 2B0SL 4GW4A 5MHSD 3EZ8A 2EE6A 4XXCC 4X9GA 4FG6C 3BKYL 4HKXB 2FWOA 4MA8L 4XBGB 3HRPA 1QG3A 3NZ8A 4LCUA 4TUJA 1JFQL 5KVGL 1W72B 1BWWA 2M26A 4Y5YC 1FYTD 3SE4C 5F7UA 5HGBA 1ZHLB 5FUOH 1KUMA 4LNVA 5E2TH 5K59F 3MJ7A 2R29L 1I7ZA 1R6VA 4GW1A 2VKXA 4TVSa 1MUJA 5DUPL 4RFEB 3O81A 3O2WH 3VFUA 5FYJH 1XGRA 4M7KH 4FTVD 4MZ2A 5DJ6B 4E41B 4FQXD 1Q72H 4U6HA 4WWKC 4X99B 3MV7D 4HIEB 1YEDA 4AY0A 4HDIA 1YEHL 4S2SA 4P5KA 1YQVH 2O5XL 1NQBA 1EGJA 1P7KB 4JFEB 3HR6A 4JG0L 4LOUD 1F6LL 5SWQB 1KACB 4HCRA 1F02I 4HSQA 5GGSB 5F71A 2DWEB 2LQRA 1FNEB 3KYOB 5L2KB 3OAUL 2HJKB 1KCVH 4FMKA 3VXOB 3VWKD 4KVNL 1LE9B 1RJLA 1Z9LA 1KTRL 4WUUD 3FOLB 4PBXA 4GRWF 1PSKH 4PRHB 3BZEB 4P5TA 1LILA 1RJCA 4RIRB 1GXEA 8FABB 1I7UB 3I75B 3GMOB 4GKOA 3VW3L 5FHBH 1M71B 1UM4L 1UWGL 5HXMA 5JTWA 4G8EA 4XB8A 1UFUA 3IDIB 5J6HB 4OV5A 4FQIL 1BAFH 4XWGH 1YEFL 4PG2C 3QHTC 5D7LA 5I9QC 3QNXB 3RZWA 2GSGA 3HUJA 3MYZA 3GUTA 1TVDA 4YDLC 1ADQL 5C3TA 3QG6A 3E2HB 1F3RB 4P2RB 3MRFA 1KN4H 4BYHA 2YBRB 1J12A 1WWAX 2W9EH 4FQ2H 5DHVB 2Q7NA 4TYUA 1J8HA 1D5IH 4NGHH 4NJ9L 4XC3H 1DBML 1DUYA 5D96B 5JO5B 4Z0XB 4X7SL 4G9DA 4ZFGH 1CR9L 2B20A 3FQXA 3MJ8B 4XVUC 3OKLB 3AGVA 2H32H 5KS9B 2VDQL 4MAYC 4ZO9A 3R1GH 1D5MA 4ELMF 1QA9A 4U1HA 4IDJL 1CGTA 5D1ZD 3C8HA 4MA7L 3QI9B 1INQB 3AVEA 4AEHH 1QKZL 5FA3A 4Y1AD 5T5NF 5ETUB 1I7TA 3KJ6L 3STBA 1CXLA 1LD9B 4QHNB 2PN5A 1IRAY 5FO8B 4OCYL 2NY6B 1HHJB 1F42A 2JJTC 4R9HA 3ZKNC 5C2UB 4KKNA 1RZ7H 1NGZA 2FNBA 4OTXL 3OWEA 3FQRB 3GIVA 1U42A 3S37H 4W6YB 4JKPH 4ODTL 3KYNA 5I17B 5GJSH 4I9WE 1JV5A 5C0EB 5C08D 2IGFL 5E56A 1UVQA 4JHWL 4NQCE 4PREB 4X6CE 3WS3A 4L4JA 5EDXA 3RIAK 1OY3B 5FIEA 3BD3A 1D6EB 2A2QT 4N90D 1UB6A 1YMME 1BVLA 4MQXD 2EXYC 3RWFA 4WTZA 5DJ8B 3RIFF 1RIVH 2PYFA 5E6ID 3NABH 4R0LB 2DL9A 3HB3C 3PWVA 1GGIL 2YD6A 3RDTD 5ILTH 3X3FH 1YC8A 4C57C 2HRPH 1CFVL 2WANA 2UY6A 3T0EB 5C0ND 5DQJB 3TVMB 1Z0MA 2R1XB 3SDXB 4NRXB 3ARGC 4Z76A 3QEGH 2CDEB 3BYTA 5EG6C 2J4WH 5GS3A 3WXWH 3PP4L 3ARFB 3MR9A 2OR8A 4FZEL 4XPAL 4NN6B 4OUUB 2ZG3A 2Z92B 4KKBC 4F7PB 4FFWC 3WD5H 1FFOA 4R2GC 4ZPTB 3TO4A 5GS1B 1AC0A 3PDOB 5GZND 1T1YA 5DJDA 1BFTA 5HTSA 4JRXD 1NC2A 4LCIH 4XAKE 1S7RB 1T89C 2B5IB 4WO4C 3FL7A 3WUWA 3BT2H 4F8QA 3W11D 1Q38A 5EZOH 4PP2B 2Z35A 2YA1A 3VG0H 2G75A 1AP2A 5HHOB 1U8IA 4YDKH 3W5MA 5A3ID 4G8GE 5HVWA 3M8OL 4NQCA 4YHYC 4X6CA 3RGVD 3OGOE 3CSBA 3D39A 4PV9A 2OJZH 2MCPH 2V5MA 2FJFB 4XX1E 4D0DB 5M7QA 1AO7E 1D5BA 4U6VH 1D6VH 4NBYB 5C92A 5GGTA 4LKXB 2RCSH 2VDKH 2EE9A 4RGOH 4MSWB 1YMMA 3S96B 1FSKB 3W82A 3QQ9D 4LLAA 1PD6A 5DRZA 1CK0L 1I7RB 4E9LA 5IGXL 3W39B 3UYPA 1PG7X 3EYOA 2XV6B 1Q9OA 3QCTL 4GQ9L 4HBCH 2OL3H 3NIFE 4KRMB 2DQDH 2HH0H 1OAYL 4P59H 5I71C 3AS2A 1OF2B 3WIFB 5CJQL 3WLBB 4NHUB 2FGZA 5EU3B 3LSOB 4PJCF 3EJZD 1AGDB 3EDDA 1QFWH 1QBBA 3S4SG 4R8WL 1K8IB 5J13B 3NPSB 2A73B 4JZJB 3BMVA 4PP1D 2PNDA 4XTRC 4DKEL 2Y4SA 4JM2B 3CSGA 4G6ML 4UUJB 4AIZA 1G84A 3ZKMD 3S5LA 2X1WL 1KB5L 5LWYL 1DFBH 1QFWI 4OFIA 4U1NA 4O2EA 1BZ7A 2FL5A 1YNTB 1S78C 2BNRD 4HK0B 3DRQA 2XTJE 3ZDXE 3SGJA 1PKQE 4ZFFB 5IB2A 3VXSD 2OSLB 4KDTA 3LH2H 3QIUD 1OTSD 4AH2B 1G0YR 1C5CL 1G9NC 3BZ4A 5FHAL 1AO7A 1OSPL 2HVKA 3LV3A 1MI5B 4I2XE 4LSTL 1G7IB 3TV3L 3C9NA 2X7LA 1NEZB 1YUHB 5CHNA 1GL4B 4PJ5D 1FN4A 1ZT1A 3A67L 2GK2A 5J3HD 3LKRB 1JN6B 2DYPA 4F7MB 5HYJD 5LKNA 2ZOLA 1CE1L 1CE6A 5I1EH 3MRCA 4NO0A 3S36L 1NGWB 1IEAA 1GGCH 5L8JB 3GSRB 2FH6A 3QULB 5IFAH 2V2TB 1GPOH 1NUNB 1RUML 1H5BA 2IQ9L 3V4PL 2D3VA 5T3ZD 1VHPA 3CPLA 4OCWL 3EOAA 4XPFL 3TN0A 4HCRH 3DO7A 5DFWH 3BRGC 1JHKH 3DURA 3NMEA 1FAIL 4N1HB 2OR9H 4Z77A 4MD0B 4XPHH 5IV2B 5BQ7A 3FT4A 3KPPB 4KTYA 3KPQA 4KHXH 5FK9A 1B2WH 2J5LC 4JFXA 2AJYH 4JJHA 1DEEB 3K2UH 5CEYB 2Q7YB 4EKXA 3I9GL 4EJ1C 1JJUA 2X70A 5F1NB 4OZIA 3ULVH 2FJGB 3F8UB 2WBJD 4P23B 1A4JA 2J8UF 3B9EA 4ZSOB 1JGVH 1IC5L 5ERWB 2EEBA 3ROOB 2BVUA 3QCVH 4APQA 1OAQL 3KXFE 1YN7A 2HG5A 4H20H 1P7QA 1PKQA 1DE4A 1EXUB 2X4PB 1IM3A 4I4WA 2F58H 3WFBH 4M00A 2FIKA 3LEXB 4KK9D 3QH3A 3TM6A 4EEEA 4XBPB 5JUEH 2HTLD 4Y5YB 1ZHBA 3CH1A 2X4UA 3IU3B 4MA3A 4LDLB 2OI9C 3ULSB 2E5EA 5CP7A 4UOJA 3DV4A 1CI5A 3N50A 1IEBA 2C3HA 1C5BL 5EBMA 4C59B 1H3TA 1J05A 4OCRL 1MH5A 1JPTH 1QSEE 1KG0A 1KYOJ 2KL6A 3TNMB 4TQEH 2BVPA 4PJHF 3MGTA 3PDGA 1ED3A 3VI4F 1XF3A 5IB4B 4MB5A 2G60L 1U8LB 4QTIL 3NBNA 1T83A 3ZLQC 4KU1A 1T03L 1QLRA 1Q9WB 3PJSB 4CAGA 5B39B 1S7WA 4TSAL 4L8BB 3I84A 4PLKC 4UNVA 1ZLVK 1OGAD 1KIPA 3O6MH 4HUVB 5I2IB 1AIFB 3O4LA 3BP5B 3BPNC 3PQYE 3ZL4H 4BFIA 5CEZD 2ESVD 4PJBE 5GHWH 1AI1H 4U7MA 3T0BA 5GGRA 3P73B 4L3AA 2X1XR 4UDUB 4KZDL 3K8LA 5D2NA 2CGRH 3NCBB 3BD4A 5LJYH 5D5MB 3KXFA 1A1OA 4NFDA 3QPQC 4TPRH 1S7QB 2X4NB 1YNKH 3H9HA 1T66C 1RJZB 3MODL 5HHVL 2Q86B 3L3IA 1IGCL 5DC0A 2ADGA 5I9QB 1TTGA 2KQMA 3S9DB 2C5DC 3H3KA 1S7SA 5IHLB 3G5VA 3TJEH 4O58L 1CG9A 4L4VB 1AGEA 4I0PD 4QRPA 5IM7A 2X9YA 3LS4H 4HJJL 1K6QH 4R7NB 1J7VR 2O5YH 3LHPH 2BCKB 4X98A 1I3UA 3VFRA 3QIBB 3C6LC 2N56A 4J1UB 4L8DA 2CDGB 3DI2B 1ZT7A 1TQCB 5JZ7C 5DRXA 2FB4L 3MA7A 2BOBA 5GZOC 4KK5C 4MAYB 2PYEB 3DMMB 2KQNA 3KGRA 4ZAKC 5C0AA 3HG1D 3RPIB 1KB9J 4F33A 1DN0B 4HIJA 3V5DB 1BJ1H 3J7HA 1XGQB 5DFVD 1OW0A 4LLUA 4OBRA 3OJVC 1J8KA 2ZUUA 3ETBF 1S8DB 1JYVA 3TYFB 4R90L 3OXRB 3P4OA 4UIMB 1QRND 4FQCL 1TPXB 1DQDH 1DVFD 3V4UL 1UADC 3QXVA 5HHXH 3QB7C 5ID0B 3DPBA 4MQ7A 3TESA 5J11B 3UTZB 2P5WE 1RAMA 4IBLT 4RDQF 1LDPL 1YECL 1S3KH 3MLSL 5B4MD 3OHXB 4YHKL 5CMAB 1NGYA 5AZEH 4GLRH 3LKSA 4ZTOH 2R56H 1SY6A 3TCXA 1KIUA 5BS0D 1Q94A 2IAMC 2YN3A 3QO1B 4PJ7E 1C08A 1RI8A 1H8NA 2LABA 5ICZB 3OTTA 3IGAB 4MA1C 2VUYA 1RK0A 3D2UA 1R3IH 5I0DA 43C9B 2B1AH 1RZKH 3O6KH 1MAJA 2XFXA 3SE8H 4DN3H 2X10A 2XPGA 1CD1B 3V0VA 3RFZC 3RP1A 1MCLA 1MCQA 5ADPL 2OTUB 3CDGA 1SEQL 1HE7A 3P9MA 1DQMH 2BY0A 1X5AA 3DVIA 5KVEH 4XC1H 5HVFB 1FRGH 4IS6B 4FS0A 1Y6NR 4HGMA 1HZHL 1XCTB 3JXAA 5HHQA 3KPTA 1MPAL 3ZTNL 5GJTL 5T33L 3VXMA 3O3AB 1ND0A 4R2GB 4YBLC 4BZ1H 3FQNB 3HI6L 2MJWA 4G9FB 5IR1B 4UV7L 2BERA 4OT1L 4GXUN 5LCVL 4PJIE 4WO4B 3AREA 4DWHA 1FZJA 1DTUA 1B6UA 3PUCA 4F9PC 1YEGL 3MRHB 4NZRH 5CD3A 4DGVH 1KJ2A 5IF0A 1G9EA 1FFPB 3MACL 4MD5B 4OZHA 2UWEA 3WFHB 4B50A 3ARDA 4XWOD 4D0BA 1L9NA 2DLHA 2ZCLH 4NWTL 5D6DC 5KBNC 1RPQA 3ARBA 5SV3A 4GMSH 5IB3A 5ID1A 4YHYB 1Z9MA 4ETQA 1P2CA 2ITCB 5CINH 1RD6A 2YA2A 4O51A 4WI4A 1CXHA 3C5ZD 4F58H 5KSUA 1NAMB 2I5YH 3T04D 5D2LB 4HF5H 3QNZA 3STZA 1EUUA 4PJ7A 3BGFB 3Q6GL 4N8VB 3D0VB 2OK0H 4O4YH 5HHPB 1KT2A 4J2XA 3E6FA 1DUZB 4KROD 1YYMH 4LLQB 2X4OB 4YUEH 1CLOL 5E6ZA 3GMPB 4JQIL 1SYVB 3JTTB 4HULB 4A2LA 3JVGC 2DICA 4I3SL 5MENE 2EE3A 4M1DH 4OFDA 3RI5F 5CP3H 5IUSA 1A8JH 1U95B 32C2A 1XIWC 3IVKB 4JFHD 4POUB 4LCWE 3VXRD 3MRDB 3S37X 5JW4M 4KY1H 2JK5B 5GSVB 2VAAA 4MD4B 4GAGL 4F7TA 3SQOL 4PJIA 2Y1VA 4TUOB 2VXTL 3DGGA 2BVQB 2VXVL 4HPOH 3VFMB 1QPXA 5L8LB 1WQVT 5D1QD 2ORBL 3DTXB 2ZPKL 4JVPA 5T3XH 1FCCA 4JO3L 4XP6L 5CGYD 5IKCA 3D18A 2EC8A 1Y18B 2R0WH 3FTGA 4WFGD 2CH8A 5BW7C 5CBEA 3BDYH 3T0AA 5CUSL 1JHTB 2QADC 3PGCB 4DJMA 4GG8A 1KN2H 2B2XH 4JM4H 5KJRH 1P84J 1IGYA 4ODVH 1EJ6A 3HMXA 1LEIB 3D3VE 4JEGB 1FFNB 4GRWB 2R0ZL 4L9LB 5GS0H 4F57H 5C0IB 5AEAA 1NL0H 1CFQB 4Z95H 4LPVA 3SDCA 4Z6AT 3U2SA 4DW2L 5FYKL 5E9DE 3CC5A 4NNYA 1EJOH 1XGYH 5LGJB 1G7MB 1AQKH 4OLWL 1TETH 4JE4B 2P47B 3PABB 2ZCHL 3UXFA 4XCCL 3GSWB 5MEOA 3U46A 5TDOA 2CLZB 3T77A 3VFWA 5C8JA 4JFED 4KI5D 4PRDB 5KSBA 1ZV5A 4LPUA 2N7AA 3BH8B 3BIKA 4KQ4H 5C70A 3JSSA 5EOCH 5FV2A 1K8DB 1MHCA 2VIRA 3RY6C 3SJVE 5JNYB 3CX5J 3GZKA 5CGTA 5KSVA 5MHSE 2OM5A 2Y5EA 4JFZL 2BVYA 1UM5H 1EBPA 4YXLL 1NLBH 4Q2ZA 4MAUL 2R23A 4UT6L 1CZ8H 4JPVH 3Q2CA 5KVMC 3B9KC 4X5LA 3FCTA 4PS4L 1ZT4A 4D2NA 5EC1A 3BMWA 3L6FA 3RTQD 1HDMA 5A2IH 2LAAA 5HYSA 1RZFH 4NM4L 1XR8B 1CGXA 1T1ZA 4FFZL 4NUGH 4PJXE 4R26H 1AXSB 4C55A 5KTEL 4BK5A 5DT1L 1F90L 1BFOB 1CDUA 1A3QA 2MHAB 5JIHA 4PJEA 4P2RD 1U93A 2PTUA 4YHIA 3PIQA 5BMFH 2AV7A 1QD0A 1I1AC 2QQNL 5HHMB 3NIGE 3V6FB 2Y25A 1A6TB 5DFTA 3MV7E 4M8QA 2QSVA 5JPMA 4G6AC 4U1KB 2E27L 3CSYA 4D3CL 2GT9A 3NCJL 3REVB 3ALWA 4M62L 4YHLL 4NHCL 3MJ9A 3DVNB 4NDMB 5D71H 3QDGA 4NOBA 3U4EB 1ZA3B 4G6KH 3ZDXF 4MVBC 2IEPA 3MMEA 1R0AL 3WDIA 2ZOKB 4RISL 4XP4L 5ACZB 3GJFB 4Y5VA 2AJZB 2V2WB 3QI9D 4BSWB 4JQXA 3HAEA 1LK2A 1BJ1J 5IBTH 1L4IA 1T80A 2NY1B 3DRTB 3L3DA 3UC0L 4PRID 4XZUB 2R39A 3DX6A 1S7TA 4PTUB 3IDXH 3VRIA 4LPXA 3MNZA 4Y5XA 2R8SL 1BJ8A 3L5XH 1VFBA 2WM0A 4QXGH 4FNLL 4PJ9C 3VFVB 1A3LL 4MDJB 3WN5B 1HOCB 5GIRB 3TT3L 1U91B 1FYTA 1N4XL 1A6WL 1WCBA 3EFFA 4K23L 3T08A 5B38A 4RA3A 4LSVH 1Q0YL 4YEEA 3DSFL 1RFDH 2A6DB 3MLXH 4FTVA 2CK0H 3H42L 5C07B 5BVPH 3QFJD 4Y19B 3MRQA 1CFSA 3THMH 3Q3GA 5DD3H 4TULH 1EO8H 5ESVB 1R5VA 3MV7A 4E42B 2X4RA 5FCUH 1S9WB 4MJID 4X7CC 3C6LB 4JLRB 3TVMD 1P4IL 4YGVB 1MCCA 4HUUA 5C71A 4I3RH 5HYIA 1LP9B 3ARFD 1SYSB 3DYMA 3FZUC 5I8EA 1IAIL 3MV01 2YD3A 3VWKA 1KIRB 5HI4D 4WUUA 4YC2C 5BXFA 1BLNA 2NW2A 3C8KB 4JCLA 1P69B 4FQQB 4LDEB 3V8OA 2YWYA 5T1DL 5L88H 5T1KB 2MTPA 4GAJL 3FOMA 4QT5B 5K9JL 4OLYH 1KLFA 5IMMA 4KTDL 2BSRA 5C08E 3MBEC 2ZZUT 3T4YB 2FX7H 3SKMB 5HHOD 4ERSL 1MCDA 4KVCH 1IGJB 4MCZB 4LCCA 4GBXC 4JRYE 3BN3B 4OBSA 1X5XA 3DXAB 1SHMA 1AFVH 4YLQT 2OXHA 3TT1L 3LPFA 1U8NB 4JQVC 5ICXA 3QHFL 3DUSB 4Z7OE 1LO0L 5FV1L 5A43C 2GFBA 5IOPB 4J3XA 4R4NC 5JW5A 2AEPH 1MVUB 2IAMB 4PGCA 3VGHA 4F37F 3I2CH 5E2WH 3STLA 2FBJH 4PJBF 1VPOH 2HT3D 4XH2B 3FN0L 1UACH 3MNWA 2A0LC 3W9DB 4B7LA 2EDLA 2N1KA 2W60B 4Y2DC 2XACC 3CFEB 1IBGL 1PAMA 2GJ6E 4QHKJ 2OQJB 4FXKA 5D1ZA 3RZCC 1JBJA 7FABH 5GS2D 4LPWA 4MB3A 3C5JB 3NZHH 4JY4A 4PJDA 1MFEL 4Y1AA 4HZLA 4M5YH 5BV7H 1WICA 1OLLA 2XQYG 5I66A 2C4XA 3K46A 1L0QA 3LKOB 2YPVH 1NCCL 5I1CH 2P48B 5CJOH 3B3IB 3FAXA 5CLWA 1BPVA 3HI5H 2BC4B 3KG5A 5CILH 4ZUUB 2AJSL 4YXHL 2V6HA 5HY9A 2V7NA 5I6XC 5C08A 2C7UB 4EUPG 2VXUH 4X7EC 4TTGA 5I1HH 1ONQB 2HTKC 4NYLA 2QTEA 2ITDB 2I60L 4E0RA 1NMBL 4L8CB 2FX9H 3WS6A 2CKBL 1MI5D 5IIEA 1TNNA 5JMOC 1D3CA 5EWIH 4HLZG 5E6IA 4G6JL 3L7FA 5EU6E 2FO4A 4RGMB 1E27B 3RDTA 4JANA 3MYJA 1T2QL 3O3BB 1JGDA 4EVNA 3RNKB 3ULVE 1OAUH 3FMGL 4K2UH 1RULH 3NACL 2B1HL 5EO9B 4C83B 2UZIL 4ZNEE 1RVFH 1YYLL 3FFCB 5EULV 3PNWB 4KGLA 1FO0L 3KPLB 4IOFC 4FZ8H 2ARJQ 1EAJA 5DVLA 2FYYB 2ENYA 3MUJA 4DCQA 1OP5K 1N6QH 1E4XH 3SKOA 4I77L 4M8VA 1G7PB 2H2SD 3BDXA 5EOCJ 3EYSL 3JUZA 1XIWB 4IOIA 3O41A 1XH3B 4X7DC 3OG4B 3R0MA 1A7NL 3LCYA 4KHTL 4AG4H 5DMYA 4EDWL 4RWYL 4ZUSA 1JFQH 4HGWB 4GW4B 4G80A 1E4XI 2DQIH 5GPRA 5I8OL 5ITBL 1BD2E 2VTFA 3VXSE 1FGVH 4FG6D 2HWZL 3JWNC 2FWOB 3ZT6A 1ZWIA 4H88H 3NZ8B 2DLGA 2EE2A 4WUKH 4X8XA 1KJVA 1VGKB 4OGAC 4WEBH 1CDGA 1NCWL 3OR7A 1GGYA 3BKCH 4Z7WE 3O8XC 2R4SL 5HGBB 4X5XB 3FO0H 3O11A 3MJ7B 5EU6A 5C0CB 4ELKA 1UB5B 1I7ZB 3ARQA 2MFNA 4GW1B 4S1RL 2YD9A 4YFLF 1MUJB 1VCAA 4OD1L 2XIDA 3MRPA 3EYVB 5GRZA 3QG7L 3SEPA 3VFUB 1YEHH 3T0WA 1XGRB 3C6SA 3EIFA 5T3ZE 4ZNCD 3EOTL 4LKCA 4LPCA 1A21A 4TVPL 3H7LA 4U6HB 4IRZH 4WWKD 4B7IA 4LFHD 3GRWA 1ZEAL 5HI5C 1RZIA 4WW1A 3TP4A 4S2SB 4P5KB 1H3UA 5GGVH 4KJPD 1KLUA 4AQOA 4JHAL 1U8MA 1X6NA 4N5UA 4QRRE 1R3KA 3CVIL 4HQQH 2ARWA 3HE6C 3BWAA 1NGPL 3CK0L 4DK6A 3VFNA 3OKEA 1I3RA 5J9PA 4OGZA 1E0OB 3FT2B 4B0MM 3TLRA 2ZSVB 1RJLB 1AR1C 1ACYH 2AJXH 4P5TB 3MV8E 3QJHA 5EIIB 3MOQA 4OQTL 3VXSA 2EC9U 4GMTL 1BECA 3B9KB 4Y0GA 3QIUA 1HXMB 3X12A 4UILL 2A77L 1QLEH 3LMJL 4G8EB 4CW1B 4LLMA 4BQ9A 4O9HL 4OV5B 2JKXA 2OBGA 4PJ5A 4XCYA 1KSRA 3RL1A 5HYJA 1O0VA 4NJ9H 5DLMH 1QEWB 4NIKB 2CO7B 3GUTB 2W9DL 1NKRA 4KMTL 5ESQB 1A7RL 2DDQL 4EIGB 5MEQA 3MRFB 1CR9H 4G42A 1P6FA 1K9TA 2AQ2A 5C0DB 3CVHB 3RWJA 4K3JL 3KHOA 4GAYA 1GHFL 4MJ2A 1ZGLM 4GG6E 3NH7L 4JCMA 1NBVL 4IDLA 1U8HA 1QSZA 1A6UL 2APTA 4YNYB 5AUMA 4R7DB 4TSBL 2DB8A 1V7MH 5IESL 5TE6L 3HCVA 4XVUD 1UYWH 1HKLH 1ROWA 4MAYD 4RBPK 1D5MB 4OAWA 1WTGT 3DMMD 5F70A 1BZ9A 1RUQL 4U1HB 4H25A 1AQDB 3MLVL 2HLFC 2FECI 4OTXH 1WT5A 3DVGA 2WBJA 4HWZA 3UROR 2NW3A 3BQUC 1I7TB 2Q8AH 4PG9B 2E7HA 1Q1JH 1WBZA 5TQ0H 3EAKA 3ZKND 4A6YL 4RCAA 4KDWA 1QVOA 3CZJA 3GIVB 5ALBL 3G6JA 5ALCH 3KYNB 2J88L 2VC2H 4LSPL 4WDIA 4LMQI 1JGEA 4DUVA 3V0WL 5AZ2L 5FUZL 4XT1C 4YHML 2Y07L 3CFBA 3ARXA 2G9HB 4CDHA 3QRFM 3LZFH 4L3CA 4FXGA 3MOAL 1CFVH 1OAKL 4TSCL 5F6HI 2J1KA 3OKMA 3IS0X 3RWFB 2ZUVA 5JW4R 2EXYD 4M93C 1MWAL 4M6OH 1KCUL 3CAFA 3HB3D 4RMWA 4P4RB 3MLYL 2FJHA 4GG6A 5DK2A 1RHHA 4FZEH 2R2EB 4Z7NE 3ECBB 2FATH 1JZ2A 4U3CA 4MQTB 1RSFA 1WUNT 2GK0A 3ARTA 3ARGD 4Z76B 1OGAA 1MFBH 1MNUL 1XGPA 3JV4A 1GGBL 3H3PH 1KTLA 5FYLL 5J1TC 4F2MB 1BQLL 5J7CC 2ESVA 1U8KB 2NX5D 1PG7L 2A9NH 1OPGL 4KKBD 4XNXL 3C5SA 4LSSH 4FFWD 3X17A 4MNHA 5BJTB 3TO4B 4PJXF 4R2GD 4LHUG 3DV6B 3FRUA 2WAHA 4XXDA 1T1YB 3QIWC 5DJDB 1A9EB 1QRNE 5C9JA 3VH8A 5E0QA 3T2QA 1C1EH 4WO4D 2OTWA 1KCSL 1WF5A 5F9JA 1NBZA 3WUWB 1TIUA 1UENA 5C0GA 2QSCL 5K9OA 4JO2L 2Z35B 2CXKA 3NIGF 1AP2B 4K3EH 5L7XH 1U8IB 2EICA 5BO1H 1A7PH 3VFSB 3TPKA 4NQCB 1RUAH 3F7VB 4X6CB 2LU7A 43CAB 3MV9E 5E8OB 4JN2A 1ORQA 1XGUB 1ZS8A 3D39B 4PV9B 1SBSL 1UA6L 3W81A 4DAGL 4L4TE 4U1JA 3UJIL 1EERB 2BXZA 1DQLH 1HHIB 4I0PA 5DEFB 1YMMB 5CCKH 2APWA 1G7HA 2AQ1A 5C86A 1OHQA 1K4CB 4FP8L 4EBQL 5DRZB 4LDOB 2XG5A 4X80H 3DUUB 1JPSL 2BSTA 4I48A 4OJFL 2VDNH 3C2AL 1A6VH 4Y2DB 5T3XE 3IETB 1A7BA 3GHBL 1MQKL 4M6AA 4HWEH 2FHFA 2ICWB 1KNOA 5I1LA 3I50H 3HG1A 2GUOB 3MBXL 4OV6F 3RZCB 1NEZG 3GGWA 1U6AL 3VGAC 4MCYB 3WJJC 4OUOA 4XP5L 2CDFA 3S3JA 2VLJE 3H9ZA 4N68A 5DEZA 5F72S 3GEWB 5TDPB 2DS4A 4XTRD 4LCYA 2VDOL 4F8TA 1QRNA 1FV1B 5EZJA 3PWPE 2AERT 5IBLC 4JO1H 1DVFA 1GC1H 4R4FL 3S5LB 3PWNA 4X83A 3PHSA 3FO9A 3GSQB 1FVEA 2FX8L 5D70L 1PQZA 1BZ7B 1VFAA 2H3NA 4LQFL 1EHXA 2C3WA 1F2QA 1S78D 3DRQB 2D9CA 5EU5A 4G8GB 1IGMH 1MFDL 3P11L 3OR6B 2YOCA 5IB2B 2Y7QB 1UXSA 4GQPH 3V8CA 1XT5A 2DIJA 4XP9H 1OM3H 4Y16C 3QUZA 4L4TA 1QFHA 5D8JL 3U7WL 3VRJB 3FONB 5BS0A 5CEXB 5IBUB 3BZ4B 1AO7B 2HVKB 3O2VH 1PZ5A 4PJ8C 4X4XA 4JR9H 2GCYB 3C9NB 2DKSA 4WU5A 2X7LB 1CDIA 3F5WB 4L5FH 1H3GA 2HJLA 5DMIH 1JGLL 1FNFA 2RBLA 4TRPL 5ICYA 1MRCH 4Q0XL 4XPFH 5DA4A 3MRCB 4NO0B 3U9UB 1FAIH 4N0YH 4PBVC 4JZNA 3VXNA 1H15B 5J6GB 5EA0L 3U0WH 3TA3C 3TZVC 2NPLX 2YRZA 3WYRA 4ZYKB 1EHLL 3CPLB 5CZXC 3NTCH 4ZTPL 3DO7B 3B4NA 3I9GH 5C0JA 5IEKA 1FQ9C 3WNLA 4JFHE 5BQ7B 3VXRE 5DD0H 3QXWA 3KPQB 5EO1A 4JPIA 4JFXB 5DD6A 3O9WC 4HHAA 4OSUL 1E6JH 3KLSA 5I74C 4PTTA 2X70B 4Z7OF 4NCDA 4PGEA 4POZC 1FP5A 1DSFH 1I8KA 5JR1L 5T5FH 2H6PA 3RPKA 4LFHG 3K8MA 2HT2C 2IBGA 5LXGL 3UBXG 4WFGE 1YN7B 4DGYL 4GS7B 2XTJB 35C8H 1PKQB 3GNML 5B39G 3REWB 2NY2C 3C5ZA 3BP6A 3X11B 5DDHA 1HWHB 5E8NB 4I2XB 1IC1A 1ZHBB 2X4UB 3O8XB 1TITA 4MA3B 4RNRA 2EIZA 1CL7H 1J87A 5CP7B 1RURH 1WEJH 4JGJA 4I1NB 3DV4B 1RZJH 4NKIH 3ILPA 4XNYH 1IEBB 4CN4A 3KNBB 4NUJB 3WO3B 5EBMB 3BFOA 4HUXA 4M02A 1J05B 4DEPC 3L3GB 2X2YA 4FQHB 5JOFA 3KPSD 5DJ0B 4OCXL 3VXTA 1KG0B 4WU7A 1LE5A 1CL7I 2OP4H 3MGTB 4PGJA 1ED3B 1XF3B 5JXAL 5DUBB 1SEBA 1LO5A 4U6TA 3PWJB 1QLFA 1RMFH 3LN4A 1N2RA 2ZG2A 3NFSH 4L1HA 5E5MB 4PJAE 2VISB 3MO1B 4PLKD 3VXRA 2ZWLT 2QEJA 1UEMA 6CGTA 3OAYK 4KZDH 4HFUH 4HMEA 5KW9H 1MY7A 1FVDA 3R0NA 1QRKA 4LRIA 4J6RH 3HE6B 3E6HA 1X6LA 2EDRA 2AKRA 4BFIB 5KANI 5IB1A 4MZ3A 2I9LA 3IRZA 5D1QA 1WBYA 4KGJA 5GGRB 5TH2B 1HWGB 4LIQL 2FLBT 4HUWB 5GRJH 3T2NL 1BX2B 1IGCH 4KUZL 1WJ3A 5KAQG 3ULVF 4RBPH 1MRFH 2AJUH 5J12B 3KXFB 3O3UN 4P46C 3QPQD 1W72A 5L9DH 3H9HB 5B8CC 4AZ8A 4V1DE 1T66D 1K3IA 3LQMA 3JV6A 3L3IB 5SWSE 2ADGB 2EKSB 4YDVA 3WNKA 2IH1A 3SN6N 1S7SB 3G5VB 3W0WE 5C07D 1AGEB 2Q76A 4P3CH 5FUOL 5E2TL 1MEXH 5IM7B 3DX8B 4WCYH 1QSEB 2NY0C 4X98B 2W1NA 3O2WL 4JZOA 3VFRB 5FYJL 4M7KL 3C6LD 5CIPA 1VEOA 2DM4A 5CEZH 4ZPVB 1CLCA 3MCLH 4JFEA 4L8DB 4NQEE 3VMNA 1ZT7B 4H0GA 3BVNB 3GI9H 4B53A 1Q72L 3MA7B 5JZ7D 3QUMH 5SWQA 5GZOD 3IJYB 1P5UA 5DMKB 1CIDA 5GGSA 1VSCA 5FKAB 1YQVL 4ZO6A 1FNEA 3HZVA 3CFJA 3KYOA 3ZYZA 4F33B 5SX4I 2HJKA 3VXOA 3PQYB 4PRIE 5IW3A 1CLZL 4PJBB 3FOLA 3RVXC 2EDOA 3LEYH 3RHWF 5E8PA 4Z7WF 3BZEA 1YPZE 5T1KD 4LLUB 1FDLH 4RIRA 1LVEA 4ODXA 1HQ4A 3KDMA 1P9MA 3P4OB 1U8OA 2YWZA 3GMOA 4MHHG 4WFFD 2AXGB 3IAGC 4OM1H 3O6FC 2CKNA 3RTQA 3SBWC 1KCVL 5IROC 4HC1A 3IDIA 4I18C 4P5MB 3ZKXC 3WSQL 1KGCD 4CVWA 4MQ7B 4V1DA 3BWUC 1EDQA 5AWNH 1W8OA 1ZGLA 5F7MC 3EDFA 3HMWH 2MQCA 5FHBL 4Z78A 1TMCB 4AENA 4L3ED 4P2RA 3HLAA 2VLKD 3NA9H 1NGYB 3QFJE 2GI7A 4XWGL 1CFTA 4LARH 2R2HA 3IDYC 1C08B 2IAMD 1G0DA 4Z0XA 2BOCB 4MJIE 4WTXA 4NNXA 5F88A 2XFXB 1KN4L 2LAGB 1I9EA 4FQ2L 1T5XB 5KS9A 3NN8B 1NLDH 2GTWA 1D5IL 4NGHL 3ZTNH 3EGSA 5D7KE 3O2DA 4RGNC 3CDGB 3P9MB 1NCUA 4ZFGL 3S8WA 1G7JB 3QI9A 4RAVB 5EOQH 3ULUH 1IAMA 4P3WA 5LCVH 4YHPB 3DX7B 1BF2A 5ETUA 1LD9A 2LFGA 3R1GL 4BA8A 2CD0A 3B6SB 4JPKH 1FBIH 3TYGH 3M1BB 4P48A 5FO8A 4PRIA 1BHGA 1MIMH 4N8VG 1ND0B 1I1FA 2X4QA 1YPZA 5F1OB 5FYKD 5I1JH 2WIMA 3FQRA 4OLXH 5B3JE 4AEHL 3JUYA 2RIKA 5I17A 2BHUA 2YHGA 1FZJB 1G7QB 5C0EA 1JYXA 5CD3B 2X09A 3DJ9A 4PREA 5IF0B 9CGTA 1J5OH 4P49A 4D0BB 2HFEA 5D7IF 4GG6F 1RZ7L 5ID1B 1D6EA 3S37L 2P5WB 4ETQB 1SJEB 1UZ6E 2A9MH 2L7JA 2APVA 1IILE 5GJSL 4O51B 2BJMH 5AAMA 5CZKA 2ADJA 3QFJA 1T7XA 2BRRH 3QNZB 5DJZB 1QUNA 1MCOH 1JPFA 4PJ7B 2VYRE 3OKOA 1MHPH 1NCAH 4P4KC 4MJIA 3RVUC 4JKMA 1JK8A 3TVMA 5C0FA 3E6FB 5I75C 3SDXA 2D0GA 3GKWH 1RIVL 1A1MA 2P8MB 3NABL 4QGTA 5DF0A 1J1OH 5ILTL 4MXWH 3X3FL 1SM3H 3ARFA 4IMLA 2HRPL 3L9RA 4OUUA 4KDVA 2H41A 3G5XB 2Z92A 4F7PA 2H2PC 4ZPTA 3QJFB 1MF2H 3PDOA 3R8QA 3QEGL 4YH6A 4HIHA 1S9XA 2J4WL 32C2B 3WXWL 2DKUA 3OF6D 1XIWD 2IPKB 2DMCA 4AEIH 4LLVB 2DTMH 4PP2A 3WD5L 4F7TB 4W4NA 3CDCA 1A3RL 4PJIB 3B9DA 4C4KT 5HHOA 1NFDF 2Y23A 5LBSH 5CUSH 4X4ME 3N85H 1WK0A 4LCIL 5FGBC 1RZ8B 5IKCB 1KELH 3BT2L 1KOAA 4D0DA 1LWRA 1VACA 4Z7NF 2V17H 5EZOL 4KJQC 4U0RC 3FTGB 2W91A 3VG0L 4HW6A 5E8DH 4LKXA 5CBEB 4YDKL 3S96A 4UQ3B 2F54E 2QADD 5MP6H 4D94A 2VXSH 2VDRH 5C0CD 3Q48A 1LEKA 1PG7W 1I7RA 5HVHB 3W39A 4UT7L 1X5JA 4U0QB 4EUPH 2OTPA 4U6VL 1D6VL 1GZQA 3ULVC 2RCSL 2VDKL 4RGOL 2XZAL 3V6ZA 3QPXH 1INDH 1S9VB 2EDWA 4DKDC 3SDCB 2VDLL 3QCUH 1OF2A 3WIFA 2X4SB 3WLBA 3TZVB 5EU3A 3LSOA 1NCDH 1D9KC 3SDAC 1AGDA 4HLZH 5E1HB 3AM8A 1K8IA 2OL3L 4HT1H 5T5NG 4JZJA 5MENB 2DQDL 2Q1EA 3VFWB 3T77B 5C8JB 4P59L 5EO0A 1HSBB 5DWUH 3QEUA 4Z7VE 4B5EA 4X7TB 2PXYC 3PGDB 1L9MA 4DVBB 4FXLA 3BIKB 3TWCH 3QUXC 1FNSH 3FFDB 2IG2H 1QFWL 4YFDB 1BZQK 3BZFB 5FYKU 1MHCB 2NQCA 2CIIA 4LCWB 2FBOJ 2FRGP 5DZOA 5KSVB 1J88A 5K9QI 1KEMH 2DQUH 2CLVA 1W72H 1YNTA 2I07B 4NM4H 3DARA 1FVCA 4X4MA 1F11B 2PKDA 4O2FB 2R23B 1I8LC 3KLHC 2JB5H 3B9KD 4LLDA 3NCEB 4AH2A 3U6RA 1UJTA 1ZT4B 2UYLB 4KRNA 2NY2B 5EC1B 1TFHA 1YUHA 4UZGA 4IRSC 1T1ZB 3IS1X 4LHJB 3RAJH 4KMQA 2YUXA 4PJGF 4M7LT 3D3VB 3GSRA 4YXKH 3O0RH 5JIKA 1U93B 3PIQB 1X5FA 5DURD 3KYKL 2EO1A 2AV7B 1I1AD 1I9IH 2DMBA 2VUOA 4M8QB 5E9DB 3JV0A 5JPMB 5I1EL 4G6AD 1GGCL 4MXVE 4RISH 3CSYB 1HKFA 4M7JH 2WLZA 5IEHA 5IFAL 2GQHA 4IIQC 3UJJH 1GPOL 1ADQA 1I9JH 3LB6C 4ACPA 1YDPB 1ZHNA 3QFDB 4XP1H 4K7PY 3OX8A 3O6LH 1DEEA 4HCRL 5CEYA 3UPRB 5AAWA 4QXWA 3MMEB 4MVBD 1JHKL 5LGHH 3P4NA 4Y5VB 2OR9L 1QBMH 2E7MA 4XVJL 4XRCA 4XPHL 3SJVB 4ZSOA 4IRJC 3HAEB 4KHXL 1B2WL 3SE3C 1UWEL 4XXCA 2VQTA 2AJYL 3QUYC 5ESAB 1S7TB 3K2UL 1EEUA 5F1KC 1X4ZA 3VRIB 1EXUA 4Y5XB 1EIBA 3ULVL 1QOKA 5MI0C 2BNUA 2NYYC 4H1LG 4PJ9D 4YR6A 1JGVL 3QCVL 5FXCH 5JQ6H 2V7HA 4Y5YA 5DHVH 3VDBA 2H32B 5EUOE 3IU3A 1WCBB 3IFLH 1FZKA 1HH9B 2R4RH 3EFFB 4HX1A 3SE4A 1ULVA 1QNZH 2VZ3A 4L29A 1JWSA 4H20L 4JKKA 2F58L 3OSKA 3LKPA 3NCYS 3WFBL 3T09A 2NY3C 3CJJA 4UU9B 1DBAH 1T7YA 5HPMA 4HG4K 2VJXA 2UZYB 3TNMA 1S5HA 1CFSB 1IVLA 5A16B 4CU8A 2PW2A 4WWKA 4F3FA 4HJGA 1ZHKA 2UUDH 4ONGH 3MV7B 4YIQA 5IB4A 1U8LA 15C8H 2X4RB 4X4ZA 4W6WB 1CGSL 1Q9WA 5B39A 1JPTL 3WLWC 4L8BA 3VXPA 5BOPA 4HUUB 5IMKA 4TQEL 3UAJC 4HUVA 1YY9C 5I2IA 3BP5A 3ES6B 2WQ8A 3FZUD 4NRYA 3H8NA 3VFOB 5I8EB 4K8RH 1CVSC 1EPFA 3DOSA 4UDUA 4U6YA 1BLNB 3O6ML 1NANH 2XQBL 3FOMB 1RZKC 3ZL4L 4S1SH 5GHWL 1S7QA 1AI1L 2X4NA 3BDBA 4HWBH 2FR4B 3MC0A 3QHFH 3MBED 3O6FB 2B8OT 4I9WD 4LCCB 4OZ4B 2FHCA 3RVWC 4GBXD 1NAKH 2CGRL 2NZIA 4PGDB 4QXUH 1TTUA 3SCMC 4PG2A 3VA6A 4IHOA 1WFNA 2A6JA 4TNWK 4TPRL 4GKZB 3QUKB 1YNKL 4M7ZC 1UT9A 3CXHK 4WI6A 3JBG7 5JW5B 4PJAF 4R4ND 1H3XA 1F4XH 4R7NA 4PGCB 3IDYB 4NFBA 4H0HB 2H1PH 4N0FA 3GK8H 3CXDH 4LVEA 3TJEL 5E5UB 2IMMA 3F62A 1R3JB 4TNVK 3RX7A 4YDIH 1SJXA 1GOFA 2EDTA 2ERJB 4WGWB 2A0LD 4MAYA 5F97E 3LS4L 4Y2DD 1ZE3C 1K6QL 2O5YL 3LHPL 1WBXA 4OGYH 1C12B 4I5BB 2IPTH 3D9AH 4C56E 2NX5E 3IT8D 3GM8A 3RZCD 1OVZA 1K5NA 2VZUA 3EJJX 1EH9A 5LG1A 5HHNA 4HZLB 3L5HA 3V5DA 4WWID 1U8JA 1TDQA 1S8DA 3OXRA 2JJTA 3B5HA 4U1GC 4UIMA 3IDJB 2GKIA 2DL2A 5DMGC 4QOKD 1ZGLP 5JOPE 3Q1SH 3VWJC 1NMBH 5ID0A 5CS7A 5HY9B 2V7NB 1DLFH 3MA9H 5C08B 5GRXG 3WCYA 1GRWA 1WWWX 2OL3B 4PUBH 2E8ZA 4OZGE 4CBPA 2P46B 3BKJH 3X13A 4JRYB 4G8GD 3OHXA 4QRSB 4C54A 2KZ1B 2OZ4H 4HK3N 1DQDL 4HPYH 2HTKD 4NYLB 5CMAA 4CN1A 3MXVH 3A0OA 5HHXL 4GT7A 1KB5A 3TPUB 4XMPH 3QISA 4OCSH 3SDDC 3QO1A 3MRIA 3H2WA 3IGAA 5E6IB 2X1OA 1S3KL 2EEAA 3MPCA 2FO4B 3RWGB 4EOWL 2W0LA 5DR5H 4JANB 5DQDH 3MYJB 4ZS7H 5AZEL 3UO1H 1JGDB 5TQ2H 2R56L 4ZFOL 4KRLB 4ZTOL 5IMLB 3ARGA 1R3IL 3W5NA 2B1AL 1RZKL 3O6KL 2P43B 4Y4HB 2GJ6B 2GTZA 3UJTH 3SE8L 5DGRA 4DN3L 2NX5A 4IOFD 4KHTH 4CU7A 3EO1B 2YD1A 3K1KC 4N5EC 1WZ1H 4Y88A 5JLZA 3SKOB 4P99A 5GXBB 5CZVL 1DQML 4DN4H 4IOIB 5KVEL 4XC1L 1FRGL 3O41B 1T89A 4WO4A 3CFKB 3MRHA 4PPTA 2P24A 3K4AA 3L95B 2DAVA 4MD5A 3S3PA 3C60C 2HFGH 4BZ1L 4ZUSB 4NN7C 1XF5A 4KRPC 2P4AB 1WZLA 1QZ1A 1ZVSA 3HI1B 2BXYA 3GSNH 3GMNB 2ITCA 2C26A 1UM6H 2XTJD 4HGKC 2Z8RA 4WEUD 4NZRL 4DGVL 4OCMC 1UEYA 1NAMA 3QG7H 3OR7B 2ZCLL 1JNNH 3WXVH 4GMSL 4LQ1A 3UTQB 3GSOB 3O8XD 5EU6B 1PX3A 4ELKB 4TVPH 4DTGL 1U3HC 5HHPA 1IL1A 2DM3A 4LGSB 1DUZA 3I02A 4F58L 2I5YL 3I6KB 4HF5L 2X4OA 1LDSA 1KTKE 3C6SB 3M07A 1ZLUK 4LKCB 1NGQH 3RWIA 1VADA 5B3JF 2OK0L 1NUFA 1D9KB 3SDAB 3VMPA 4OFPA 2XZQH 3K0WA 1QHPA 5HI5D 1YYML 2KH2B 4UBDC 4YUEL 4QCIA 1AXTH 3P0YH 3CU1A 1KLUB 4HZAA 1IM9D 1U8MB 3SPVB 1K4DA 1JZ6A 3BE1H 2NY4C 1R3KB 3EJYC 1UZ6F 3V2AR 4M1DL 3BWAB 4HKZB 3WE6A 3HE6D 4TUOA 3QZWB 2BVQA 2WLYA 3VFNB 2VKWA 2ILLA 4F7CB 1AJ7H 3OKEB 1VKXB 4RRPA 1MAMH 5E7BA 1N8ZA 5CD5C 4ELME 1AR1D 4XHQA 1T6VN 5DRNA 4HH9A 2K3TA 3WL9B 4DQOH 1BD2B 1Y18A 1LMKA 3VXSB 1FIGL 5FUCE 1I85C 3KXFD 1WC7A 4HPOL 4HIXH 5DJCB 5FM8A 5IHBA 5DI8B 3X12B 1JHTA 3PGCA 2DDQH 5E00A 1NFKA 1V3MA 1FJ1B 3W9EB 4U1SA 4MNGE 5T3XL 4LLMB 4D9RE 2Q3ZA 3GMQB 3L3JB 3F12B 4JDTL 4LRNH 2D7QA 4IRSB 1GSMA 1J0IA 2R0WL 2WIIB 4Z7WB 4FOMA 5C0IA 3BDYL 4HAFA 2IBZY 3KPSE 3ARZA 1TZGH 2B2XL 4JM4L 1IAIM 4G42B 5LGJA 4ODVL 1G7MA 4JFDE 3CNKA 3ELAT 3OJDB 3RWJB 2HRLA 1QSED 4PJFE 5DS8A 5GS0L 2XOTA 4F57L 1U8PB 1NL0L 2I26N 4Z95L 3ROLA 1U8HB 1PDKA 2CRMA 2VDPH 4HJ0C 3WBDA 1G9MH 5AUMB 1CDYA 3T1FA 2C1PB 4IIQB 1HSAA 1EJOL 1XGYL 1T04A 3OMZA 1AQKL 1GGUA 1TETL 2MCG1 5FGRA 4ZUWA 4OAWB 1MREH 1M1SA 1K8DA 1ORSA 3I6GA 5JNYA 5FF6B 2GSIA 5E4IA 4WTZG 5KVFH 2HLFD 4Y4KC 3VD4A 3AMKA 3PQYD 3PV7A 3BO8A 4IRJB 2NW3B 4KQ4L 4PD4K 1RUKH 1VESA 2F9BT 3BQUD 4RX4D 1G1YA 3V0WH 5EOCL 3SKUD 4CJ1A 2SEBB 3SHSA 4JDVA 4ELMA 4HUNB 4JKWA 3NVQA 3MV8B 2VR4A 1QVOB 4RFOH 5EORH 1IARB 3MRNB 1UM5L 1OAKH 4NC1C 1XR8A 1BIHA 1NLBL 4LP4A 4TTDC 3RIFK 1CZ8L 4JPVL 1F6FB 3TH4T 1CDBA 3MGAA 5F7DA 2EYRA 1XCQA 1BFOA 1BQHA 1MFAL 3GMLA 2E9IA 1ZANH 3IDMB 2EDQA 1RZFL 2NY3B 4M61A 4Z7VF 3KPSA 4QHLB 3V6FA 1A6TA 3WUWG 1BGXH 2IF7A 4U1KA 2EIEA 4PB9H 1CD0A 5CLTA 4H8WC 4GG6B 3GSUA 1I8MB 1BQLH 1FZMA 1NSNH 1RHHB 2XZCH 4OD3H 5DK2B 3HE7C 4OCLC 4YPGB 5BMFL 1LQSR 3C08H 3U4EA 1ZA3A 4OLUH 1T22B 3OB8A 2ZOKA 3JV4B 3GBNH 1KTLB 2YPLE 2YXFA 3IJSA 3ILQC 1YN6B 5D71L 4G6KL 4MNHB 1F2XK 5E99L 3JV5A 3FRUB 3QEQE 3QIWD 1NGXB 5C9JB 2AXJA 4ZUTB 1MFCH 4PJCE 3VH8B 1EO5A 3VFVA 2F19L 4MDJA 1YEKL 4Q74A 5JHLH 4OF5A 2WBWB 3OQ3B 5IBTL 4DAGH 3IDXL 3S6CA 1ZLWK 1E4JA 3L5XL 4QXGL 5M95B 1SMOA 2P5WD 2VLKE 1ZS8B 3BW9B 1MQ8A 2V5TA 3DYPA 5BV7C 1JRHH 2YD5A 4MWFB 5C07A 4M7ZB 1X3DA 3UTTE 3SO3C 3S5LG 5JPNA 4LSVL 1MCIA 2F8OA 1L6ZA 3MOBH 1RFDL 1KC5H 2VZSA 2P5EE 2AJVH 4U2YA 3MLXL 2XRAH 3C6LA 4K9EH 3SGKC 1F3DH 4YGVA 4YAQB 5BVPL 1JRHI 4I48B 3THML 4XP5H 5DD3L 4TULL 2GW5A 1EO8L 3O4OB 3T3MF 5EU7E 3VFTB 4XX1G 5FCUL 1M6OB 2AEQH 1DBJL 5IBUG 4RQQB 5I1LB 1KENH 3KAAA 3DSNA 1UQSB 1WSST 4G8IA 3GBLA 3FRPA 3NCFB 3C8KA 2CDFB 5EUOF 1OARH 1AD0A 2LU3A 4FQQA 3F7YA 2OJEB 1SQ2N 4I3RL 5T1KA 5FYKE 2MKWA 1WAAE 1MCPH 4AEEA 4JPWH 1CXKA 4OKVA 5HYFA 3N1MC 1QRNB 1CFNB 5EZJB 4PJCA 4WFEE 5IBLD 3UZEA 3FO9B 1FNGB 1WFUA 3VWJB 1PQZB 3IKCB 1RJYA 5L88L 2H3NB 2AP2A 5H8DA 3TC9A 3LQAH 4OLYL 3K4DA 4LLYA 5EU5B 3DIFB 4M03A 1JGLH 4L3EA 1ZA6A 1UXSB 3MV9B 3DUSA 2VLKA 4Q0XH 4KVCL 5IOPA 5HDOA 3QUZB 4L4TB 4Y16D 3MLPA 2J8UE 3CMOH 1MVUA 2IAMA 1PZ5B 3SDDB 4KMLB 5GRVK 1KEGH 4PJ8D 4WU5B 4WW2F 1B0WA 1HXYA 2JTDA 1AFVL 4KJYB 1GAFH 3AY4C 1X5LA 3QXUA 4XH2A 5DTFB 2EDDA 4FRWA 2W60A 2AEPL 3PHOB 4JZNB 5HI3C 3SDCD 3VXNB 1Q8MA 3CFEA 3TA3D 3TZVD 3PGFH 4YO0B 3I2CL 4OF8A 5E2WL 2FBJL 5D7JC 1CLYH 1VPOL 5CZXD 2EDYA 1TZHA 1UACL 4Y89A 2GY5A 5MEND 1PY4A 5IEKB 3OKNA 2YD2A 5ADOL 4N1EA 4XAWH 4H0IA 5EO1B 4JPIB 1K85A 7FABL 1BM3H 4HHAB 2QKIA 4PJHE 1ZLUH 3NZHL 5LXGH 4LCWD 1FNLA 2XXCB 3JTSA 4M5YL 4ZUUA 2ZCKH 2DIBA 2Q6WA 5BV7L 3GNMH 1M7DA 5GQBA 3QXTA 1IC7L 1AKJB 3PWPB 4F9PA 2C3VA 1EZVX 2C7UA 3RGHA 1I8KB 1QTYT 1G9NH 3C60B 1J0YA 4POZD 5EBLA 2JLLA 2YPVL 5J1AA 3ARWA 5I1CL 4KRPB 5D6DA 5CJOL 2BRQA 2HT2D 1R5WA 3PWUB 5C6TH 4GRWH 5CILL 2R69H 3U82B 4L8CA 2NY2D 1KPVA 5KG9A 2VXUL 1WWCA 5I1HL 2J8UA 4ODSH 4X9IA 3O3BA 2VLRE 1CD8A 3RNKA 2EIZB 3HNTH 4JFOB 3D3VD 2FX9L 3S35H 5EO9A 1GH7A 5C6PB 5EWIL 2E7LC 1OD9A 2GAZA 3GO1H 4C83A 1FFQA 1KJ3H 3BPOC 3DO3A 1LO4H 1D5ZA 1RY7B 2XA8H 3EOYG 3VXTB 3MTRA 5E9DD 3PNWA 3C87A 3JVGA 4WU7B 1OAUL 2EDKA 2FYYA 4K2UL 3S88H 1RULL 5FOBB 3O3DB 1D7FA 3BP4A 4UMGA 1SEBB 1WLHA 1KIQA 1KPUB 1BBJA 1RIUH 1RVFL 4OZGF 3LN4B 1N2RB 1XIWA 4FQXC 3FQTA 1XH3A 3VXRB 4FZ8L 4LAJH 2XNAB 2WW8A 4NZTH 5FM5O 1FVDB 4MMXC 1WCQA 4PJHA 3AFLA 1HEZA 1N6QL 1FNAA 3SJVD 2AKRB 1E4XL 2PTVA 4HGWA 5IB1B 2I9LB 1JF1B 1HCFX 1WBYB 5D1QB 1JNHB 5DD1H 4G6FB 5F9WC 4MX7B 1DQTA 2LVEA 4AG4L 5FM5M 4NQTA 1EK3A 1IAOB 5D1XC 1VGKA 3P4MA 4XB7A 3Q0HA 5BW7A 3EYQC 4P46D 2DQIL 3D0LB 5SX5K 2A1WH 1FGVL 3SKNB 4RAUA 4X5XA 5C0CA 3JV6B 4ORGA 1UB5A 4H88L 4WUKL 4WV1C 3N1PC 1XAUA 4WEBL 4YDVB 3EYVA 3ZMRA 2IH1B 5DMJB 3FHQA 5F7WC 1HK6A 3BKCL 1FH5H 4ALAH 2DBJA 5IWLC 5E2UH 4HS8H 3MLUH 2Q76B 1I9RH 4N0RA 3FO0L 4Q97A 3L3KA 1P4BH 4J7RA 5HDQH 3GJFH 4JZOB 2NY0D 1VENA 1LO3H 3OB0K 3RWEA 3GI8H 2Y36H 5CIPB 1CLZH 5F21B 5EC2A 3FO2B 4NRZB 4IRZL 2CLRA 4MNQE 4LL9A 4PJAB 2XN9D 3RY6A 2CR3A 3NOIA 1NBYB 4XVTH 4NO3A 3L7EB 3HZVB 3CFJB 3FT2A 5GGVL 1JF6A 2RB8A 2ZSVA 4MJ6B 3RVXD 4CDGC 5D4QA 3GB7A 5E8PB 3WSQH 4HQQL 3OAZH 5EIIA 5HYEA 1T20A 4ODXB 1HQ4B 3B9KA 4UV4H 5C2BH 3KDMB 1HXMA 1U8OB 3MRKA 2BDNH 3NFPB 4K71C 4E5XA 4M4RA 3MLRH 3O6FD 3RTQB 2O26U 4CW1A 4EXPX 3ESUF 1IKNC 1ACYL 2AJXL 4LASH 4QYOB 3AC0A 5DVOA 5AD0B 4V1DB 1JIBA 1QEWA 2X89D 1NUDA 1ZGLB 1HILB 2HFFA 5SWSB 1OT1A 5ESQA 4ODBD 4Z78B 4AENB 1QLEL 3HLAB 4JAMA 4NO2B 4EN3C 5C0DA 3CVHA 1CFTB 1I1AA 4IOSD 4G3YH 2R2HB 3W0WB 3MLZH 5JMRA 4H1LH 2O93L 5DLML 3PXHA 1PKOA 3IKKA 1ZK9A 4YNYA 4NNXB 5F88B 4R7DA 4CU6A 3P3YA 2JJSC 2D7PA 1L7IH 1QFPA 2R0KH 4ZUVA 3G6AB 2GTWB 1B4JH 4MQXC 3EZJB 3Q5YA 4HEPG 4NQEB 3EGSB 5EBGA 1AQDA 4WW2C 2JCCE 1G6RH 3AS3A 3TF7C 2GEEA 1V7ML 4MMZC 3RBGA 4XNQA 3RX5A 1FAKT 1UYWL 1HKLL 4PG9A 1MVFA 4ZOBA 5C0NC 5KSAC 4PRIB 1I1FB 3Q5OA 2C4FT 3LKQB 2X4QB 1YPZB 2ENSA 3FO1B 3ME0A 4GSDH 2CIKB 4WENB 1KXTB 4PJ9A 1U3JA 5KOMC 1UWXH 2Q8AL 5DD5H 4YBQC 1FLRH 1VB9A 3TNNB 1Q1JL 1LK3L 2A83A 3NIDE 5TQ0L 3H6JA 4PJFF 1S9YB 2HFEB 4JRYD 2G9HA 4S1QL 4P2YA 3BESR 1F4HA 5F9OH 2RQ8A 1H8OA 3L5WA 2C4FU 5ALCL 2VC2L 4NKMA 1Z5LA 3VDAA 3W11C 5CJ5A 3VMOA 5DA0B 5BV7B 2ADJB 5JHDE 3I3BA 3QFJB 3NCCB 25C8H 5A3IC 4P4RA 1JPFB 3KHQA 3LZFL 5EIQA 3RGVC 2HT4C 3OKOB 1GC1C 4YWGH 2R2EA 3ECBA 4MJIB 1DN2A 3RVUD 5HSFA 1WGOA 3ARYA 5E2JA 1JK8B 3RI5K 5C0FB 4DUWA 1FIEA 2AJ3A 4M6OL 1A1MB 5TDNA 3LN9A 2CKBA 2AQ3A 3T4AB 5C7XH 5CSZA 4F2MA 4FFYH 4Y4HD 2GJ6D 4IMLB 5DJAB 3L9RB 4CRPA 1U8KA 2JCCA 2FATL 5HGHA 3V4VH 4HAGA 5BJTA 1QP1A 1A3RH 1Q9LA 3TBVA 3DUHA 3LAFA 3DV6A 4HIHB 1MFBL 1S9XB 3Q5TA 2ZUTA 1A47A 3ZDYE 1A9EA 3H3PL 1A9BA 3L3HA 4TVPE 4QOKE 3ULUF 1DL7H 1V7NH 2A9NL 4O02H 5CBAB 3MJ6A 4LSSL 3MBEA 2JE8A 3ESVF 2P1YA 4NP4L 1L0YA 1MHEA 1UCTA 1KF9B 4GBXA 3VFSA 5IMOA 3F7VA 43CAA 3QAZC 5E8OA 1C1EL 1ZOXA 1XGUA 3I3EA 3I6LE 3RWCB 4QTHA 5I1AB 1VACB 4JQVA 4UT7H 1HHIA 4KJQD 4K3EL 5DEFA 5L7XL 4M4PA 2K7QA 2XZAH 5BO1L 4LNRB 5C9KA 1A7PL 2CPCA 1RUAL 2PW1B 2VDLH 4PYHA 1K4CA 5EU6D 1VFMA 1LEKB 4QHMA 5TF1H 4DFHA 3DUUA 1DQLL 1GZQB 4Y4FC 3ULVD 1U36A 2P49B 2ZNXA 2JELH 3V6ZB 3SKJH 5CCKL 4WNQB 3DNKA 4HEME 4Y2DA 2XICA 3IETA 1VGEH 3JWDH 3IDUA 5KVDH 2ICWA 4XPTH 4LAQH 2GUOA 5JW4N 4X80L 1H9VA 4OFKA 1D9KD 3SDAD 3RZCA 5HYSG 2FLRT 5B3NA 4MCYA 3MROA 3QQ4B 2VDNL 3A6OA 5F3BA 3TIEB 1E4KC 1A6VL 5EO0B 4CVUA 5TDPA 3AAZB 3QEUB 5HD8D 4HWEL 2PXYD 3I50L 1FV1A 5DJXB 5ACMA 3QUXD 2ADFH 4NQDE 3GSQA 4QOKA 3D85B 2CIIB 1RZJC 1E4WH 2CLVB 4G7YH 2AEWA 2EEDA 2N4IA 1RK1A 1FVCB 4G8GA 3OR6A 1BD2D 4JO1L 1GC1L 4FFVC 2Y7QA 2HMIC 3KLHD 5JIPA 2ATPB 4KK8C 4LLDB 1GIGH 1SBBA 3NCYP 3U6RB 2W92A 3VRJA 3FONA 5F7LB 5CEXA 1M7XA 2IALB 5FA4B 2GCYA 1Y6KR 2PCPB 3C09C 3F5WA 3KYKH 3U4AA 2DQGL 4O5LH 1YY8A 4PGBA 4IRSD 2F54B 1IGML 2G2RA 1QSVA 4U33A 4HXBH 5E4EC 5JA9A 3HAEG 5D5ME 4XP9L 1OM3L 5KN5B 3U9UA 3UX9B 1OWRM 3RNQA 5HPOA 1H15A 3O2VL 4K07A 5J6GA 4JR9L 4J8RB 1CDJA 4L8SC 4L5FL 1WAAF 1EGJH 5DMIL 4ZYKA 1JF5A 1MRCL 2YK1H 3WO4C 3ZKQD 4N0YL 1CS6A 4XVJH 5IEHB 3U0WL 1TZIB 4X7FC 4NQUA 5B38G 1ZHNB 2EDHA 1UWEH 4Z7VB 4XHJC 3SGEI 3OX8B 1WITA 3NTCL 2X1PA 4QRRD 4IM8A 3P4NB 2RGSA 2NZ9C 1F3JB 4XRCB 5I76B 4KK6C 4NZJA 5DD0L 4IRJD 1SVCP 2Y5TA 2E6QA 5J06A 1OD7A 1E6JL 3ARRA 2NXYC 3QUYD 3S3SA 1Y0LA 5E2VH 4W4OC 3REWA 2Z93B 3MV8D 5F9WB 5FYLE 5C3LD 4WIQA 5FUCC 1QQDB 3WDHA 2CXGA 3X11A 5D1XB 1DSFL 2BNUB 2AK1H 2V9TA 4YR6B 5T5FL 2NYYD 5E8NA 3TGXA 4I2XA 3H0TA 2V7HB 4XI5C 3CVHH 1JWMA 4CMMB 1FZKB 3O8XA 4HX1B 35C8L 1JWSB 4L29B 5FDWA 4S0TD 3IDNB 2EXWC 4J12A 5CJXC 3LKPB 3MRGB 3KNBA 4NUJA 4A6YA 2NY3D 2DQJH 3L3GA 4FQHA 1CGSH 5JQHC 5DJ0A 4BH7A 4JDZA 5HPMB 3SY0A 4FQLH 2IH3B 3K2MC 1S5HB 1CL7L 1J86A 2PW2B 1RURL 3F7PC 1WEJL 4WWKB 4QWWC 3AB0C 4HJGB 3RY4A 1ZHKB 4F3FB 1RZJL 4NKIL 4XNYL 4YIQB 2EYSB 3LRSA 3WNOA 5DUBA 2D7OA 2QHRH 3PWJA 4G43A 5F89A 1L7TH 3G5ZA 3WLWD 5E5MA 3VXPB 2KPNA 4N9GB 2VISA 3MO1A 5IMKB 1IM9A 3KLDA 1BMGA 2DTSA 3UAJD 2OP4L 1MWAA 3LPGA 1YY9D 2XQBH 1AC6A 1X9QA 5I19H 1U3ZA 3HE6A 3U0PB 1ITCA 4NRYB 3J8F7 1RMFL 5F7KC 3FB8A 1OSZB 5TH2A 3NFSL 4HUWA 1LNUB 1XR9B 5FAAA 2FD6H 4U6YB 5F7EH 1BX2A 5EZLB 4HFUL 4XPBH 5KW9L 5EZIH 2MKLC 3FN9A 4OFYA 4J6RL 1XZ0A 3AXLA 1FGNH 2E9BA 4PB0H 1OTTC 4WY7H 1EEZB 2L7UA 5GRJL 4UB0L 4F37K 2VO5A 4AM0A 5C09D 3RVWD 1G7LB 4XVSH 5EUOB 1MRFL 2AJUL 2DQTH 4IHOB 2EKSA 3S35X 2A6JB 3ULUC 5L9DL 1NDMB 1IMHC 2B4CH 5HGGS 4YDLB 5DQ9A 3WHE0 4EN3B 2BHYA 3DX8A 2F15A 1QSEA 2EDEA 2ID5A 5BZWB 1S7XB 4P3DA 4P2OC 4N0FB 4ZDHA 1F97A 2FEDC 4ZPVA 4WGVB 3BVNA 4P3CL 4QRUB 1HQRB 4HIIB 1MEXL 4WCYL 3IJYA 1UH4A 4X6DE 5ENWB 3VXQA 5HYQB 1WBXB 5DMKA 2WV3A 2NY7H 3QDJD 1J1XH 4HKJB 5FKAA 3P9LB 1JPGA 5CEZL 1B0RB 3MCLL 2X5PA 1K5NB 3PQYA 3GI9L 4PJBA 5HHNB 1PEZA 3QUML 1U58B 2QV2A 3BQUA 4RX4A 1U8JB 1ZSDA 2NLJA 4J3VA 2QSQA 4F15C 1OP3K 2E7CA 3SOBH 1MCRA 2AXGA 5JW3H 2VAJA 2VN7A 4P5MA 3K74B 3MUGB 3LEYL 3VWJD 5INCB 5GGTH 1FDLL 5DJYB 3DBXA 4HKBB 4X8JA 4CVZB 3X13B 4OIIH 4EOWH 4OM1L 3MV9D 3FKUS 2IANE 2GIYA 1BWMA 4U1MA 3QUZD 4L4TD 1KB5B 3NCMA 5I8KH 1A0QH 1DQJA 3MRIB 3SDDD 2V2XA 3SO5A 5AWNL 2VWEE 2BOCA 4K7FB 3HMWL 3H3BC 1AHWC 2Z91A 2YEZA 3OGCA 4CVXA 3NA9L 4M48H 1A14H 3TBSB 1QFWM 1T5XA 3BIAX 1J11A 4PY7A 3NN8A 3MREA 3ZT5A 4LARL 2G5BB 3QDME 1CDHA 1V5JA 3ARGB 3CZFB 4F9LC 1MJ7H 5CZVH 1W8NA 2F53E 5T3XD 1G7JA 1OB1A 4PR5A 1AE6H 4RAVA 5EU7C 2W59A 1DJSA 2GTZB 3EO9H 2ICWI 4YHPA 3DX7A 4LGPB 4C56B 2NX5B 4ZODA 1NLDL 2XYCA 3B6SA 2ED9A 3LEVH 3M1BA 1VFOA 3IU4H 4N5ED 2X05A 3HNVH 1N0LA 3VGGA 4ZOCA 2VLJD 5JLZB 2GYSA 2XT1B 3QIWA 4LSRH 2ZG1A 3KJ4C 4U7SA 2AK4E 2NCMA 5EOQL 2BY1A 3ULUL 1IC4H 2J7LA 1U8QA 3F7RA 4N0UE 3BSZH 5C0RH 4MYWB 1YJDH 3PWPD 1AKJD 1G7QA 4NPYB 2MNUA 3KYAA 4JPKL 1FBIL 3F6LA 3TYGL 2P24B 1MIML 3C60D 1BIIA 1XF5B 2WINB 1DBBL 4KRPD 3O3EB 4M1GH 4RZCB 1S7UA 4AMKH 5I1JL 1ZVSB 4OLXL 2P5WA 4OZGB 2PR4H 4QNPE 3QAZB 1SJEA 3U1SH 3MNVB 4P2CG 4DTGH 4JY5H 2D7MA 1J5OL 3FT3B 4NWUH 4DZBA 5DJZA 5EOTA 4LIQE 4U3XA 4WI5A 4JFFE 3QZWG 4RMRA 2JCCF 4BFGA 3UDWC 2DD8H 2A9ML 2HLAB 3RRQA 1U3HD 1IL1B 2BJML 4LVOC 3UTPE 3I02B 3PV6B 3GFUA 2BRRL 2P8MA 3BN9C 4OZFA 1BQSA 1MCOL 1N7MH 3KPNA 3D48R 4WHTB 5I71B 4FQJH 4QHUA 3RX8A 1MHPL 1NCAL 3LRGA 1RZGA 3RWIB 4DZ8B 1VADB 2VZVA 2J6EA 3G5XA 3WFZA 4P2QE 3QJFA 1TJGL 3GKWL 2C3GA 3WJJA 4JFPB 3VI3E 3NIDF 1J1OL 4O2CA 4UBDD 4QCIB 5J8OA 4MXWL 1SM3L 4JM2F 2IPKA 3UZQA 2P8LB 3ZHLA 1K4DB 1QSFE 5IQ9B 2W0KA 2DWDB 2NY4D 4LLVA 3EJYD 1S5IH 1FIGH 3FAWA 5JA8B 1MF2L 3WE6B 4N0UA 5FYJE 1UG9A 4K3DH 4RA0C 3KPRE 1C16A 3LDBC 4FQPA 3P40A 4NO5A 1R24B 2QQKH 3IFNH 4JHZA 4KI5C 1OGTA 1BBDH 1N8ZB 4G6FD 1RZ8A 5CD5D 4JDTH 4LU5H 4X0KA 5DRNB 4AEIL 4HH9B 2DTML 5F7NC 2GHWB 3CUPA 1MCFA 1WC7B 2GJJA 5LBSL 4Y16A 1YQ2A 2O5ZH 4UQ3A 2WNGA 3N85L 4OF6A 5E00B 4RMVA 1RU9H 4PJ8A 4U1SB 5I1GH 3C09B 1KELL 5KANG 3B8YA 2V17L 2C9AA 1UJ3C 4EZMA 5E8DL 4GOSA 1S9VA 2H26B 3GKZA 1MLCA 2NY5H 5MP6L 2QSTA 5IK3A 2VXSL 1G6VK 1NJ9A 2X4SA 3ZDYF 2VDRL 3TA3A 4L8SB 3TZVA 3VFPA 1DLHB 3LN5A 1TVBA 5DS8B 3ARPA 1KFAH 3L5JA 3WO4B 5TFSH 2C1OB 4NZDA 3ROLB 5MENA 3QPXL 1INDL 4CGTA 4P2QA 5M94B 1HSBA 3T1FB 1ZTXH 3QCUL 1HSAB 2BSSA 4X7TA 1T04B 3PGDA 4DVBA 1NCDL 4Y19E 3FFDA 4ZUWB 4GW5B 5JORA 2J5LB 3BZFA 3L3OB 3O9WA 1ORSB 4LCWA 3ZHKA 2XA3A 3I6GB 5DC4B 4HT1L 3MZTA 2GSIB 3ALPA 4OFVA 4PRPE 4ODWA 5DWUL 4Y4KD 4YQXH 1T2XA 3CCHA 3BO8B 2I07A 3QQ3A 2Z31C 4AT6A 1F11A 3TWCL 5D93C 4O2FA 1FNSL 2IG2L 1WFOA 2CUHA 2EZ0C 2XWBA 1CXFA 4JDVB 1PX4A 4ELMB 1BEYH 2NXYB 4ZD3H 1ZLVH 1MFAH 1KEML 1AY1H 2UYLA 2DQUL 1W72L 1TLKA 4TTDD 2NY6C 5KOVC 2JB5L 4V1DD 4MNGB 3QQNA 3WFEH 5F7DB 2EYRB 1XCQB 3D3VA 2OI9B 2VOTA 4ONHB 5SWSD 3WJLC 1BQHB 3GMLB 4OLZH 2EIBA 2Q3AA 4K8RC 2VSCA 4KC3B 4M61B 1N5YH 2ED8A 5D72L 3QEHA 3KPSB 3VH8G 3W0WD 7CGTA 1KYOK 3RAJL 5E9DA 3ZE1E 4YE4L 5IVZA 4JFDB 4HXAH 3CLEH 4YXKL 2CJUH 2F8XC 3O0RL 5F3HA 4PJFB 1JWUB 2XG4A 2VDMH 1NEUA 2R9HC 4NCC1 1V8HA 3GSUB 4UQ2B 1FZMB 4U4BA 5FO7A 3HE7D 1YDPA 4ZS6C 5DYOA 3QFDA 1I9IL 4NQED 4TUKH 4X6FA 1FCGA 4LK4A 5E99H 1MLBA 3WIHA 1P5VA 3UPRA 4R0LC 2XN9E 2E8YA 5IJVA 3HZKB 2JB6B 1VDGA 4M7JL 1X5KA 3IJSB 3ILQD 5H94B 3UJJL 3WHE1 1W0VB 2F19H 3BPNB 3SJVA 3CH8A 1I9JL 1YEKH 3T0EC 2BNQE 1E6OH 1HNFA 2BFVL 4AJ0A 5I0ZA 2AGJH 1CICC 3HPLB 3IAQA 1CWVA 4Z5RB 3IXTA 5I8CA 4XP1L 4HFWA 4ZOEA 1IJ9A 3O6LL 5ESAA 5DK0B 1PZUB 5LGHL 5D5MF 3WMSA 1QBML 1YEEH 4NN6C 3P77B 5I30H 1FLTX 1I1YB 4P46A 1J0HA 4F80A 1SY6H 2EIDA 2H32A 5GS1C 3X3GL 2W0PA 5D6CA 1HH9A 1NCBH 2CO6B 4PJXA 1IFHH 3GMMB 1HYSC 2B5IC 4UU9A 1VEPA 2VERN 5HDLA 2EH8L 5JQ6L 1NMAH 3N0PB 4HS6A 3IFLL 2R4RL 3QNYB 3QXAB 1QNZL 4EI5C 5A16A 2F8VA 5JPNB 1J1PH 3GSVA 4P2OB 2WP3O 1UCBH 1DBAL 1DBJH 5KAQF 3BIBX 1K2DA 2VN4A 4U1IA 4AYFA 1QYGH 2PF6A 5JXEC 2CMRH 4RGNE 2YMXH 4ONGL 3CD4A 3DHJA 5D7KD 5IVOA 1B4RA 3ES6A 15C8L 2XN9A 2X1QA 3CFDB 4W81A 4PRBA 4WHYG 4ZAKB 1IQWH 3BEWB 1JHLH 3VFOA 4AEFA 1VERA 2YPLB 4G8IB 1AXIB 5EB9A 3WFCL 2HJFA 4DKFH 2I25N 1BVKA 2MSPA 5GGUB 3MCG1 1KJ2H 2I27N 1AD0B 5EH1A 3F7YB 3HTLX 4QRTB 4OF3A 4HK3J 2J8OA 4OKVB 4UTAH 4BQ8A 3QEQB 2WK2A 3CDYA 2FR4A 4K8RL 4PJCB 3O6FA 5J13C 3NPSC 3SBWA 5IROA 4JB9H 4I18A 4OZ4A 4LEOA 1RJYB 4PGDA 3UCRA 4UDTA 2E6JA 4JM2C 2X89A 4KKAC 4S1SL 2VZTA 3FJTA 3SGDI 3HC0B 2YD7A 4GKZA 4HWBL 4LLYB 3T2PA 3QUKA 4L3EB 1ZA6B 5CKAA 2JIXD 2VLKB 5HVGB 1RIHH 4NM8H 2AV1B 4BZ2H 4C58B 3RUGE 1NAKL 1MAKA 4QXUL 1M7IB 4IMKC 5E08H 3UTTB 1T0PB 4MA1B 4GJTB 1HXYB 4NQXB 3WIIH 2ICCA 4BH8B 2J6EH 1R3JA 4PBWD 5J1SC 3WKNA 2DJSA 1BOYA 1F4XL 3TH2T 4KV5F 5HI3D 2WSKA 5ADOH 2H1PL 1C12A 1Z9SA 4XMKL 3GK8L 3CXDL 4I5BA 1R3HA 1WZMA 3DX9B 3VD3A 5D7JD 3LY6A 1TZHB 3R06A 4YDIL 3EOBB 4S0SD 2MPAL 1IC7H 3TJHC 3WEXB 3OKNB 3HS0A 4YFLI 4OGYL 4YBLB 2IPTL 4U7KA 3D9AL 3IDJA 3KJ4B 1A6AB 2QKIB 3D85D 3ZE2E 3JTSB 2VR9A 2Q6WB 1M7DB 2C3VB 3NFNA 4UOW0 2OL3A 5CWSA 1QR4A 2ADIA 1KTDA 3CIQA 5EBLB 5J1AB 4JRYA 1XEDA 4QRSA 3QDHA 4GRLC 4KQ3H 3G9VA 2KKQA 1NH6A 3HMXH 3Q1SL 1R5WB 2H45A 4OB5H 4ISVA 4L1DA 1I3GH 3TPUA 1SMAA 3MA9L 1DLFL 4P23C 2R1YB 4PUBL 1KPVB 1IGFH 5KG9B 3BKJL 4X6DF 4FMFA 2F54D 2J8UB 4XCFL 3RWGA 2OZ4L 5K9QG 4HPYL 1LEGB 5J0BA 2Z8VC 3MXVL 2E7BA 4P4KA 4XMPL 4GXVH 3IAPA 1DR9A 4OCSL 3EYFB 4ZXBC 5IMLA 5FGSA 2YXMA 3BUTA 5E95B 4LVOB 1DDHA 5IG7A 2GAZB 2UY7A 3G08A 1ZVHA 1X7QB 1D5ZB 5DQDL 5DR5L 4ZS7L 3KYMB 4Y4HA 2GJ6A 1MIEH 5D7LE 3HC3H 3UO1L 5TQ2L 3HUJE 2VH5L 4OGXH 3EO1A 3HRZB 3BP4B 4RMTA 1KIQB 12E8H 5T1MA 2A74B 1BBJB 4U05A 3RVVC 4BSVB 1J8HE 1Q0XH 3FQTB 3UJTL 4G8FB 4CADA 1T5WA 3CFKA 1TJIL 1YNLH 1ETZA 3CDFA 3L95A 4PJHB 1YEIH 1WZ1L 3VU2A 1HEZB 2QJDA 1LO2H 2IPUG 3LDBB 4KI1A 3HI1A 3RA7H 1HINH 4KJPC 3BZDA 5DZLA 4DN4L 3GMNA 4P57A 5FGBA 1W2KT 5D1XD 2HFGL 2APFA 1G9MC 3P4MB 3QO0B 4BQCA 3EYQD 3MRMB 1JNLH 5IHZB 2QADB 3I3DA 1P84K 3U4BH 3UTQA 3GSNL 4RAUB 3GSOA 1UM6L 5J4MA 4Q6IC 4ORGB 1GOHA 2VLRB 1UJ3B 3I6KA 1MJUL 1FE8H 1N3NB 3QHZH 4L9DA 1JNNL 3WXVL 3MJ9H 3IDGB 2P44B 1EFXA 2DKMA 4ZNEA 4BZYA 3WIHH 2XKUA 4V2CB 4F7EA 1KXQE 1D9KA 3SDAA 4PYGA 3L3KB 4MDIB 1YEJH 1A64A 3RWEB 1IKFH 3E1F1 3HAEH 3BRFA 2VLLA 3BP7B 1QBLH 3RHWK 1NGQL 4POYA 3TBWB 1JZ4A 2EC9T 2Z9TA 3SPVA 5EC2B 1PY9A 2PXYA 4QNPF 2P8PA 3QUXA 1AGCA 3MUHL 4HH8A 2CLRB 2XZQL 4TOYH 4HKZA 3HC4H 3DVFA 3QZWA 1PBYA 3RU8H 1IGTB 3CX5K 3QIBC 4F7CA 1HH6B 1T1WA 1VKXA 4NO3B 4KTEH 1AXTL 3P0YL 1OWWA 2BP3A 2XTLA 1AGBA 1TQCC 1YA5A 4KXZH 1FNHA 3BE1L 3GB7B 5IHUH 2Z31B 3WL9A 4XMLH 1BD2A 1KJMB 3DMMC 5D93B 1I8LA 1T20B 5EN2A 5DJCA 5DI8A 3MRKB 1AJ7L 1G0XA 4PV8B 4E5XB 3D5OF 1MAML 1I75A 1FJ1A 3W9EA 1CU4H 4K94H 1JI1A 3GMQA 3L3JA 3F12A 4IRSA 4KXZI 4DQOL 4YHNA 2WIIA 4Z7WA 1ERNA 1QPPA 2HKHH 2WWKT 4HIXL 1TPXC 2HFFB 4N8CH 3VI3F 1FYHB 3FB7A 4JAMB 5DURB 2CRYA 4EI6A 4EN3D 4LRNL 3OJDA 1FPTH 1IGIH 1I1AB 3GSXB 5J11C 3C2SA 1FC2D 5D7IE 1U8PA 5EBWB 2D4FA 3D39E 2VL4A 2XKSA 5I1KH 4LF3A 2FIRT 1TZGL 2C1PA 3ARSA 5C6WH 4IIQA 4ZUVB 1CGUA 3GBMH 4M3JA 4U3HA 4QRRA 5FF6A 1P4LA 2VDPL 4MNQB 1G9ML 3PL6C 2Q8BH 3S97C 3M17B 4X4YA 4XNQB 4AL8H 3LS5L 4IRJA 1KCRH 3SE3A 1CICB 1X5ZA 5KSAD 1MREL 4LBEA 2IJ0C 1LK3H 2SEBA 3QUYA 3RJQB 4S1DC 1A2YA 3MV8A 4S1QH 5KVFL 3V7MA 4XNMA 4K9EC 3MRNA 3T65B 4PJ9B 3K3QA 2EDBA 4LP5A 1RUKL 2V5RA 4KZEH 5C09E 4YBQD 1H3PH 2A83B 4ODHH 2UVEA 2YC1A 2MQ0A 3LQZB 4RFOL 3IDMA 5EORL 4XBEH 3SE9H 3L5WB 5C0BD 1CBVH 4NKMB 2NTSP 1Z5LB 2ZKHH 4QHLA 1NFDE 2KBGA 4NN5C 1CXIA 2QBWA 3RQ3A 2BZDA 4EI5B 2AXFA 2A6IB 3T8XB 1JMXA 3AU1B 5D7IA 1ZANL 5HGDB 1I8MA 2HT4D 2BY3A 2DQFA 4YPGA 4LSQL 2VABB 5LVEA 3E0GA 4ZMAT 2AJ3B 1BGXL 1T22A 5TDNB 3WNMA 2CKBB 3QDJE 5ISZE 1LP9F 2WWMC 4FQ1L 5SWZD 3LQAC 4PB9L 5CSZB 1KLGA 3EFDH 3BGFC 2XZCL 1NSNL 4OD3L 2OR7A 1YN6A 4C56D 2JCCB 5LAXA 4JO4H 4LHUB 5HGHB 4DVRL 3C08L 5F7HA 2PTTA 4ZFOA 2D31B 4OLUL 1Q9LB 4NP4H 3TBVB 3JWOH 3OJMB 3MGOB 3OG6B 4YC2B 3CMGA 1NGXA 5C1MB 1NCNA 3AS1A 3GBNL 1FZOB 4ZUTA 1A9BB 3L3HB 1JGUH 4ODUA 1D5XA 3IFOB 3OKDA 1FO0B 4NKOB 3MBEB 5JOPD 2ZJSH 3AUVA 1MHEB 3GIZH 4GBXB 3KLAA 3ZE1F 5C09A 1JP5A 4ZQKA 5IMOB 3SCMA 1MFCL 5ANME 5GRUH 4PLOB 1W0WA 5JHLL 3BW9A 3V7AE 4QTHB 2R2CA 4OZIE 1JYNA 2YKLH 4MWFA 2YR3A 2DLFH 4I0KA 1NFDA 1FL5B 5JHDB 2FSEA 2VWEC 4QHMB 5IW1B 4UOW1 4MGXA 1B6DA 3G6DL 4YAQA 1P53A 1JRHL 3DWTA 1X4XA 1GGTA 4Y4FD 4EQ2A 3EYUH 3D25A 1EEQA 4X6EB 1N59B 3G04B 2DQEH 3VE0B 2ZUXA 1TCRB 3VFTA 1T3FA 3MOBL 3QDJA 1KC5L 1M6OA 5ISZA 2AJVL 4RQQA 2XRAL 4K9EL 5IQ7L 4PJGE 1UQSA 3GSNB 4L9LC 3VJ6A 2IFGA 3B5TA 3MROB 4W6XB 1TENA 2XY1A 4Z18A 5F3BB 2OJEA 1AH1A 1O7VA 2ZSWA 2AEQL 5SV4A 4BFEA 1T0MB 3U30C 3ZHDA 3LIZH 1CFNA 1KENL 5E8EB 4Z8FH 4DGIH 4M5ZH 4XGZB 4KFZC 4QOKB 1FNGA 1QACA 3VWJA 4EDXA 1OARL 3IKCA 2Y72A 5I6XB 1MCPL 2AI0H 2BVEA 1F4WH 4JPWL 1OP5H 5DUMH 4YPJA 1TTFA 2DQGH 5DVMA 4UIKH 1RK1B 3DIFA 5ANMA 1EO7A 3VDCA 3MV9A 4FFVD 4GRLB 2HMID 3O4LE 3F58H 3JZ7A 4KK8D 1KCKA 2ATKA 4J4PC 1BFVH 3QRGH 1A6ZB 1M05A 1NAML 5CP3A 3EHBC 3SDDA 3QWOB 5F96H 4KKCC 1O5DT 3LQAL 1A7QH 3S98A 1YY8B 4PGBB 2X4TA 3W2DH 4KJYA 3QA3B 5D2NE 2G2RB 3N1FC 5F1IA 2V9QA 5DTFA 1V3JA 1FL6A 2D7TH 3GRWH 3RNQB 3CMOL 3PHOA 4ZXBB 2JF1A 5GISH 1KEGL 1JTPA 1MJJB 4YO0A 3UTSD 2LV4A 4OLVH 1GAFL 3BI9X 3H9SD 4HS3A 2NTFA 2XWJA