4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
2WF7A 3QU9A 1Y8AA 2FPRA 3DV9A 2NO4A 2FUCA 4CF4A 1QQ7A 4L6CA 3IJ5A 5AVYA 2YBDA 4YCLA 3ESRA 1MH9A 2BDUA 5T41A 5AI4A 3PGLA 4YCMA 3AR2A 4DFDA 2YJ4A 3CZ4A 4UMFA 1N8NA 2HSZA 4UU0A 4KN8A 5AM0A 3SHQA 3U7EB 3E58A 2RARA 1RDFA 3NAMA 5AK4A 4BX0A 3OCUA 1F5SA 3FZQA 2CFTA 1XVIA 3OTQA 2FEAA 4BNDB 1NRWA 4JB3A 5ALTA 4UM7A 2MU1A 2G0AA 3OCXA 3A1CA 4RESA 2R8ZA 2G06A 2P9JA 4GIBA 1Z4KA 5ALPA 3D6JA 2OYCA 5A3QA 2P27A 2PR7A 3KDPA 3I28A 5ALKA 5ALJA 3WK5A 2FUEA 2YJ5A 2B1QA 1QYIA 1SU4A 1FEZA 4C4SA 2VKQA 2GHTA 1CR6A 5AI5A 4Y2TA 5JJBA 1RKUA 4KX5A 2WM8A 2CFSA 3QU7A 3SLRA 5AM1A 3QXGA 4QJBA 2EATA 4QQFA 2FPSA 3I76A 3WKBA 4I9GA 3WK8A 5AM3A 4KNWA 2C4NA 3BWVA 3L1VA 4CNQA 3B9RA 2G09A 5AVSA 2B0CA 2EARA 2HX1A 3ONNA 5AKJA 1JUDA 1U2SA 2W4MA 2JAOA 5ALYA 2WF8A 3I1YA 5ALHA 4EELA 2IOFA 3WK4A 2HF2A 4UM5A 3QUTA 2G1AA 1N9KA 1TJ3A 3ZW7A 5AVVA 2HI0A 2ZBGA 3AR9A 5AW9A 4OD0A 2ZXEA 2RB5A 4HGRA 2DQSA 3ZWKA 1ZD3A 1Z5GA 1RRCA 2HDOA 3E8MA 1T9ZA 3W5CA 2GFHA 5ALVA 3AR4A 4KNVA 1NF2A 5AKIA 4YGYA 5ALGA 1L8OA 1YNSA 2W11A 2AH5A 5IS2A 2R8YA 1WR8A 3L0CA 5AW1A 1Q91A 2GO7A 3NRJA 3FM9A 2AUTA 4UASA 5A3SA 5ALEA 2YFYA 2YMLA 3B9BA 1ZD5A 1ZJJA 2R8EA 4OHFA 2WF5A 3ZTWA 4ZEWA 3AR5A 4L57A 4OCZA 1RLMA 1Z4NA 3IRUA 3WKEA 3FPSA 3ZX4A 3DAOA 5AM4A 2B8EA 4CF5A 2G08A 2I7DA 1Z4LA 1NNLA 3U19A 3L5KA 3KBBA 4Y2PA 2HO4A 2YJ3A 3EF1A 1L8LA 3QU2A 3L1UA 1YDFA 1Z4JA 2GMWA 4Y2VA 3WKAA 3MN1A 2FPXA 3OCVA 2WF6A 1VJRA 4EENA 2I34A 5A3RA 4HGQA 2YJ6A 3FVVA 4YCNA 5AVRA 1VJ5A 4Y2SA 1QQ6A 3KOOA 3R09A 4I9FA 3ZI4A 3SKYA 5AM5A 2OM6A 5AHXA 4NFLA 3R4CA 4HGPA 4G9BA 2I54A 3EPRA 4G63A 2P11A 1TE2A 3S6JA 4J03A 2HEGA 3ET4A 3WGUA 4YIHA 1SWVA 2WF9A 2FI1A 3A1EA 5AKZA 1L7MA 2IOHA 1U2TA 2FPWA 2C8KA 2FDRA 4UMVA 5ALXA 3DNPA 1RLOA 2B82A 2I6XA 3QU5A 4XPZA 4HGNA 4E88A 3A3YA 2PQ0A 4L6AA 3PDWA 4UMEA 3UMGA 3WGVA 1XPJA 1Z4MA 1YV9A 3ZVNA 2D2VA 3QNMA 2P69A 3EWIA 1O08A 1TJ5A 5AW7A 3WK6A 3EF0A 2BY4A 4JDPA 3P96A 3NUQA 4H1WA 5AKKA 3WK7A 5ALQA 1L7OA 1LTQA 4F71A 3QYPA 2JARA 3BA6A 3M1YA 3U7HB 2EAUA 5IT4A 1X42A 1J8DA 3I6BA 4GXTA 4UARA 1T5SA 2NO5A 4PNHA 3N07A 1U02A 4CE6A 3ZVLA 2OBBA 4J2TA 4FYPA 2JAUA 5AVUA 3SMVA 1TJ4A 2ZOSA 3QUCA 4MUMA 4KX3A 3K1ZA 4Y2RA 4AS2A 3J7TA 4UU1A 1CQZA 1WVIA 4B6JA 3E81A 3N1UA 4BYGA 4NABA 5AI0A 3MMZA 1YJ5A 4ZEVA 5AM2A 3U7FB 2YMMA 1VFPA 2O2XA 5AW4A 3U26A 3B8EA 1LVHA 1ZD4A 3ED5A 5AKHA 3PGVA 2RBKA 5AI6A 1EK2A 4XOUA 3KD3A 5ALZA 3L0YA 3NIWA 1S2OA 3RFUA 5AVZA 3QLEA 1L7PA 2YMQA 2I55A 2RAVA 3SKXA 2CFRA 3PCTA 1ZD2P 2ZBDA 1RQNA 4UAVA 4IFTA 2X4DA 1Z4PX 1ZRMA 1KYTA 2PKEA 3FPBA 4FE3A 4HAIA 4ZEXA 1SWWA 1QH9A 3DDHA 5AVTA 4Y2UA 3KZXA 5AW6A 3HYCA 2B30A 2IA5A 3ZU6A 2WFAA 3UM9A 3OCWA 4RETA 5AI8A 2AGVA 3L8EA 5AW0A 1RKQA 3VAYA 1Q92A 2FPUA 4Y2YA 3OPXA 4YH1A 3M9LA 2ODAA 2B8JA 5AI9A 3W5DA 5AKGA 4DW8A 1ZOLA 4Y2QA 2Q4RA 3FGOA 1PW5A 5AKLA 5ALOA 2CN1A 3IB6A 5FP0A 2QLTA 5AKXA 3AR3A 5ALFA 4KYTA 5ALIA 4F72A 3MC1A 2OA0A 5ALSA 2NYVA 4BNDA 1Z88A 3SD7A 3ZUPA 3QGMA 4HGOA 4AS3A 5ALLA 5AW2A 3ZX5A 4Y2XA 2ZBFA 2B1RA 2O9JA 4BEWA 4MWOA 4NAVA 5AKYA 2MSNA 3GYGA 3ET5A 1WPGA 4Y2JA 3WKDA 3ZTYA 2IYEA 3U7GA 3W5AA 1T5TA 4UAUA 5AK3A 3E84A 5AESA 3OCZA 1ZRNA 1L6RA 1Z4OA 2YMPA 5AIAA 4HYTA 5E0OA 2HCFA 4EX6A 3L7YA 3L8HA 5ALUA 1Z4IA 4BEVA 5ALRA 3L8FA 2JAWA 3UMBA 1AQ6A 3OCYA 5AVXA 3N8GA 1L7NA 1WZCA 3N5KA 4OFZA 1IWOA 1J97A 1RMTA 4DCCA 3AR7A 2C9MA 4UATA 5IT0A 1Z4QA 1YS9A 2HOQA 4DWOA 3NASA 4FFDA 4NV0A 4BX2A 5AK5A 1S8OA 5ALDA 5AW5A 2YY6A 3N28A 3ESQA 4UMDA 1RLTA 5ALMA 3UMCA 2Q4TA 3ZWDA 3QUBA 5AK6A 4CF3A 2WHEA 3RF6A 1RMQA 3L0BA 4C4RA 3NANA 4YIKA 3R9KA 3ZVMA 1RQLA 2AMYA 5AICA 1ZS9A 2C8LA 2G07A 3MPOA 2IOFK 3QU4A 3W5BA 1TA0A 2Q5EA 2QYHA 4EEKA 1Z5UA 2G80A 1EK1A 2BDEA 4XE5A 3CNHA 4C4TA 4IG4A 3F9RA 1RC8A 2JGAA 5AVWA 1U7OA 4XQ0A 1RKVA 1XP5A 5AIBA 2HF7A 3WK9A 2C88A 3NALA 4BX3A 4Y3UA 3U13A 2ZG6A 3A1DA 5AVQA 2R8XA 3WKCA 4NWIA 4BKMA 3AR8A 2HHLA 2YN4A 1U7PA 4EX7A 3AR6A 3HLTA 4O8CA 4AP9A 5ALWA 4EZEA 1K1EA 3QUQA 3QX7A 2W43A 4UW9A 1RPZA 3KC2A 3L8GA 5AW8A 1O03A 5ALNA 1QQ5A 4BBJA 2GHQA 5AKEA 2I33A 2ZBEA 3SF0A 3TLMA 5AW3A 1YMQA 1RMYA
chains in the Genus database with same CATH superfamily
4H7KA 1CUZA 5EXDA 1N25A 4GL4A 2H4YA 2LUOA 2PZMA 2ODNA 3ABOB 5IM5A 4EUKA 4IINA 4D0LB 2VOJA 1PL8A 1K63A 3DTYA 3D8NA 3KS9A 2VI5A 5GY7A 3SZ3A 1XPRA 2JH3A 3A4VA 4AROA 4YUZA 2VJDA 5FTJA 1VJDA 1P0QA 3PUJA 1E1CB 2IIVA 5B1YA 1GPAA 3CURA 3LHSA 1M6VB 2X5XA 3W3ZB 4KRXA 2YZNA 4OU4A 4RHEA 3WZMA 2I2AA 1B8OA 2QGFA 1ZGHA 4DFDA 2W37A 3DDUA 5DTMA 2UUPA 2G1UA 1CUWA 1N2GA 4YLGA 1UBUS 3LC7O 1W1IA 4AU1A 5ILQA 2P7IA 5IHXA 3T3OA 2XT0A 1VIAA 3O38A 1VL0A 3WB9A 3ZXSA 2B8WA 1OI2A 5TQJA 4PC6A 4S12A 1D4ZA 1C30A 5KTYA 4Y2HA 1ORVA 4KR3A 3E8SA 3UWDA 1EVQA 3AW8A 4P3PA 1SCAA 2GWHA 4OF4A 4UREA 4L9AA 3E9ZA 3Q8XB 3P2OA 3S40A 5JV5A 3MS7A 3H5RA 2F7SA 2JKVA 3KZVA 4S05A 2W2VA 4H7IA 5JYCA 1NNSA 2FR0A 2C4KA 4TT3D 2UXCB 2FUKA 2QUJA 2YZMA 3WGJA 1WMBA 3PITA 3WOVA 1XLTC 3GLFB 3OEEA 4E70A 3N86A 5IASA 1FFXB 4MIYA 2QAJA 3BIOA 1ZITA 4OK3A 2W58A 1SKQA 1TM1E 3T9AA 1E1RA 4JEIA 1MUUA 1FFEA 4L73A 4LV8B 4P4TA 2AD5A 3H8JA 3JVIA 3D81A 3BTUA 3TLAA 5CHEA 3WK5A 3DLIA 4O33A 2XRFA 3O03A 4G8BA 2FZVA 4K6KA 3NC1C 3TR5A 1ESMA 2AMJA 1JHRA 2Z98A 4GKAA 5CLGA 3T9DA 4RTLA 2P6PA 2Q3EA 2Y66A 3WGQA 4FWBA 1U94A 4PC2A 2XCTB 4C0XA 1QQAA 3NUZA 4G1FA 1DJMA 3FWNA 3DHNA 4RTOA 1KRXA 4DBZA 2I2XB 1UM9A 4MVYA 2DGDA 2H2DA 5IN5A 5L7WA 2ZSAA 1TCCA 1VL5A 4RNDB 3AK4A 3JTEA 4F4HA 2ZAOA 4C4YA 1J0EA 2VHEA 1BEEA 4HBGA 4INAA 2YXPX 4NS4A 2C83A 3GMSA 4O63O 5EJ6A 4XX0B 1F9AA 5AYVA 1C3XA 4F4CA 1VLHA 1Z0ZA 3AY3A 3IE0A 3CS3A 1E2FA 2GN8A 1RI1A 1U2GC 3OE1A 1UQUA 4X3PA 1ZINA 3ZHCA 4ZHSA 2DX7A 2PUBA 1GILA 5AVSA 1CQWA 2Q50A 2BFWA 3NH6A 1GP2A 3SGLA 2VSNA 4A5SA 1PNQA 2HDHA 3LXUX 4UPEA 1QK4A 3CKMA 1X3LA 3IVAA 3LDUA 4JU9A 4CDRA 3JQRA 2JKZA 4I55B 1GFIA 1RABA 2ZYDA 1XYGA 3MJ4A 3ODPA 1DO0A 4QQRA 5CVCA 4IEFB 4OD0A 3AIOA 3CMCO 4OQYA 1L7VC 3CTPA 4ZVSA 4NHOA 4DCTA 3BM5A 1NRXA 1C1YA 3LWNA 1ZD3A 2N42A 1T3LA 4Y9UA 2J6IA 1LBQA 4AICA 3LHIA 5IVHA 4FOPA 1DQRA 5EWLA 4JUIA 2HLDA 2PUHA 1ZN2A 3E1SA 1XO1A 4D96A 1YNSA 2CB9A 1KMIY 3AFOA 5FPSA 3JQBC 4LXYA 1V11A 4PRZA 2R8YA 1UAAA 1G291 2A6PA 2HMWA 3FTFA 5HG0A 3JARB 3QF4B 4RVHA 4YAFA 5K01A 1YFKA 3IQZA 3W34A 3SVZA 1QANA 1MF7A 1C3LA 3O93A 1N6IA 1KZ9A 4S24A 1ZZEA 3HJCA 1L8QA 2ZRQA 1BXZA 1KNQA 1QG0A 1IY8A 4L76A 4YK7A 5EE5B 5FWYB 4XD7A 1MT0A 4P98A 4YRKA 3G6KA 1FUQA 1DSSG 3HYLA 3P7MA 2A78A 4PG7A 5IAGA 1P2BA 2PX8A 2RGCA 3AHCA 3O1IC 4KN5A 4HVTA 4CEHB 1CUIA 3I58A 4EJFA 3SKVA 1ZD9A 2Z1DA 2NT3A 3PSAA 2ALJA 4O4LB 3LBAA 1G66A 3GLKA 2BGMA 9LDBA 4HC4A 3TR0A 3MJHA 5F1PA 2QZZA 4LA4A 4IRUB 1QAOA 2B2NA 2X2FA 3HZHA 4G9EA 4NY1A 1A7KA 4ZEOA 5BQ5A 3JD0A 3OIGA 4D3FA 3OY7A 1NBMA 4ER7A 3BF7A 1XZBA 2YJZA 3MT7A 3PBKA 3RYHA 4NCKA 4RIFA 5KI6A 5CB4A 4V1CB 2NU8A 3FW1A 1N0UA 1LS6A 1QR6A 4PQRA 4LWOA 5LU9A 1FFYA 1YDWA 1AB6A 2YJ6A 3PKZA 2OCYC 4BLSA 4YCNA 4ZYTA 4MUBA 4N7RA 4YLYA 5KOJB 3AGPA 4KR0A 4XFDA 1XMPA 2P4SA 1CYEA 3MGGA 5EGNA 4PX5A 5HF5A 3ROMA 4BLUA 4MR9A 1VB3A 5E8JA 1ZVJA 4K9QA 2A9RA 2I6GA 2JA1A 1SIOA 4B6QA 3FOAA 1XJQA 2FWPA 4KREA 1GFSA 4P7GA 1DGQA 1GQSA 2QLNA 3F4LA 4HAVA 3T0GA 1F0KA 1WP9A 2VJQA 3CX4A 3OFNA 3WQSB 4BX9A 3ZDEA 1V5FA 2YNMC 3PEEA 2B8NA 4ZCSA 4XIJA 3OX4A 3AVQA 2YIDA 1M34E 4FFWA 3H0CA 5B57C 5FT9A 3KKOA 3JASB 1GU0A 2Q5QA 4I5DA 4IL5A 2IOHA 3EW9A 4FE4A 1U1GA 4A8HA 1DKQA 2BI4A 1ORRA 3C6QA 4IILA 3RODA 4ZYVA 4UCWA 3AY0A 3H19A 3ACCA 4LYFA 2P2DA 3IXQA 5AUNB 4XYBA 4EWLA 2I6XA 4RORA 1KYZA 3L6EA 2BJVA 4D9HA 2XNDD 3HCOA 2XW6A 1SCUA 3CT4A 3K1AA 1GPKA 2CNWA 4D0RA 3FFWA 4LQDA 1EP3B 1Z2AA 3MGKA 3A3YA 2QXTA 2J33A 2P6OA 2Q0QA 3NFRA 3A9SA 3H42B 3TSAA 4DLXA 3GJYA 2MIIA 5JPCA 2D7DA 1Z7YA 3F4TA 4I4NA 4C04A 4C0WA 2P2LA 3KT8A 4GFDA 1JEOA 2O20A 1GQYA 4PGMA 3OLXA 3FUTA 2GEUA 4DR6B 2P77A 2V8BA 4CCSA 3Q10A 2JFYA 3GLGE 1FYEA 3WK6A 4BASA 4IJQA 1ES9A 1SQSA 5AVYA 1EFRD 3VU8A 1E4EA 3IESA 1QV7A 4CETA 1UINA 2R5WA 4L51A 3U7RA 4BZXA 4DJDC 1KOFA 1KP3A 1YBAA 1OFUA 5JFGA 1NSTA 1TT5A 3M1IA 3QEAZ 3D6VA 3SSMA 5BN3B 1XZDA 4B1FA 1TZBA 2AG5A 3ZWMA 4AYTA 3QVGA 3WGZA 5KCZA 3FNIA 1N0HA 2QJRA 1Z47A 3DKRA 3KZKA 5TPZD 4YAEA 4B35A 5F21A 3HC7A 4DCSA 4R1OA 4A8JA 3ZHQA 3FPFA 1EVJA 2E1PA 2WWTA 4MW7A 1EI9A 3K15A 1FLVA 1MV5A 2YNMD 2ZRHA 4BCDA 1NJSA 1DBSA 1GKUB 3KQWA 3RVLA 3SVTA 3K70B 5A7HA 3CGWA 1PHPA 1PLLA 2I2CA 2JGFA 1A77A 2P5UA 1NP6A 4LFAB 1XTSA 4UVGA 4A7PA 4BNHA 1QGYA 1U1FA 3I4FA 4ZOAA 3P9KA 1NYLA 1T8YA 4H6XA 1XJ5A 2YHSA 2DWQA 3QBEA 2EZUA 2QBYB 4MA0A 1GZVA 2AJLI 3PC4A 4UU1A 5CW2A 4LQCA 2GAOA 3C5VA 2NV2B 4OSEA 3R9IA 3V4PB 3X1ZA 1DHTA 2GUWA 3SHFA 1WSAA 2HYDA 3VC7A 3UAZA 4DM4A 4F3NA 1KO8A 1QH1A 3BREA 4NABA 4JJKA 5LMNB 1ICIA 1L8XA 3NBUA 3OQOA 1G3MA 4IHQA 4UUMA 3MWKA 5AM2A 1PJRA 4H59A 3RFVA 4BMDA 1ZIYA 4Q1BA 2CEKA 5EXSA 1E8DA 1AX9A 5D86A 1OJ7A 2WUFA 4IW3B 4QUBA 1B6RA 2Y76A 3HFSA 4G5YA 4HQ6A 3HDVA 2BW0A 4P3OA 1P1BA 2O07A 3GEPA 1NQAO 3GLUA 4Y8VA 5C5EA 4HPJB 3WWZA 2PH5A 1U28A 3KD3A 2QVZX 3FDZB 3NIWA 1IW7D 4OHKA 5BW8A 4X1OA 3TGWA 5C8YF 3IKTA 1FTWA 3NXKA 4KFSA 3DBLB 4DLBA 2R6FA 2I2WA 4DLSA 2P9QA 5AVZA 4PPFA 1YS1X 4N18A 4O0LA 4IIUA 1RQNA 4GQBA 2WHRA 2W7TA 3NWOA 3K31A 4WKPA 4Y98A 2I9PA 4GRIA 4AECA 3M2PA 4NBTA 1HLPA 2E82A 5DEIA 3U0BA 2JL1A 4YVFA 5L3ZA 3DMGA 4MVJM 5EZYB 3EEIA 1TUBA 1CY2A 2CVPA 3MT8A 2H5JA 1N92A 4KWCA 2GZ1A 4PLGA 1ENOA 4UEOA 2QTVA 3CX8A 1MO3A 3P0EA 4CTKA 2MTBA 4CV1A 1YJ8A 4E5NA 2VQEB 3UJDA 5U4QA 1R64A 3HRHA 1NMZA 4V3CA 4DWWA 3T7EA 3M3DA 3W5UA 1JFRA 1AOXA 1JW9B 4Q39A 2AUMA 1X0XA 3MLBA 2DY0A 1FUKA 3EWSA 4ZOLB 3WLEA 3PWZA 3V3TA 1K7XB 2ON6A 4MVJI 4RANA 3W5VA 5IBQA 1ZEMA 2QA5A 4Y1EA 1LK0A 3SAJA 3WHLA 1HQDA 3D6MA 2GJAA 1RCFA 4NK5A 2GVDC 4GSLA 3UVEA 4Q15A 1CR4A 1OFIA 4KE7A 3W5IA 2D1YA 5KX5A 1MRZA 2WP8J 1BGVA 4CUZA 1L0BA 1OXBB 2CGEA 5AKXA 5JAOA 1SGWA 4XVCA 2BYTA 4CGZA 1QRAA 1YU6A 1MX9A 1DFHA 4IXDA 4C20A 3MD0A 5FL7D 4F72A 4HQLA 4R98A 4O25A 3TYXA 4ZZ2A 1MOPA 1Y3BE 4ZALA 4KFTA 5KREA 3EIQA 1K9VF 4M76B 1USIA 5HKKA 3I9MA 4OHOA 1XTRA 4HGOA 3C3DA 4QXOA 4ND8A 1JTFA 3GLFA 3EEFA 1M73E 2IZ5A 1KARA 3PYLA 2IYZA 3ZV3A 1MKYA 3L8ZA 4MWOA 2Y1DA 1VHJA 2FMKA 2VJCA 5JVDB 2AXQA 1CK4A 2UVPA 5DXJA 3EN0A 3WKDA 1ZN9A 3A58B 1DCKA 3GA7A 2FW6A 2DH5A 2X4IA 4MAFA 5DHPA 4G0ZA 3ZLJA 4DMMA 3KE8A 1VG8A 4K86A 4QKQA 4JCCA 3WRWA 1U3VA 2YWBA 2MYTA 4TYWA 2E49A 4MV1A 1U0GA 4PQEA 3HCFA 6ADHA 3QBDA 4MV5A 3ZCPA 1OXSC 2IUYA 3V55A 1FYWA 2ZGVA 2XCOA 3HO6A 4OJQA 5E0OA 2BP7B 3VV3A 4IZHA 1Z8DA 2IEDA 1UADA 1DIAA 2CUNA 3OIUA 2ZJOA 3TIXB 2CCJA 2V9ZA 4B45A 5TQ0B 2F48A 1CZHA 4NMMA 1C0PA 5IF3A 4NLEA 1YQGA 2CNDA 2DPLA 3N5KA 4YC7A 2P35A 1ADCA 1KGDA 2HMYB 1CNEA 2WA1A 4LYHA 4P6VF 3TIIA 1QPZA 2WJPA 4Q9IA 2IUSA 4LY6A 1C3UA 2Y4OA 1K89A 1TCVA 5HIAA 5L51A 3LZ6A 5E9QA 4MCHA 4O6VA 2ACVA 2I1QA 3TTYA 4F5WA 3DLBA 3HHEA 2GK6A 3ESQA 2AFHE 3EQ8A 4I1YA 4NDZA 1FQOA 5EEGA 3TOZA 4MS1B 2ZK7A 1OV6A 2XV1A 3NB0A 4U1RA 2YW9A 5IRCD 1KFBB 4YIKA 3D0QA 1RQLA 1NX6A 3PICA 3QIAA 4RQUA 4AN0A 4I5FA 2X0RA 3IDZA 3FVRA 3PI7A 3QE0A 3ORRA 1ATZA 2WAOA 1M5UA 2AC4A 2FF7A 4JQSA 2EVWX 2ONJA 1JU4A 4OQFA 2DLNA 2I6SA 2PLNA 3A3PA 2ZYUX 2EWWA 5L95A 2C2MA 3Q7RA 4EJSC 1DEAA 1RKVA 3GRUA 3HCEA 1MG0A 4IXMA 2JFXA 5IAKA 5IDQA 3WK9A 1IB0A 7ADHA 4PQYA 2ODPA 2BZGA 1K6IA 3CPEA 3LDHA 4INZA 1NVAA 4CEIA 1N33B 2KSQA 3OG9A 1PW7A 1LBIA 2BFPA 2H4FA 3OPYB 1WCXA 3S2ZA 3UWOA 1Z6ZA 2AFVA 3JARA 2BBOA 5J5CA 2C1EA 3S99A 4OA8A 1JU9A 3RS2A 1U7PA 2M9MA 3KTAA 1PGOA 3KYDA 5G1OA 3QSYA 1Y37A 4RGBA 1Q0ZA 4S35A 2BE7A 4B32A 1CJMA 4BAZA 5NULA 2R65A 1F8UA 2YN2A 3E3MA 4GWGA 4CM4B 3HGMA 2D5LA 1PGPA 1V96A 2WNSA 3FUCA 3L0PA 2WUGA 4PU0A 3ZH2A 2R1VB 3SFTA 4QZVA 3JQFA 1E1DA 3B7PA 1P29A 1U0JA 3DE6X 3I9V6 4XCQA 3R7LA 3MCTA 2V7EA 2VSXA 2ERCA 4AX8A 3B1ZA 2IH5A 3HL0A 2OD9A 3ZHSA 3O6VA 5DXFA 3N75A 4ACAA 4AYWA 2P5SA 2YTZA 5E38A 5DDIP 4HH4A 1EXWA 1L5FA 1SXJE 3B6EA 4Q4JB 5TEWA 4R1LA 3BSYA 2R85A 1H66A 1NVXQ 2G9ZA 2IHZA 2NO4A 4Z9AA 3KCQA 4CF4A 1L4LA 1YS6A 1H4TA 3GJRA 4OAPA 4S0XA 4WCVA 5A71A 2NAFA 1SQ6A 3WGIA 3HK2A 1IN1A 5A9SB 1KZ6A 2OHOA 4JU8A 4EFLA 4ZYYA 1MH9A 4Z4FA 3WBFA 2RC6A 3T1VA 2QTCA 1ANKA 4LHWA 3LWBA 3O4FA 4RY0A 1XVUA 1H4VB 2GBGA 5IAEA 1Z7GA 1K06A 2XBMA 1Z0AA 3G2HA 3ME5A 3TFOA 4DR3B 5I7WA 4OBBA 4OUDA 2NVUA 3SN6A 1H65A 2P9EA 5TVKA 2GN9A 1XRMA 5FWNA 1UPTA 4HT3B 2VP9A 4LBYA 4OQLA 1V1MA 3FZQA 5LDDC 2LTAA 3N2KA 4MV0A 3VDQA 1PL6A 3C3XA 2OLJA 4I4TB 3WWCA 3DP7A 4UM7A 4TZKA 3P19A 3IEMA 2D5CA 2OXTA 5A7GA 2FGJA 2VF7A 5F23A 3SLKA 3EGWA 4UOZA 1A5BB 2OUIA 3OZWA 3PIRA 4UKDA 1RP7A 1U0RA 4ACBA 3NKFA 4J3NA 4C9BA 2O3SA 2MWMA 4IWYA 3ZGNA 4JZYA 4KQ6A 1CUHA 1P17A 3ZWBA 5LDHA 2J9ZB 4JR2A 5EXPA 5HILA 4D02A 5A5GA 5KQGA 5KHAA 1Z4KA 1AN0A 1PJBA 1EX7A 2FTKE 2G72A 1TO2E 2CVZA 2JW5A 2Y4NA 4KUEA 4TTQA 2OPBA 4K9DA 2IUUA 4B74A 5BVHA 5KWEA 4AZSA 3FVTA 3OKCA 5D3MA 4TLDA 2VRWA 1XHFA 4P5EA 3CSSA 5JH7A 3RVBA 1KFJB 1IZ0A 3AUAA 2V1XA 1RM4A 3AM4A 2XCLA 2ZIUB 1K7WA 3MZ0A 4XSGA 1JTEA 3RAPR 1DOAA 1CR6A 5FTMA 2UU9B 3OFJA 3LLMA 4F4DA 1ZK0A 1UKBA 4JK3A 4IKEA 3KL4A 2P2SA 1FNMA 2GA9A 1GWNA 1O94A 3ONDA 4URXR 4N0EA 3RRPA 3S8YA 4OYLA 5EIHA 4K6FA 1I94B 4J07A 1JVNA 2BOVA 2EATA 4ESHA 3M6UA 2ZQZA 5SYNA 4YP5A 4E51A 1M0EA 4L7QA 2IPAB 5FWAA 1CQXA 3W9BA 5HJEA 5AM3A 1T4CB 2BV3A 3AESA 3D2CA 3DBVO 2FW0A 3KT3A 4BVJA 3HMKA 4R1UA 3KPJA 4RU1A 2VK4A 4PPQA 3NDIA 2H2HA 2OO3A 4GE0A 1Z37A 4PLZA 3ZGVA 4ANFA 3DO8A 3LLSA 4RAQA 5BN3A 3FROA 4O3MA 1Q0QA 4WZBB 2OESA 3DC2A 5DXAA 4C5BA 2PLWA 3ONNA 2ODTX 1R0SA 4UUOA 2BFBB 3IDQA 3G9UA 4N6OA 4WN9B 1XFAA 4ILEA 4PIVA 2QL5A 3V4RA 3NBXX 5I8WA 4A0QA 1FY2A 3W8RA 2G1AA 1N9KA 1E7YA 1ZN7A 2RCYA 4Q1VA 1ZJ6A 4LGVA 3SS7X 2WLSA 2ZB4A 4DVJA 4YJ3B 9ATCA 3KQYA 1QWSA 2PPVA 1HG1A 1I32A 1V5IA 2VFAA 2X9VA 5A06A 5GTDA 2QL7A 2QTHA 4U2GA 4RULA 4MWZA 2QBYA 3F5QA 4UU8A 3H8SA 2I4MA 1CIPA 3B2QA 4M60A 4OQEA 1N1GA 3K1TA 2G4LA 1P81A 4GMDA 1XNRB 1WF3A 3H2BA 3OJOA 4KK4A 2QUAA 1OYOA 3DFUA 3O3CA 5KC9A 2CE2X 4MI1A 2JRLA 1TGVA 4KMMA 4O4JB 5C31A 2Z5GA 2AN9A 2QRGA 5K0TA 2EQ5A 5TSDA 1XCPA 5HKLA 2VJMA 2FPMA 5HIJA 3PKIA 5KYKA 2XUHA 3LPNA 5KNDA 4FLEA 1E1NA 2X0IA 5F33A 3VH1A 1E9FA 1V4BA 1A9PA 1ZO8A 5LUAA 3BXFA 2OQ2A 3ELUA 5HE8A 1RBYA 2F1IA 2AG1A 1ULTA 3PV0A 2W6IA 3S1AA 2Z8XA 1F6BA 1PIWA 1XRLA 1I2ZA 3DBLA 3EUEA 1JHPA 2EF0A 3KLBA 4IZIA 1QYRA 1YB2A 3HDTA 4KAJA 1GTG1 1UWLA 5FJIA 3GVXA 3L77A 5D01A 4DLLA 2PUWA 3EZYA 1E79A 3DAOA 4K9NA 2AUNA 4L0CA 1XVVA 1I7PA 2C61A 2HMTA 3U9LA 3Q3CA 5LOVF 1U9ZA 2A7XA 4WIAA 1FFAA 2E18A 3TMYA 1KJJA 2IEYA 4JIGA 1G6Q1 2P8SA 4PLWA 3W79A 3HUTA 3EA5A 4PHTA 1UPFA 3ES9A 1KBQA 2ROQA 4XR9A 5TT0A 4GP7A 4N47A 4WJLA 2F8TA 4QXMA 4F9TA 3IQXA 1KDYA 3C3PA 1SAYA 2R6HA 3O0DA 3V8BA 1TEZA 2VDRB 4HNUA 3AC0A 3NDBB 5JAIA 2UUBB 3CEJA 5KDDA 2MDTA 1QQ6A 1FP2A 2JFOA 2ZWMA 4ZOLA 4HEJA 1FP6A 4BWVA 2OYSA 4Q05A 3O31A 4YA6A 4BOYA 1GNSA 3VR0A 2RJNA 4OFBA 5FBLB 1FFGA 2J3MA 1GG5A 1K2VN 3IUSA 1EM8A 3BFJA 4GX1A 3EPRA 6REQB 4PIPA 2HLNA 3RVKA 3BB3A 1NU6A 4RZQA 2AEMA 5C34B 1N2CE 2GNPA 1VG9B 3KZ1E 1S1MA 3ET4A 4PONA 3UJBA 4DARA 4DBLE 3T5PA 1KYWA 5JRZA 1OROA 2AQIA 4B31A 1YHZA 4Q1AA 1VM6A 3A6HA 1LDNA 2CDBA 3DB1A 3OT4A 5DBGA 1NIJA 1I33A 2P79A 5LA6F 2R6JA 5SZHB 2WJJA 1U0TA 4FYVA 4BBAA 2HR1A 1QCYA 1EDDA 2C77A 5GJVC 3LHFA 3OZXA 3TIVA 5B12A 4JT2A 1XKTA 1Q7RA 1Q14A 3DTVB 4JOSA 3THXA 2CL0X 3HKEA 3WLOA 3SI7A 3B2EA 2CVFA 1PX0A 1ZUD1 5CG1A 1OPRA 2O8VA 5KYVA 3ZV7A 4E88A 2ZRDA 4AQDA 5K0JA 3MJSA 2X8BA 3TRHA 2FSUA 1N9ZA 2ENUA 3WGVA 1J99A 1V8BA 4B09A 5E7MA 2PAFA 3LGSA 2Y0PA 3RVRA 5KQLA 4OPMA 1O8BA 3CX7A 1SXQA 1EQUA 4ZGGA 4QLAA 3WR5A 3UBMA 1QX3A 4KQGA 3LBYA 1KQFA 3F8WA 1FS4A 1HBJA 1T3GA 2B25A 3BDIA 3I6IA 3KJQA 3P94A 5DHAA 1E2LA 2PIAA 5DU2A 4K26A 2CJPA 4BWFB 3GJ4A 3W2HA 2ZPTX 3IPRA 3R3HA 4DCVA 2AQKA 1YMUA 3SEZA 4OQZA 5AXDA 1KEEB 4GZMA 1TVEA 2OK8A 4XDYA 4WINA 3WLFA 5AUOB 4ZCRA 2ARKA 2O7NA 4ICIA 1YL7A 4H7DA 5GVSA 1BYIA 5BT8A 2GYVA 1MAHA 1MG5A 5CT6A 2NIPA 3VR6H 3PVZA 2XGMA 3QI7A 4I4IA 4MW1A 4PCAA 4KXLA 4JI1B 1EVZA 4ZVQA 2D27A 3CISA 2HIAA 5DHUA 3RSOA 4DLTA 5JYDA 3R7WB 1HE1C 4Z1MD 3NTOA 3TTVA 4OXIA 1T2CA 1T5IA 1ZKMA 2BZ0A 4YFYA 1CJCA 5EPUA 1N1DA 3Q12A 4JD5A 4B44A 3STYA 1NDQA 1UOOA 1CDDA 4YAUA 3O8RA 2DUNA 3BWBA 3GYBA 2GETA 3QWFA 2ID4A 1QE0A 2BTOA 3BB1A 5JEEA 3DAHA 3N58A 3ANLA 4ZYWA 5EPOA 3KG2A 4N76A 5G0TA 3VO8A 1DFGA 2H3HA 3EXHC 3F67A 3OX3A 3V1MA 4U02A 3EA4A 5FULA 1YACA 3RRXA 1GL3A 1AKWA 4RKFA 3U2QA 3WSVA 4AN4A 1VIVA 2BEVA 1JAYA 2C2BA 2OZLA 3FNHA 1MABB 1LPSA 2B61A 3R6QA 1NOJA 3FDXA 3PE6A 2O2XA 5IN4A 1SKMA 3TW6A 2HFKA 3LBNA 5BUCA 4DDTA 3TM5A 4DQXA 1XJ0A 3H17A 4MLDA 1EK2A 1S2DA 2ZRBA 1H2WA 4RHUA 2ZDHA 1T9DA 4QGSA 1QSGA 3C3MA 4PYIA 4QNRA 2GHIA 3ZKAA 2WSYB 4DV2B 1UXGA 1QUFA 1RCTE 2IY8A 1E1YA 4LJ8A 1OTYA 2I55A 4XW2A 3U7QA 1Y4ZA 4CMGA 1G5IA 3PPVA 3M6LA 3ACDA 2PWZA 2F55A 3IAS6 5CLHA 5F1OA 3WNQA 5JRDS 3VKHA 4LS3A 4CM4A 3C6MA 4NBRA 3VSDA 5ECGC 4HXFB 5K0EA 2R1VA 4N4AA 2CDRA 4A82A 2RHWA 1EG7A 3SNHA 2DULA 1K5GA 1XXHE 2CHQA 4TM8A 1H05A 1H6CA 2J3HA 2JZNA 1G5HA 5DULA 1FYVA 3ZZ1A 3JD2A 5FLKA 1IEQA 2K4MA 4KR6A 4RS3A 2YJNA 4LJSA 1VL6A 1UT8A 4WH0A 3HP4A 4PSDA 3OT1B 4LN1A 2QUIA 4S1NA 4UUBA 4K2AA 3YASA 1I6WA 3L8EA 3QF7A 4OGFA 5EKDA 1QZZA 5CCXA 4X54A 3MOGA 4AM8A 4A1FA 1ZIXA 4DILA 1YS7A 1T3TA 2PZGA 3EGCA 3R2JA 1N2SA 3MQFA 1Q92A 2FPUA 3U3ZA 2RHBA 1T8SA 4MQ5A 3BMQA 3JQGB 3PL5A 5JZSA 2G83A 4J0HA 3T7JA 2B7CA 2B3DA 2W90A 5BRAA 1NUPA 5EMNA 1DIBA 2OCLA 4LTMA 4WXPA 1MDBA 3KQVA 4B4OA 2B5OA 3RTEA 3ZE0B 1MC1A 1C0EA 4LBWA 4HF7A 5FP0A 1XTUA 4JLOA 4MLZA 3U1BA 1N5KA 2XNSA 3OBIA 4D9IA 4KYTA 3T5CA 5FPQA 5LDGA 1JEQB 2ZYIA 3EGIA 4LYYA 4MUXA 1FU7A 1L4HA 4Z9YA 3UAXA 3VR6A 4RDHA 5AJYA 5DX1A 4CM9D 4OEHA 1GQQA 1RBZA 3TW4A 5G0UA 2H9IA 4YMHA 2G67A 3T9EA 3IEKA 3AVXA 2GF2A 4PG6A 3CVXA 2W42A 1QC5B 4A8JC 3PC8A 3EPJA 1Y5MA 2VHJA 3HO8A 4O2BF 1SIWA 2FUG6 3AI2A 5H8WA 2QTMA 2IQ5A 2ZB8A 1GKYA 3R5HA 3G8DA 2YYYA 1QRUA 3LBFA 5LJIA 2WV7A 3R0JA 2ECPA 2YWFA 1T0HB 3PUHA 1Y7HA 4YJ2F 3VHRA 1OAAA 2VXYA 2OFFA 5BMVB 3MXTA 5AK3A 1RRGA 5EAIA 1G5QA 1K8YB 1ZRNA 2CXSA 2IL1A 4JVNA 1YQ9A 2Z58A 2IYQA 4PYKA 5LNK1 1LLQA 2HCJB 2Q4EA 4BGIA 1G60A 2FW1A 5IKPA 4HYTA 3PNYA 3UHAA 3RSLA 3FETA 4HXGA 1QDEA 1WEHA 1YQUA 4QUKA 3W4KA 3ZDYB 5U9CA 2P0YA 3HR8A 4NE2A 1H1TA 4OV6B 1AQ6A 3DR3A 1HDIA 2KI5A 2QZ4A 2WVAA 1YUNA 3QNWA 4U7HA 3W2EA 4GU5A 3RHZA 4K6MA 2XZDA 4OFZA 1VIYA 4AJKA 4CMJA 3E2MA 1MQSA 4YCCA 1COWD 2PV0A 3GRFA 2Z43A 3OQBA 4ZFNA 1JXAA 2IP2A 3ZLVA 4EA9A 2ZRPA 2X2OA 1RE5A 2ZXFA 3L6BA 4QLOA 1E0SA 1U28C 4TMXA 4C4XA 1XWIA 3U4GA 4KW7A 4UMDA 1JHXA 3O7MA 2RHLA 3DCNA 1EB9A 1JR3D 4JR1A 3V7YA 2C7BA 2WHPA 2HJWA 2DQZA 1T2AA 3ZU3A 4BVLA 4WZBA 1P5FA 3EVTA 3ZQ6A 3JQ9A 3OURA 4NQRA 4P7BA 4C4OA 5KTKA 2VYVD 2OG2A 4TTTS 5I7EA 1JDJA 4U6SA 4UHCA 1L2TA 3T3MB 3TAHA 3R23A 4MWGA 2Q8NA 5EL0A 5H4HA 1FRNA 4Z0PA 3BD6A 3VPBA 1EDBA 1Z5UA 1YUBA 2ZZNA 1XNJA 2X76A 4YJ3A 5IZ4A 1EXVA 2QAGC 1NTRA 1ZYUA 3LPDA 3TZ6A 1V16B 3A70A 3F74A 4IQJM 1OZAA 3VMFA 1V9SA 2D2IA 4CKCB 4KNYA 1J8YF 2P6UA 1TYEB 4HDSA 3EXFA 4YJDA 4Z9XA 1RWMA 3K2BA 4C22A 3DE2X 4P4NA 1KF0A 5G3ZA 1QH0A 1VPLA 2OBNA 2G5CA 1GDDA 2DERA 5HOEA 1ZD1A 4M9QA 2ZG6A 4H60A 3FPHA 4JP1A 2NSDA 2A33A 5H3HA 1ZH0A 3OJCA 3PUKA 3WNZA 4CFZA 1JDPA 1HURA 1VRWA 3AR8A 3PNSA 4AMGA 3QA3E 5LMZA 4E31A 3GAZA 3D5TA 1JZSA 1PZFA 2ZYSA 3K9GA 1B8PA 2KX7A 1NXSA 4HEA6 5IVDA 4PCLA 2PA3A 1T9BA 5EPEA 3CF2A 1R9JA 1ZBDA 4AP9A 1NHWA 5FWDA 4R0VA 5BSMA 2J3DA 4CMCA 3N59A 3U16A 1IBSA 3NVDA 4REQB 3GP3A 2E55A 3L8GA 4G0XA 4LNAA 3WWOA 2NACA 4MYSA 4MQBA 1Z25A 3WRXA 2OUKA 3EHDA 2J9GA 4GOXA 4BBJA 1IHPA 1ZAKA 3GJ8A 4R31A 1CFJA 3A6FA 2WKRA 4CMIB 1N2XA 1VLJA 1SUIA 1ABEA 1UPBA 3D9QX 5AW3A 2JF0A 1YMQA 1UQRA 4EJMA 5A0FA 1FUYB 3QM1A 5CVTA 1YJBA 4AKIA 2VP4A 3A10A 1Q0RA 2DPMA 4W4TA 4YS6A 5TS3A 4BB6A 2PD4A 4ND6A 4EFKA 3FKJA 3N7TA 4V0RA 1OB5A 2VBCA 3ZZ0A 4NK4A 1A4RA 1RI3A 1NVVQ 1AG9A 2WYWA 2YUTA 2CMHA 1C0IA 3IJ5A 2XUGA 3IUBA 4MR8B 2JA2A 2JFGA 4OBEA 4B2YA 1H9CA 3WYAA 2LDXA 1JIVA 5TGTA 3URMA 3ZPXA 1XEFA 3SP1A 1NVMB 2D7CA 5CLJA 1IVNA 1FMCA 3DFIA 1QOQB 1E1QA 2JAXA 3E2PA 4PBTA 3KJEA 3HLKA 4Y18A 3K0SA 6YASA 2R8PA 3PXGA 2NZXA 1G19A 1J06A 1RZ3A 3GCGA 2A9JA 4PZZA 2OP0A 2CCKA 3QP9A 2EXXA 4JI8B 3COPA 3LQYA 3OO0A 4O8ZA 2QRNA 1N6RA 3ND7A 1QLHA 2V55B 1XKLA 2DR0A 4EMUA 1II9A 1E9BA 1SU7A 1F5SA 2FZEA 3LF2A 4RSGA 1VE9A 1NUAA 1IXZA 3K30A 6REQA 3FWKA 3HDHA 3L2OB 4OOEA 4XCXA 4BGDA 5IKMA 3LU1A 4JVOA 1WV0A 1N2HA 8ATCA 2CYBA 2DBQA 3JQ8B 3LPLA 3OP4A 1RFGE 1KEVA 4NMWA 1ZC3A 1YFMA 1IMJA 4PRKA 2G0TA 4MVJH 1T8PA 4H31A 3V97A 1HNWB 4R0NA 1E2QA 2R8ZA 4RLQA 1XRSB 4MJXA 4M46A 5FO0A 4UVIA 1G7TA 3KQMA 3LE8A 1VA5A 2UYQA 5BNIA 5HRAA 2RHOA 2R7NA 4DF3A 4LGYA 2NADA 2VP2A 1ULAA 3L7IA 4JYZA 4QTTB 2IZOA 2P6RA 4M8KA 2Z6UA 3ZY2A 3GPLA 1MNAA 5HKKD 4M22A 5EG5A 5IARA 1X80A 4A23A 3TWOA 1QBGA 2IPXA 1ESDA 2AF4C 4KX5A 4XOIA 3TPZA 2Q0SA 1ISSA 2WEKA 4O02B 2J5XA 4J1NA 2HDNB 3EXG1 5KYXA 1UK7A 3BHIA 1YQTA 3PHLA 1JYSA 4LHZA 5CNMA 3ZCXA 1AK9A 4E5PA 3S1SA 4D5GA 3ESCA 4FSXA 4YHBA 2C97A 5YASA 5I9BA 3I76A 4PO8A 4H0CA 2QMQA 4X62B 2X41A 4YMLA 4Y1RA 1E5XA 3H6HA 3A1NA 3SR0A 3PFWO 2PGNA 4CV3A 2PGIA 2VXOA 5LKRA 2QXUA 3IC5A 4PPNA 5KZMB 4NXMB 5LU8A 5DSTA 2OO5A 5DYGA 2G5TA 1I24A 5DCUA 1ZH6A 2N1BA 3DZFA 4KSCA 5KNCH 2A59A 3RSFA 4OL9A 2CY0A 3PWSA 4PX9A 3ROGA 3VNVA 4LJ6A 1SU8A 1X1BA 4LVCA 3TZQA 1G5TA 4DM3A 1AD2A 4DA4A 1Q7TA 3CGGA 2R4UA 4F2DA 4MYRA 4OYYA 4R1NA 1T5DX 1Y6GA 4JQCA 2KLHA 5AW9A 1D1TA 4PNZA 3IEPA 2YKGA 4FYHA 3AV0B 4AWXA 2QVLA 2MJLA 3E0XA 3QVWA 2OCAA 5KYWB 4QO8A 2N75A 1X7DA 1BVUA 1UBRS 2IBSA 1YVUA 2PZ8A 3I34X 1ZNWA 3H9UA 2GAJA 1QHSA 3EDOA 3C48A 2XMPA 2OKGA 5K45A 1T6BY 4M1WA 2QMOA 1TD9A 2VLIA 1IHDA 2IE8A 3D0RA 4MDEA 1WMEA 4RD6A 3U4MA 3DOOA 1E6KA 2AMVA 5EKTA 3ZZNA 3RRFA 4IJVA 3RSGA 3NRJA 5KUTA 4BNIA 3E7XA 2FG7C 5TJ9A 1MABA 4UASA 4ENPA 3PFHA 4YUAA 4E1BA 3EQZA 2V97A 4Z5XA 1AKVA 1VZ3A 2ONKA 2HJRA 4OB8A 3L4JA 2J5RA 1Z6GA 5T8KA 1XVAA 4DEXA 3C5HA 5BQXA 3E7DA 3LXRA 4ZEWA 2FSIA 3NCHA 5K0ZA 3QLUA 3SX2A 5LZ2A 2H2WA 1TYZA 4L57A 4UFNA 4XAQA 3GJ0A 4YX9A 3Q87B 2C84A 5IX8A 1YRHA 3ZK7A 1ISMA 3PFFA 1MU0A 4QPPA 1EAYA 1NBEA 3ZX4A 1H2XA 4M0FA 4E11A 3HN2A 4FMCB 5CXQA 2HTEA 3CRRA 1OW3B 1ODTC 1OGJA 1A7JA 4MVJA 5K2OA 1WUHS 4KVGA 4BCBA 5LD2C 2OV8A 3AEUB 5CVEA 4DIBA 4QXRA 1WZNA 2NVOA 3KBBA 2HXGA 2WE7A 3PA6A 5DNDA 2YJ3A 1YTUA 1G2PA 2RGWA 1VE7A 1OKKA 1WB6A 1JJVA 1LFAA 2OE2A 2ZYRA 1U4SA 3LO8A 2AS0A 3A04A 4W63A 5G02A 4BVEA 1P5ZB 4Y2VA 4US2R 4J7UA 3TW8B 3GV0A 1YJXA 4R8SA 5ULLA 1VG0B 2QX9A 2HSDA 4HN9A 4V0KA 5L7TA 3OICA 3TKLA 3ISTA 2IT1A 1LPAB 1NXWA 2AE2A 3NO4A 4G07A 4MA5A 5FYQA 3UAYA 5KU1A 2EW8A 2QN7A 3I5UA 4M6WA 1U1EA 2QTBA 5KINB 4IDGA 1LDYA 4I9FA 4MX2A 3AVPA 3NX4A 3CW8X 3IXMA 3EARA 1Z06A 2OAP1 5CXSA 1CB0A 1IAQA 4QYMA 1B4DA 1M6NA 3FOBA 3QMVA 3F4RA 4HGPA 1Y5NA 1XYYA 4L15A 5M34A 2ZU6A 1UBHS 1WW2A 1MENA 1EAMA 3C4JA 4S1TA 2XWQA 1Q12A 4G63A 2BEUA 3UN1A 4IM7A 3JPYA 3OJXA 5FR1A 3TDNA 1R6XA 1UJ5A 2M6SA 2ZKIA 1F2TB 1UPUA 2WT4A 5GGXA 3IOBA 1Y1SA 1YIAA 2YVUA 1E18A 5BR7A 4N3NA 1HYBA 1ZR4A 3U1VA 1U16A 3VOBA 1GFWA 1ZESA 2Z3WA 3GZJA 1POWA 3QKRB 4U5XA 2PXCA 5CM2Z 4DIDA 5KNCA 1IHXA 5E1OA 2WWYA 2B82A 1RWPA 3D3WA 1CZRA 2AB0A 3ABSB 1RYYA 3HLYA 4NYIQ 3C7CB 4XPZA 2NXNA 2B1GA 4V39A 3WLAA 4DA0A 3BRWD 2ID8A 3B1WA 3V8PA 3LVQE 1F0PA 1GGEA 1KZYC 1T0JB 1VGQA 1RS0A 3EFOB 1EXDA 2G28A 3H9CA 4KV9A 1IDN1 4B9EA 1UFQA 1I0LA 1TU4A 3FNBA 4DV4B 4FM9A 1IWBB 3IUJA 1P75A 4ZCMA 2GNOA 1KMHA 3AZOA 5G4LA 2O0KA 2P9ZA 3UTCA 1KJZA 5A3VA 4X60A 4ATNA 4Q37A 1HXHA 4ZI5A 3EPLA 3CU5A 3BC1A 1XV5A 1P7WA 2C9ZA 3RU2A 1KVQA 1FFWA 1IIBA 2R97A 3B20A 2IDMA 3CRZA 3NRCA 2VZLA 1TPZA 7YASA 2QB5A 2WIGA 3IALA 2QTAA 4NYMQ 1XWFA 2FW7A 2LCIA 3A9TA 3NS7A 3ADBA 2FZGA 1AGNA 1IM2A 1K6JA 1ZCAA 2BM9A 1PR1A 3ZQKA 3F98A 4QBKA 2FR8C 3WNDA 3I6BA 5I7AA 4I66A 2SKDA 2ZI9A 2WYOA 1IN4A 1XB2A 3T3EA 3TKYA 1U8AA 3AEKB 1TMYA 2DSNA 4P0QB 4AQ7A 4YMSA 2W6ZA 3HB4X 3I83A 3DMPA 1DQZA 4I5GA 2XDAA 5C8DA 1PT7A 4C7OB 2JJYA 4DIUA 1X2EA 2I3AA 3UWMA 4OQNA 1W5BA 4D45A 2XUFA 2O8BB 3RVQA 1DRJA 1G5PA 1DX9A 2R5NA 2XYRA 1WTAA 4NIMA 1QIFA 2GTPA 1FSGA 5EUMA 2ZI4A 3RBZA 7AT1A 4NMHA 1D8TA 3H5OA 2HGZA 2W4IA 2PYDA 3RASA 1BOOA 1TKAA 3HSKA 1LW6E 4QUIA 1TNDA 2UYYA 4X1YB 3A2KA 3IQWA 5F51A 3USES 2D8AA 4KUHA 4IDFA 2JFUA 1PZNA 2D2EA 2CJYA 3B6ZA 1OIVA 2W22A 3QXSA 3WRVA 4FGWA 4TKUA 3HDGA 4RDXA 2C2ZA 1M34B 5AI0A 5H3LA 1N2BA 2O2YA 1SUFA 4RGYA 1X7WB 2FPPB 1R8SA 3U7FB 1T1JA 4OYRA 2BIFA 5E1DA 4N0MA 3B3AA 1DJLA 1Z6TA 5EP4A 3VPDA 4FZ5A 1SO8A 5E8RA 4TSFD 3GLSA 1ORWA 1Z8FA 2IZZA 2QU8A 4N5DA 4IRXA 5T64A 4CIDA 5TGZA 1XX6A 1YWGO 2V6GA 3S2UA 1VXRA 4IDOA 4DYHA 1W4BA 3T3PB 3CVUA 1U3WA 3RFUA 3MXOA 5D6NA 3RC8A 5B58T 1BCSB 1UC4B 4FDLA 3ENVA 1BCRB 3I5MA 3O4RA 2QZ9A 1I5EA 5COQA 2A4MA 4UAVA 4D4IA 1Z33A 4MQLA 1ZRMA 1HYGA 3HNRA 4REQA 3PNPA 4HZUB 5EZ5A 1KYTA 4BHTA 1C4XA 4FE3A 2RE8A 1JZQA 3ZV5A 5ECDA 1KDRA 3DDHA 5AVTA 3ESZA 2PYZA 4CU5A 3ZDCA 3R20A 5JI3E 4GYKA 1DKOA 1XFDA 1ZEJA 1IQ0A 1E59A 1C2TA 1DQYA 3HU3A 4Q9LA 4DIOA 2YOHA 3ZU6A 1WZUA 1KK3A 2H51A 1HY1A 2ZCVA 1EZZA 1B74A 1N7HA 3CO0S 2I62A 2QJTA 4DIFA 2N0SA 1H69A 1D4AA 3AP2A 1BX1A 4HLUA 1ZH4A 1IU9A 1I7QB 3KTOA 1VLMA 3F3MA 2EL7A 2WWRA 2IYTA 1RT9A 1P4SA 1OYVA 3HVHA 4MR8A 2Z5LA 3LNTA 2PNJA 1AO3A 3BWYA 1ZJ4A 3LHDA 3PFCA 2GEBA 4J29A 2B8TA 4DUGA 4BNNA 4DW8A 4A2PA 2DBVO 3QVUA 1V7QA 4BJ6A 5CYPA 1XHEA 1ZCJA 1RHJA 4TMZA 5M3BA 2EQAA 4TV8B 1P0IA 3VKFA 4RTQA 1D6NA 5K9ZA 3OH8A 4PC3A 3P52A 2VPYA 1NJFA 2ZQ5A 4QATA 1WETA 4FYMA 2BZ1A 3COSA 3C2QA 5ALFA 5EA2A 5EE3A 1E9DA 1WQ1R 2GZ2A 2GCEA 4UUNA 2BGNA 7REQB 3D6TB 3MC1A 3NTRA 5AHRA 3M6WA 4TXNA 4YAJA 1FW8A 4XQCA 1JBQA 1W0JD 3GLTA 2WTUA 4PYQA 5FI1B 3WB2A 5JUWA 3PB3A 3QHPA 16PKA 1MX5A 1BAPA 2PYIA 3BGOS 3FX2A 4EG4A 1GA4A 1R5NA 1SBIA 2F1RA 3F9IA 3F90A 1KKMA 4JVSB 4EDFA 2IDJA 5A2QA 2R6CA 5CRIA 2RHMA 2ZBVA 4TTRA 3R3WA 3D7LA 2PS1A 3CE9A 5EJMA 3RAFC 4LZJA 1BA2A 2E4AA 1SBQA 3FJOA 3QPUA 1SVOA 2TMKA 1BJTA 1Y89A 1A9RA 1DAFA 2X0KA 1XMXA 2IYEA 4D8VA 5AQEA 4I50F 1BDJA 3E84A 3P20A 4IIJF 1D09A 2QOEA 3L0OA 4S1VA 1CG6A 5BV7A 2OR3A 1QE5A 3DS8A 3UC5A 3E27A 2GI4A 4EQ6B 3JYQA 5HP4A 1G8SA 3N2YA 1UBNA 3ML1A 4CG1A 4EJ0A 3RFXA 4BNKA 2XB8A 2V4UA 2B4AA 3K09C 1N6OA 4XWAA 3U4HA 4M21A 3J7AC 1Y7IA 4HDKB 3NIGB 1RMTA 2AI1A 1US8B 1GD1O 4BGEA 3LAWA 2OORA 1CVRA 1YS9A 1YR2A 1G20B 1P0PA 1BWQA 1RYFA 3A25A 3NASA 3PT9A 4FFDA 4PW0A 2P7HA 4Q6WA 3ZV4A 4BQFA 3DL7A 4ZTZB 1IK6A 4J6EA 5JSYA 4Q1FA 2XBLA 3DC7A 4URZR 1W4RA 2Q4TA 4R01A 4WXHA 1GPJA 3C45A 3L07A 3QUBA 5TB5A 4CJXA 1EBFA 2IIPA 1EVIA 2OWDA 4PZ0A 1T24A 3GVCA 3NANA 4LK3A 4CXMA 1RAFA 1TQ2A 5B2EA 5IXYA 2QDKA 1L5ZA 3ZVMA 1IBLB 3GDFA 3ROXA 4O59O 1IPFA 3L6DA 3OWOA 4JLAA 1S8AA 1ZXBA 2I22A 3MWFA 2BAGA 2GYYA 4FFMA 5CBKA 5CD9A 3W5BA 5DVZA 4RPHA 3SHTA 3J81k 3OTIA 1AUPA 4OQQA 4M8LA 5F1YA 3GC6A 5EJ9A 1QIJA 2PRYA 3PIDA 2JVJA 1MPTA 5KYWA 4D80A 2A67A 2AFRA 4D8TA 2ZI3A 3ILHA 2PANA 2JGAA 1B93A 4IQ4A 1EFUA 1TW2A 3BOSA 1RJGA 2VPZA 2J41A 3TPFA 2Q21A 3GP5A 2QE7A 3TSOA 3VSCA 1P7PA 5ITVA 3NALA 1FNBA 2RB4A 1PEYA 2B4YA 3ZD6A 2OT3B 5IJXA 3G7SA 4ZJUA 4MITA 3T1QA 3PRKE 3TMKA 4AXXA 2QTRA 3UT5A 2BONA 3H16A 2X75A 1SPBS 3EOAI 3KXLA 3MB5A 4GGOA 3P9ZA 5AOCA 2XMGA 2NU7B 2ZSFA 1FVOA 4Z9BA 1FQKA 1TJ7A 1T2VA 4K9PA 5I48A 2I2BA 5GAJA 5KTNA 1FVFA 1PR9A 2AWNA 2BGUA 3RCBA 3EASA 1VCNA 1M67A 1J9ZA 2HK8A 4HX5A 5F3RA 1T0PA 5AHKA 2E5FA 1MR3F 1T5OA 3TQQA 2PGOA 4EZEA 3KZOA 2NQ8A 4NZYA 3ERCA 1K3FA 2W43A 1ZJYA 3VI4B 4WZZA 3A1VA 1LD3A 4JNCA 1O03A 3A14A 5EIBC 5AVOA 2QV7A 3X43A 4FINA 1RNLA 4CCYA 3U3RA 2GXUA 2WE8A 2XWJI 3EOZA 2FQWA 4EYOA 2J09A 3IAM1 2Q28A 4EHBA 5B7GA 1NN1A 5JXIA 2WSSA 3QTLA 4I4LA 4G4IA 3AEUA 5EE9A 1STOA 1SM4A 421PA 1TO6A 1URPA 2J4FA 1L7RA 1NVKA 2D4HA 2PQ6A 4LDRA 3UK7A 3SOPA 4F97A 4G6ZA 2CYAA 1EJ6A 3CB4A 3OD5A 5BW6B 3K0HA 1D9XA 4XSHA 4FCVA 3HWX1 4K3UA 2GVNA 1ML4A 4BY9E 3EEBA 4IF6A 3PRYA 4XGNA 4CVNA 1IQRA 4EKYA 1KJNA 1N8NA 1Q2XA 3E9CA 3T12A 4EG5A 4DKXA 1Y8QB 4F21A 1DAKA 1LLDA 4KN8A 1JR2A 5ARBA 3CZCA 2YRWA 3ZE6A 4CZ2A 3BMCB 5E4YA 3K2QA 4J94A 4DCUA 2ZKLA 4ZQGA 3U6KA 4L74A 4RMGA 2VWGA 4DJAA 3KWLA 1Z68A 3G88A 1V25A 3FYHA 1Q1BA 4CKBB 3GIWA 3ORFA 4YRQA 1CCWA 1JDBC 1JEEA 1F2TA 1GG2A 1U5CA 1DQNA 3GLIB 2EHJA 4JI7B 4H18A 4IDQA 4O2AF 1G59A 1G3UA 4WT7A 3UG7A 3TE7A 3E3AA 2PLAA 4IWXA 1E2GA 5H1YA 5H16A 1GGMA 3BWDD 4IDCA 4E15A 5CB6A 3O1JC 1FURA 2G06A 1PUIA 4MKZA 2O54A 1JSZA 5DHRA 5L7YA 1P7VA 4RDCA 3WGHA 3P9QA 1KQ3A 5A3QA 4NG4A 4HCJA 3I28A 1GADO 5EIBD 4ZKEA 1ZKDA 3TD9A 4GWLA 5CNIA 3FBWA 5IK2A 3ZBQA 4EO4A 4YCBA 2B1QA 2RK3A 5FAXA 4KQJA 4P92A 3EFOA 4WLOA 5CM8B 2WFLB 4X97A 4MUFA 2XPCA 2P2ZA 1W96A 1DLJA 4PPYA 5AI5A 4HFRA 1QR2A 1S96A 5JJBA 1NX9A 1GCGA 1ZMRA 5BOSA 3DKVA 4G1UC 2QRLA 3QU7A 4O4HB 2CJFA 3RQSA 3TXAA 5F64A 3LP5A 4JI4B 1QIIA 4NESA 3ZW8A 4CPDA 2FUSA 1AM4D 1RBQA 1RRKA 1MO2A 4X20A 5KOHA 3VC2A 5LIPA 2HA7A 4FXPA 3I37X 5LLDA 2PBLA 3TGPA 3COJA 3MT0A 2QRMA 3PQ8A 2C4NA 1C9MA 3U3XA 2XZLA 3IS3A 2BFOA 1G18A 2QPLA 5IW8A 4D4GA 5GONA 2X5NA 1SXJB 1I3CA 3O2QB 2A0KA 3KR1A 1FLDA 1M75A 1NUHA 3MTDA 2ZYAA 3ONWA 1UFOA 4GNRA 1HKHA 3W04A 1GPH1 1KMQA 4GG1A 4AY4A 4OHBA 2YXEA 3AEKA 3H9GA 3LSYA 2ZBPA 1KMCA 4BMNA 4UM5A 1CJTC 3C98A 4RUKA 3K0BA 1JFSA 4C7OA 1C3VA 3EVGA 4JZKA 2GAFA 1P0FA 4I81A 1BFDA 2DWCA 2ZXEA 1Z39A 1D8AA 5GGYA 3S44A 1OC4A 3MFYA 1NAHA 1JSLA 2O8BA 2IV7A 2J7PD 2IK8A 2ZR7A 3ZJVA 3W5CA 3KETA 1SK8A 1I80A 2ZSIA 2FKAA 1AH2A 4F8YA 2NYAA 5ALGA 4R2WA 4E33A 5A4AA 2DE0X 3CNQS 2VJYA 4BLRA 2HNBA 2IWHA 2H1SA 1Q91A 2WILA 3MS4A 4FSHA 1JNXX 2BCGY 3KPYA 1X7WA 2FPPA 3H1AA 3AF6A 1RHMA 2AA3A 3KQSA 2OQVA 4RD1A 5HJ7A 1TTTA 2YWCA 5I8PA 5CK4A 2X7XA 3D7KA 5K8VA 2XQIA 1WMAA 3AUYA 4QRIA 3CUWA 3MRSA 3SF8A 3L8CA 2IOQA 4KGZA 2JG3A 5LXTF 4DLRA 5CA0B 1JQKA 2BBTA 2EX1A 4W9NC 2OXEA 2DRIA 3DOEA 1F20A 4G5FA 2GBLC 2R6AA 1F5NA 3ZI7A 4FQ5A 3WGTA 4YR9A 5ECYA 1XQ9A 2W2LA 3GJ3A 3HBJA 4PZPA 1BCRA 1X6VA 3E70C 2JHGA 3V8EA 3G13A 4WCDA 5TQVA 3ZHYA 1SD2A 3P2EA 1XZNA 4Q3NA 1FYDA 2FF5A 5D1HA 1AXGA 2P6MA 3ZWNA 3L5KA 5B3KA 1XMSA 2YVKA 2Z09A 3W7VA 1NA5A 1KRWA 4MRAA 2VTBA 1SR8A 1HT1E 2DPXA 2CNKA 1PEAA 1YE5A 1MJ5A 1KQNA 1Y6ZA 3PDHA 1SVLA 5E95A 1XCMA 1DRVA 3DKKA 1YUMA 5H3CA 3SBEA 5JNRA 4Q82A 2DB3A 1IIRA 3ZHXA 3DMFA 2A1IA 3C1OA 2VP0A 4MAAA 4N40A 1XUOA 3WV5A 4HATA 2X9QA 5K8TA 5AHXA 4COOA 1WZIA 1RPTA 2AMLA 1JX6A 2VXBA 3WYGA 3RQIA 2YQ4A 4YP1A 5FOVA 4PAWA 1YB4A 1Z0FA 4BP8A 5KSYA 1CYDA 1M10A 1JHZA 2QTZA 4CLRB 1WXIA 4KSYA 4PCUA 2O6LA 5BWNA 3K32A 3IP1A 3PQ5A 4QIHA 5JSQA 1QORA 2A88A 2JAHA 1TE2A 2QNBA 3B36A 1SVMA 3AF1A 3NLLA 3D1JA 3TTTA 1EP9A 4KN9S 1KE1A 4RM3A 4D43A 3EC2A 1TAUA 1F0YA 2FI1A 3GUCA 1E1QD 1T25A 3H2KA 3JQ7A 1L5VA 2JEYA 1DTWB 3OJWA 4Z2AA 1DRKA 1U2TA 5HYVA 1W6UA 5JPIA 1DKPA 3QYJA 2VF4X 1G8HA 2VQ6A 3MK31 4TRRA 4UMVA 1J9GA 1L5SA 2PUTA 1WDMA 2MYPA 3C8UA 1QYDA 3S7ZA 3TLZA 4NEGA 4S3MA 4JGIA 2Y1FA 5JDCC 2EKDA 3ZY4A 2WOJA 4FI3C 5ESWA 4JOQA 3O9MA 3REOA 3RIXA 4D8YA 1JFTA 3EGEA 3CNNA 2JH8A 3CRQA 1NVUQ 1VDZA 1NM5C 2RBGA 3HRIA 4MWCA 2IHBA 1GAXA 2RBEA 2ZS9A 5EC8A 5AVKA 2Q0XA 4MR7B 1C4OA 1C5KA 1XK6A 3V8VA 4RO0A 4RV5A 1YC5A 2JK0A 3D6NB 4CCWA 3SICE 2JJQA 1BE6A 2E6KA 3BICA 1KI9A 3CH7A 1GZHB 1UWVA 4OJTA 4D99A 4HNAB 1XI2A 4MXDA 4YDSA 3T7AA 1GPMA 2GSWA 3JZDA 2P5TB 4ECAA 2V7WA 1IXRC 3GJTA 1I2BA 3AL2A 4Q66C 1NFRA 1WUTA 1Z6QA 3R0IA 3H0KA 2DKFA 5H80A 5CVJA 4ZC1A 5C3UA 2YXBA 1F1BA 4Z4HA 3JWGA 3FYCA 1BMQA 3O3NB 2BUAA 4LMBA 1JAHA 1B3BA 1EXNA 1U5BA 4UFPA 1US8A 5E1BA 2C4HA 3AKEA 1SQ0A 5BSUA 3WIUA 3HJUA 1G20A 1MAUA 3E4DA 4JASB 5FUXA 5TY0A 3U09A 2PT9A 1YO6A 3QLVC 2GSDA 1DRUA 4QSMA 5ENVA 2CUKA 3D8BA 3N07A 3BMNA 4BJ5A 4G4JA 4ARVA 4UDNA 1OFVA 2A2ZA 1VHWA 3HXTA 3UJ8A 5J2UA 3JXEA 4IMPA 2JIMA 4FYPA 2QQGA 3ASZA 3HB1A 3Q7QA 4Z3KA 3RVOA 1I6KA 1JS1X 5AVUA 4DLUA 3VVLA 3SC4A 4BAUA 1Q7EA 4MUMA 2EU8A 3DW3X 4RACA 2GD2A 3DZGA 3ROTA 1MEJA 4AS2A 2X1LA 1XDSA 4LG1A 4C76A 4JEHA 4K8RB 4XIFA 2IXFA 5JANA 3EIEA 3LUKA 2BKXA 5CLQA 1WU7A 2P4QA 2CZCA 2BN4A 2BHNA 3PCRB 4Q1DA 1ZZGA 1F6WA 2DQKA 2IIQA 3DMHA 3Q7IA 4IDPA 1T10A 3I30X 1TQHA 3ICPA 1X86B 1J23A 1C1HA 3UJNA 4OXKA 1ZIOA 1G4AE 1Z2PX 3GROA 2PK3A 1BO6A 1JKJA 1F3OA 1VMKA 3WYBA 3ICQB 3CJTA 3PP8A 1SHLA 4EL0A 2FFBA 3DTNA 1M2HA 2N1MA 4OHXA 4YO8A 4ABYA 1N8KA 4RADA 3SYNA 3FI9A 3WLSA 4ALLA 3JQEA 2NNLD 1CEEA 4AXBA 4CKXA 2F6RA 2ZTUA 3IUEA 3KKZA 3WDLA 4EBBA 3U60B 5FI3A 1Y1KE 4BXOB 3HYSA 4R68A 4IRMA 3ZHZA 3T9FA 2FKNA 5F2EA 1XR3A 2XBUA 4OMUA 1W5FA 3K5WA 3RBAA 3GDGA 1CT9A 2A1TR 2L42A 4PLCA 5FUQA 4WOPA 3E15A 1BG6A 3IT1A 4H7FA 1CZLA 2EIHA 3Q2OA 5AJXA 3UHFA 2GPWA 3D4BA 3TQFA 1QGAA 1MGPA 1NW8A 1SWWA 5ED0A 1Y5IA 3L79A 3K16A 4RYLA 3RGGA 4Y2UA 3LI2A 4DEYA 2Q1SA 5AW6A 5JCJD 1DKRA 2BMJA 2JFWA 3FZNA 4DIKA 5BYKA 2P5YA 4XJVA 3CVJA 1U8UA 1NJ5A 3L5OA 3RHFA 3EAGA 3HWWA 3FCXA 3LA6A 2AKEA 1V3VA 1HLDA 3CZ5A 2V3VA 2X42A 5K3OA 2EFDB 4P7JA 4EHLA 2VYCA 3DE1X 4TWRA 3CPSA 1IAVA 3TIGA 2M6RA 3FUVA 1QUEA 1PBTA 2SHKA 2DFPA 3E5MA 3OPXA 1EX1A 2JVIA 3G6WA 4O2LA 4RELA 4US1R 1V6CA 3CNLA 2K2QB 4LV5B 4Y6RA 1RWXA 3R9XA 3JTMA 4RAOA 5AJUA 1GYQA 4BDTA 1ATIA 2HBRA 1PQYA 3MWLA 4XQ9A 5DTJA 4WJKB 3TZBA 3O90A 1HM5A 2CK3A 3HKBB 4EPRA 1E2MA 1E0DA 2P90A 4KVZA 5EHIA 1NI4A 1IOLA 1GLGA 1VPVA 2VA9A 4LV6A 3H1TA 4HG2A 4L3WA 4D81A 4JVLA 3OETA 1GYPA 4U7PB 3R7AA 5KTTA 3N2ZB 3R6LA 3ZDRA 4GZ3A 4K9LA 4RL4A 3SJ7A 4AO8A 1TA9A 4HQRA 4R81A 3FLAA 3ISJA 1O4WA 4QGBA 2BRUC 4M3NA 1M1YA 1IBRA 2J08A 1R6DA 5LL6P 1Y4UA 4UM9D 3T4XA 3ZX5A 3RTBA 3V1UA 2NZWA 5DCYA 3A36A 4TL8A 4WL0A 1KAHA 2HA5A 1KIFA 1F1JA 1MC5A 2IYXA 1E5DA 4MVXA 2QSJA 4CHTA 2DP4E 4OKSA 1I51A 4ZVVA 1AA6A 1KJIA 2CHUA 1R6AA 1YZFA 4EGCB 1L5KA 3SG0A 4S1WA 3SBXA 3U37A 2OFXA 3PFKA 5C5CA 1JQ3A 1L3BA 3A2NA 3CR8A 5JWOA 2CLKB 4BV9A 2NGRA 4ND5A 2ZIWB 1T4DA 2VF2A 1COZA 4IV8A 4JVMA 4EARA 1UXOA 4F7DA 5CFRA 4A27A 1Z4IA 4BRUA 1SELA 3QVMA 1NDHA 4B4UA 1W73A 4HPXB 5IC6A 4ZAXA 5HDBB 1YCFA 5BQFA 1PQ4A 4F96A 3GRYA 1OMOA 3EH2A 1NYQA 3S55A 3W3AD 4YRSA 1YOBA 5LOVA 1B7GO 4I1SA 1L4EA 5DWVA 3RHTA 5FBKA 1FXWF 2CDAA 2D0IA 3EDMA 4JB8A 4HMOA 1FBTA 5D6BA 1NV9A 3R44A 5AK5A 1Z6PA 1NLZA 4M1SA 5CA1F 1VYTA 1BE0A 4URYR 3DZ8A 4U9HS 2ZJ2A 3B6MA 3K6KA 4B3HA 5JSZB 3G5LA 1FFHA 3WDMA 1I2AA 4Y6PA 3K9NA 2UZ4A 1HNZB 3AVUA 1PFKA 1Z38A 4X3OA 3T41A 4RABA 5A03A 5DN6D 3FSGD 3L0BA 3VVMA 3DULA 3PC3A 4PZCA 2XOKA 3V2UA 2E4ZA 4RFVA 3HE3A 3NUGA 3D7NA 2O7RA 3QBJA 3ODGA 4X7BA 5AICA 5EIAA 4ZYXA 4EITA 1GL6A 2QLBA 2X15A 6CHYA 5BNTA 1FP4B 5IZCC 4DPMA 5B6IA 5KNDD 1J42A 2Q5EA 4INPA 2I2DA 4GI3A 1X1TA 3UYLA 3H83A 3PEWA 1YSCA 2KHZA 3EISA 2ZUEA 2AK3A 3HMQA 4H27A 1BMDA 1Z5VA 2XUDA 4M38A 4US0R 3EG9B 2JLXA 3O5AA 2ZJYA 3THOA 4DYVA 2J0SA 3GY0A 4XVRA 3IJEB 4OU5A 4DDVA 1W5AA 3DEFA 1MORA 2C7OA 1DAMA 2MSWA 4HLUC 3L3BA 4KXVA 3T52A 2IYVA 1D3AA 1QVVA 2HLHA 4G09A 1I1HA 2RJ3A 1C3EA 5DBOA 3B1VA 5CLLA 1MIOB 4NX2A 5MFPA 1W25A 1EXMA 3GQBB 4DB2A 4RVSA 3ZTTA 2FUNB 4TGLA 4Q1CA 5LYJB 2AOTB 1QE3A 3IMGA 5E1MA 1EJBA 1B8VA 2O2IA 2FB9A 3CPJB 2BTEA 3SFVA 3A2MA 3CVWA 1KXJA 2WB4A 3JQ6A 1ISRA 5FNVB 2JKYA 2E89A 3QX7A 3H0EA 1EU1A 5D7NA 3RUAA 1P74A 2Q3CA 3H5LA 3K0CC 2L17A 1XNQB 1WQ4A 2YHAA 5CA0A 4LJKA 3ZJUA 2GN1A 4HPWA 1ZOIA 1C14A 4L95C 1ORIA 4OXRA 3IP5A 2QTTA 5KAPA 2HKIA 5HK9A 2GHQA 2OEPA 2O1WA 3TJRA 1UQTA 2CEAA 1L7QA 4I14A 3T7RA 3TLMA 3M2TA 1RMYA 4Q7MB 4EYEA 2DFLA 3IJPA 3K0AA 4LMAA 3ZJ5A 4LZZA 3CRW1 1Z36A 2VWHA 1E2DA 1QMGA 3FH0A 3I01A 3ZWVA 2XUAA 5T3UA 4ZCPA 2Q46A 3KYJB 4QYTA 1B2RA 1BTOA 1ORHA 2I65A 2QR3A 1JYEA 2E4VA 3ESRA 4MQUA 4GX5A 2HV8A 5F12A 4XEHA 4ZVTA 4EI7A 2QUKA 1FS6A 1WOYA 1CRPA 1G2IA 4KIFA 2CXOA 3B60A 5EGSA 4A8PA 3JAKB 1AT1A 3AVTA 5EJ5A 2Y6UA 3A6ZA 3CEMA 1V3UA 1ZRHA 4FYJA 3WXBA 4ILKA 3GTDA 2F62A 1W85B 2VPTA 2Z6VA 5FCDA 1U63A 3CTMA 4MPPA 4NG5A 1XCJA 2WRZA 4V38A 5IH7A 5EIOA 2NP6A 3IP3A 1TK2A 4CLRA 4BX0A 4GMXA 4K40A 3IHTA 3PK0A 2AEJA 1NF9A 2WMOB 1QV6A 1SIBE 3EYWA 4JB3A 5JO0A 1OD6A 3AFGA 3TEFA 1NVDA 3MAAC 2EOAA 3GRAA 5G40A 2B78A 3P5SA 2G5PA 1QWOA 1R8JA 1VP3A 3OKFA 4KO3S 3W9YA 1QM5A 2QI9F 1JVBA 1Z28A 3IFSA 5BRNA 1G8JA 2OLEA 2XUQA 3UJHA 5L3VA 3TXYA 2YWJA 3WV4A 1U7TA 3Q5EA 2KBEA 3K8YA 1PJ8A 1SKAA 2FJPA 2MSLA 3IHLA 2ZAIA 5A6VA 2PGLA 4EY5A 1PVDA 4L0QA 1XIVA 2O4UX 2WW8A 3MVEA 3R6WA 3O8DA 3U3KA 4JXXA 1TM2A 1ZONA 5J1TB 4RF5A 4K5QA 3PR2B 4PSUA 4H35A 1ST3A 1ISFA 1FEZA 2HWUA 2A9OA 2PDAA 3ZD7A 4NCXA 1QIGA 4YT2A 1T35A 2VSQA 1TC2A 2ZB7A 3BB4A 1QFSA 1Q11A 1NQTA 2NUPB 5K3SA 3A3OA 5JZOA 3VR5A 4K9RA 1NW3A 1C3CA 3A7EA 3IA7A 4PC1A 4QOFA 3RVSA 3JYPA 4ZDKA 2ZAYA 4YNBA 4HNAA 4TXHA 2CV0A 1U1CA 2H1FA 5LVAA 5C2JB 3QXGA 2J45A 4QUHA 1TK3A 4A4DA 1NBME 1K8XB 1J5EB 3VYTB 3GCWA 3DQPA 4I9GA 1D07A 1L4MA 3RBXA 2QN3A 5EXTA 5BVGB 1AZLA 1QZ3A 1UEXC 4BKOA 4PS0A 2C2OA 1Q3TA 3BWVA 3UMJA 3AEQB 1O87A 4ZU3A 6ABPA 3ETNA 1OHHA 1ZGZA 3DDZX 1AKNA 2DPHA 3DOHA 3GH3A 3NG1A 4QPJC 4TVSA 1JUDA 2Q6IA 4EB3A 5BR8B 5IKEA 3UAGA 3IUNA 1EEXB 3E6AA 3MWJA 2IGTA 2BELA 4KTTE 3W7BA 1A4UA 1NPYA 1YRQA 1CZUA 4J90A 4XB1A 1QHYA 2ZBGA 2W2OA 3GFQA 4RHXA 3JVEA 2XDQA 3HPQA 2FMTA 5FR2A 3OFVA 3ILXA 1VHQA 3HP7A 4LXHA 4UEQA 4TXJA 2DUMA 3BUSA 4ROTA 3AEZA 1N5LA 1YL6A 3ROEA 1JG3A 5IJ9A 4KZPA 5KTMA 4E14A 3IQHX 2F90A 4G84A 2NPOA 3MT9A 2O57A 3TNFA 3TLCA 2DFKB 3ZGXA 3ZZMA 5CAEA 5CDYA 3IVXA 4ND3A 5I51A 5J2TF 2W6MA 2XHZA 2QIPA 2KM1A 2PVSA 1ODLA 1TYCA 2LBPA 3ENWA 1DXQA 1Z12A 3V7WA 2R7MA 4IZ6A 1RTTA 1II0A 4YRJA 5HIMA 3R7BA 3ZNPA 3UB3A 2C5AA 3V4SA 1UBTS 1OWMA 3LC2O 4JUAA 1HA3A 4PNEA 3G2IA 2ANCA 2YFYA 3I6ZA 2YMLA 2I1WA 3IKMB 5DLYA 1G4UR 2JC3A 2FZ4A 5BWBA 4IJMA 4DRYA 1JG4A 4XWWA 1DCNA 4P34A 2K2WA 1OBVA 2Q3MA 2QE7D 2WTNA 3QWAA 4X1IB 1X7XA 4KI0A 4MYHA 4CGYA 3Q8WA 4IV0A 1XQXA 5K51A 3MBOA 4X6XA 4B3IA 4CNBA 4ZZ0A 1N6NA 1A1VA 2EBWA 2W6JA 4DA7A 1ZFNA 2DHDA 3JQAA 3OZCA 1AMOA 4CUJA 3PXUA 4FI3F 3N2NA 4O4IF 2BJHA 1X87A 1Y3FE 3LX6A 3FI0A 2D3WA 5C1BA 5DSXA 1AKQA 3O4JA 3QU2A 4QPNA 4M83A 1LF5A 2C82A 4U3JA 5G0VA 3MNFA 4BNGA 2H3EA 1GO2A 4P0TA 1VJRA 4DCGA 5AD1A 4ZTUB 3N70A 3OIWA 1Q7GA 3CUVA 4RYDA 4C0AC 1OE0A 3DAFA 4C06A 1KJQA 3CLHA 1E2EA 1A04A 1DPGA 1SG9A 1HNNA 2A5YB 2FEOA 3KK0A 3KOOA 1UMBB 2W8ZA 4PRYA 3KOUA 1K4YA 4F3RA 1EUCB 3RVPA 1YHNA 2WSSD 4GQAA 4B40A 5SZIA 3LW7A 3HR4A 5JTUA 2P9GA 1C2YA 1DE0A 2XLBA 3F78A 1GSOA 1MP0A 3R4CA 4KQFA 2RH4A 4ZVMA 3RS9A 4YQEA 5JZVA 1A98A 1ACLA 2O3QA 2PO5A 4E7PA 1KFCB 1O95C 4RCVA 3H04A 3THWA 4KXXA 2F43A 2BD0A 1S2IA 4BNWA 4X0EA 1ZA1A 2VQFB 1CDZA 1WY7A 3M1AA 3I8OA 1CR1A 3NNSA 4I4CA 1TAGA 1NJ2A 1FCJA 3FD8A 4NNOA 3RSHA 3SZLA 1THGA 4O1MA 1OLXB 3HI4A 3UWSA 3CUEF 5CBPB 2OC9A 1FIUA 1RYZA 1OBOA 4RMIA 1I2MA 3KTFA 1CS0B 3I04M 3QEMA 2E21A 4M7OA 2HJ9A 4Q48A 1DKLA 3I0MA 3GNSA 1FRVA 3L8YA 3OQHA 4R05A 1EIWA 1QHIA 3M9XA 4MGEA 4BLWA 4NOLA 4J49A 3WG9A 1YC2A 1HKUA 1FTSA 1D4FA 2XUJA 4N6GA 1PWXA 1ZC4A 3PPXA 5AHWA 3PUYA 4G41A 4FOSA 4N65A 4OHMA 2WJGA 4K81B 1PFQA 3RWOA 2VRCD 3E82A 1CERA 1X13A 4G8CA 2AT1A 4H17A 2G6BA 3UW3A 3A4MA 3T3IA 3OLYA 1WUIS 4NBNA 4PXYA 3V1LA 1UH5A 1E61A 3EF0A 3VGPA 2VHQA 4D4JA 2O59A 4IS3A 3I62A 3WNCA 3JD4A 2H1HA 4PAOA 4L5BA 5GV7A 3GCZA 3ZZTA 4FOTA 2PEYA 3GEIA 2ADMA 3VZQA 2VAVA 3DF7A 2IUTA 1LTQA 2OENG 5ALQA 4CDMA 3FY4A 1CZNA 1G6HA 3PX7A 1CTQA 4BFTA 1DEXA 1LA2A 2VNJA 3F47A 3DM5A 1L4NA 1R50A 1IJFA 4MPTA 1KH1A 3FDFA 3IV7A 2HD4A 1P18A 4TVOA 2FY8A 5CYOA 3RFTA 3TMAA 4AULA 1NKVA 3CI0K 1XTBA 1VJCA 1JI3A 1S2MA 2X1HA 3E5NA 8AT1A 2EYUA 5T5QA 1VKHA 1DV2A 1ZOPA 4FDAA 4AX4A 1O1YA 2EG9A 2B4RO 3EVDA 4BP9A 1O95D 2V65A 4LQ4A 1CEYA 4M8NE 1YK0A 1ULZA 1WCWA 1YNOA 4J2TA 1EUQA 3VH2A 4M1MA 2VP5A 3TCXB 1Z16A 5DE3A 1I7SB 1SG0A 3IVCA 3R5SA 1XZKA 4L8YA 3HSYA 2Q0HA 2R751 3D0KA 4LKOA 3SDZA 1W36B 3JZIA 1OLSB 2TMGA 1LPOA 1EDZA 1FDVA 1VGVA 2BMDA 3FGZA 1X7ZB 1IRIA 4GBGA 5DCLA 5ER6A 3QTTA 2X5OA 4E2FA 2GF9A 2GEDA 5JG7A 1Q6YA 5T57A 1QO9A 3C39A 3M4NA 3DTTA 1VIDA 1G1AA 2A0UA 3MILA 4X7RA 1NFFA 1PUJA 3VDRA 5GJBA 1AMNA 4URWR 2JBHA 1JB9A 4F06A 2GD1O 2YMMA 1QO0A 3U62A 2C94A 4V0ME 5J63A 5LQKA 4ARBA 3GLFE 1LTHR 3EIUA 4Q3KA 1ZD4A 1U4NA 1QH8B 1D7OA 4EK9A 2V0NA 4E5YA 2X2EA 3MGBA 3QWIA 2J4CA 1UMDB 4D57A 3N8DA 3V80A 1Z2DA 2WABA 1A2QA 2QRZA 3FXAA 4UZSA 4EJ6A 3L6RA 5LYJA 5A2GA 2AOTA 4CQMD 5L3QA 2WINI 2MSDB 2NZYA 4RH1A 3D8RA 2V7VA 1ZUNB 4QDJA 1CDEA 1R3DA 4MQ4A 4MW4A 1ENYA 1J2UA 1OVGA 2QP9X 5FNVA 1DLIA 1UBKS 4FHFA 5MN5A 1X1SA 1R16A 1CIVA 4JC5A 3FTEA 1VMIA 2C3UA 2QLJA 3CT6A 3ER8A 2Z1MA 1IHYA 4OAOA 4LF5B 3D02A 4UDXX 2DG2A 1ZHHA 3OEHA 4DXHA 1HT2E 3PLNA 1A88A 1RRPA 4FDTA 5E9WA 3KEGA 3T1TA 4AJOA 1EUDA 4JJFA 4MS3B 1CX9B 4CTMA 2N9UA 4A91A 3NOVA 3IO5A 3P32A 4Z49A 4EB6B 3QE4A 1NYTA 5IP5A 5IC5A 2JGKA 5B4UA 4YRLA 2SNIE 2W9XA 2ZW9A 3G3EA 3IQDB 2EG5A 2W2LD 1C7FA 1JIUA 1ZI8A 3T1HB 1ELOA 3PGA1 4H15A 4EI8A 5LP6B 2FRDC 1NNI1 4P5DA 4L85A 1P73A 1VIMA 3DWFA 1OWPA 4KACA 4BO4A 5D84A 1KIAA 1HOTA 1VKNA 2YVLA 3HFGA 4XTRA 5DGCA 1M76A 1PZXA 3IOYA 3NYQA 1ZSYA 2ZYWX 4EO7A 5HKAA 3VKGA <