4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
4HAIA 3QXGA 4Y2SA 1WVIA 1QH9A 4HYTA 3N1UA 3ZW7A 5AKZA 2I7DA 3OCWA 1QYIA 2FPWA 2YMLA 3QU9A 3SMVA 1J97A 2JAUA 1RDFA 4YH1A 2AMYA 3OCXA 4Y2TA 4EX6A 2OYCA 2YMQA 3DAOA 3W5AA 1T5SA 2P9JA 2O9JA 3RFUA 1ZJJA 1S8OA 5AW3A 2FUCA 4G9BA 5AM1A 1N8NA 4RESA 5AW6A 3L0YA 3QNMA 5IT4A 3WKDA 4UM5A 2YMPA 1Z5GA 4CF5A 5AI9A 5AM5A 1RMTA 1JUDA 2HSZA 1Z5UA 3A1CA 1VFPA 3ZVMA 5JJBA 1RQLA 4EX7A 3KZXA 4O8CA 2G07A 3I28A 2R8XA 1NRWA 4OCZA 3ZTYA 3I6BA 3WGVA 2YFYA 2IYEA 2RBKA 2MU1A 3ESQA 3QYPA 4Y2PA 4C4SA 4FFDA 3QU7A 3WK7A 1O08A 3D6JA 3R9KA 2JGAA 3E81A 2HDOA 3W5BA 2ZBDA 2W43A 2B0CA 2G06A 4KX3A 5IS2A 4BEVA 3L8EA 2GHQA 4NV0A 1Z4QA 3EPRA 3PGVA 1YJ5A 5ALIA 4JB3A 5ALKA 4OFZA 2DQSA 5ALGA 3ZX5A 2EAUA 5AVSA 1ZOLA 2HF2A 3S6JA 4NFLA 4HGOA 1ZD3A 3U13A 4EZEA 2FPUA 4AS3A 5AI0A 1TJ5A 2YBDA 1Q91A 5ALOA 1Z4JA 2FI1A 2D2VA 1Z4MA 3U7GA 3UM9A 5ALQA 2R8EA 1L8LA 2IA5A 3VAYA 3ZX4A 5AK4A 5A3SA 1L7NA 3QU4A 3GYGA 3ZVNA 2C9MA 2HF7A 3IJ5A 5AW1A 5ALZA 1U7OA 5E0OA 2GFHA 2ZXEA 3M9LA 2P69A 2Q4TA 3QUCA 5AI8A 1RLMA 1RLOA 1YS9A 4DWOA 2ZBFA 4YIKA 4QJBA 3NRJA 3SLRA 5AVTA 3WK9A 3FPSA 5AK5A 5AKYA 3I76A 4BNDA 1RRCA 2P11A 3WKEA 2B1RA 2IOFK 5AM0A 4CE6A 2B8JA 5ALPA 4KN8A 4JDPA 4YCMA 2NO5A 3WKCA 4BBJA 4Y2RA 5AIBA 1Z88A 1RC8A 4DW8A 4I9FA 5ALLA 1AQ6A 4ZEWA 4BX3A 2B8EA 5AW0A 3OPXA 2NYVA 4XQ0A 2YY6A 3B8EA 1EK1A 3N07A 1VJRA 3N8GA 1TJ3A 2FPRA 4BYGA 2ZOSA 2WF9A 3IB6A 4KNVA 3L5KA 5AESA 2AGVA 4Y2XA 2HHLA 5AKHA 1Z4KA 1ZRMA 5ALEA 1RMYA 3IRUA 3UMCA 1MH9A 3TLMA 1L6RA 3E8MA 3ZU6A 3NIWA 2I55A 1EK2A 4XPZA 4YGYA 4MUMA 1PW5A 2PQ0A 3OCYA 3N28A 1YMQA 5ALRA 3U7FB 5IT0A 4L6CA 5ALFA 5AVWA 2C4NA 4QQFA 4Y2VA 3J7TA 3UMGA 2IOFA 3L0CA 2YJ4A 5AKXA 2HOQA 5AKLA 1WPGA 2ZBEA 5AVRA 1N9KA 3FVVA 2W11A 3AR2A 2O2XA 1U7PA 5ALXA 4EEKA 2AH5A 2HX1A 1K1EA 2G09A 4UAVA 4E88A 1NNLA 2G80A 4MWOA 3N5KA 5AKGA 3B9RA 3WKBA 2JAWA 3PCTA 3K1ZA 4BX0A 3QX7A 3R09A 4CF4A 3KD3A 2QLTA 3U26A 3AR6A 2EATA 3W5CA 5AICA 5ALJA 1XVIA 1SWWA 2YN4A 2RB5A 2YJ5A 3QU2A 2CN1A 2HCFA 4UU0A 1WZCA 2OBBA 1F5SA 1FEZA 2JARA 3U19A 1XP5A 4CF3A 5AVZA 4F72A 4YIHA 5AKIA 2GMWA 5A3RA 1VJ5A 4RETA 3L1UA 4UMEA 3UMBA 3KOOA 3ONNA 4HGPA 3EF1A 3NALA 5A3QA 3U7HB 3AR8A 2FUEA 2RARA 1ZD5A 4BEWA 1CR6A 4J03A 4F71A 1RQNA 4YCLA 2Q5EA 1LTQA 1YV9A 1YNSA 4OD0A 5AM3A 3MPOA 1U2TA 5AW5A 2NO4A 1Q92A 3A1EA 3E58A 5AM4A 3AR7A 5AK6A 4L57A 3L8HA 5AW9A 3AR3A 2FPSA 3PGLA 1Z4NA 3OCZA 5AKKA 1QQ5A 2PKEA 4IG4A 3FGOA 3NANA 2G0AA 5AHXA 3ZUPA 4NAVA 4UMVA 4KNWA 4DFDA 2C8KA 3WK6A 4EELA 3L8GA 2B82A 3ZI4A 4C4TA 2W4MA 4KX5A 5ALNA 2BY4A 2RAVA 1ZD4A 3DDHA 3QLEA 3OTQA 5AW7A 1L7OA 4UU1A 4UARA 5AVQA 4ZEVA 3SD7A 3L1VA 3I1YA 4DCCA 3ET4A 1QQ7A 5AVVA 4FE3A 2ODAA 5AI4A 3CNHA 2FEAA 1RKQA 1YDFA 3FPBA 4NWIA 4EENA 1LVHA 2WM8A 4AP9A 3DV9A 1X42A 4UW9A 3OCVA 5AKEA 3L7YA 5AVYA 4HGRA 1U2SA 5AVUA 1TE2A 3ZWDA 4H1WA 2X4DA 2G1AA 2I54A 4UM7A 5T41A 1O03A 4Y3UA 2CFRA 3ET5A 2GO7A 3L0BA 4ZEXA 3A1DA 3RF6A 3HYCA 1RKVA 3M1YA 4HGQA 3R4CA 1SWVA 3QUQA 5AKJA 3WK5A 2WHEA 2ZBGA 1IWOA 1RLTA 2FDRA 5AM2A 2YMMA 3QGMA 2G08A 4AS2A 3BWVA 1Z4PX 1ZS9A 2MSNA 3B9BA 2R8ZA 3ED5A 5ALVA 2BDEA 3NAMA 2R8YA 2WF6A 3QUBA 5AVXA 4UAUA 1RMQA 4HGNA 5FP0A 4YCNA 2ZG6A 3AR9A 3AR5A 4G63A 1L8OA 2WFAA 5AI5A 2BDUA 2C8LA 5ALSA 3W5DA 1Z4IA 3MN1A 1L7MA 5ALDA 1NF2A 1RKUA 1ZRNA 1T5TA 2CFTA 4KYTA 5AK3A 4FYPA 3QUTA 1SU4A 1ZD2P 1QQ6A 2OA0A 4Y2YA 3SKXA 1Z4OA 4XOUA 5ALTA 3NUQA 1L7PA 2PR7A 4BKMA 3NASA 3P96A 3WK4A 3KDPA 1TJ4A 4PNHA 3KBBA 2JAOA 3WGUA 5ALUA 3F9RA 4GXTA 3SHQA 2WF7A 2IOHA 2HO4A 3PDWA 3L8FA 4NABA 4IFTA 4XE5A 2HEGA 1WR8A 5AI6A 3FZQA 3FM9A 1RPZA 2C88A 5AW2A 4UATA 4GIBA 3E84A 3CZ4A 2P27A 2B1QA 1XPJA 2OM6A 3HLTA 4Y2JA 3DNPA 2CFSA 3WK8A 4B6JA 2YJ3A 5AW4A 4J2TA 2WF5A 1CQZA 2HI0A 1Z4LA 2GHTA 2B30A 4UASA 5ALYA 4UMDA 4Y2QA 3EF0A 4I9GA 3SKYA 4UMFA 3AR4A 3BA6A 3WKAA 4Y2UA 3ZTWA 1U02A 4BNDB 5ALWA 2I34A 3KC2A 2I6XA 5ALMA 4L6AA 3SF0A 2FPXA 2Q4RA 1KYTA 4CNQA 2VKQA 2QYHA 3ZVLA 2I33A 2EARA 2AUTA 2YJ6A 4C4RA 3MC1A 5AIAA 3QU5A 3ZWKA 4OHFA 4BX2A 1S2OA 3MMZA 1J8DA 1Y8AA 3A3YA 3OCUA 3EWIA 5AW8A 1TA0A 3U7EB 1T9ZA 5ALHA 2WF8A 3ESRA
chains in the Genus database with same CATH superfamily
3BGIA 4BFTA 3BL5A 3FKQA 4JYAB 2YXPX 4KRFA 1GZ4A 2G5GX 4WKCA 1UMKA 1Y7IA 5AUQA 2M98A 3FKSD 2I7DA 1AUOA 1FU8A 2FPWA 3KQQA 4MHSA 4NZ9A 5H8WA 2I2FA 3GJ3A 3F4TA 1NVUQ 4O4LF 2GO1A 4I4CA 5JAMA 4KE8A 4IPTA 3RS9A 3B7GA 1L8QA 1VHWA 1M0SA 4Z4GA 3ZE9A 4HDKB 2OK7A 2BGRA 1VSUA 4TS3A 3A9RA 1E3QA 4URYR 3WMWA 2YFKA 1H0KA 4CMCA 1IVYA 1N8NA 1UFRA 2FEOA 3IC5A 3OY2A 5J63A 5K99A 1MO5A 2UVDA 5NULA 5K3CA 5L3QB 3AUUA 4MI3A 4MR9B 4GFDA 3SC2A 4ARVA 5CEFA 3L1IA 4UM5A 2W98A 5EQTA 1F2DA 1DCMA 1KIFA 1OLXA 3I9MA 4WZ6A 2HSZA 4JJ4A 1AHIA 2VXCA 2PUTA 3TD9A 2RH5A 3GYBA 4YJHA 2XCOA 4TVOA 5DNVA 1P77A 5IJXA 2QTLA 4OAQA 3ZTYA 1BCRA 1T35A 1DQZA 4BCBA 1FMLA 4HNGA 5I9MA 5CYFA 1E2NA 1Z6TA 1HNWB 2IPOA 1YZYA 2A9VA 3QU7A 2A1TR 5KNBD 3D6JA 5C1IA 4LFAB 1ZHFA 3AHGA 3VR3D 1M6NA 2CDBA 2HDOA 2Q6KA 2JLUA 1GZHB 3GP5A 3MYRA 1JF8A 4KX3A 2OG2A 3NV7A 1OV6A 4LEIA 4PWYA 5IABA 5FCDA 2GVNA 3ONVA 1D4ZA 3CGGA 2GPTA 1I8TA 2I2WA 4WDRA 3O8OB 5AJUA 3W4IA 2A9OA 2BFBB 2PGAA 2EERA 3HY6A 1Y3DE 2R6R1 3R3WA 3OMLA 2XHEA 3FTFA 3DHEA 3VV3A 2Q1TA 2YN0A 3MM4A 4MICA 1YULA 4Q4AA 1ZOLA 1SXJC 1DMRA 4XD7A 5ES3A 3ZGNA 2I8CA 1KEVA 1TT5B 2I7TA 4AQ7A 2O2HA 5JCZA 2R87A 2DPYA 3MTGA 1QR6A 2LCQA 3ND6A 1SG9A 4GX1A 5I4CA 2F1IA 3ADOA 4HLDA 3ENQA 4J9UE 5JJLA 1QYWA 2X6RA 3HCBA 2OCXA 4X6XA 3RV3A 2PTGA 5IFLA 1V11A 2G28A 3EIHA 4MVJI 4ZOLA 3WDMA 1SUIA 1GPMA 1EGAA 1YI8A 3DOEA 3FSEA 2C9ZA 3GB9A 1P80A 3KKNA 4CF7A 3O8QA 1G3MA 5TMPA 1TIBA 2IZOA 3HKCB 5B53A 2FZ4A 3PWSA 4M1WA 3SG0A 3FYTA 5GGYA 3AEUA 3UXHA 5A3SA 4YFYA 4EJSB 2XYQA 1V3QE 4G5YA 1XEWX 4JHLA 3QU4A 1LCIA 2H4FA 3EFHA 5LNK6 1JDTA 1W5TA 2FSFA 2VSXA 3L4BA 1NUSA 2EU8A 5DDIP 1TCAA 2A30A 5K3DA 5JXWA 4FEGA 2HHAA 5E0OA 3A0RB 3F97A 1XPRA 3GG9A 3QEMB 2P9FA 1JKMA 4UPVA 2R47A 4C7OB 4M88A 2BP7B 2H06A 2HD4A 2XUKA 3F7TA 1I3CA 5EJGA 3PNPA 4PYJA 2IC5A 4QJBA 1V8BA 4EBFA 2X8WA 4UHKA 1KERA 4D45A 3I4CA 2WJ4A 4BFXA 3THXA 5H82A 2H51A 3RAEC 5KNCA 1RAIA 3QOXA 4WBNA 3AKZA 3L6BA 3JATA 3JQPA 1XWWA 1H42A 4X8OA 1Y9DA 4BNDA 4X84A 2YWXA 2GNAA 3RS3A 4NCBA 2NYRA 3KEMA 1U6KA 1QH0A 1QMPA 1VGRA 2FN8A 2II6A 4L07A 1LBIA 3IP3A 4MITA 4XGKA 5CGQB 5ALPA 4GSLA 1QP7A 4L5IA 1M72A 3B6JA 3HCEA 1X1SA 1H4TA 4RZXA 2IIBA 4Y2RA 3ZW9A 2ZYGA 4BQIA 4EL5A 4QECA 5BWCA 1G5PA 3QSGA 1KZ7B 4PTYA 3AHFA 2VP6A 5ALLA 1SOWA 1AQ6A 5GV8A 1XCPA 1WJGA 5AW0A 3EVAA 1RYNA 3GMTA 4PZZA 3AG5A 2GN1A 1PSWA 1JFFA 1JYFA 4FGZA 4N3CA 4DXDA 2OD9A 3TCXB 4QTYA 1XRRA 2WUDA 4QJ4A 4UCXA 4DRXA 3SE0A 3FWYA 4H59A 4DWJA 5ELXA 1BEZA 1KC3A 3ROGA 3DMTA 1KI2A 3L01A 4BNUA 2VQDA 3BIOA 1LLDA 3H99A 4UTPA 1GTJ1 3S5UA 2ZS7A 3TV2A 3KVRA 2FR0A 5BSRA 5JV5A 1ZA1A 1KY4A 1LDNA 4WJLA 1KR2A 4TLCA 5EIBC 4M89A 5K01A 1EX1A 4XR9A 5FUMA 2HQRA 2RI1A 3WJ2A 4RZUA 2HN9A 1EGHA 4TXHA 3UAXA 3HP1A 4RACA 4C7BA 2BFFA 2PHZA 3WLOA 2CSXA 3NS7A 4Z4EA 5CIWA 3G1TA 1J8MF 3IJEB 4U9UA 4ZVPA 1VA5A 3QPUA 4W7HA 2C4NA 1BNCA 4QQFA 4JJEA 1F4LA 4PZ0A 1B74A 2H2DA 3INYA 1BE6A 3I72A 1DKQA 3BDVA 4GNRA 5C0OE 5AKLA 4ZJUA 3EJWA 4RZHA 2HU2A 1N3YA 3GARA 4DBZA 1V95A 1JHMA 4EGJA 1TIPA 3N8KA 4RV9A 4ZQCB 4CM9A 3TM4A 1J3UA 3OMWA 2V7QD 4HTFB 4EEKA 4X7PA 3ZS8A 2AH5A 1T2FA 3B1KA 2CXRA 1JG2A 1PVDA 4DCPA 1NMEA 3ID6C 2W2NA 3DHVA 4HH3C 4RD4A 3PDUA 4WT7A 4P8RA 2HL6A 1T36A 5DM4A 1NP7A 1RLIA 3AUSA 5HA5A 2B99A 2K2QB 5IYZA 2Y1WA 2KS6A 3ZV4A 5IAOA 2AI2A 2GWHA 5IBRA 4I5FA 1MB2A 5FIUA 3QEAZ 1ZW1A 2NTEA 4BP9A 1CLEA 5BYAA 2IYSA 4QG7A 1KI7A 1C1DA 2WU4A 4KXUA 1IK6A 4N12A 5CM9C 4BNKA 2BHNA 2V6JA 3AI3A 3EW9A 3L07A 5JVDA 2K2WA 1FTWA 3E22B 1VECA 2EDCA 1TM3E 3U26A 1TDJA 1EE2A 4P3KA 1BCSA 3A26A 4CQMB 3EQ8A 2NU8A 4PN3A 5BN1A 3IP1A 1UXJA 4GL4A 3UTDA 3A2LA 2BEWB 2XODA 1JWLA 2QIOA 1SHJA 4X8MA 1DG9A 4DIMA 5T3YA 4FE4A 3O21A 4HZIA 3N2NA 1SBTA 1EQ2A 4QRDA 4GICA 3F96A 5HWSA 4FUTA 1FSPA 4F38A 3DZBA 4B45A 5BWOA 3AKCA 4U8GA 5PNTA 5HQ3A 4L7VA 3DG9A 2ZBUA 1GZ5A 4FI3F 3G79A 4H4EA 4IHJB 1H6DA 2JEOA 1KAHA 3DTVB 4NK4A 4PAMA 2G67A 4A0HA 5KYWB 4K1XA 3AZOA 3U62A 1MO2A 4ZVVA 3CNOA 4F5ZA 5BW4A 1PZGA 1MA0A 1X8XA 4JT4A 1PFVA 1YUBA 2WWGA 4PM4A 1ZM3A 3D7KA 4BDTA 1X9GA 3AF2A 3GH3A 4GX5A 1Q3TA 3KHTA 1CNEA 3TD2A 3FSGD 3E61A 2X0IA 3H2YA 3GLGB 3QHAA 1CKEA 1NQ5A 2TYSB 2YWJA 4WNAB 4MUKA 2P2GA 1XLTC 3KL4A 2OV3A 3RGWS 2EJCA 4EEIA 1G8GA 1SZPA 3F5QA 2HY7A 3DD1A 2P7IA 2X8BA 3DCJA 5DHQA 2IQIA 1B0ZA 3IIEA 1HDCA 3AG6A 3LQRA 3DD5A 4GLJA 3RCBA 2D62A 1FYVA 2E1RA 4QQNA 4Z51A 3X43A 4MKGA 1ORVA 1ACJA 3TQQA 2B7CA 3L6UA 2W6NA 3HL0A 3NIBA 1W5FA 2PUGA 2JPDA 4DDMA 4LSWA 3KEOA 3AQIA 5EMMA 4L57A 5GONB 1CQIA 2LIPA 3HV2A 4MKHA 1M2JA 2NZJA 2P91A 1Q1GA 2ZWIA 4FYJA 4P7BA 4ZT6A 2BH9A 3WWOA 3TQSA 4EG7A 1PEKE 2X8JA 1IUKA 1QO9A 4ESVA 5JSFA 2ON6A 3N59A 5JU6A 4NS4A 1MVNA 3LYAA 3WDSA 2WU1A 1TZJA 4Y1RB 3V1KA 4Q1DA 4R2WA 3AIOA 2AA3A 3KQVA 4MW5A 4PBTA 5TEVA 3T5BA 2C77A 4CT4B 6Q21A 3OOJA 3BXFA 2Y76A 4IV5A 4G0WA 3HKEA 2QUJA 4CUJA 2NG1A 3KWJA 4H27A 2H4XA 3WGZA 2J4FA 5K8TA 3BFKA 4U3JB 3IEVA 4UC0A 1A9ZA 3BH7A 1VCNA 1U31A 2Y0PA 3IQXA 1MB0A 4FKBA 3R7LA 1V6SA 4FE3A 4LWOA 3JQ7B 4D9CA 4OQEA 5EE9A 2V0CA 2OYRA 4HDOB 1GRNA 4CCSA 5LL6P 4E6PA 4KAXA 2JLAA 1SC1A 1JR2A 5HCUA 1GSOA 2VJBA 4EENA 3HU5A 4QU5A 1PEDA 5BV7A 3EHEA 4BJ1A 3BMQA 1RWBA 2XRYA 4EMTA 4G89A 2JJ2A 1K63A 3PR2B 1UP6A 2O8DA 3SC4A 3EIEA 3Q9LA 3WRXC 3O5AA 1IBLB 3Q3EA 2X1HA 3C4JA 2JCGA 4PBRA 1KO4A 1B1AA 1IZZA 1MG0A 3CR8A 5AVYA 3CNEA 4HGRA 5DGCA 2ZSHA 1HE2A 5CCXA 4FMCF 4UM9D 2B37A 2WSSD 1I0IA 1W4ZA 2O06A 2X4DA 2ZSKA 3T06B 1CLUA 4CQLB 1RABA 1A4XA 2EEPA 2CJPA 2J09A 4AYWA 1LQTA 2BV3A 4DLTA 3CO5A 2LVBA 4ZO8A 4FMBB 4GOXA 1XK7A 3K72B 1SB9A 4MIYA 3TLGB 1A9RA 5G4KA 2OFXA 3E9YA 3O3NB 2VYVD 5EL0A 5JSYA 5KVCA 4C2UA 5D85A 4N3GA 2HF9A 4MS1B 4C0QC 4HAWA 1V4NA 1DS6A 1SY7A 3FCUB 3DO5A 3Q3CA 4G0ZA 1GGFA 4MS4A 5EIHA 4Z5XA 2CK3A 2WHEA 1Z08A 2F67A 3I09A 2ZI6A 4G3XA 3TX6A 3LBFA 4WOBA 4X85A 1FFEA 3OM0A 5LP6F 2MIIA 3QFTA 3PHBE 3T1VA 3SK0A 1NU6A 2C95A 3GRZA 4U6QA 4R98A 1MO4A 5FV7A 5JVDF 1SU7A 4G5QA 4BVBA 2FKNA 1E2KA 2G08A 4MLDA 2E5LB 2BKUA 4MV7A 1NVTA 2RC5A 3LQYA 4TMWA 5H80A 3QBPA 3TKLA 1H8EA 1M3SA 4LHSA 3DFMA 4CXMA 4Z9YA 4IRXA 4BKRA 2WLSA 4FJ2A 2ZSUA 3ZKAA 2YJZA 4GI2A 4CM6A 2HLPA 1L8OA 1PD1A 3FH0A 3ONDA 4LC1A 2PVPA 2R84A 5EEGA 3TGWA 2HLHA 5KJFA 1FRZA 4AAYA 1XZCA 1CIJA 1OV4A 3MD0A 5A06A 2V7XA 2WAXA 4LN1A 5D5HA 1H85A 3AHDA 3STVA 4DHEA 1ZOIA 2OE2A 3UW1A 4CL0A 3FCOA 1WZIA 2Q8NA 5SY4A 4KFTA 4ZGWA 1CRZA 1RRGA 3BD6A 3L9XA 1XCGB 4ROSA 3X3HA 2PD3A 1KP9A 3L5OA 5AK3A 2BFEA 3QUTA 4II2A 5EIWA 3TCKA 2JGNA 1U15A 1O6CA 2OZLA 3IUJA 1E2GA 2OO5C 4BC0A 4DGSA 3EXFA 3GOHA 5EUBA 3GFFA 2CHUA 4GXNA 2PEYA 3D6TB 2P1RA 4CCAA 2P4SA 4KYIB 4R1OA 1OPRA 4WK2B 4I4NA 5MFZA 3UJAA 4QVGA 2AJTA 1PJ4A 3WV4A 4BAUA 3LKVA 6REQB 2XTJA 4P5EA 1HKUA 1E6KA 4LIPD 3ZKWB 3O8CA 1JB9A 2BGIA 1WX1A 3L1KA 1KDYA 1BWPA 3ZEIA 3PRHA 1ZX1A 1NGSA 3C2QA 4HS9A 1Z34A 4P5DA 3JWEA 3TSCA 4MEJA 4FYHA 4QPPA 3DC7A 4K6FA 1U3UA 1KZYC 3CX4A 3HLTA 1TT7A 2ZCUA 3LUHA 3IV9A 4NDZA 8AT1A 1GAQA 2AQIA 4BHTA 2YJ3A 3CLRC 4LF7B 1QLWA 4ODIA 3PUJA 4L08A 1PJQA 1W9MA 1WXIA 3DMNA 4L78A 5BQFA 4QBGB 1YR9A 1YR2A 2HJ9A 2PZJA 2YTZA 3W05A 4ZEMA 1H05A 2QJRA 5H3LA 5A4FS 2EBWA 2CXSA 4UNNA 4BVLA 4PIPA 3TIXB 2VH2A 1X7XA 4DXHA 4YAOA 4OB8A 1NNSA 2H1FA 4MDYA 3VMMA 1YA8A 4CLXA 1K97A 4BO1A 2AMJA 4XUDA 1JG3A 2Z6VA 3LHSA 4R16A 1NR5A 3IQIX 3TW6A 4DR7B 4KOEC 1UBGA 2LKDA 2QEQA 3FYUA 5K7SA 2N46A 1TC1A 4ER6A 2HVGA 2GA9A 1FP1D 2FPKA 2NZVG 1C1XB 2VAVA 2ZIVB 4FWBA 4ZYUA 1KI3A 1K9SA 2FX3A 3G2JA 1KNQA 3MRTA 4GP6A 3ITEA 5ESXA 4KN9S 5K0TA 3H6KA 1Y8AA 2EP8A 1HEUA 1YU6A 2G72A 3OE7D 1BOOA 1SKYE 1H2FA 2R6HA 2R86A 2XKAA 3QLVA 5E3JA 4IIVA 4WN9A 3JZDA 3U7EB 2JD2A 4ZYZA 3RIHA 1P0MA 2ORWA 5KYWA 2B25A 2KI5A 2VHWA 1FW8A 1OI7A 4J0GA 4QFMA 4PPQA 4KWIA 3C3PA 2B6NA 4IIHA 4XSHA 2FSUA 3ASYA 3DV0A 2O2JA 1TTHA 1RNLA 1L4YA 1MJHA 1X19A 1JYSA 5EN4A 3AUAA 3S28A 2JAUA 2JCSA 2ZM6B 1U04A 4R2IA 3GW8A 3F3SA 1FMFA 1YQUA 2HA4A 3LUAA 3K9WA 4ZT3A 1UL1X 5J4HA 4O3MA 4DDTA 3ZXUB 5JALA 2XEXA 1JDVA 1WU8A 3NR2A 4HH0A 3KAJA 1T5SA 4N8DA 4LC9A 2OQRA 3QQ5A 3FHCB 1VP3A 1S8OA 3D3WB 3RDPA 3Q12A 1L7XA 4HQKA 3AV3A 1E2PA 4HL6A 1ZI6A 4OI2A 3L0OA 4PPNA 4UBMA 5TX7A 3L8CA 3PUWA 3V4FA 4DA7A 1SVUA 3FSJX 4L8WB 2P2CA 3RB8A 4BRUA 1AQJA 1E4OA 1UK9A 2NOAA 1Z2NX 4RLFA 4EB6A 3C3WA 3FTDA 3RIXA 4ED9A 1LNZA 2R6FA 1VL5A 1M0EA 2Q4DA 3KTAB 3V6MA 2VDPB 3A1CA 4BNFA 4FM9A 4H6PA 1M1NA 1RRMA 1YQ9A 3B9QA 3PQ2A 4JBNA 5FPQA 1TQ6A 2QZZA 4X64B 4JODA 4YRRA 2Q46A 2YRXA 4PRYA 1JVBA 1U7TA 2X9GA 1G3IA 2XQFA 2BFCB 2JBAA 3I2JA 3OLVA 1TEZA 3H2SA 4MUFA 1FX1A 1PWEA 2PQ6A 4A27A 4KODA 1R8JA 1AZSC 1CK4A 3KP1A 4TTQA 1L1FA 4ZI7B 4I55F 2FFBA 3R9KA 1OLUB 4C7VA 1XEWY 2JGAA 2XZDA 3T34A 3MBIA 1CJCA 1R66A 5P21A 1EFHA 3ABIA 2C42A 3WJ1A 3WLPA 3OIVA 1VKHA 3E3MA 4G0NA 5KNCH 2CW5A 3KXKA 3FIJA 4MV3A 4KACA 1BS1A 4U6SA 3WB1A 2PGOA 5JSZB 3DAYA 3FVQA 3FYSA 5DM60 3HN6A 5ALKA 3GGGA 4C7XA 4A2WA 1JN0A 1JIXA 5AVSA 3G3EA 2JLQA 3KTFA 1SBCA 2REXB 5AXBA 1F2TB 4Z3DA 3U13A 1NR1A 2L0XA 2ZTUA 4NG4A 4LOHA 4RSMA 3JQ8B 4X7MA 4DG8A 1R1DA 2D1SA 1C14A 5IZ4A 3GELA 1EFCA 2FI1A 2VDOB 2Z30A 1UZMA 3C6MA 4TYMA 4X5OA 1QR2A 1YR7A 3IJRA 1W36D 1Y1SA 2YWHA 4MRMB 4TTPA 5A04A 1E4YA 1VKJA 5KC9A 5B3KA 3GA5A 3JAMA 1M34E 4NU6A 4ONEA 2ZPAA 4PIMA 4C4XA 5CBPB 2WR8A 3KHKA 5FWXA 3VNRA 3KKMA 2Z5FA 4HGZA 4RKYA 3D0OA 1CY1A 1KL7A 1RFGE 2HF7A 3DJFA 3D3JA 1RBYA 4GZ6A 2GH1A 3SC3A 5IM4F 1CG6A 5B5SA 4HH4A 4BNLA 3BPSA 1PJTA 5F2EA 2ZXEA 1D8AA 2KJQA 2LCIA 2OXRA 2BP7A 4F2WA 5JXHA 2VQFB 2B8WA 3BZUA 4JLJA 3DBLA 3CPJB 3FOWA 4KAAA 4OX9Y 2XGSA 4ZVMA 4F7DA 1Y1TA 4HDRB 3TYXA 1GZUA 1WUTA 4D4LA 4Y6QA 3FBTA 5K05A 1S2IA 4K40A 3DBOB 4MS4B 3G0BA 2CZGA 2W6JD 3HKDA 1AM4D 2HCBA 4X95A 4CR6A 1GZDA 3B51X 3T0FA 4N0PA 1FBNA 2OAGA 4K9KA 2GYYA 3VOBA 5CFQA 5LB4A 3WVNA 4RK5A 3AB8A 4BNZA 2YIVX 3AK4A 1GYPA 1LK0A 4UFNA 1KYXA 2PZ8A 2I2DA 4I81A 3DEZA 3WLAA 1FVFA 1HL7A 4MJXA 2CYCA 2GJ8A 1POWA 1UDWA 3CKLA 1U2GA 5JDCC 4BFWA 4D79A 4LNUA 4QYIB 1HYEA 3IVXA 2Y99A 3AY3A 5HIJA 2PO5A 4BAGA 5KTSA 2AS0A 1OKKD 2LP4Y 2NNLD 5BURA 2BKXA 3A3NA 2BMWA 3LY9A 4R9RA 1P1KA 1TVKA 3S1LA 4KNVA 5JSQA 2YIJA 3TVDA 3TTSA 2IHNA 3ZLTA 2FN7A 1SK8A 2FQQA 3N9IA 4UVEA 5EE1A 1B14A 1SXJB 3ANNA 3DMPA 5K0EA 1X3SA 2OORC 2PX4A 1NLYA 2FJ0A 2RGCA 1ZRMA 5K0FA 1USIA 2WICA 3VI3B 1E0KA 4YCAA 4G4SO 2HV8A 2WBLC 3IGFA 3LVQE 3Q6MA 1LW7A 1FLVA 5EJ4A 4QHYA 4EY8A 3E8MA 3FF1A 4DSAA 3IPYA 2CEAA 3RRYA 3D81A 3IPAA 4QIHA 2WVHA 3PRYA 1GTSA 5H1YA 2J9YB 3KJFA 3ETCA 3R6LA 2I03A 4Z1OA 3DDSA 4M49A 2PCJA 5E7JA 4ZVRA 3TG2A 2JA1A 4E5NA 2AK2A 2ORVA 3WAJA 4A8JA 2FQWA 3CEAA 1TU3A 1X2BA 1ZDMA 1D4OA 2Y93A 1FLDA 3HDJA 3KKLA 3TZLA 2E4XA 3L0ZA 1NNUA 4IWNA 1V1MB 4GKBA 2QZ4A 5LBUA 3U7QB 2P78A 3LK6A 1ZK1A 5A05A 3IDAA 5IEJA 1MAWA 3NP9A 3PHHA 1R0XA 1M76A 2VTBA 2RGYA 3IUNA 3K7EA 2HX1A 1K1EA 3MTJA 3C5VA 4F21A 3HSYA 4DLKA 3UA4A 1THZA 1W4CA 3EPJA 2B5WA 1T1IA 3EBPA 1M5TA 5AP9A 4N4AA 1AS2A 4YBRA 5CLGA 5ANRB 3VUEA 1Z8NA 1HURA 3LKZA 2GETA 1L6IA 2BLLA 3L84A 2ZUCA 1NQXA 5FB3A 2HJVA 2R11A 1VMEA 5MN4A 4DPMA 2H1HA 1TM4E 4PVDA 2Y1LA 1H3EA 3ICQB 3HYRA 4IAOA 3CZ5A 4LYFA 1CJVC 1P3JA 3ELBA 5AWFC 3I45A 3SVZA 4KXMA 3R6TA 1X92A 4RELA 4FDAA 2X0DA 5FNZA 5HGXA 3OI7A 4M99A 4CTNA 3QPWA 2XB6A 3D7MA 2VJOA 3EEBA 3EGVA 3PDHA 4FJ1A 3K0CC 4TM8A 3T5GA 1XQVA 2VPPA 3HMKA 3EYAA 5FTLA 3AI2A 1R6DA 2F3SA 5FOXA 4ARCA 3VFDA 3EMDA 4EB0A 4QU8A 1HNXB 2G1PA 1FVHA 1CF9A 3PFNA 1PDVA 2D5BA 1I7LA 1LBQA 1KNXA 4LI3X 4Q47A 5HQ3B 2XTZA 4JKIA 2ZYIA 3SZGA 3DL7A 3M2PA 2XH8A 3K4PA 3LYLA 4FGKA 5LCXA 2QM8A 2Y0CA 4CM7A 2Q3CA 5I9IA 3SHOA 1DIBA 1KKMA 2W22A 3GA0A 3HZHA 4DNFA 5A62A 1ULAA 3UPTA 1WA5A 2HQBA 1T4DA 2FFRA 4O6VA 4LMBA 3QOYA 2CLLB 2QSJA 1XZJA 4UU8A 5TJHA 4ER5A 4LXHA 3ULKA 1FMJA 1W5EA 1NN0A 3IH5A 2MTBA 4TQ9A 5CU7A 3BT7A 1CFJA 2IXEA 3NM4A 3R44A 4DKXA 1YV9A 3W8RA 2YH2A 3BN3A 4FEEA 4MRSA 3P4XA 4MLPA 5EUCA 4UDOA 1UPTA 4LVUA 1VSQA 3VDMA 4MVCA 3JQ9A 2V7WA 2OGUA 3OZXA 4F5DA 5L7WA 2R1VA 5J5AA 1K7EB 4S1PA 3BGOS 3TB6A 2YHUA 6YASA 1HDZA 1GKUB 2AN4A 2BWJA 3TM5A 2CEKA 3ZV3A 1KJ9A 2FPSA 1P1JA 3FAZA 1ZUHA 1Z07A 3TQOA 1YZNA 1T6NA 3DLHA 3QELA 2ZBPA 3CB4A 3O47A 3BREA 3NANA 9MHTA 2P2LA 4XYBA 1E5QA 2B6HA 1HDEA 2P77A 1O97D 1KQOA 1PUXA 4UNRA 4QNRA 3QMWA 1JQBA 2X2OA 4GI3A 4KNWA 1S0UA 4M54A 3TB4A 4BQRA 5IKXA 3A31A 1OXUA 3OZTA 1J9EA 3BX1A 3ZI4A 2BR4A 1U80A 2JHFA 1YVEI 2V8BA 2WWWA 4B84A 4G24A 1VOTA 1H2WA 1DE0A 1NBAA 2HIHA 2H1IA 1H2EA 2QMEA 2WPDD 2X15A 4FSHA 4QYMA 1GPH1 4BN4A 4P0QB 4M9UA 5DEIA 1P5HA 1L7QA 2R4UA 2EW1A 3A9WA 3AILA 3EZNA 3PNQA 4RL4A 1I7DA 13PKA 3WYAA 4I08A 3I1YA 3N6RA 1ID8A 4Z4IA 1DXOA 4YRCA 5HCIA 5ARBA 5BN5A 2QW8A 4WOPA 3QXCA 2CE2X 1BX0A 4CG3A 4DIDA 4E5SA 4Q4CA 1L5RA 4ZDIA 2DFKB 2H1WA 3KWLA 3QYJA 3REGA 4N18A 2OK8A 1HXHA 3NAZA 2BEKA 4G0OA 3A3PA 4OEHA 5EE0A 3WC4A 2WYHA 3OLZA 2QTRA 4TL8A 5ICMA 4DMKA 1J22A 3GRUA 3E35A 4YP7A 3RUHA 3V2HA 3EGIA 4CKYA 4BXOB 3LO5A 1PFWA 2XNCA 1RTTA 3QP9A 4JY7A 5K3SA 3UGKA 5FOUA 3EC7A 3Q3GE 4J0EA 4BWGA 1SUSA 3AVPA 3AHJA 1HTBA 5K51A 1SEPA 4DJTA 4KZKA 1G4UR 5CFOA 2NXCA 4XJSA 521PA 4BC1A 5FYDA 3K0FB 1NJGA 4JROA 2WD9A 2WTBA 2G1AA 1HZZC 1N5MA 1J0AA 4HMQA 1FU4A 2NXNA 3C3MA 1Y34E 1ZG3A 3H86A 1FUEA 3EZFA 1CETA 1G2PA 3HB9A 3MD9A 4NZNA 4PPFA 4FCWA 2DPHA 3JQFC 5H16A 1HE8B 5C37A 2DQ4A 4P92A 2MSEB 3B6ZA 1CNMA 1PNOA 4KMOA 5KWVA 2HYDA 4K6CA 4NDAA 3BWXA 5IJ0A 2D6FA 5I7EA 3O7WA 4M8LA 5CD9A 4AY6A 4LYYA 2RGBA 1WF6A 4KO2S 4W6ZA 3LY8A 5C1DA 1KQ7A 1G21E 2BJVA 2H4ZA 3MLEA 3S2EA 4E13A 2IPLA 4FLFA 2CYBA 5AM2A 4HNSA 1JMVA 4F4CA 3P2KA 1L7EA 1OVGA 4KXLA 4Z8YA 1NY5A 4I19A 3R9WA 1Z12A 3B9BA 4PS1A 2FW0A 1JSZA 3RJ5A 1A1VA 1GEEA 2XJ9A 3IMFA 2FDXA 4UAUA 4BMPB 2O05A 5ADHA 3A2NA 4ESOA 1DIHA 4YCNA 4B3BA 1BJRE 5H3HA 4AURA 3PC2A 1C2YA 4L0QA 4MINA 4XCXA 4AY4A 4EG3A 3WICA 5C8YF 2FUKA 5B7PA 2ZATA 1ADCA 4AJPA 1DFGA 1II8B 2FGJA 4QQKA 4EUKA 1WG8A 2BDUA 3SPXA 2IYWA 3MCTA 2O0KA 1AQIA 2FQ1A 1TEVA 2KPOA 3NAQA 4BJHB 2F43A 5ALDA 5KYTA 1NF2A 1RKUA 1ZRNA 2XBMA 1JE1A 2JGLA 1NI5A 2HWKA 2OO5A 3GUZA 3JWJA 4KQXA 5DWDA 2PUBA 2YZGA 3U17A 1DXQA 4MUGA 3WQHA 4R54A 3CLTD 2YWFA 3DV0B 5KZMB 3KELA 1MMFB 2ZZNA 4A4DA 2IXAA 3FTEA 3EAQA 2R7LA 3NUQA 1F2UA 2CDRA 3GT3A 4RTSA 3LGAA 3BRWA 3FKJA 1Z83A 2HMSA 4I8XA 5BN4B 5IASA 5KQRA 3UPUA 4D80A 1DAKA 4PCUA 3MWKA 1TLLA 2CUTA 3KDPA 4DMCA 2C94A 4PCVA 4DDHA 3JZMA 2VRCA 3S2ZA 4HYQA 2FUG6 5K0CA 4OP2A 1Z33A 4NBWA 3SHQA 1E5LA 3F6EX 3C8MA 5DSZA 3A8TA 3T61A 2KBFA 4YJKA 4ZXFA 1AV6A 3HY4A 5HM8A 1OPXA 2X86A 1FS5A 1LVUA 3DEAA 4L73A 2BZSA 2E18A 3M9WA 1NN5A 4RSRA 4D0LB 2G9QA 4D4JA 1SVWA 1M1NB 2GFIA 1X80A 2BGUA 4LJ5A 1A8SA 1PUIA 1SQFA 3M6LA 4Y2JA 5CJ2A 3ESAA 3TOXA 4ZO7A 4U8HA 2BKEA 4KMSA 3A6ZA 5CHYA 1UFKA 5JRZA 5IRCD 1M6YA 2QRKA 3KCNA 3TQCA 1K6EA 1XRLA 3KU1A 5ALYA 1EG7A 5KIAA 3BWDD 3KNZA 1X7GA 2Q29A 3B70A 2PUAA 2M6SA 3R20A 3PGKA 4Z4FA 3IT3A 3BGWA 1B16A 4GMGA 4YO8A 4GH5A 2YWRA 1WD5A 3K4HA 3KZNA 3I4FA 4UHEA 5ADVA 5A71A 1VL2A 2SCUA 1R0CA 2VQ3A 3C8HA 1H9CA 1EKXA 3L7KA 1CVIA 2CLCX 4IGAA 4O2BA 1XMPA 2X76A 2NADA 4IUDS 4II7A 2FYTA 3HPRA 4ZC8A 3UT6A 4S04A 4DIUA 1G59A 1TF5A 1XTSA 2EARA 4W9MC 1YF3A 1QYXA 1G6HA 3A36A 4M0EA 5EMLA 1QRRA 2XOEA 1IN8A 3CWZA 4AY5A 3NWBA 4EEXA 1E0AA 2NZ2A 4FPXA 2XMQA 3E2MA 2ZU0C 4G25A 1Q20A 5HYVA 1CUWA 1DAPA 3G0DA 2PSEA 1MJGM 1VJ0A 3LDHA 3PLNA 1SZCA 4BN0A 2OO7A 4JUBA 2XPCA 3AP1A 1JWBB 3W6OA 2J0VA 3T3GA 2OLJA 4OI0A 3ESBA 2VUIB 1S01A 3LQKA 1KQPA 4MV9A 3TPCA 4E2YA 1GZSA 4HJXA 3F6YA 2G5PA 3LL4A 1AS0A 1RYFA 3K96A 4JL5A 3KUXA 5E6SA 4BMXA 1JX6A 3K73O 4NV3A 3KAKA 4GLLA 5HF5A 2GESA 4WSOA 2MINA 1VG9B 4KR3A 2BGTA 2ID7A 1KEEB 2YVQA 3L05A 3RO7A 4IL5A 4APBA 2G70A 4LVOA 4D74A 2IOYA 1CY7A 1EB8A 1MIHA 1OXKB 3K92A 5TGZA 5DBEX 4ZU6X 4D3FA 3JYPA 4ZA2A 4F0JA 4JLPA 3RFUA 1PTKA 1SXGA 2CT8A 1SM4A 4JNKA 1ZJJA 5DP2A 3VR5D 1P0FA 4RV4A 4URHA 3WNVA 2CGEA 3QBJA 2A3RA 5A3VA 2RK4A 2OCDA 3HB7A 4GPTA 5TF0A 4DMGA 3G7NA 1IOLA 2NUAB 1UOOA 1CUFA 2PJUA 3U4DA 4EM6A 3ZGZA 1J8FA 2YWBA 3AUJB 4O02B 1NNEA 2YMPA 4B4DA 4BNIA 1FPMA 1K5PA 2NT3A 1HORA 4PV7A 1H2YA 1Z5UA 1QFJA 3MBOA 3TQTA 4IHJF 2PMWB 1OFVA 3DZJA 3GRYA 5CYOA 4LOKA 3ADDA 1Z36A 1MQ9A 2X1MA 1Q0RA 1A69A 2EHDA 2ZVQX 4MQEA 3P20A 2J0QA 2H1CA 1O8BA 1YKGA 3JCZA 2C5SA 4MR7B 3RKRA 2D0DA 3HABA 3I0MA 4NYMQ 1P2UA 2E4YA 2X1LA 3CR3C 3UK7A 3WK7A 2OXCA 4EIWA 1D8TA 1JU3A 4HDQB 4K8OA 4CTKA 3KQNA 1WABA 1DCFA 4C7OA 4JITA 4PYNA 3SZMA 3WBKA 2X42A 3LKBA 1Z5ZA 3LOQA 4NSLA 3I2GA 5FTKA 5U4XA 4KK3A 3RYCA 1G20B 1T3GA 2QAGA 2WV9A 1I4EB 1MBZA 3CNBA 3KT3A 2AW3A 2QRNA 4E21A 3IAAA 1WB6A 4QSHA 5F64A 3NCHA 3W1WA 1IN5A 2C59A 4LECA 5K09A 5DIFA 4D1YA 3NRBA 3VNSA 2CLSA 3BCUA 1USVA 1RPNA 4CMBA 3IQFA 3ZZNA 1ISSA 2QT0A 2A2ZA 3NVDA 1P0QA 4X62B 1MOSA 1WL8A 2ZRLA 4Q9IA 5JHGB 2E21A 6ADHA 1NTRA 3EARA 3UB4A 3L04A 1L4GA 5LA6B 1W87A 1ZXLA 3E82A 1EDDA 4IDNA 1Y8RB 2UXCB 2QT9A 4BLOA 4PFJA 5BORA 1E79A 1L4NA 3GZ4A 3ZKWA 4E03A 2UV8A 4Q7LA 3FNIA 3F74A 1I4OA 1AE1A 3VUFA 4JI2B 3OURA 1CE8B 4I4IA 4PIVA 4R2XA 2RHJA 3DJYA 3EVZA 3AGQA 3LF2A 3HI4A 5K3FB 4JI1B 4F85A 3TIIA 3VR5H 2HSGA 4P08A 3PFBA 5DE3A 1BMTA 2WIDA 2UZAA 3QUAA 1YS6A 2YZNA 4GQIA 1RI5A 4H2DA 1C8BA 1JXAA 2WAMA 3B2NA 1AU9A 4K3UA 4LY3A 4NPCA 1RLOA 2F3PA 4QYWA 4XJXA 4AG3A 3ZHSA 5I45A 2OSBA 1KWKA 3IE1A 4IGEA 4MWZA 4Q9HA 1QCYA 1A5TA 2V74B 5T7BA 2IDMA 1HK7A 2AKYA 3OQVA 1MB4A 5D5QA 3G2MA 3DZGA 1IB6A 5IJ0B 3KVOA 3EB9A 3W3ZB 4HCJA 4ITVA 1DDOA 3CISA 4YHHB 4PCLA 4LX0A 4DBLC 1JT2A 3RAPR 1CY6A 5KJ6A 5FBLB 2KLBA 2JGIA 4N1AA 1O4WA 1QLJA 3L7BA 3L49A 1Y8ZA 1E0SA 1JA0A 2ZB2A 1E9RA 4LTMA 1ZL0A 3OIGA 4R8RA 3ZGYA 5IKEA 5LN1A 2WW8A 3U31A 2GHRA 1QANA 1SELA 2HRBA 3NDIA 1VG1A 5DBIA 5GIOE 1IY2A 1DUIA 1EDZA 4IRUB 4KN5A 3K1TA 5A5DA 1J8YF 1GU1A 4MWSA 4X7BA 8ATCA 3INTA 1GGMA 3P2OA 3LUCA 2QMOA 3GUHA 1FLNA 1KPIA 3SX4A 3ROTA 3ZCTA 4LMRA 1C3JA 1JZQA 3L5KA 5AESA 3PHJA 4HVLA 1B8VA 2JCYA 4PLCA 3ETHA 4XWGA 4P6VF 1H1TA 4JAVC 2SBTA 2KLHA 3MIIA 3T1TA 4M21A 2FG5A 3NHYA 3PHGA 1V7CA 3DV2A 1Q83A 3NIWA 4L8YA 5EUQB 3VC7A 2NTYC 4AZ3B 5LP1A 1U8FO 2Z58A 3CZ9A 5K2MA 5BNTA 5JS7A 3TLCA 1PG5A 3AHEA 4QTTB 4ZRMA 3ZQUA 2H9IA 2L18A 2ZLBA 3PENA 3VR6D 3U7FB 2I4IA 2ECFA 1ZL2A 2GQ0A 1COWA 1HFKA 3OZEA 4KBYA 1QYVA 3BHNA 1V26A 5HMLA 2XUIA 3T4PA 4JC0A 421PA 4IKPA 1MHPA 1T29A 3W06A 1I2AA 1X8JA 1VMKA 4K6MA 4V0ME 3MILA 1ZIPA 1GN9A 3E9ZA 3KTAA 4U7GA 2I2AA 1FE8A 1VKZA 1QK4A 3GU3A 3FGZA 3TQHA 4RL6A 1G7TA 1CB0A 1ZH0A 2XVAA 5E2AA 1SUFA 3MT7A 1Q3HA 4G8DA 5K0LA 1T0IA 4D9HA 3L7JA 3S81A 4QJ5A 4R6XA 5IYZB 1U6JA 4N3NA 2PGIA 4IIDA 4D97A 1U0EA 3CR7A 1N7HA 2R7NA 3T7IA 4A5SA 1H8HA 3B9RA 3P9RA 1KQFA 1RW4A 3WKBA 3RYIB 2IYFA 3BQNB 3HCAA 3GJ7A 5KX5A 4N0EA 5T4EA 3IUYA 4JMPA 4PC7A 2QRPA 3PD1A 5F9FA 2BSQA 3FWKA 1HDYA 1RHQA 2HRDA 5I7RA 4BVJA 4QULA 5FNVF 1JALA 1IHDA 2Q5QA 2QLTA 1C7FA 3B6MA 3D5TA 5ECYA 1DADA 2GEVA 4QO7A 4ZCLA 2TMYA 1Y1QA 3KSAC 3G2KA 4MJ7A 4WJZA 2JAPA 2QZJA 3N70A 3Q8XB 4G81A 2G9VA 2HA5A 5J59A 3TTVA 1JIKA 3X2SA 2YJ5A 2Q6TA 3ABRB 5L3SB 4U4AA 1NVVR 1ZOPA 4LBVA 1DMSA 4ZKEA 4UU0A 1XJ0A 4W1RA 3WLMA 4I1RA 3W4KA 3DTTA 4Z49A 2R751 3EFOA 1XMVA 2EZTA 4OGGA 1UBJS 2HHCA 3UAYA 3NBQA 5JXIA 2GILA 4KR9A 3HVIA 1PJAA 2GR9A 2JCVA 2QAIA 4I99A 3ZZUA 2ZT7A 1SGWA 4YRFA 3IKVA 3KYCA 4H1VA 4WXEA 4JJGA 2FA9A 3EF1A 4JJFA 4XIFA 4EJFA 1RC0A 4RZ2A 4J75A 5F7XA 3L40A 2NGRA 3HXKA 2XMBA 3O83A 4IY1A 3RRXA 4ASUD 3E7XA 5CB4B 5JZVA 4J2OA 1PFQA 2EV9A 2G36A 3UOGA 1M10A 2DCMA 2PH7A 1Z47A 2XHZA 3KZVA 4TLBA 4U0JA 4CBVA 2O7SA 1SKAA 3SSAA 3E03A 3SQWA 4KR6A 3ZTTA 5L8VA 3DW1X 2DUJA 1OT5A 2RJOA 1RM0A 4KHPB 3PKZA 5SYAA 3SS9X 2BTEA 1F06A 1IM2A 1YNSA 3MUFA 3LI2A 1UAAA 3AVWA 3MPOA 2EZ8A 4ZYXA 1GPKA 4DIOA 1DKUA 2HLNA 1OJ7A 5HS4A 2O2DA 3CIOA 3HE3A 3R40A 4GR4A 3ZLUA 3K0SA 3H83A 4Y6LA 4CM8B 3FFTA 4WBNB 2BLNA 3FGPA 4Y67A 4U7DA 3L8HA 2ZB4A 1C50A 1UIRA 1Y8QB 3PGLA 2JF0A 4UM8B 5FO0A 2WNIA 3UJ7A 2CBZA 4IG4A 2A5YB 3AP3A 3MS2A 1ESZA 4OQZA 1QGED 1W25A 1XRNA 2AJCA 4BL5A 5KNBA 1OX5A 4DIBA 4MV8A 4MVJF 5HF6A 2HFJA 3V7WA 2IELA 4JP1A 3COZA 1N4DA 3REQA 4PX2A 3F98A 4EO9A 2AT1A 3MOIA 1DBQA 3C85A 4ZAZA 4RTQA 1V5GA 1PT9A 3DWEX 1S8NA 2Q50A 3FAKA 3E4DA 2IU6A 1L7OA 3IMKA 4RJJA 2X75A 2EYUA 1UZNA 4I1SA 1SXJA 2XF2A 2V58A 3WZLA 1PWZA 3ZWMA 5AQ1A 3EG9B 2YXBA 1PFKA 5BSUA 1GQFA 4EP1A 2VJPA 1Q0LA 4XLZA 4M7PA 3R7BA 1XJQA 4E14A 5FYQA 1D3AA 1UDAA 2BL4A 3U56A 1DIRA 3EXEA 4OMUA 3S2IA 2D5IA 1SUAA 2ZWVA 5I7AA 3TNJA 3WOVA 2K7FA 4MLCA 2WSYB 5BVHA 3K0HA 4A9AA 3ENZA 3FOEC 3OWOA 2FP4B 1ZESA 1WD7A 2VBIA 3HDHA 5CJJA 3JALB 4ZMSA 4PO9A 1QIFA 4A6PA 3K5HA 5G4LA 5FFFA 4YECA 4RFLA 3K1AA 4DVGA 2BGLA 1QGUA 3DV9A 2DY1A 3A4NA 3HV0A 4CL2A 4E7OA 2D7CA 3RTDA 2JIRA 3M0EA 4FW8A 3EQZA 3PXEA 4R9UC 3N05A 2O4CA 2C2KA 4PO1A 2D2IA 2NAFA 2PS3A 4N65A 2GPWA 1BJKA 5FWDA 1PV1A 3DUWA 5B1SA 2PD4A 4AG6A 2WV7A 4EABA 4KVFA 3IUEA 4JLDA 3V6LA 4FNAA 3JD4A 3QSYA 3TECE 3LVRE 2VK8A 3H11A 2QJTA 1T36B 1F0PA 4IJUA 2PSJA 4QO8A 4X94A 3PI7A 1DT5A 1DC6A 3VV2A 4MGZR 1U3CA 2ZI7A 4Z0HO 2ERXA 2C3MA 2PZEA 2GO7A 2FEWB 4JEMA 4BU1A 4ZAVA 4C2TA 1QORA 1V5EA 2ID9A 4POOA 5FDFA 2DH5A 2VT2A 4IGIA 3S55A 3UV6A 3WMGA 4HWTA 5A6VA 1EFDN 4DMUB 2EBFX 4DR3B 2PANA 3FHLA 3ZWXA 1E8MA 1XTZA 3CVVA 1ORTA 2ZRIA 4R9NA 5SY9A 4H18A 3ZYCA 2JLZA 2A1IA 2GARA 1TQHA 2IW3A 4MS3A 4S12A 2I4NA 3VPAA 5JJKA 2A78A 2JAHA 3G8DA 2MSNA 2D00A 2VZEA 1EMDA 3KXIA 4UNPA 4XEUA 5DYWA 2BDEA 2OBXA 2PSDA 1PNQA 3IKJA 3R24A 4KXVA 3TNDA 3DHYA 4ZZIA 4AYTA 1LX6A 4I9NA 1GZVA 1P4GA 4QUHA 3C97A 4CEJB 5K6TA 2ZG6A 5GY7A 2FWAA 5JCOA 2VNHA 3F7OA 5A9TA 1A8PA 4HRYA 1YS7A 2HXGA 4D0RA 4XSGA 3PFKA 1R5JA 3SBOA 4S24A 1Z4IA 4IDPA 3K9GA 4ZIRA 3AFNA 3GGCA 2YKGA 2OY0A 4F4IA 3U4MA 2AD5A 4W82A 1AKRA 1QIEA 2XNJA 1LFAA 4RHUA 2GBFA 3HXLA 3ICWA 3FCEA 2I3ZA 4GP9A 4Q19A 4FYPA 1AN0A 5CEJA 2OHFA 1R6BX 1Q11A 3W5JA 5C7YA 1MO3A 1F2UB 1YB7A 2BBSA 5D00A 2ONZA 2H4JA 3BMNB 4KXWA 3QKTA 4PLYA 1Q15A 3RBXA 3WDKA 3O1IC 4H3VA 5F21A 3VVLA 3P96A 1EK6A 1OTYA 4IF6A 3WJ7A 2FW6A 1KJQA 2IEAA 2ZUUA 3SR0A 3SSOA 5FLKA 3E9RA 2JBWA 2ZYSA 5A02A 1H0RA 3EQ2A 4WE3A 1CJKC 3QI7A 1BWRA 1U1FA 4D4KA 4UVHA 5F2NA 3PPIA 3A2MA 1T2DA 3BQ9A 1Y4SA 1G7RA 4RPGA 2XZOA 5LMZA 2QTGA 2BW0A 2QQGA 4FLMA 4FGSA 4NABA 4YJFB 4M9SA 4XE5A 2DQZA 2I67A 1NMYA 2I4TA 3NHAA 2DFDA 3DQZA 3IKLA 3AJAA 2TMDA 4I1VA 2A7XA 3JSAA 3SCZA 5CYGA 1RPZA 3GT4A 1APBA 5JZBA 2GN6A 1QB8A 5JMOA 2IYXA 4LK3A 4AJOA 3IEXA 5DSXA 5CCEA 3VH1A 3LZDA 3JQAA 4UHJA 2NUTA 3VJMA 5A0TA 1URPA 1QQAA 1R0YA 2QSUA 1X1RA 2GZDA 1MCZA 1CUVA 1RE1A 2MT9A 4HWGA 2EKPA 1MOQA 2FWNA 4UJ5A 2GCPA 1RKBA 4YMIA 4E4TA 4UM9B 1Q0TA 1G66A 3PGXA 2G83A 3FBGA 3RYIA 5TARA 1Q12A 2CZQA 5DCUA 3TI9A 1YZHA 2FX2A 1GG5A 2E89A 2XLBA 3I1JA 3KR0A 2D74A 3Q3JB 4H0NA 1NRIA 4NOKA 1BXGA 3LPCA 2QYOA 4Y9SA 4YJ3A 5DLDA 5FI0B 2ZVPX 4TTIA 1BKYA 3CI0K 3HUTA 4BFCA 1O9GA 4QX6A 1UWVA 3SJUA 5ALWA 3AESB 4IINA 4MGYR 3LZ6A 4XTCS 3INNA 5ALMA 1YCDA 2D0PB 4KQWA 4QZVA 2Q28A 4RV5A 2VYND 3DAFA 4D0NA 3U9SA 3S1SA 2Y1FA 1JEOA 1TM2A 1P7WA 2RJ3A 3BDIA 3DMRA 1ZWLA 3DT9A 3HEAA 3CLTC 3JYQA 4MO2A 4DNXA 4DWWA 4BJ6A 3QU5A 4KSBA 4TV8B 1NZJA 3GI1A 5M7EA 4BX2A 1J5EB 4JLWA 3KJXA 3O8DA 4FDMA 1CC1S 2IIPA 4WLVA 5JMTA 2WABA 3CF0A 3ELWA 3EMVA 4FBLA 3EIFA 5BN3A 1SQ6A 3ADCA 2EFEB 3FDZB 1E9EA 4PR0A 1PVOA 1W85A 1X13A 2PWZA 3CF4A 4D99A 1FXUA 1QH9A 1X7WA 5GJVC 3WHIA 3HXMA 5I5EA 2C7RA 4LF6B 1EFLA 2QQEA 4TT3A 4II3A 3BQMB 2HK9A 2J3HA 3I01A 3AFMA 4OLJA 4WY2A 3TQIA 4IMPA 1RJEA 2I8LA 1KYQA 2ZYVX 3IO5A 3A1NA 3SIRA 1T9BA 1T24A 4CQLA 1DT3A 2GRJA 5BRAA 1UPBA 3UJPA 4WWHA 2PXAA 1VKOA 5AJVB 3QTTA 3S2GA 1KI6B 2F6RA 4NAUA 2YMQA 4B6SA 4ENWA 4HNVA 1DXYA 3P9ZA 4GW3A 2ZUEA 4JH0A 1YCHA 1FMTA 4QFCA 5AVOA 4KPFC 4R1TA 4JYPA 3QPAA 2ZBQA 4RESA 1JI0A 3W2HA 4DLYA 3C3EA 1YZGA 1BGXT 3OESA 4R7GA 2IWRA 2UZ1B 4JI4B 1VXOA 3D6MA 3WNQA 2V1UA 4MQLA 1PL7A 2J7PD 4PFSA 2CXOA 5TQVA 5K8UA 4Q1BA 4XGRA 5AI9A 5IC6A 3DKPA 4EFLA 1TW2A 2ZAYA 1K06A 5JJBA 4EX7A 2FZKA 2HCTA 4DM3A 3CH7A 2H1LA 3G2LA 5CVEA 3WGIA 5KC8A 1RCFA 1SULA 2PZGA 4QXQA 5DM1A 1OYWA 5TXGA 3M8KA 1IXZA 4CODB 1KO8A 1YHYA 3DOOA 5BMVA 5A2QA 1N6IA 4CQJA 4LSMA 1UP4A 1XZDA 3ESQA 2MU1A 3EIOA 4KO8A 1YIDA 2PS1A 3N8DA 2LNDA 3A28A 5HKAA 5KVVA 3S68A 4L5AA 1HYQA 3Q7IA 1AA9A 1IDN1 1HH4A 2VP5A 1VPDA 4MRVA 1MJ5A 1PCXA 2OKCA 1TKCA 1T6ZA 1IZ9A 1VLQA 1N7IA 1SEVA 1XDZA 2IPMA 4IF4A 4XQEA 3RABA 4EJ0A 1CUEA 1EVYA 2O6HA 2GHQA 4NV0A 2GVZC 3NFYA 1Z4QA 2GZRA 3AF1A 3DQQA 1QGAA 4WXMA 3FVRA 1N1DA 2WD7B 4ZOQI 3IPRA 3HBLA 3D2CA 4IZIA 5ALGA 4BNNA 1PV4A 4IWXA 5KI6A 1KPHA 1TMYA 2GAFA 3NIGB 2VUHB 2NO9A 1Z28A 1IPFA 5EZ6B 4R8VA 3B8HA 2ZJOA 2Q3JA 1OA0A 5EPOA 1J1ZA 3IPLA 3TFOA 2P5UA 3E05A 3KUUA 1P8AA 1YJBA 1MQAA 3MMXA 3W5HA 5CPBA 5ENDA 3L4EA 3KQMA 1N3LA 4P36A 4NQRA 2ODBA 1R0SA 3KSZO 3V4PB 4CQMD 5I7SA 4U2EA 3F9CA 5CDYA 2IP4A 2DTXA 1KAEA 1OLXB 1Y1RA 2BFAA 1M75A 3AEXA 1JLKA 3NBFA 3PNSA 4ISBA 4JIGA 2W2TA 4IUBS 1W2HA 1Y4ZA 4HV4A 2H3HA 1OI4A 3OA2A 1IEWA 1LQUA 2C9MA 3AC0A 2FZWA 3EWSA 3TK1A 2QNIA 2PT9A 2XXAB 1I1OA 2DX7A 1ARZA 1K8XB 2FR1A 1FY2A 1MJNA 4KXNA 2VTEA 1Q2XA 2WDZA 2J6BA 3HCRA 1FDWA 2O7VA 5B7QA 5J2TB 5KCMA 3D7LA 3MGBA 3QMVA 1TKRA 4WEQA 2EGGA 4CKBB 1YS9A 4K9PA 5ENVA 4E5PA 3L8MA 1TKAA 2KBEA 4ZP1A 2VLBA 3MTBA 3L0IB 4KHZA 3UBTA 1T4CA 3VNBA 4N3BA 3T7TA 2LCFA 1XV5A 3HJGA 5C2JB 1X1TA 3PJDA 1L4UA 3WLSA 1FK8A 1J6UA 1SQSA 4O2AA 2HMUA 3TQFA 3V1YA 4BECA 5EP2A 2EP7A 3DKRA 5A4IS 4GBGA 2C5GA 4DDKA 4INJA 5I6DA 2ZROA 3KJIA 1VSBA 2HM7A 3KKOA 4BUZA 3FYUB 2BD0A 4RK4A 4ZRDA 4EW2A 2NO5A 2PMEA 1WMDA 2C4TA 4V2IA 2GLTA 2A0UA 2PRIA 4BQQA 4ALJA 4B43A 3EUFA 1YFJA 3B52X 4RSHA 1ZNWA 3I9V1 4JXJA 1JEQB 4H6XA 4HQLA 4MQ5A 1GVNB 1OU4A 3THOA 4GMFA 3LC2O 3U39A 3EFOB 3DDUA 1JPJA 2VJNA 1TM1E 4XQ0A 4ZDKA 4Z86A 1EK1A 4M0UA 3GLFA 3MJ4A 5TS2A 3THWB 4LXIA 3HS3A 2Y05A 3PFHA 4TTVA 4D82A 2XUQA 3F6CA 3H5NA 1WUKS 1Q16A 4Y2HA 4L3WA 4GMKA 4M9XA 1X8LA 4NJMB 4ZALA 4O2AF 5A5EA 1D7OA 4G1VA 3FDIA 3MZ0A 1U7UA 3DBVO 3EMKA 3F8WA 3LSTA 1GPLA 4Y6PA 4BB9A 5L51A 5LOVF 2CFIA 2MINB 4EF6A 1AF4A 3I37X 5EAIA 3PV0A 5DI3B 3TAXA 2I55A 3O73A 4XPZA 2PNFA 2MR6A 1PHRA 4XWOA 5ULLA 2F9FA 4WEOA 3QZUA 1VB5A 4Q00A 4QKQA 1PW5A 1ZD9A 4R3NA 3ZHTA 3LTNC 2XYPA 1VMIA 1DKNA 5IP5A 2GN9A 4J3FA 1NMSA 1DAFA 2J7KA 3SGLA 4Q7MB 1A77A 2OBMA 4Y9UA 3SDZA 3QJ5A 1MU0A 2AL7A 721PA 3BHGA 4YAKA 3SBXA 2C2OA 4IDOA 3TSWA 1KSJA 3TBKA 4EFKA 1P17A 1TPYA 3UW3A 4BMNA 2B1IA 2E4WA 4M9RA 1IQ0A 8ABPA 1EINA 1WW2A 4R1PA 4JT8A 5COAA 4KUEA 1RBMA 4NCJA 4RENA 1DJMA 3OOWA 4WK0B 1GFSA 3OP4A 1I2CA 1T9HA 3QTBA 1GNQA 1KVQA 1E0DA 3RIEA 1EZ4A 2ZE8A 3LHFA 5CIQA 4XR4A 3LWDA 4IIJB 2EKLA 2GCOB 5BUZA 1W2GA 3PRKE 2F1RA 3UAZA 2ACVA 4Y1RA 1XB2A 5T3UA 1ST3A 2NQTA 5C7IO 5L7TA 1FTSA 2F90A 4BX0A 5HOQA 5JYCA 2JVIA 4OXNA 5ILOA 5L3QA 5C7OO 2CNNA 4K2AA 4MW9A 2UYYA 4JCOA 2EATA 3OY7A 4DLWA 5FBVB 2W6IA 1GD1O 5DBGA 2YVLA 4L5JA 3CVXA 3ORRA 3AERA 4E6EA 1SRQA 2PNJA 2OHHA 2AVNA 2VTVA 4ENRA 1NV8A 4OX9B 2Z2JA 3JTEA 5CT9A 3V4OA 2FN3A 5FUWA 1ODCA 4TLLB 4BN5A 2HTEA 4ZI7F 2FGKA 1USKA 2C20A 1XTIA 3EXEB 4M0FA 2AOXA 2IXGA 3LNCA 3ZVKA 1SKBA 2I4LA 5AKIA 3QFHA 2HPHA 1TQ2A 1I32A 2C84A 4IQ8A 1QBGA 1M7HA 5AJXA 1CJMA 5BXYA 1UC5B 3T3HA 1N5DA 3ONNA 1P18A 4N7MA 3V34A 4YUYA 2PU5A 5TB5A 1YQWA 1E94E 2NU9B 5ICSA 3AJEA 4HQNA 1GU7A 1ZZEA 3MUEA 4QOFA 4RS3A 1KZGB 1U81A 2EC5A 1ZINA 4DIKA 5IH7A 2BZ1A 2VHVA 1M6HA 4A15A 1LS1A 1OTXA 2DUWA 2O2ZA 3VKWA 1UK6A 3IV7A 3O1LA 2Q5EA 2V65A 2KHZA 4Q3KA 4JL6A 4BS9A 1QOZA 3N7UA 3SEQA 3V1LA 1BWQA 1LEHA 1XE3A 3AHHA 3HBJA 3JVIA 4RCYA 2DQYA 3IQHX 4TWAA 3RVPA 3SLKA 1I5EA 4QXPA 3SJAA 3IAS1 5DWQA 2HEIA 4ZOLB 1YA4A 1KDRA 4S1TA 1CZOA 5DLPA 4CEIB 2VNJA 3OM8A 2Q6LA 4L4ZA 1CIPA 5KQPA 1AB5A 2YVAA 3HKDB 5EINA 4W5WA 1B6TA 5KVQA 4BQFA 2J48A 4PZEA 2AJ8A 5I48A 4ZARA 3BB3A 2GDZA 1U0GA 4NCIA 5ISMA 5F91A 1C8KA 1U1IA 3DZCA 4NYJQ 1DARA 4E3ZA 1UK7A 3CJRA 4F5YA 3T5AA 4LOIA 4U7WA 5JXJA 4B82A 4E30A 5E4YA 3ZIUA 4YXFA 4QHSA 1BDIA 2ZTLA 3U60B 1I1HA 1IMOA 5CFPA 2YV4A 4D41A 1QVRA 1GQYA 1L5SA 5LIRA 1NA5A 1ZGAA 4UEJA 1UJ6A 3E15A 1FU7A 1ULBA 2R7MA 2JRLA 1FW6A 1W93A 3WBFA 5K8IA 5KSZA 1JHZA 1NQAO 3PD7A 2OBNA 1MN6A 3I5AA 1AK2A 2AFIA 3TF5A 2X4LA 3EG9A 1FPQA 2VPZA 3EEIA 3TJMA 3SD7A 5BNZA 2FEMA 4WTOA 2DR2A 1Y6RA 1B23P 5HUHA 3RSLA 4OYHA 1EVIA 1YVRA 2EL9A 3RYTC 1KHHA 4MYTA 1Z68A 2ZRFA 1MC5A 1PVVA 2K87A 1T2EA 2O8VA 3MJTA 5DNDA 4Z3OA 1E7WA 1NKVA 5AI4A 3KB1A 4FYYA 3MWJA 4OL0A 2ZUTA 4MIKA 4JYBA 4BVAA 5K0SA 2ZJ2A 3VZBA 3GGPA 4CIVA 2C2ZA 5B36A 3C4VA 1NASA 4N6GA 4ZVNA 3DEKA 2VJMB 3ZWWA 1JFFB 2P2SA 5IAGA 3MT9A 1AO0A 3K1AB 4FDVA 5BV0A 2JDID 2HGZA 2QTMA 2VBGA 3ZXIA 1DAMA 2GXAA 5EHQA 2E49A 5IDVA 4G0VA 2B3TA 2DFLA 4OA5A 1CQIB 1G8PA 2COEA 3QFCA 4GYWA 1BXKA 4WK6A 5CHEA 5AH0A 4DEYA 3JZFA 3OLCX 4DF3A 4QM7A 3FOCA 2HUPA 1XWOA 2A0YA 3ER9A 1QO0A 1FDRA 3EY9A 5FA6A 4A0QA 1NVVQ 3L4JA 3ZY3A 1VKRA 2CBGA 2NVOA 2VQSA 4QOHA 4MW0A 2OCYC 1E3JA 1SVMA 3FPHA 5F23A 1PBTA 2JEYA 2QVXX 1VG8A 2QTHA 3A1DA 1MW9X 1RKVA 1N2EA 1QHNA 1Y4UA 3OG9A 2NU7A 2IQ5A 5LP6A 1QU3A 2F00A 2Z2ZA 1ODJA 2PLRA 1KJWA 4IS2A 5BY2A 1KMMA 2XYHA 3OQ6A 4KFRA 2AG1A 1W75A 2I3BA 2GFQA 3JR3A 4NFYA 1A97A 4Q4HB 2FSSA 2ZRDA 1HQYE 5LUBA 3K2IA 4TVSA 1FMCA 3HZZA 4EB8A 1NXTA 2JIOA 4HEQA 2ZI9A 3G1UA 4LJYA 2VSFA 2F9LA 4LW8A 3JVVA 5TIIA 3A9SA 3CE9A 3N76A 1S3SA 3OPYB 1VE6A 5C7LO 1I33A 4E94A 1KARA 3ESZA 1JQDA 2C98A 3KT8A 3REOA 1NVDA 3HPQA 4XB1A 4BO8A 2JFHA 3HA2A 5M04A 4HBGA 1M66A 1YFEA 5C46F 4DCVA 4G26A 4G63A 2O1WA 1IY8A 3UQYS 3N39C 3UN1A 3OUTA 1OIWA 1X1QA 4C4YA 1ZNYA 1PZEA 3JWIA 5CFRA 4NRDA 1PE0A 2G1KA 4GE3A 2AXQA 2IEYA 1JDUA 2AI1A 2GEFA 3WY9A 1HWYA 2CXHA 3U3MA 3OVMA 4NC9A 4AJ1A 1QRUA 4ND3A 1QHHB 1ZONA 1E89A 4CDNA 1Z29A 5FL7D 3CVJA 1Z0KA 1GAXA 3KEQA 1NW3A 4KITB 1UADA 1SU4A 1DJQA 4OHUA 3V7YA 2QM0A 2AG8A 2PIDA 2Q49A 2Q6OA 1Z22A 4I9UA 4MVJE 2HQOA 4CJXA 3V2UA 1NP3A 1QVVA 4F3NA 1FXSA 1N6NA 1C4KA 3NTXA 3OU6A 3PRJA 5IU6A 5KU7A 3BXPA 1JDBC 1YK0A 2WTAA 2VKTA 2IEZA 4YA6A 5EE3A 1TZKA 1NM5C 1AURA 1DJNA 3ES9A 3NHBA 3KBBA 3DFFA 3F7NA 4PNHA 2ZFUA 3VZPA 3IT0A 5J2TA 3QVKA 3WLFA 4JQZA 1YB6A 4HDSA 1TU0A 121PA 1CULC 4YCJA 4ZQGA 2VF7A 5ICCA 5FHQA 1ONNA 3FPEA 1F4VA 4O25A 3DOUA 4KLNA 4JLAA 4NPAA 2WVGA 1QIJA 5EZSA 1CUSA 4RHFA 4QQRA 4Z9BA 2B1QA 3K2QA 3M3HA 2DM6A 2VTKA 4UVGA 1AF7A 1JDPA 1ZC4A 1PZNA 3G0CA 2R3SA 1O3YA 4XZ3A 5I7UA 2BFCA 3IVCA 3GLGA 3E7PA 1B3RA 1YKFA 2W2KB 4J2TA 4R3UC 1CQZA 4ZAFA 3O93A 5EMJA 1ULSA 2GHTA 1YGPA 5BWBA 3MERA 1AMNA 1AKYA 2R1TA 4XB6B 1L5YA 1A8IA 2FRDC 2HADA 2SKCA 1REQB 4TLMB 1OROA 4P0PB 1CUXA 2BM1A 2WP0A 5EERA 1EFUA 4HEA6 4BZZA 1PTJA 1KRXA 5TT0A 4JGGA 1DKOA 1N0IA 3K9NA 1PR2A 5JAOA 1ECFA 3FWZA 3U3RA 3KC2A 2CXTA 4Q9NA 1FUOA 2FPXA 4J07A 2P3SA 5DMXA 3LNTA 4B71A 1WU7A 2PLAA 2XDYA 4LFBB 3OT1A 4QL3A 3O7MA 5JNUA 4LRTB 4HD8A 3JQ8A 3UV7A 3WIBA 1PK8A 1DBRA 1M6WA 4YRQA 3ZWKA 4ENTA 3K53A 3CU5A 3LQQA 2CMDA 2AOWA 1CUUA 1X7YA 2D5CA 2TRSB 3RQSA 1ZK2A 3FA2A 3PKIA 4X71A 3SYNA 5KTRA 5LQMA 3LXXA 5F7OA 4KDEA 1E7YA 2PBRA 3JASA 4U9IS 3GHHA 1U0LA 3A11A 3VDXA 1TADA 1IEQA 2WK1A 2QE6A 4KG7A 2WG2A 4CMKA 3MBKA 4APAA 3D4NA 3MCVA 2PKYX 4DYHA 1CQJA 2VN8A 3UWKA 2FW7A 1M2KA 3MS4A 3ZWQA 4UVDA 3FXAA 1KR5A 1QZXA 1RPJA 2AE1A 3A6DA 1ISMA 2QPAA 3AM4A 4P2GA 1AO3A 2UZ3A 2XQKA 4IS3A 1JR3D 2NW6A 3BZWA 3KYDB 4HX2A 5H81A 3SXJA 5JMWA 3OCXA 4YMHA 5HK9A 5JAUA 2FV8A 2OYCA 2BCEA 3DBLB 1VCIA 2X9LA 2JI8A 5JROA 1GL7A 1KETA 1SBIA 3GL9A 4HDRA 1JIVA 3TXAA 2YRFA 2ZE5A 3DEYX 4KV7A 4QDOA 1W19A 1F6DA 2ZETA 3BMQB 4A1OA 4BLWA 1ONOA 4MW1A 4C9BA 2YYSA 1MQSA 3R0ZA 1Z5GA 2H2AA 4FX2A 5BQPA 1JFTA 4IGFA 1ZXBA 1R15A 1N5IA 4IVNA 3A1WA 5IYZF 2HU5A 2X3UA 2ZRKA 4BVHA 3T15A 1WUIS 1ZUD1 5C53B 1UWKA 3P0HA 1K08A 5IN4A 2ZCJA 2G9ZA 4MUNA 1QUEA 3HXOA 1RWWA 5LNK1 2QIPA 2QQ5A 4RPHA 3M2TA 5E4FA 3W0LB 2XT9A 2NVBA 4L9SA 3RFVA 1YDMA 1V7ZA 3QITA 1WHTB 1ZGGA 3EDMA 3S29A 5IWAB 3IMCA 4ZFNA 4DLXA 1KMQA 5DV9A 4EA8A 5KYKA 3F90A 3PDCA 1Y7PA 2Q21A 1LS6A 2BT4A 2Q3DA 3L8EA 3WFZA 4BEVA 1SURA 3W7BA 4DSZA 3AVYA 3MAAC 4MZXA 4G86A 3ZDQA 1ZISA 5JOQA 1DXHA 4PAOA 1WP4A 2G6TA 3CW8X 4XSVA 4BWFB 1NX6A 1P33A 3LCJA 3ROEA 5EVJA 4EW1A 1ISFA 4NFLA 3QHPA 4TKVA 2BR3A 1KBZA 2JIMA 5EZYB 3AW9A 3G85A 4TROA 4MDFA 1U3DA 3RIYA 1IN1A 5IDYA 1G8HA 2YUIA 4ECAA 2VHTA 3PX7A 1N8TA 3WYFA 1W0KA 2F7SA 4UDNA 2QY6A 1YJCA 3OEEA 4MKZA 3U7GA 1SK9A 3RT1A 4QWWA 4WKNA 1CY2A 1EWRA 2Q2WA 1HLGA 1PR5A 2OXEA 4TN5A 1RE0A 1M2VB 2FK7A 2W5UA 3E5RA 3MB5A 1CRLA 1VHDA 4V0OA 1CEEA 3R7SA 3U3KA 1BVUA 2NYUA 3AL2A 4OG2A 1L7NA 3MSCA 4HATA 2WWFA 4EA9A 2C9OA 3SN6A 5HM6A 1AUWA 1YZQA 2UYQA 4NNPA 1E98A 2I91A 3GRFA 5JHHB 4KH0A 5MN6A 2FQXA 3AVTA 2GFHA 1Z5WA 3ISVA 1VIVA 4RTOA 1WV0A 2OHGA 2ONJA 1Z73A 2I6FA 3JY6A 2LBPA 4JKYA 2UUOA 4YK7A 2C3OA 3MQFA 4ZO4A 5G3YA 5HCNA 2BMFA 2CE7A 1JAIA 1AGNA 2OP1A 2Z83A 5ER9A 3TTXA 4AI6A 3VPGA 4B8YA 1FP2A 3JPYA 3QA3E 3LLVA 2R5FA 4XX1A 4Z9XA 4MKFA 2QAGC 1SUCA 1QHSA 3BIWA 2PN1A 2AKAB 3D7RA 3CKMA 3HA5A 4K87A 3ABOB 1JLLB 1YL6A 1PSDA 3AOGA 3JARB 1Y0BA 3TLJA 1IU9A 2ZUVA 3F6PA 3G2IA 4P32A 5HQJA 4R0MA 4F9FA 3Q7RA 3M4YA 3IALA 1E5TA 2V3VA 4PCAA 1JHQA 1VJRA 2JFZA 3WL7A 2Z1MA 3IYLW 5JFTA 1Z6XA 5C8YA 2XKBA 1DSSG 4B3DA 3IB6A 4W5RA 2UZ4A 2BJHA 1LJUA 3P45A 1P2GA 1N6KA 4DLUA 4BZWA 5BV2P 5CLFA 1ADGA 1DQRA 1KS2A 4H15A 5FWXB 2ES4A 2HHLA 5JFGA 1R6UA 3NHZA 1SQ0A 4D25A 2PZKA 3I9OA 1GUFA 4PX3A 5KO2A 1P6XA 3CKYA 2YW2A 4YWJA 4ZOEA 2DUNA 4F9TA 2ZJ7A 4JIMA 4EY5A 4B79A 3MFYA 4H3HB 2FG6C 3O95A 3OX4A 3ERCA 4O2RA 4MUHA 3NNSA 3O2NA 2PYZA 3G89A 5JD4A 4CLDA 4B34A 3AB3A 8MHTA 1Y5RA 3M4NA 1P7VA 2JKVA 2H7CA 3W8NA 3L0CA 2JIPA 3ZIDA 5LLDA 3STYA 4J7AA 2G8LA 3U7JA 1FQOA 2AXPA 4W5TA 3MXOA 3NTQA 5BUCA 2QDKA 4D8XA 3WNBA 1CUYA 2YUTA 3CRRA 3IQDB 4JVNA 4ROTA 1Y6GA 5DP1A 2Q4OA 2H6EA 2NPFA 4E2FA 4S0XA 3RG8A 1LZKA 1COWD 2DLNA 3AFGA 3P0IA 1C0LA 3JW8A 3O2JA 3TTTA 3KQLA 2QD1A 3E0XA 4KPUB 4LRYA 5ALXA 5ICGA 5BOSB 1IHXA 4EOGA 3KIPA 1G42A 1Y8CA 2IGBA 3WL5A 3ZG6A 7REQB 1T10A 4NYJR 3OQIA 1MG5A 4FZRA 3D8RA 4TN1A 1ODLA 1RBZA 3UFBA 2ZRPA 3EA0A 3JWGA 5LOVA 1FUIA 3OFSA 4IGKA 1YUMA 2OVBA 3FZGA 4XKJA 5EYPB 3VTAA 2Y27A 4EL0A 2AZ4A 3KUCA 2IX3A 2RG1A 4OKSA 1KZ9A 1X9HA 4MPJA 4XA8A 4DJAA 4FB4A 1JE0A 4F2GA 5BWLA 1ODKA 3CMCO 4FZJA 4F2HA 2NPOA 4UQPA 1ZOOA 2IY7A 5TPWB 4FHZA 3V46A 4B7CA 1XZIA 4XX0A 1TF2A 5I7OA 3PJGA 3KSMA 4TLAA 2XGOA 2QAGB 3GEMA 3CLSC 3OD5A 5SY6A 1TUGA 2EFYA 3COVA 4JS0A 3TQRA 2WT9A 4KBFA 3H04A 5EJEA 4R01A 4UNQA 3K9LA 5F1OA 1QRTA 2JBAB 5F5XA 1F14A 1TJNA 3OKFA 2WYUA 4F72A 3LSYA 1SC3A 4BRSA 1SHKA 1QHFA 1QOQB 1UJMA 1VJ5A 2IP2A 1XZPA 3IDZA 4IFBA 1CQPA 4C1NA 1WWKA 4NHOA 1BVRA 1US8B 3UO8B 2YYAA 4MGIR 1X7HA 1PS9A 3K5PA 4PZAA 4HGPA 5L3RA 3H2GA 1VRCA 2E37A 4IVQA 3SF8A 3QLVC 1JQ3A 4M53A 5E7MA 3QXSA 3NYWA 4B48A 2ACEA 1G1AA 4KDCA 4M4SA 2NYAA 2FUEA 2P2YA 1WB5A 4YQEA 2DSTA 2GJ4A 2RI0A 2XNSA 4AJKA 4ZZ1A 1PS0A 4IDBA 2XEDA 1XZMA 3ZI7A 3FLBA 2FR8C 4G8CA 4HPWA 1VDMA 3HADA 2CF5A 2PPLA 3CT4A 1E7MA 5KWSA 3V8EA 3MJCA 3RT7A 3RSQA 3H5OA 1YFMA 5EKXA 3CRMA 3IV6A 1HYBA 4LV5B 4RCZA 3H8JA 1VI5A 3RU9A 1YU9A 1HYGA 2UZ0A 4Q01A 1SCIA 1CW2B 1E6MA 1EM8B 3RNOA 3KQYA 3TMKA 3OICA 1Z26A 5AW5A 4O4HF 2V03A 3BWMA 1ZKDA 2G77B 2C4VA 4MMYB 4O2AB 4QXMA 2FWPA 2KM1A 4P2BA 4HAYA 4S1WA 4U9HS 1XO1A 1PZXA 1Q7RA 5BYKA 1IY0A 4F04A 2HRRA 2VHCA 2R2GA 4WFKA 3C7DB 2OCGA 4GHWA 4D9JA 4KYVA 3CZRA 3T1OA 2A4MA 3UT5A 5U1PA 3W2IA 3MWFA 1CP3A 5HQTA 1DWOA 2PMFA 1XDUA 2F1KA 3SIPA 4ZZ0A 4LF9B 2YXLA 4UEOA 3VOSA 1X39A 3DXFA 5DJ5A 2ID4A 3JYHA 3KWFA 3CH5A 1RWNA 4Q4DA 5TT1A 4Q48A 4JJKA 2RHLA 1GDHA 2ZW9A 3PF8A 5ALNA 2O54A 1YB1A 2HA2A 4C4PA 4B6EA 3NNNA 4O29A 1Y5LA 4Z3KA 3H1EA 1RJFA 4DRZA 2R00C 5IT9A 1KDPA 3K05A 2OQVA 2GCIA 4QD3A 2HMVA 1TEHA 4JHXA 3C3DA 4MARA 4PNPA 3TRFA 4WKBA 1XMIA 4S2UA 5B6PA 2R8RA 2XMSA 1PJZA 4L74A 3OQBA 3RFXA 1Y42X 5CX1A 4I55B 3T7SA 4D81A 2APJA 3UG7A 2A84A 5AVVA 2GRAA 4IUYA 4UBNA 4IVPA 3C74A 3CNHA 2MHCA 2VXBA 4YP9A 1Z2EA 1FFSA 1QONA 4X54A 3TBFA 3PPWA 3TVYA 1JSXA 3N53A 1YDFA 1PGQA 1CUBA 2JZNA 2VJMA 3LE8A 1YJAA 2QZ9A 3MTDA 3R0XA 1JZSA 4FIZA 5K8VA 4NBLA 1EWKA 1ZGJA 4LPKA 2DKNA 2V7UA 3RSZA 1XRQA 1KO1A 1DCKA 1DP4A 2AWOA 1GM5A 1TU4A 3WGKA 4BVGA 4H4DA 1SCAA 3UJNA 4NXNB 2C07A 2ZIXB 1TTPB 2B83A 2JFQA 1IBSA 3BMCB 1UKEA 2BFDB 3HBNA 1FFBA 3E5MA 4B1FA 1KDVA 3BILA 2Z2XA 3P9YA 3D6VA 3QVGA 5EP3A 1GDDA 1FJGB 3V2IA 3OWHA 1BCRB 2VK1A 1Z5PA 4KN6A 1FDTA 4JC8A 3T41A 2C04A 4KSCA 1IJFA 4AK9A 3A1FA 4YRPA 1WZNA 3LA8A 3HMQA 4OV6B 5E8RA 5ENZA 3VDQA 4YUAA 3GLIE 2HHHB 2CL6X 4QXAA 4Y18A 1H4VB 1EZ1A 3WXBA 4DDUA 3M1YA 1S1MA 3HRIA 3AETB 4ZYLA 3T3OA 3QUQA 4MVJH 1JSLA 3IVAA 4MCAA 2G76A 1ADBA 2HPAA 3IT2A 1XJCA 5CEEA 1SKMA 4PRLA 1MRNA 1UR5A 4NYIR 1V1MA 4XGIA 3ACBA 3FNBA 5I4BA 1IWOA 1RLTA 1SXJD 4PFQA 5KTOA 1QIHA 4TMVA 4X1IB 4O2BB 5D86A 2IYQA 1U8ZA 3I39X 3QGMA 1L5QA 3FRHA 4A6EA 1DGQA 1TW3A 3T4UA 1D7AA 5BN5B 3NAMA 4RH0A 1K68A 4IH9A 1C3VA