4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
molecule tags Hydrolase
source organism Homo sapiens
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
1VFPA 2OM6A 1RLOA 3ZX4A 5IT0A 1RKUA 4F72A 3KDPA 4YCMA 2I34A 2AGVA 1T5SA 3WKBA 2GHTA 5AI9A 1YMQA 4F71A 3VAYA 4DWOA 3R09A 2ZBGA 2PKEA 3MN1A 3GYGA 1ZD4A 3UMCA 4OD0A 1NF2A 3U13A 1YNSA 3L8FA 3OCZA 3WKAA 3N8GA 2HDOA 2DQSA 3RFUA 3DNPA 2FI1A 2IOFK 1N8NA 2O2XA 3ET5A 3ZVMA 5ALDA 4G63A 5AKLA 3N1UA 3OCWA 1L8LA 5AICA 3WK9A 4C4SA 1Z4OA 3QNMA 5AM5A 2B8EA 4L6AA 4YGYA 1ZOLA 2P9JA 4CNQA 2GMWA 4HGQA 4CF5A 3KBBA 1U02A 1YJ5A 1RC8A 1NRWA 3WK6A 2YFYA 1T5TA 2C8KA 3U7FB 4Y2YA 4UATA 4MWOA 1L7PA 2HI0A 3A1EA 3PGVA 3HLTA 5AW6A 3M1YA 1ZJJA 1TJ4A 1FEZA 5AVSA 3WK4A 1SWVA 1ZRMA 3QGMA 2YJ3A 1Y8AA 2B0CA 3MC1A 2EATA 1U2SA 3L8GA 2X4DA 4CF3A 5ALWA 4HGNA 4JB3A 4EELA 4RESA 4AS3A 4FYPA 4JDPA 3FVVA 4RETA 5ALTA 3IRUA 5JJBA 2HOQA 2G06A 2JAWA 3ET4A 3KOOA 3L7YA 2RB5A 3F9RA 4Y2UA 4AS2A 2WF7A 4EX6A 4NWIA 3A3YA 4OCZA 4HGRA 4KX3A 5AI6A 2WF6A 3CNHA 5ALRA 2WF8A 1L7NA 1KYTA 2HF7A 3U26A 5AVRA 3ZWKA 5AKGA 2WF9A 3QU4A 3L0YA 2HSZA 4CF4A 5AW8A 3PDWA 3B9RA 3OCUA 1Z4QA 3UM9A 2FDRA 4KNVA 3WGUA 2GFHA 2NO5A 2PQ0A 1RMQA 3EF1A 1U7PA 1RQNA 1U2TA 2G09A 3OCVA 4UAUA 2QLTA 3R9KA 1QQ5A 2R8XA 4I9GA 3NRJA 1TE2A 1VJ5A 1VJRA 5ALZA 1SU4A 3J7TA 1TJ5A 5AK5A 2RARA 1YS9A 2BDEA 2HCFA 2D2VA 1WVIA 4UASA 3N07A 1YDFA 2I54A 3EWIA 2AH5A 5T41A 3W5AA 5AW5A 2YMLA 2AMYA 3CZ4A 2R8ZA 3QUQA 2RBKA 3DDHA 2GO7A 1QYIA 3AR6A 3QU7A 2CFSA 1ZD3A 5AM2A 5AK3A 1QQ6A 4YCNA 5ALFA 1Q92A 2P27A 3OPXA 4J03A 1RDFA 5AIBA 2FPXA 5AKEA 3AR3A 4MUMA 4FE3A 2YJ4A 2B1QA 2HF2A 2YN4A 2ZBFA 4BNDA 5AW0A 3W5DA 1EK1A 2I6XA 2C8LA 3SD7A 4HGPA 5AHXA 2OBBA 1QQ7A 3M9LA 5ALVA 2Q5EA 4YCLA 2YJ5A 3WKEA 4Y2XA 1X42A 3BWVA 1Z4KA 5AW9A 1Z4MA 1N9KA 4BYGA 2B8JA 1Z4IA 1S2OA 2NO4A 3KC2A 4KN8A 3WKDA 5ALMA 2FPUA 5AVWA 3FPSA 3E84A 4I9FA 4XPZA 5ALUA 3EPRA 1RLMA 1RKVA 5ALSA 4UM5A 5AK6A 3NUQA 4L6CA 4NAVA 4BKMA 3B9BA 1J97A 3QYPA 3QU5A 3EF0A 3WK7A 4NFLA 5AKKA 2ZG6A 4UAVA 1TJ3A 2G80A 1RMYA 1F5SA 2ZXEA 5A3RA 3OTQA 5AVYA 1Z4NA 3BA6A 4ZEVA 2PR7A 5ALJA 2FPSA 3PCTA 5AVTA 4YIKA 1L7OA 2ZBEA 2G0AA 2YMQA 3FPBA 5ALEA 2YBDA 4H1WA 5A3QA 2FEAA 4NABA 1S8OA 3P96A 3UMBA 3ZUPA 3QUBA 2B82A 2Q4RA 2JGAA 5AVUA 2FPRA 1LTQA 2QYHA 1WZCA 2EARA 2VKQA 1WR8A 3QX7A 4OHFA 5AW2A 4BEVA 3I6BA 1Z4JA 3NASA 5AI8A 2MU1A 4Y2QA 1QH9A 5AVVA 3ZTYA 4FFDA 2ZOSA 1Z4PX 4UARA 2IA5A 1RPZA 1L8OA 1K1EA 1CQZA 4PNHA 5AVZA 3QLEA 4KX5A 4QQFA 2WFAA 2MSNA 3DV9A 2WM8A 3W5BA 3L1VA 3A1DA 4GIBA 3NIWA 5AM4A 3NALA 4EEKA 2ZBDA 4OFZA 1EK2A 3UMGA 4BBJA 3D6JA 1JUDA 3U7EB 4Y2RA 2R8EA 5AW3A 3ZW7A 2IOHA 2I7DA 3ZTWA 4B6JA 3L0CA 3ZU6A 3OCXA 5AW4A 3IB6A 1L6RA 1U7OA 3U19A 5ALKA 4Y2PA 4YH1A 3L8HA 3OCYA 5IS2A 1L7MA 4UW9A 4CE6A 3N5KA 1PW5A 4UU1A 3WGVA 3AR5A 5AM1A 4UMVA 1Q91A 3SLRA 1Z5UA 1ZS9A 2W43A 3QU9A 4UMFA 1Z5GA 5AKJA 4BX0A 3I1YA 3SF0A 4O8CA 3HYCA 5AKHA 3TLMA 3B8EA 3WK5A 4BX3A 2YY6A 3MMZA 4DFDA 2HX1A 1SWWA 2IYEA 4BEWA 3RF6A 3A1CA 5ALHA 4J2TA 5AKZA 1ZD2P 2BY4A 2G1AA 4EENA 2BDUA 4Y2TA 1RKQA 3N28A 1RLTA 1TA0A 5ALLA 3ZVNA 2JARA 1XVIA 3ONNA 4Y2JA 4ZEXA 1RRCA 2NYVA 1RMTA 5AKIA 3FZQA 2CFRA 2FUEA 5AK4A 5AM0A 4XQ0A 3QUTA 2W11A 4EX7A 1O03A 5E0OA 3SKYA 4UMEA 3E58A 2OYCA 4BX2A 2JAUA 3ZX5A 4Y3UA 3ED5A 2FPWA 3FGOA 3ZVLA 5ALXA 3I76A 1Z88A 4E88A 3SMVA 2P69A 4IFTA 2G07A 3ESRA 3L0BA 3PGLA 2CN1A 3E8MA 2R8YA 3L8EA 1WPGA 2AUTA 4DW8A 2C9MA 5AKXA 1ZRNA 2HO4A 2I33A 1RQLA 5AVXA 3K1ZA 2P11A 2ODAA 3AR7A 1T9ZA 1ZD5A 2C88A 3WKCA 2HHLA 2YJ6A 3R4CA 2C4NA 5FP0A 3ZI4A 3I28A 2WHEA 2WF5A 4UU0A 2EAUA 1CR6A 4Y2VA 4C4RA 4DCCA 5ALPA 4GXTA 2W4MA 2B1RA 3QXGA 2G08A 3AR2A 3DAOA 4YIHA 4L57A 4HGOA 1Z4LA 2YMPA 4NV0A 4UMDA 4Y2SA 4C4TA 3SKXA 2Q4TA 4HAIA 3QUCA 4KNWA 5AI5A 3S6JA 1XP5A 3U7GA 5AW7A 2OA0A 5ALOA 4XE5A 3IJ5A 3ZWDA 4XOUA 4AP9A 2FUCA 2CFTA 5AM3A 3MPOA 2JAOA 1XPJA 2IOFA 4IG4A 3U7HB 4HYTA 3WK8A 3FM9A 5AESA 5A3SA 3QU2A 4BNDB 3NAMA 3W5CA 1MH9A 2HEGA 4UM7A 5ALQA 2GHQA 5ALGA 1AQ6A 3SHQA 5AVQA 4ZEWA 4KYTA 5ALIA 3NANA 5ALYA 4EZEA 4QJBA 3KZXA 3ESQA 1YV9A 2RAVA 3E81A 1IWOA 3L1UA 5AI4A 3KD3A 5IT4A 2B30A 2O9JA 1O08A 5AI0A 5AIAA 3L5KA 2I55A 5AKYA 3AR8A 3AR9A 4G9BA 3AR4A 5ALNA 5AW1A 1LVHA 1J8DA 2YMMA 1NNLA
chains in the Genus database with same CATH superfamily
1VFPA 1DG9A 4RY2A 1V95A 1ZRSA 3RC2A 3WIEA 2DVMA 3L1HA 4F06A 1JR6A 1NUHA 2I34A 4GHWA 2WJ3A 4D8TA 2Z8ZA 3AKEA 3I2JA 4NR0A 3CVWA 5EWJA 5DB4A 5SZHB 4D6YA 3HGTA 3AFHA 4EFKA 1N3BA 1KI9A 2QTFA 2ZULA 3COSA 1UODA 3HCEA 5J40A 4F71A 2G1KA 2P9BA 1O6ZA 4KPGA 3DOCA 2V7QD 4CPDA 1Z8DA 3KSZO 3ZHCA 2VEOA 4RCYA 1SKQA 5JY1A 3DEKA 3O75A 5CGQB 3AJAA 4UTRA 1XD9A 2WTUA 4RK1A 2GZ1A 4CU5A 3HDTA 1KY4A 1ZD4A 4WZAA 5ESRA 1V9SA 1JHMA 4GVLA 4TLAA 1ZR2A 2ZPAA 4E0BA 3CQ9A 4RC9A 2JJ2D 4WXRA 3R3XA 4HWRA 4L8FA 3WKAA 4B6SA 1CY2A 5LB4A 3IJRA 5LD2C 2J0SA 3WE7A 3IBYA 5TS2A 4CKYA 3UUWA 1IFXA 2V7XA 4TT8A 1JR3A 1BW9A 1GLNA 2HDHA 4MWSA 4TYQA 4EQ6A 4L5YA 3OOYA 3M89A 1NJ6A 5L40A 5ALDA 5AKLA 5IKXA 3GJXC 3GAFA 4LZZA 2D1QA 4CL3A 1CDZA 3KVOA 4U3JA 5AICA 3MWKA 4DUGD 5CLFA 4PSCA 1ETUA 3R7BA 1Q7TA 3UFXB 5KQMA 2EW2A 1JAHA 3R77A 4L6AA 3HDHA 5JRZA 3KHSA 4G1VA 2FR0A 5C80A 1DCTA 1KI6B 1P2TA 5E7MA 1U80A 1XTPA 3ABIA 1U02A 1B2RA 2AE1A 3ITNA 2JHPA 4QX6A 4EJSA 4KK3A 1L7EA 4RE6A 1RC8A 4HUQA 3SEFA 2N42A 2VWHA 2G36A 2P4EA 3FN4A 1M0TA 4I19A 1RWVA 5IX8A 5JCPA 3GEDA 2IF0A 1C7QA 2H7CA 3FSGA 3IAM1 4H31A 2W4IA 3K9QO 4URHA 3PUHA 4CM9A 3NAGA 2WR8A 1GQYA 4OTZA 3K6RA 1Y7HA 5CMLA 4BO8A 2NU8B 3IOMA 3VSBA 4A26A 3H65A 3OOEA 3UAXA 5KYUA 2Q3MA 1PL0A 1UPTA 1ZI6A 3Q11A 4W8GA 3VR4H 4BU1A 5IABA 4QD3A 3FTPA 4DLVA 2XWQA 5LN1A 4LXQA 2H9IA 2I80A 4GDFA 1PZHA 4BJ3A 4EGCB 2GERA 2QM3A 4ADMA 4AS3A 2I2BA 3QJGA 4OMFG 2EQAA 4KE6A 3ET4A 3HY6A 2M6SA 1QPBA 1EUYA 2GHIA 3I9V6 4M98A 5A05A 2YNMC 4B76A 1ETHA 2P77A 3IMEA 3VHQA 3N0VA 2HQSA 3A2KA 1XQYA 3IB3A 4BLVA 1RJFA 2D7JA 3KG2A 3NBUA 1NN0A 3QWIA 4NWIA 2HNAA 4OCZA 4QGAA 5BN4B 3GOHA 1E2DA 4FYJA 1QDLB 3SDZA 2P2CA 4DQKA 2JPDA 3CZ9A 1MRSA 4D81A 5IJ0B 1C3JA 1NUPA 2IYXA 1A1VA 2F7SA 4JP8A 1ONPA 3E22B 3LXMA 1KYTA 3HRIA 3QFRA 4MB0A 2FW8A 2FMUA 4DA0A 3LBAA 3CF2A 1JI3A 4HS4A 1Y98A 2QUZA 3A3OA 4V1CB 2HSZA 3KVYA 1Q74A 4WMLA 2HKIA 3PDWA 2OHFA 5KEIA 3R44A 3ACDA 3VOAA 4FDAA 4L5BA 1NY5A 2UZ0A 3UM9A 2FMFA 3ZWBA 4DMKA 4NARA 3F4SA 4D25A 2GNPA 1YK1A 1YHZA 1XZAA 3NX4A 4ZC1A 1UC4B 4AY4A 3IDOA 1JIKA 1F0NA 3IPCA 1EEXB 4J0GA 3WGNA 1ZICA 1REQA 3WJAA 3F5SA 3LZ6A 5DXJA 1CX9B 4ZWNA 3WRVA 4QGBA 2VFAA 2WWTA 3HXTA 1ZVQA 3MGBA 5SY9A 3V2UA 1P3Y1 2DLCX 5KOHA 1Q1EA 1WTAA 2QTGA 1IEQA 4PSAA 4MR9B 1QIHA 1I1OA 3I39X 1X7XA 4JP2A 3SR0A 4I5EA 5AK5A 3CH7A 5C8DA 2WOOA 2VTBA 4EKDA 3FDZB 4IZOA 4G8CA 4MWEA 1GLVA 1MHPA 3OJWA 4R2MA 2CHGA 1JSLA 3A25A 3EODA 4LSZA 2BFBB 4RIHA 1Y81A 1AUWA 3COVA 4NK4A 2DWOA 2R1VB 2FQ1A 2WLTA 1E60A 5FOSA 4MGIR 5BQPA 4EPYA 1C0EA 1ABBA 3DLTA 3VI3B 2VNSA 1OFVA 3FVRA 2VUSA 4XD7A 4E09A 3JYNA 3Q1LA 3LMKA 1B73A 4LC9A 5KMGA 3IOBA 2XIJA 1XOIA 2H2IA 4MVJF 4PZYA 2BYTA 2PQ2A 4BVGA 3DBHB 2O8FA 5KCZA 3HWSA 5IAJA 4DL9A 3OX4A 2F59A 4BZPA 2AOVA 1YQXA 5IT5A 2OILA 1Z08A 4DDWA 1E92A 1UBOS 2VWQA 5IYZF 2NP7A 3N2KB 3WP0A 3L40A 4ZOAA 2OBYA 2IEAA 2YHIB 3GX1A 3OPVA 1TT7A 1U0EA 3RUEA 3TTYA 4ESEA 2IH5A 4CEHA 3PX2A 2FA9A 3WB1A 1ZU4A 4JDUA 3W6NA 3DDNA 4DA9A 1YKFA 3MF4A 4DRZA 3LLVA 4M1EA 2GYYA 1H1TA 4UE6A 4BCDA 1R5JA 1E6WA 2R85A 2ZJYA 2IVZA 3OZBA 2YC4C 3UMVA 4CQLB 3C8TA 3HCNA 2FAXA 4I55B 4M0EA 4ZAGA 5LU9A 2ZU0C 2H29A 3SXJA 3BVPA 5BW6B 1UBHS 4Y2XA 3EULA 4EHJA 4W5RA 5TS3A 3ZHXA 2XUQA 3M6LA 4CT0A 2E1PA 4PYOA 1SD2A 2NU9B 4YFYA 5KU1A 1SELA 4YV0A 3QW4B 1A72A 4LOAA 4R2XA 4F4HA 5KNLA 2QL9A 1C8LA 1DOHA 2VT7A 3IALA 1XRMA 2J3KA 5AVWA 1BAPA 3UK1A 2JLRA 1MT3A 2BTOA 2I29A 4PC3A 1MAWA 1Z16A 1KNXA 2W48A 4B71A 5LMNB 3OZGA 4YYEA 3AYZB 1V26A 2WDPA 2XVMA 4ZVRA 4XX0B 2WAYA 4OATA 4BMYA 2R87A 3H97A 3DPUA 3GPBA 3C87A 2E85A 1NT2A 2CXSA 3NEJA 4FONA 4FE7A 4I1IA 4NFLA 1Z2OX 4RMIA 4DS3A 4KUEA 3EG9B 4KQFA 4G25A 4KGXA 5IH7A 1Z39A 3HCBA 4NSNA 3IHLA 4NLEA 3GRVA 1DPFA 4HQNA 4XH9B 2FUSA 3GLIE 3IIMA 3KQHA 3EEIA 1D5WA 3ZG6A 1YULA 3PXEA 3LG2A 1QRAA 1GNLA 2VP3A 3BXHA 3O47A 4YMUA 4ZMBA 3AEUB 3RANA 2HWKA 3FWKA 4PAWA 5ALEA 4KXMA 3W05A 3WDMA 2OK8A 3WX0A 4B6QA 4RY0A 1CVIA 4R8LA 5HOEA 1JSRA 1OAOA 2B8WA 3PGA1 3SHWA 3ZQKA 4LBWA 821PA 4JYMA 4YCBA 5CEFA 4UNSA 2FJUA 4EF4A 5BQ5A 1QFMA 5LL6P 4IJ5A 5DYIA 3I42A 5CVUA 4OB6A 3C3CA 4OB8A 1KZGB 3PX7A 1PYOA 3C8HA 1OT3A 5TR9A 1JIIA 3LBYA 4B7UA 3GEPA 2OGUA 2VPIA 1YR2A 1HDXA 1BE0A 3TKLA 1JTFA 3NEAA 5B1EA 5C1PA 4V02A 2VWPA 5AT1A 1EX6A 1QK3A 3ZHVA 1K27A 1L7RA 4BL5A 5ELMA 3DQZA 3PI6A 1A1SA 5EWJB 2P1DA 2QRPA 2H08A 4ID9A 4YJ3A 2YUIA 3C6QA 4TS9A 3RVOA 1C3OB 3K2IA 1V2HE 4HUJA 2GK6A 1V2GA 2D2EA 2CNWD 1CNMA 4CQMB 4V0ME 4AC9A 1PSWA 1HTBA 1FU7A 3GJ7A 2PCLA 1G7SA 5FHRA 4A8PA 3ESDA 4PE5B 1TECE 1N2EA 1FDOA 4W8HA 1IULA 4FJ0A 3TI7A 4BECA 2OQRA 4DM7A 3ES9A 1YA8A 2H48A 4WA7A 2WM8A 1CP3A 4DJFC 3VOTA 5C7YA 4WD3A 3NYRA 2EX1A 3FMVA 4URVR 1CNEA 1VE7A 3E05A 3NALA 3RS7A 2X6QA 2C07A 3U7EB 4DCPA 4Y67A 1CDOA 1Q2UA 1YUMA 3UMYA 4YMTA 1P72A 4XPIA 1IHUA 4EQ6B 3P0EA 4R54A 3EZ6A 4V39A 2D00A 2BT4A 2M9MA 3CM0A 3ONFA 5JOQA 1EFAA 3ITDA 3UW1A 2YQZA 4IIHA 2LGJA 1YFEA 2M1ZA 1Z0AA 4V2IA 1ECBA 4E1AA 1HR0B 1CR4A 3B85A 4QHSA 4TWIA 3W1EA 3WLOA 4B3RB 3IURA 3F67A 3PHBE 1OROA 1W4AA 3EEQA 4JNCA 1QHEA 4KVAA 5ALKA 2ZJ0A 5FTMA 2IYYA 1NKTA 4HQKA 3VV3A 5DBFA 4CE6A 3B1VA 4OXQA 3O3CA 4G97A 3EQ6A 1CB7A 3S0JA 2X2EA 1SVNA 3B2QA 1G3RA 1ZD9A 2OGSA 2ZROA 1V8PA 1IZZA 2VAWA 4UUQA 4X1YB 3EXEA 4UHBA 5DP1A 1XZGA 1T0BA 2XADA 2OCLA 2VPWA 1IH8A 1ZN8A 3CX8A 3NVDA 4G9EA 4BX0A 5HIAA 1ZN2A 4XIGS 4R68A 3CUKA 3QPAA 2O2DA 1M34B 1IOWA 2W2KA 3V4FA 3W04A 3KKMA 5KYUB 3TF5A 2JLZA 1QRDA 3C15C 4HTFA 2ZKLA 1LQ2A 3AUUA 3OZAA 1HFEL 1E7SA 5F9MA 5CXSA 3T4XA 4Z7OB 1TA9A 2ZIAA 2OZLB 5AOBA 4D9FA 3HI4A 3ONVA 2IZZA 4EMTA 2H1RA 5F98A 1CJTC 3IUEA 3UG7A 5LFAA 1CSEE 3UJAA 3ZWCA 5C3MA 2D3WA 1B41A 4MRSA 1O8BA 1T2AA 2D13A 1U0OC 4LWZA 3VU9A 3HKEB 1LNZA 5JSZA 4FWBA 1GU7A 4TKVA 5ICFA 2CL7X 5LMZA 4CIBA 1IEWA 3WNVA 2CF6A 3O8CA 4QEKA 2A5LA 2FPMA 3GJZA 1YVEI 3ADKA 2X0IA 1IXRC 1SVMA 1YZQA 2H7YA 4B3IA 5D1HA 5AK4A 1BFDA 1IK4A 4KWEA 4C4AA 3V1KA 4ZOLA 3H2KA 4N7BA 1SULA 2IP1A 1MAAA 3SKYA 1Z38A 2AMLA 1M8JA 3OQHA 1M2JA 5EIFA 5M29A 2NSYA 5A04A 1Q1BA 2AUMA 3HPQA 2YJNA 1P0PA 4EY7A 3HRKA 2BGKA 4RANA 3QQ5A 3HVRA 5I45A 3V3KA 1A9RA 2Z4RA 3FAZA 1WKCA 5TGZA 3GZNA 3CIFA 1R6AA 2ZSKA 3H05A 4PO1A 2V03A 3HMKA 4D3XA 3ANMA 4U7HA 1TYCA 3L4JA 4YK7A 4EKNB 1XF1A 1DAHA 3JYHA 1EI9A 2H07A 2YWHA 1ZMRA 2W98A 4QG7A 3J81k 4ZFNA 2ZYRA 3NU1A 4YRJA 1R0WA 2PLAA 3L1IA 3RABA 4ENPA 3JR7A 5A5DA 1BXKA 1D2CA 4MB6A 4QJ4A 4X20A 1T4BA 1X7XB 1P44A 1T8TA 1TXGA 1B8VA 2D2XA 4A73A 3K71B 1GRVA 5J47A 5KWSA 3N7UA 3DE0X 3SJZA 3CGGA 4F21A 4CLHA 3JCZA 1SBCA 2PFGA 3NYWA 2ONCA 4TOIA 5CRIA 1LDGA 5K8LA 1E3DA 4WN9B 1I5OA 4OLAA 2AXPA 3P9QA 4F4UA 4OJMX 5DX8A 4HGOA 4R0NA 3WWPA 4YMSA 1Q12A 1KO8A 4IILA 3MJRA 4DLUA 1KMNA 3HKDA 5GAJA 1T5LA 3W5UA 3WI7A 2I1WA 5B3JA 1IPFA 2DU8A 2QZPA 4RADA 4AMYA 1VRWA 3LOPA 2FW1A 1WTCA 2VQ3A 3Q8XB 1KU0A 4G5RA 3U7GA 1KDVA 5BMVF 1NA5A 3P9RA 3OLVA 3CO5A 4KRXA 2AKAB 3BN3A 2PUAA 2DYKA 4YAIA 4EF5A 1ID8A 1MC4A 3QVVA 4LYFA 5EP3A 2FW6A 1O5IA 4FINA 3WRYA 1EFTA 2LIPA 4CEHB 4C14A 2W71A 4OOEA 3QBEA 3QUAA 4L8VA 2R3SA 1TC2A 4OXNA 1GY8A 3A31A 1PG5A 4HYTA 3V33A 1LS1A 2FSIA 2Y0PA 3ZWQA 2VYVA 3DEIA 3QU2A 1NNSA 1YZVA 1C0PA 3MGCA 3RVKA 2HLNA 5JLJA 2O4CA 2Y1WA 3IT0A 3Q0EA 3QPDA 4YNBA 2CB0A 5CIYA 2ZUUA 2PWAA 1PEKE 3U16A 4K9KA 1L4UA 1LU9A 5CX4A 3RODA 1H4VB 2EG9A 4V03A 4EZEA 1HDIA 3KJHA 1FDWA 4KYUA 4WE3A 5CLJA 3DL0A 1NJ8A 1EDZA 2A58A 4UHKA 2PCJA 1TRHA 2K87A 3IQXA 4NCHA 3F4RA 1ZM7A 2J6HA 1OBOA 2ZPTX 4BNJA 2GPWA 5IT4A 4PRLA 4X91A 4AKSA 2R97A 3DT6A 1QH0A 2ZBQA 1NDUA 4ISBA 1X87A 2Q5CA 4Y2SA 5TJHA 2Q4DA 4B44A 5MF6A 1QB8A 5IVKA 1KVSA 3PWTA 1RCTE 2Q28A 3MBIA 4DBZA 5HQTA 5EE5B 1JFRA 3E8SA 3N8IA 5JS1A 3Q85A 1NWHA 4AKEA 4EGJA 2HMWA 3ZX4A 5A0TA 3MCVA 1Q3KA 4GSKA 4W82A 4QRIA 4ZEOA 2XBLA 5L8VA 1CUFA 1XA4A 2NYRA 1NPYA 3F3YA 1X86B 4MAAA 1YB5A 5LMCA 1P6UA 1YCGA 5C5EA 5TVKA 3GLVA 3L77A 2IHTA 3BC1A 3FYDA 3MVEA 1FQKA 3NYQA 3T5MA 4QPCA 1U0BB 2E49A 1SEPA 4B3BA 1DEXA 5EUMA 3JU3A 4O4HA 1D2AA 2PKEA 3LUDA 1DDIA 1SEVA 1B0ZA 1TJYA 1SBIA 3GYGA 1C50A 3KTAA 4G67A 3EW9A 2FWNA 4DCOA 1ZGZA 2WIKA 3KNZA 1HE3A 1I5RA 2H7VA 3O9ZA 4G1CA 4LHEA 1DOFA 1EP9A 4FOLA 3UMCA 2AQIA 4ZPJA 4O2RA 3FNRA 3GP8A 1V4BA 1VE3A 2CZCA 1QVAA 4HP8A 3BMQA 2F6RA 4HDKA 1OI2A 3U1VA 1J9ZA 3T7AA 1N8NA 3PJEA 3KL4A 2NQ8A 1RBYA 2R4QA 2VQDA 1ZXXA 1V1RA 5I7UA 4G63A 1KZHA 1TCCA 3AZQA 3SHOA 1O77A 1IWPB 4DGQA 1HNZB 4Q3EA 1A2QA 1N6RA 1RM5A 3D43A 4RWZA 2DG2A 5EJ8A 4PZEA 2Q6TA 2WDZA 2V65A 4MIOA 2D1YA 2W6ZA 1ZMTA 1G9TA 4AJLA 2ZJOA 4LJSA 3QLTA 5FA8A 2OFOA 4F5EA 4UFOA 2A92A 3UB4A 2ZVDA 3ORFA 3BSWA 1CR1A 1OFIA 5FR1A 3VX4A 4B4VA 2ZVQX 4XWTA 4UD6A 3G2MA 3V4OA 4NE7A 4RDCA 2ZIEA 4UPEA 1SVLA 4QBFA 3ICQB 5DLYA 3RYIA 1LF5A 2AOTA 1G7RA 1KYYA 1RSZA 2JIZD 3CNLA 3N7AA 4HEHA 4MW2A 4MVJP 4RPJA 2X15A 1C3XA 1OBCA 1J2YA 1PS0A 1G8JA 4HX9A 3TW4A 3WWOA 4ZJUA 2GCGA 4F5WA 1O95C 5FOQA 2QRGA 1T1IA 1KFJB 3WIDA 1QO0A 3ABQB 3QFTA 4DR2B 2X8WA 1E2MA 1QRUA 5L7WA 221PA 3GG2A 3GJ0A 3VYSB 3WDKA 3DDUA 1GKIA 1P4JA 2H0QA 2HT6A 5FFMA 1NIPA 1TAQA 2Q3DA 4OQEA 5DXFA 3UICA 3C5WP 4LJAA 2QX6A 3LDAA 2NACA 3GDWA 4QPZA 4GWLA 5B1DA 3R3WA 1TYZA 4L16A 4XRGA 2O54A 1TD9A 4NLLA 3O91A 5IFLA 3OMXA 1VA4A 2ZTHA 5D3MA 5IFKA 1OXTA 3I1IA 2PLNA 2FLKA 5I5GA 2GAAA 1DC5A 4WN3A 5THXA 4CTNA 5DYGA 5C1IA 1Q1NA 3O7MA 2O8BB 5E6RB 1TQ8A 1ANKA 1Z8FA 2AT1A 2WK1A 2Z2IA 1RAIA 4QARA 2ZWOA 5JXGA 1Q0HA 1JLLA 2IHYA 5COAA 2ECOA 1N2IA 1NX9A 3O1LA 5CXXA 3U26A 5ICCA 1FIUA 2I62A 4J3FA 1Q44A 5LLTA 2YICA 1TJUA 4FGLA 1E2KA 1Z3IX 1OB2A 1OH8A 2ZRPA 4U9HS 4X44A 3CUTA 1QGUA 1S02A 4CU2A 4E08A 3BA1A 4QAQA 2QGAB 1UBRS 1GAJA 2QRUA 1UQRA 1PCXA 3TTUA 4LDPA 4UDNA 5B5SA 1MA3A 5K3DA 2PQ0A 2OPBA 3HSYA 1P4SA 1P77A 2R7KA 1ESNA 4QTUB 1AHIA 3LIIA 2G09A 4NKRA 1RAAA 3V6MA 2FLWA 1KH3A 1Q1ZA 2P41A 3DHVA 4KLCA 2JW5A 4UAUA 3VU9B 3ZU5A 3OQNA 3B1KA 2AG8A 2CB9A 5JSZB 1TJWA 2PRKA 4CG0A 3DO5A 4MPRA 3T38A 1LDYA 2CNOA 4RORA 4X93A 3DPIA 4G4SO 1O58A 5EERA 1WUTA 1K2VN 1DZ3A 4OMDA 3I9MA 3HTXA 4PG5A 5ESXA 4AP5A 6YASA 4G09A 3AFNA 2B2CA 1KQPA 3GT3A 1UMDB 4A7PA 2HF8A 5KYWB 4PBTA 3HB5X 2DE0X 3PSHA 3T0IA 1JLHA 2DR3A 4AMZA 5BYKA 1EQUA 3ZHZA 5ILQA 2OORA 4XSHA 3RFCA 3SM9A 1TRKA 1Z0SA 2VHXA 3QHPA 3A27A 2XSZA 3O8NA 4F5YA 3ZBTA 1L5FA 2AC2A 4FDVA 1A2OA 4UOEA 2GO1A 3KTOA 3Q7IA 3AERB 3GCDA 1JTVA 3GZNB 1N9GA 3KQNA 4N76A 3WDLA 3DOJA 2C00A 2EW1A 1A82A 1N57A 4A0SA 1G4AE 2QYTA 3DCJA 2IYNA 4FYWA 3ZCVA 1XTQA 5ILGA 4RGVA 3QY0A 4MROA 4MWCA 1SXGA 4CL2A 1UBLS 4V3CA 4GI2A 5E95A 2WHXA 2QI9F 5LYJF 2YY7A 5CVEA 3SOPA 1ECGA 4R1LA 5JQGF 3OZIA 2D5BA 4FE3A 3C16C 4KC0A 1A9XA 1DDGA 4AYWA 2RH8A 3ZVKA 2V0CA 3DJYA 2NMVA 3FCUB 3NOVA 4EG5A 3ADOA 2R79A 4BEBA 1D1SA 4ZCRA 1QIDA 2Y4OA 4BB0A 5EXTA 3G6KA 4BQOA 3QLVA 3DUWA 1P33A 5JXWA 1XDUA 2WW8A 1ICEA 2PV0A 1Z4KA 4OHXA 4P4SA 4PRKA 4CIYA 2J0QA 3U40A 1F4LA 5H4GA 3ZGOA 2AC7A 1LH0A 1C7FA 1JAZA 2C5AA 3HP1A 5TX7A 3LCJA 1NE7A 2QN7A 1K7FB 1UFRA 4PZ0A 4N3GA 4TUYA 4ON9A 5JZ9A 4RZHA 1FDUA 4ZVUA 5ADVA 2XTMA 2XZPA 1CNFA 4RVSA 5DLQC 3GVXA 1JYFA 3B6JA 5IDVA 3JAMA 4GX1A 1AXRA 1TLTA 4IOLA 1IUPA 4LDZA 1G5IA 4LTMA 4UEQA 5G0SA 3TDNA 1OX6A 4B6FA 5FYDA 4FLFA 4Q6WA 3II6X 3HY3A 1EE1A 4UE3S 2F8SA 2WKWA 3KZ1E 3NBYC 4AU1A 2JRLA 2QPAA 2A67A 2CXPA 3FBGA 3GW8A 1Q16A 4KZPA 1BOFA 5JHHB 4J1QA 1GZSA 1Z0DA 4X6UA 3IEVA 4UAVA 2Y2VA 3PS9A 3PIDA 5D85A 5AVOA 3PKIA 4HGZA 3KX2A 2BM1A 2EDCA 4B3SB 5D5HA 1E0SA 4Q9LA 3SNHA 3VU0A 4YVFA 5KO2A 4PLVA 2PR7A 1JI0A 1YD7A 1Y37A 3ZWWA 4E3ZA 1I10A 1WF3A 1U0FA 4XX1A 2NO7A 2RMKA 5IARA 5IAGA 3RFTA 1SPBS 1HKUA 3LY9A 4FCVA 4KEAA 4JOCA 4TL8A 4BJ1A 1UJCA 4WDRA 4XARA 3TDKA 4MVYA 1QCDA 1L5KA 3LS2A 4UNQA 3LT0A 4Y6RA 3ZH2A 6ABPA 2XB2A 4A2PA 4B3XA 2WKRA 2OG1A 3LUGA 3EISA 3RS4A 3VJKA 1URPA 4WXPA 3MAGA 1KYWA 3KZVA 1BCSA 1K8RA 1CUJA 1IPHA 3FKSA 4NIMA 5L4NA 2FPRA 4XIFA 2XQFA 4RQUA 4P0TA 4QYIB 3QV1A 1N5IA 1DC3A 3H2ZA 1VLJA 4G0NA 2FK7A 4YRTA 4E15A 4XR9A 5C7LO 3YASA 1I13A 1Y9EA 3RIMA 4M1KA 4MUAA 3PEFA 3RC9A 4EITA 2C0PA 2O3QA 5JDIC 5LIRA 3GXOA 4DDUA 1WCIB 4PZZA 2QE6A 1YAJA 4RSMA 4IJUA 1TIPA 2NLOA 3EDRA 1NYTA 1FUQA 3LT2A 1QIGA 1IBLB 1PJZA 1ORHA 3FCSB 4I1PA 3IV7A 2JAXA 3BIXA 4MINA 4ND7A 1IXZA 4K9RA 5KKCA 5FOTA 1PX2A 3JPYA 4REOA 2H0AA 2VT3A 3LX8A 2W8BA 3MS2A 4RTQA 1ORTA 1T2UA 2JD0A 4FGZA 4IO0A 1FRVA 2WIDA 5JZOA 3OWOA 1B1AA 1RYYA 3INRA 3SS8A 3OPYB 4YAFA 3UMGA 2NOAA 2YIMA 4RVUA 4HDKB 2J1LA 3RJ5A 3ZD9A 4QBGB 2NUBA 2XRMA 3DUFA 4IM7A 2GBLC 3I5UA 4RHCA 3ZLVA 2RBEA 5A4MS 3OH8A 1BU5A 2VT2A 1V7CA 3ORQA 1V1RB 1VPEA 2MIIA 4KWIA 4LV5B 4BAGA 1P9OA 5A9RA 1T9BA 1ZMBA 4LRYA 5CITA 3AUXA 4RH3A 1N8KA 2XT6A 5DBOA 1P19A 2HA4A 4GMKA 3IB6A 1H8HA 3D4PA 4ZOCA 1GPYA 4LMPA 3K2EA 1X0XA 1F6BA 4WKPA 5EPUA 4DLRA 3F5MA 3RSHA 2PS9A 4AXBA 5J2UF 1FTNA 3MTGA 3LUKA 2RHGB 4J9UE 1E5DA 1IZ9A 1U8UA 2V3WA 4PQYA 3G2KA 1IHXA 2ID8A 1ZS9A 2IYQA 4L0QA 2REBA 1PNQA 2IIPA 1JKMA 1BVUA 3WDSA 3PJDA 3CXRA 5LXTA 1E77A 4I3FA 4X1KB 3RTEA 1S4QA 2O6HA 3PEYA 3BORA 4NBKA 1A71A 2FZVA 1VLQA 2JIQA 3EZNA 2ZWIA 4AUMA 3LYHA 3PDHA 1AM4D 2F3TA 1SIUA 1XDWA 1IDN1 4O0LA 1KAMA 4YO8A 2Y92A 5AHOA 2G4LA 4AJJA 4XEHA 1TZBA 4J0CA 3PR1A 4DJ5X 1VGVA 1IHPA 4FMBB 3NQ41 4PYIA 2VZ9A 4D2IA 1PHPA 5ALHA 4NOJA 2D5CA 1Z6TA 2WHRA 4Y0VA 1P3DA 1HEIA 3S81A 1XLTC 5EKDA 2ID9A 5KDDA 5I4BA 3CONA 3KAPA 2BDUA 3UC9A 4E5SA 1JXMA 2GCIA 3HR8A 5E6SA 3W5HA 1EFPA 2B61A 2JCVA 5E1BA 2IWRA 4FOPA 4C0XA 3T5PA 4P3OA 2RBGA 4HAYA 1A9OA 1F60A 1YR3A 2XA9A 3GEMA 3IAUA 5AJYA 3ZGLA 3BL5A 1AJEA 4H08A 1RBQA 1YZKA 5KC8A 2NZUG 4EJ2A 1UMKA 1K3FA 4MWGA 5LA6F 4FDMA 3LUFA 2P8SA 2VA9A 2Z83A 4A6PA 2B4QA 1KZ1A 1ISIA 4AMUA 1RXYA 2VL7A 1U31A 3BWBA 1C0KA 5F73A 2R2AA 4EMUA 1DKQA 3FGOA 1UIMA 3OUTA 3U4AA 1ZCBA 1QGUB 4Q34A 4UFNA 2IU0A 4MEAA 4DXDA 3H8SA 5JW6A 2G9QA 4KVFA 3QMMA 3AHGA 3MTBA 1S3GA 2HQRA 3EIXA 1C30A 1NHGA 2UYOA 4BNGA 1SC4A 3L43A 4KMRA 3G2JA 1FFCA 2FZWA 3LNCA 4C5BA 1C80A 3OM9A 4ZK6A 1MIOA 4XQCA 4GVPA 4X64B 1AGXA 4UEWA 5JSYA 2ZSHA 1SA0B 5J1SB 1L4HA 1LJ8A 4JY7A 1OH5A 3L1KA 5HHTA 4TLBA 1TVCA 5CA1A 1Q0SA 1G42A 1FF9A 1XO1A 2WAOA 4NOMA 2FWBA 4BQIA 2ANBA 2GA8A 4MULA 4YDSA 5EEGA 5BPFA 3GAAA 2JFUA 3A10A 3LW8A 1YZLA 2YJ6A 2JH3A 3CTMA 3OIYA 5JROA 3ZI4A 1CUYA 2GTIA 3T7IA 1D1QA 4YXWD 2DRIA 3MWGA 4WOCA 4GBED 4LZOA 4FHCA 5PNTA 4X90A 1K97A 3Q1KA 4B3TB 1MZVA 3QLUA 4M1OA 4XUCA 1AO0A 1NWCA 1T26A 4M1TA 3FTEA 4ND5A 4RZ2A 4C0AC 1TYEB 4EB6B 1YK0A 1G8GA 1QLJA 1VE1A 4OKSA 1J23A 2PRSA 4DZRA 4YT4A 1VLLA 4JHLA 4TVOA 3THYA 4YP5A 4C0WA 1E8DA 3TKYA 1OPRA 3LWZA 2A9OA 1QIJA 4MA0A 2AX3A 1O96B 2XB9A 4NICA 4LXTA 2OA0A 5ALOA 3OO1A 2PGJA 2Y67A 4EFMA 3H6KA 1EK0A 3K1AB 1GZUA 2XECA 1XQVA 4M76B 2ZI4A 1IY8A 4CODB 5FI0B 4Q6BA 3HBLA 3EWSA 1G16A 3MELA 1OWMA 5G1NA 2QZSA 1XYYA 1IEXA 1YE8A 2I2AA 3ODPA 3BQNB 3LC2O 5TPWA 4DJAA 2RCNA 1E7WA 2W6CX 4AJHA 2FF5A 3CVXA 2LZ0A 1K5HA 5EPOA 5ALGA 3EMKA 2L18A 1EJ0A 4KR9A 1BIFA 4J2HA 1W5TA 1TMKA 4P4SB 4LXIA 2PH3A 3IMFA 3RFVA 3BYZA 3SOZA 2ACEA 3K4QA 3SSOA 3HKBB 2LRHA 1MABA 1R6UA 5GMOA 4H7PA 2PSEA 3FYUC 1LJLA 1YA4A 4HQOA 1QKIA 4LN1A 1IWOA 1E3EA 4N82A 3RWOA 3OPQA 5HE8A 5EZ5A 2Q8PA 4J0QA 3G7SA 4DC9A 1BZYA 2F4NA 5CT6A 3T9DA 4AQ7A 4A0GA 1JXOA 1RRFA 5FB3A 3A2NA 1JJ7A 5H82A 4JVSB 4Q0MA 4MUJA 1X9GA 5LSAA 2QNBA 2R6DA 2RGCA 1X7YA 4ND2A 2XUDA 5IUNC 3CZRA 3IBTA 2ASVA 5F4BA 2ZJZA 4MLCA 2Q2VA 2PUJA 4F12A 3DEFA 1B43A 2EFCB 1X1TA 1DARA 3T6KA 3IAS6 1E2FA 3OZEA 4AZTA 1NFRA 2HSJA 4EY3A 5K8CA 4E31A 3JVDA 2H65A 3W8EA 3FUTA 2JDIA 3AI7A 2JKYA 4NV3A 3FLEA 2F1KA 4BY9E 4CKBA 4IUBS 2HA0A 1I4WA 1G8YA 2HCJB 3HN6A 1J3UA 1OKKA 1TM3E 1Y3BE 2Z2JA 3MN1A 4NMHA 1DKOA 4NXNB 4EUSA 4D42A 4X94A 1MO6A 3ZJTA 1RWNA 3S8MA 1NMSA 2EKDA 3WSTA 3UG6A 2Z2YA 3HO6A 3OZSA 1YNSA 1EE9A 1JZTA 1UMCB 3IEXA 3L8FA 4HQ6A 3N8GA 4B75A 4JJ6A 2ZE5A 5C3UA 3TTSA 1NU8A 3O21A 4KR2A 1I9GA 5DNAA 1SGWA 3M3PA 3NTOA 3NORA 4M1YA 4IS2A 2QMYA 3EXHA 4NHEA 3WLJA 1KWGA 2O2XA 1CP2A 4KIWA 2ONKA 1T2FA 5DU2A 1EIZA 3Q7PA 3AXSA 3TOXA 4TLDA 2X22A 1LKZA 5BN3B 2VH2A 4C4SA 2PK3A 2XUZA 3DV2A 2IYAA 5KYYB 4M0CA 3VH2A 3N6RA 3T3PB 2ENWA 2IYWA 3Q3EA 3RG8A 3SEQA 1DJOA 1MC5A 4MW6A 4EPRA 4EG8A 2OBLA 4LYJA 3TXAA 3HN2A 4HXYA 3S8EA 1FUUA 2FEXA 2HPZA 5KTTA 1J2UA 3EUFA 3L84A 2OXEA 1YS4A 4KIUA 1SD1A 2H3EA 2OO5A 5JY6A 3U7FB 2BMAA 1XQWA 1AMOA 2PAFA 4MWOA 3S1AB 1SU6A 1N36B 1KIMA 1SZPA 2R84A 1SCUB 3R6QA 2FSVC 4YQEA 4GE0A 5IXSA 3FAKA 3F74A 1TO1E 3TX6A 3LI2A 3WLNA 2EEPA 3X1YA 2YVAA 3AEKA 1V3UA 4PG6A 1CE8A 4ZGBA 5IF9A 3QOYA 4H0CA 3MG9A 2JEYA 3PRHA 4C06A 3OF5A 4YJHA 4F2WA 3DE7X 2EZUA 3R0VA 5B3KA 2AEMA 4G86A 1NF8A 3L8GA 4LHWA 3QW2A 2P6NA 3ZZ1A 2JJQA 2FOIA 5GONB 5I8WA 3BGWA 1BXZA 4JDPA 5C53B 4BQSA 1G8KA 1AX9A 1GGVA 3AETB 4CJXA 1UK7A 2LWIA 2YOHA 3ABZA 3KB2A 1HH4A 3O2NA 3X43A 1KOGA 1OXVA 2XAUA 1XEFA 3V4ZA 1NPTO 2PXCA 5FWXA 2G71A 3GJ4A 1C3VA 1YMUA 3EFOA 4HLUC 5DE3A 1L4BA 2G9NA 4B3JA 4F0JA 4JV5B 3A3YA 1IN8A 3EYAA 3CX7A 1EFHA 3CWCA 3JQDA 2AW3A 5EG5A 1U99A 1GUAA 1NZDA 2ZR7A 1N5RA 2V7EA 3ZCPA 2O6LA 1CZRA 2R7MA 1EDBA 2YFHA 1QCYA 2ZT6A 3BZUA 3I64A 4J1SA 3VH3A 2HFKA 4ZGGA 5LOVB 4FE4A 3DTYA 5C34B 4YYZA 2DUJA 2UKDA 1CRLA 3L0YA 3PFFA 4LDQA 4NZ9A 4ALNA 3T7EA 4E4TA 3QXCA 4ARCA 3VDRA 2AEEA 4F3NA 1GIAA 1U16A 1FS4A 1YHNA 4G0QA 3MJFA 3MUNA 2FDRA 5L7TA 1QC5A 1SJ9A 1TADA 4CM1A 3DVLA 2VYFA 4EHHA 2D6FA 1L7DA 2NO5A 3DMTA 4HWTA 1JFFB 3CH6A 4DBLC 4X1KA 1XC7A 1P7WA 1HYGA 1Y9ZA 4W1PA 4ECEA 1RM4A 4M0FA 3SWWA 2X9LA 3IR7A 5I7RA 2KS6A 1MG0A 5IC5A 3UK6A 2JIRA 3TW8B 1GGKA 1Y89A 1M2VA 4O5AA 1EFPB 1TE2A 4NBTA 2ZB8A 2ATXA 5EHNA 4UQLA 4FQ8A 3AF3A 3LVFO 2J0EA 1D1PA 4GI5A 4MVJI 1FYEA 1Q3TA 4XWYA 1T2CA 4XYMA 3O74A 3HSKA 3ZLJA 4RSGA 1WUJS 2RJNA 3CE9A 2FRVA 1ZSNA 3ESAA 1RAFA 1Y6RA 3LUCA 4BQRA 5I7WA 3L9XA 4R9SA 2V59A 2HWWA 4G0PA 1HNXB 3TR6A 1RBMA 3OT1B 2YZKA 2XTAA 4Y98A 4EW3A 1P6QA 5FNZA 2YMLA 2AYYA 3SDSA 5A6VA 1TEHA 1V37A 2I99A 2PTRA 1C30B 4GE3A 1QYVA 4M4SA 3PYMA 2WSSA 1S9HA 3MJVA 4DQUA 5CFPA 1DKMA 1KPIA 3R24A 2XNDD 1TM5E 1MIOB 4X3PA 4MVXA 2YZ7A 5M34A 3QU7A 2UXCB 4QTZA 1NOKA 3OHMA 5KSYA 3U6KA 2WD9A 1BWSA 2XOEA 2RC6A 2EXXA 3LZCA 5E1OA 1ST3A 3UK7A 1R12A 2AK3A 2PQMA 3FYSA 5EMLA 3OPXA 3LWBA 3E6AA 3TPCA 5CEJA 1GG2A 1I4TD 1ST2A 2I2FA 2QAIA 2RGDA 2WYWA 4W63A 2LPMA 2ADFA 4HC4A 5AKEA 1KI7A 5DTJA 1GGJA 4ITUA 2B4KA 4HAOA 3HKCA 4PQRA 4M7OA 4QRDA 2EJWA 4K6GA 2HBRA 3Q9LA 5C0OE 4ARBA 3Q88A 4ZTBA 4X62B 2XZOA 5ALVA 4AN1A 1U3CA 1H6AA 3GEEA 2C78A 2YJ5A 4L8WB 3D2BA 1QR2A 5C7OO 2RCYA 5AW9A 4PSKA 5F2OA 4U0JA 1F3LA 2XWBF 3RVLA 1VFNA 1GJRA 1M8PA 3BL6A 2YYYA 3NUGA 5ALMA 3COZA 3AI2A 3IE0A 3THOA 3ZE1B 4PXAA 2VQFB 2PUGA 2CNWA 2WHPA 1DFIA 3KUUA 4JL6A 4RQAA 1UC9A 2GZHA 1L5LA 1PW7A 4IIFA 5BR1A 1NQWA 2JJ1D 2I7VA 1RLMA 3MT7A 1UZNA 3UWOA 5JH7A 4D9GA 3QV2A 3CURA 4KFUA 5FWDA 3R6GA 1AUQA 4E33A 3ESCA 3B6KA 5EWMB 5EXEA 1RXCA 1XX6A 2Y0CA 2IC5A 4MGYR 2QNRA 1M75A 3R7WB 4LGYA 3RD8A 4KO3S 1N6LA 5AKKA 2GAOA 2JC3A 1FA9A 1DCNA 1L4MA 1XNHA 2G80A 1NSFA 3GP5A 3EZ9A 3F2VA 5HJ2A 5BNWA 1Z22A 4BO1A 4EG3A 5IC4A 4D8YA 2C9OA 2IHUA 5LR6A 2HA2A 1N5MA 3I4FA 1GWNA 1IHOA 2B7CA 3D4OA 4Z0HO 1E3MA 1FSPA 1MABB 1BMDA 1M8KA 3BQ9A 3G2OA 5T4EA 2AFHA 1XEWY 3DAPA 2PU5A 4OHYA 1G6OA 1OBVA 1X1BA 3N0RA 4PTYA 1XNRB 1AD2A 1EHCA 4ADLA 1PSDA 1SIBE 4JBXA 3IT2A 1MENA 1PGQA 1DQZA 4PCUA 4Z99A 1P4GA 3LKVA 2I91A 1DBRA 2VS1A 3EXG1 3MRXA 3QXHA 3DT8A 4K9PA 3R5JA 5DWDA 3EQZA 4FR0A 2P5UA 2GJ9A 3OKCA 1JG1A 1ESZA 3R3UA 1Q7GA 1J8YF 1LV8A 4ISCA 1ZH2A 3CLUD 5HKKA 4OLBA 3T1YB 5KVCA 2J3JA 2BIFA 4RJTA 3T3EA 4MVWA 1QK5A 1YSCA 1MO5A 2KPOA 4OHFA 1KY2A 4U4AA 4CF6A 3IC5A 4LBZA 2OVBA 3E1KA 3STVA 4KQHA 5HFAA 4CMJA 3KLBA 1L4KA 3PIRA 5LP6C 4A8JB 2JLXA 4Q3OA 3KFVA 1BMTA 3ZYCA 1XZIA 3G85A 1YJCA 1CZNA 2NUAA 3N0WA 4YDHB 4EVQA 1E2LA 1K75A 3NAQA 4IXTA 4UEOA 4CKBB 4CIWA 1WZ2A 2Q9UA 1GGHA 1ACLA 2HN9A 2UUOA 5IDYA 5J63A 1LQUA 3EXG2 1IUNA 1NSTA 2XCOA 4GP9A 1SQ6A 2WFAA 5DX0A 3CR3C 3L7AA 4QLBA 2P2NA 2QR5A 3CGWA 4PLYA 1MX3A 4CMGA 1SH7A 3KAQA 4D4IA 1RJDA 4MRMB 1YOVA 2A1TR 4P5PA 5A9TA 5I6DA 3O9MA 1YQQA 2QIPA 5CLLA 4I2NA 5LLSA 3I2GA 4OFZA 1EAYA 3R6WA 1IIRA 2AZDA 4PX9A 2CVHA 2VPXA 1FUPA 1COWD 1JUDA 3A2MA 3V2HA 1Q5PA 1Y6FA 1H65A 4DRXA 1SQ0A 4KTVE 1JPVA 3AL2A 2P3SA 1XA0A 1XFAA 2WSMA 3RC3A 1FY2A 4AJEA 4PHTA 4JYAB 1VGRA 1W85B 1FTSA 2RONA 4BO2A 3FLBA 3ZYZA 1HC7A 1UDAA 3F6EX 2IP2A 1Q57A 4MJ7A 1ZPDA 1Z6QA 4YJFA 4K9NA 4KITB 1OWLA 2GX6A 4HYEA 4BU0A 2FPPB 1NF9A 4IYRA 4DCVA 3HWX1 4D0RA 1L7MA 3FNEA 2VSYA 2Y6VA 3KM0A 3CBQA 3HE3A 3AR5A 1QGED 1N2SA 2DY1A 1YTUA 1HDZA 4B6EA 4TZ0A 2BRUC 3ZHBA 3QX8A 1XRRA 4P6VF 4GX5A 1BJKA 2WP0A 1GKKA 4BNIA 4EI7A 4HDMB 4O8CA 3CI0K 4DMLA 4B47A 1QR6A 4EG6A 1Z7BA 4OK5A 1F7UA 2D4AA 2OFWA 3FRIA 3TLKA 1KEUA 2C9BA 3EQ2A 1V8BA 1J1IA 3UJ3X 3WK5A 1XWFA 5HBRA 1PVDA 5L7YA 1WETA 1P9RA 4QT0A 4E7PA 1W5EA 3GQVA 4MYDA 1KMMA 4A16A 4JKIA 1I14A 3N9IA 3LKZA 4KCGA 4P81A 2PWPA 4XQEA 3AY3A 4RF2A 4XDYA 5ELXA 1O0BA 3KDSE 2VHTA 3ME5A 1N1EA 1UZUA 2I8AA 3NM4A 3AP3A 4YP6A 4DLBA 1ZD2P 2G1AA 3CVJA 1F8YA 4H0NA 4L9WA 1RYNA 1DC4A 3W7VA 3K0AB 2WVAA 3Q3VA 3J7AC 3ZV6A 3JSAA 2GXSA 3HCRA 3R74A 1N2JA 2H85A 3IXLA 5LQRA 1BROA 1XRLA 4ER7A 3G9XA 3ICWA 1X8JA 2JGLA 1TL7C 4OHOA 5LBIA 3VPFA 1Y80A 5K6AA 4O08A 1OA0A 3H5IA 1PT7A 1IAVA 1N0IA 4JZYA 2QPTA 3WL6A 1AG9A 4RSRA 2XEDA 1T8UA 5L3ZA 2XNKA 3K05A 5E0OA 3S2EA 4YMVA 2AF3C 2W0MA 3FWHA 4J0DA 2ZJ5A 2WJYA 2PWZA 3PUZA 1ZR4A 1A77A 3D9QX 1JKIA 1D2RA 1WW3A 3GROA 4JX9A 1JHDA 2YH2A 4MV4A 4Y3UA 4YR9A 2BR4A 4PFKA 1USGA 2WJHA 4O1IA 1RXWA 5IN4A 4QUAA 4L50A 1AA6A 1EVKA 1MO3A 5HKBA 2JLWA 1Z7WA 2HCRA 2P69A 1VHWA 1U1GA 4N0DA 3VTKA 1FQWA 3WNZA 4X97A 4E4YA 1JR2A 3TRIA 3U4HA 4D8WA 4LJRA 3ORHA 1SBQA 4JT9A 2ZFUA 1NMQA 3MILA 4LZLA 3LC7O 4M21A 4UTXA 4M8NE 4XSVA 3Q0IA 4HD8A 3WGQA 3ZV3A 2PL5A 3O73A 5EIOA 4C07A 2HVGA 3SC4A 1J56A 2EIHA 3PE4A 1D07A 2PRYA 4AAYA 5AVXA 1WU7A 4D0GA 3O4JA 1EGHA 2DBVO 3CG0A 3QBVA 4QICA 3A26A 5B30A 3K6KA 5L51A 1GTRA 3WKCA 2YZGA 2HHLA 2R6JA 1OFHA 2MMCA 3I28A 4Q4HA 1PJQA 1QK4A 3WLMA 8ABPA 1QVRA 1L8AA 3URKA 5TIIA 4W5OA 1QVWA 1TQ6A 4MVJE 3VHLB 1E3SA 5JEEA 3IELA 2QJFA 3C48A 1SQFA 4PXYA 3OQBA 1ZD1A 2OQVA 3ZZTA 3T3HA 1SXJC 5T3UA 2EF1A 4TXJA 1E1LA 1HG0A 2Z6AA 4HAIA 3T0GA 3UA3A 3HUEA 1D4AA 1WKVA 4GLOA 1OPXA 4L5AA 4MJLA 5FEMA 3UWKA 4QVGA 4OGGA 3EFBA 2CNNA 3C24A 3DE4X 2L2QA 1CZLA 1ID1A 3ASVA 3KELA 2GN9A 4XM1A 1L5YA 2WM2A 1YJXA 4PLCA 1N5JA 4PNZA 3RGGA 1VYTA 1KPGA 1YR6A 4RJKA 1WHTA 2JBHA 5BO5A 2V4ZA 3EF3A 4GOMD 4W9NA 4QRHA 2BL4A 3VDMA 1CY7A 1FYDA 3GRYA 4LMBA 2YWFA 1U1DA 2R66A 1ODIA 4RF4A 1E96A 5K3BA 1HTTA 5E9WA 2BSAA 2A94A 1K8XB 2DTDA 1ACMA 3KQVA 3LCMA 2Z58A 3LHSA 5H68A 4WZ6A 1CF2O 2OESA 3GR6A 3CJRA 1NVBA 1U0HC 3HHEA 3NH9A 4UM7A 5BQOA 5F3DA 5TF0A 1FQJA 3WYBA 4PWZA 2JGRA 3A9CA 4L2IA 2IYFA 1L0BA 1P29A 3WFZA 2PWYA 1QE0A 3FZEA 3L7DA 3JWIA 1J2TA 3OF2A 4TVBA 1U7WA 1UZAA 3G0DA 4OLFA 4DPKA 3G5MA 1WVGA 4D1YA 4MQEA 3L1UA 2XXAA 3RC8A 5H80A 5H9WA 1HNWB 5AI4A 2V54A 3VVMA 4HXFB 5K2MA 2QHXA 2ZIWB 3F5FA 1QNFA 2EKLA 4DCNA 3L07A 3ZE2B 5JD6A 3WYEA 2DECA 4YALA 1I2ZA 1YTLA 2IGTA 5K0BA 2JLSA 5T6MA 1I6WA 1V1MB 3RK4A 2PS0A 3C8MA 2XQIA 4E14A 2BD0A 1YI8A 3K70D 7MHTA 1GAWA 2JIZA 2QV0A 2OHJA 3J81A 4ND8B 3FCXA 2GCOA 2V7GA 4BMVA 3PQ7A 2UZ4A 2B4AA 1RLUA 1MKYA 1DSSG 3ILHA 2CJWA 3PB3A 2D7DA 3BX1A 3MB5A 1C9NA 2WD8A 3AIKA 4WCFC 2AGVA 1E2IA 4BKRA 4L08A 1ORVA 1BEEA 2DPHA 2FZKA 3WO1A 4BUCA 1FMCA 4RD3A 5AJXA 5DTRA 5EQTA 4GMHA 5HIMA 5BSTA 3WLHA 1WXWA 4D9EA 1DAIA 5AD1A 1Z2EA 2CHEA 4O2LA 4PHHA 5SY4A 1JX6A 4RK6A 1W1WA 3PKJA 5K3EA 2QQGA 1GGEA 4JUAA 1LF0A 2GEJA 2DSNA 4K9DA 4PGFA 5AWFC 3RV3A 1ZISA 1JU4A 4MAFA 5A62A 1PNRA 1R8YA 2P3QA 3N0TA 4MUIA 1ZH4A 3R40A 3V7UA 4QXRA 1BKYA 1QMGA 4B8ZA 4J2OA 3OE7A 2OCPA 1X19A 2FZ5A 3E4CA 1KR2A 3FTNA 4FBMA 3K9HA 1XAHA 2JVJA 2E3JA 1BG6A 1E4VA 3A6KA 1BTOA 1DT3A 2WIFA 3GJ5A 4O4LA 3ZWVA 3B1YA 4MGKR 1TJPB 2QR3A 5AOVA 5TVGA 2P75A 2ZUWA 3VNQA 5A4IS 3OD5A 1OXSC 3QFHA 1VCOA 2DH6A 1K0UA 2OEPA 2XCUA 1QHYA 1QFSA 1SHKA 1U8FO 2CVOA 2WB4A 3HADA 3P0FA 4IJMA 3NBAA 5TQJA 4B4UA 5JQWA 1RZRD 3NT2A 1FE8A 3CUWA 3OCWA 5DJ5A 3ZGXA 1BQEA 2JHAA 3JTEA 3OTHA 3M4XA 4ROSA 3I0MA 4G0YA 3JZDA 1BMQA 3TPZA 5MHTA 3LY8A 3OHSX 2HDNB 3G02A 2QA5A 1US8A 2WB2A 3EGVA 5DWQA 2B35A 4JLMA 3ZHRA 2XHZA 1VYVA 2CBGA 4NECA 5ES4B 1N2CB 1SZJG 1IAQA 1QSGA 2G77B 1RYBA 3K16A 4NAUA 3G0IA 3HDGA 4PNPA 4RMJA 3RREA 3ZUGA 4DXAA 4HUTA 2Q1YA 2P9HA 4RZQA 2FHSA 2BM8A 1A8HA 5EP4A 5HA5A 4DCGA 2GK4A 3W2FA 5TXGA 2E4XA 1R27A 1WCXA 2IUYA 2COUA 1JNXX 4AMBA 4DGSA 3IQWA 4YHHB 1NKVA 3AH8A 4N5LA 2FW0A 1QLWA 1C0IA 2ZI6A 3BWXA 4HAZA 4OXRA 4Z4HA 3D6VA 1YUNA 3EUAA 4EG7A 1ZVKA 1F2UA 1N2OA 2ZB3A 1HM5A 2FHPA 3FXAA 4YPFA 1T43A 3F47A 4P7GA 1U2SA 3GUHA 2X4DA 3WG9A 4DQVA 3T7DA 2BOVA 4UDXX 3H9GA 4CVNA 3LP6A 1NMZA 3ZLUA 2WIJA 4CM8A 4N48A 5ALTA 3BF8A 4MI9A 1GR0A 2XCTB 5T64A 1WXQA 2HOQA 1R9GA 3DL2A 5F7ZA 4JI8B 3W6ZA 3LDGA 4IJ6A 1ADGA 1DOAA 1QZUA 3DZBA 4M38A 4Q7QA 4YJFB 3DVQX 1ND5A 1OV6A 1Q14A 3UAVA 1U94A 4BWYA 1ISMA 3BBLA 4P2GA 2E6UX 1W36D 3I5YA 1U5AA 2A9QA 3OQJA 2O0HA 4M8LA 5LQNA 3MFYA 1U7XA 3A6ZA 3MQ4A 1FRNA 1FS5A 1ZW6A 2EL9A 3CNHA 3NONA 4ID3A 4M2LA 4EVRA 3R3VA 2ZIVB 4JA2A 3OKAA 3KQSA 2JLUA 4QYWA 2GF2A 4YDQA 2ZSJA 4HFNA 5CT5A 4NV1A 3O7WA 1O97D 2EF0A 1SIOA 2IT1A 4NJMA 4X1IA 1G7TA 3I92A 4JI6B 4TMKA 2NXWA 2YV5A 1OLXB 1WXGA 3D8RA 2QQ5A 4I50B 5GIOE 4IXWA 3FHTA 4KNVA 4DADA 1TUBA 2QRZA 5E7JA 5I7EA 1JQAA 2D59A 2FX2A 2ZI9A 3D7KA 1GUYA 3DAYA 2XWSA 3WB0A 2WMDA 2XKKA 2H5LA 2IXAA 3BHNA 2G9UA 4QGFA 3KPWA 4RA6A 1BGXT 4PS1A 2NPOA 1UBKS 2PUBA 3IVMA 3HA7A 4R1SA 2BEJA 4DNQA 3AIMA 1OXXK 4JB8A 2HWYA 5A9SB 2HT1A 1GNTA 1M8FA 4KHZA 5LDDC 3I8SA 3K9CA 5DULA 2QSJA 1ZUD1 5CH8A 3UAWA 3ORYA 4CG3A 1XTTA 2R7AA 1W96A 3IE2A 1E4OA 1EHIA 5HEKA 3PA8A 1MV8A 1VBKA 1Z2CA 4TKZA 5IANA 3BJEA 4F3TA 3GDGA 4MPPA 4OKNA 4PRZA 4HZGA 3ANTA 4I1SA 4F91B 5TF4A 4INOA 4LZAA 1XU7A 3HU1A 1UFKA 1D8TA 4QXAA 1VG0B 4YRFA 4OI0A 5BMOA 2GM3A 4C87A 1KQ7A 2EDAA 1DO0A 2I54A 2ZQYA 2AFIE 1VKJA 2QN2A 4ALMA 4BBPA 4MR8A 1Q3HA 5K1ZA 3RLFA 1WF6A 1R0LA 2PU7A 5AW5A 3U0VA 5TNXA 4F8EA 2OKCA 3IAAA 1YDMA 3GLHE 5JO0A 1KP2A 2KE5A 4GL2A 2BTQA 3UMFA 4BVBA 1JFVA 1M10A 1M74A 3AYXB 3NDIA 4Y6QA 3RBXA 1T5OA 1ZVJA 2W7TA 5ECYA 2PZFA 3I3OA 4A0HA 5HKAA 4KACA 4EPXA 1P4AA 4UM8B 5CNIA 2OAP1 2DKFA 4JNKA 1G3IA 2VUHB 1PGOA 1SCJA 2NT4A 4PICA 4RHXA 4AWBA 2J0UB 2QJOA 1M2EA 5MN4A 5IVIA 4XUEA 4UDOA 1DTWB 4KXLA 2DGDA 5FBHA 3V2GA 4CL0A 1ZH8A 4FEAA 1VHDA 1MAUA 3OBBA 1W75A 3P4XA 4HQFA 4MTCA 3NOXA 1DAFA 1XDGA 3B53X 3P0RA 4Q4HB 4RM2A 5A6SA 4ER0A 1XJWA 4KBYA 4LV8B 2P9FA 3QPVA 2WIBA 1KJJA 4LRWA 3ZHQA 1V47A 2H2GA 1LPNA 2C7VA 1NXTA 2P2GA 5TEVA 3C3BA 4GF5A 4U63A 4AMVA 2Y0BA 1XIVA 1SVWA 2OXTA 2WA2A 2FSPA 4FR2A 3NHMA 1O0SA 1VKNA 4PM4A 3NKLA 5JAPA 3I2YX 3GIWA 1AUXA 4MCIA 4GEKA 3ZGYA 3NMUF 1WXDA 3W6OA 3T5TA 2MSLA 2ZYAA 4TQ9A 3H13A 4X95A 5T57A 4PZ9A 3BEOA 2HXYA 3T99A 2IPAB 4BFCA 4RTRA 3AB7A 3CPSA 3NDRA 1C8KA 2AHOA 1KQFA 1UXKA 3NUQA 5LZ4A 5DCUA 2B21A 3QF4A 4RL4A 3RUFA 5JCZA 2Q5QA 4B3MB 4U6NA 5CDFE 6REQB 3KT8A 3W3AD 1IRIA 3GPIA 1PTKA 2G40A 2V5UA 2WYOA 2BUCA 3L7JA 4RPLA 4XJTA 3NTLA 1QGYA 3K0FA 1PR4A 1B6RA 1Q6ZA 3IEUA 1MJGA 1OLSB 4RD6A 3ZZ0A 2ZG6A 4PLZA 1PJSA 3OQIB 1Y3HA 3TLAA 2ORED 4QNNA 1A9PA 4F9FA 4ND4A 1TPYA 4H7DA 4CUKA 3JRNA 2ORIA 4NH0A 4GM4A 4L2IB 4KQKA 3TB4A 4HSGA 1GA1A 3SI7A 1E5TA 3IAM6 1PAUA 3P1JA 4G56A 4H2DA 1M7HA 4V24A 2B4RO 2Q5OA 3RS9A 2OMEA 3SHTA 4C1NA 1GILA 3N3BC 4RLFA 2PEYA 5JAIA 3QVOA 1SKMA 4A27A 1XD8A 2X3YA 1N5LA 4E5YA 3RYCA 3ZDCA 1MC1A 1Z68A 4W4TA 1ZNXA 2BBTA 2DFNA 3DEJA 4H77A 2Q3HA 3L0OA 3ADPA 1L5SA 4GZ3A 1DVRA 3PXCX 4UXHA 1S8OA 4R8MA 2QJRA 4IDHA 5EL0A 4C5CA 4KGVA 1E8MA 2J31A 5FRDA 3EDQA 3ID6C 4TSKA 1E3TA 1OIWA 5DRYA 4J91A 1P5FA 2JGDB 1KEEA 5IM4A 3EXFB 4XI9A 1YBVA 1M9NA 4FD3A 1X1AA 3GLFE 2MDTA 3N2GB 4BV2A 4UD2A 5I7FA 3W06A 1XZBA 1K7XB 4LJ8A 5JARA 4EVSA 2W83A 5IF3A 3UNXA 4FB4A 1AF7A 2PX8A 3TCKA 1L3BA 2JI8A 3B82A 2DQ4A 3LFHA 3PXBA 3ZHYA 3A9RA 2QAGB 3GLQA 3CW8X 2CDAA 3SVLA 1VKHA 3VZPA 3MYRA 1Y4AE 5K6AC 2R6FA 1CQJA 3AJ8A 1VG1A 2BEUA 3CISA 3ORSA 4LMRA 3W2EA 4QQFA 3P97A 3KJIA 1UPCA 1ESMA 4K3UA 3S5UA 2IYZA 2AZTA 1E2HA 1EM8A 5A2QA 4FS3A 4GXQA 2JLVA 3LPDA 2WPNA 1X74A 4CMIA 3ZBUA 1ZJ6A 3V4SA 2CXHA 4F4DA 4X0EA 1SUBA 3I52A 1J2RA 4JBWA 5K9ZA 3NM6B 5AM4A 3PK0A 4V0LA 1HZZA 4W99A 2J41A 1ZWLA 4HMPA 1PFKA 2VZ8A 3CHYA 2X86A 1G21A 1S2IA 2XUHA 3C4VA 3IDFA 1ODFA 1JWAB 2GAFA 4HJRA 1K4YA 3BREA 5JR3A 5TQ2B 1ZGCA 2A9RA 2UU9B 3HJGA 4NEQA 1HT1E 1WMBA 2Q7OE 2VCEA 3AXTA 5DLPA 1RHQA 3RS5A 3WWEA 3E61A 4BIMA 4DC1A 2RD2A 1GPKA 2GUWA 4FMDB 2VF2A 4BXOA 4KR6A 1PX0A 1QG4A 2NQTA 1I80A 5T7BA 1OI7A 1PFYA 5EFZA 1EK5A 2WNIA 2Z08A 3PTZA 4PEVA 1J21A 2C2XA 2R86A 1NBME 4R2KA 3HB9A 4CGYA 1U0GA 1YR9A 1YRBA 3FR7A 4FMCB 2J09A 4QU8A 4MVJM 1KRXA 5EJEA 2JD2A 1N6HA 3KUKA 1ZXLA 3GPCA 1Q91A 3UAZA 1PWHA 2QRHA 5K0ZA 1C1XA 1E1MA 1QU2A 4BQNA 4EUHA 3COPA 3E82A 1K6EA 2OTCA 4L8YA 4S1OA 4CM7A 3SF0A 4OVKA 2SCUA 1J4AA 1E5QA 1J0DA 1RC0A 3UJCA 4JXZA 2E55A 2EKPA 2HJ9A 3DWFA 2VBIA 4H9GA 2FPLA 4C30A 1TB4A 5H3HA 3PWKA 1APBA 2VF8A 2YY6A 3AESA 1S3FA 4J7CA 3VHRA 4F2PA 4MLZA 4WNYA 1JT9A 4QJ5A 4BFLA 1N1GA 1EG7A 2BHTA 1KMHB 3CBGA 3L8YA 4CM8B 1L5HA 1E2GA 1HGXA 3LXRA 4EHBA 1H1LA 3LXUX 3MOIA 3SICE 3NEYA 4D74A 1LLDA 4JLBA 5DYNA 1U7ZA 2HUNA 3V8BA 3GWGA 3HFRA 3PNVA 2OHIA 5K09A 1C9YA 3LT4A 1LDNA 4N9WA 4FYYA 5FI1B 3PXGA 4EJSC 4L72A 4W9MC 4OUKX 1ESCA 4GP6A 4M1MA 3MJEA 3ZWYA 2JARA 4ODIA 3ONNA 4RIIA 1JEDA 1S2NA 2BI8A 4YRLA 2AEJA 1I94B 5CA0B 3DC7A 1TQ2A 2CFRA 2PLWA 5E3IA 3GBVA 1KL7A 3M9XA 3RLIA 3ASZA 1QGOA 1B3RA 1WVMA 1CUIA 2DQYA 3FWZA 1E6LA 2IP4A 5FQOA 3STTA 1Z83A 4E5MA 4BX2A 2JGFA 4TXLA 4X1IB 4ZCMA 1QX3A 1SUDA 5DTQA 2ZIZA 4MK4A 3ZLTA 4CV1A 3I9OA 4B34A 3RRZA 2XD4A 3O9VA 1NU6A 1TUBB 1XTVA 3CE6A 3LYUA 5GY7A 3SMVA 4IFTA 3VSEA 3ZV5A 2W42A 2O48X 2XODA 2QN8A 4CMHA 2CL0X 3MINB 1FFGA 1RTTA 3M6XA 1GCUA 2FUKA 1UEJA 1P61B 4MARA 4FFLA 4HBZA 1UPBA 4O25A 5IP5A 4PGGA 5J4KA 1ZRNA 2ERYA 2RKBA 4Q3DA 4EFCA 1R50A 1GRQA 2CVQA 3EGXB 2ZVPX 2P11A 3K1ZA 4IHJA 4QUHA 2ODAA 3TNYA 2IPXA 4WECA 2NU7B 4OXIA 2ZGVA 4F4FA 2WG1A 4N9QA 4H1VA 4UJ5A 2X1LA 1T4MA 2RGWA 3IJPA 1WS6A 4JQZA 1AKVA 1WLYA 3L6DA 5C46F 1WZEA 2QYSA 2QIOA 1FNNA 3KWLA 4C6HA 3P2YA 4Y2VA 3L18A 5JT1A 3C5CA 3NJ4A 5F5NA 4ASUD 3LOUA 1G17A 2W4MA 1IVNA 3S2SA 5ICGA 2QYOA 1LRKA 2HMAA 2OCYC 3IPAA 1RPTA 2JI6A 1MH1A 4CETA 4R9UC 1P5ZB 5J43A 1SVKA 1ECFA 1S96A 3DLPX 3OA0A 4MR8B 1K5PA 3NTRA 4L7VA 1L5QA 1FNDA 1P2VA 2O3JA 3O82A 1CS0A 3CTPA 3PQ5A 4I6GA 4XLLA 3I09A 1YKGA 2Q4TA 3M3HA 4DT1B 1K5DA 2UUPA 1T15A 1Z63A 2DBRA 3AHHA 4EYQA 4MITA 3TQFA 5TPZA 4JENA 3P9CA 5HTKA 4EY6A 4N1AA 5K8VA 1M0SA 3GWZA 2ODQA 4YRSA 3HR4A 1GL9B 4Q9HA 3TO5A 1UPFA 3R2JA 3ETJA 4N3CA 5L95A 4O1HA 2CV0A 5K0TA 5D86A 5JMPA 5HGJA 4ZYTA 3NH6A 4AM8A 3OIFA 2HZ7A 4HVCA 1F0YA 4F45A 2IYPA 2OO3A 3KBOA 4YONB 1KP9A 3F98A 3V8MA 3OFSA 1NJGA 1PHRA 2DPLA 4PSDA 2JIPA 2VRWA 2XDAA 3VNBA 4GX2A 4E2FA 1K8ZB 5I8ZA 3RWMB 2ZUTA 4WACA 1EDEA 3T4EA 2M32A 1P1HA 1U2GA 3IAEA 4NU5A 1THTA 2KM1A 3KZXA 4BMOB 4FM9A 4E94A 2V7WA 3HEMA 1HL3A 3G1WA 4BWFB 4R71A 5IKPA 3AHIA 1RXUA 1EMDA 5G4LA 4UTNA 2CBZA 2CJYA 1LBEA 2IQ5A 2VP2A 2O9JA 3KZKA 3NPAA 1T36B 3OLQA 2F8LA 3FR8A 4HWGA 1X1EA 1PT9A 1QDUA 1T1RA 2Z2KA 1E61A 1YC2A 4Z1MA 4HN4B 1U04A 2YHSA 4R01A 2PY6A 1G0OA 3AR4A 2R751 3BMNA 2FPGA 3QF4B 4L22A 4NZPA 4P3NA 3TFOA 1OHHA 2QRNA 3KUXA 4F5ZA 5EQFA 5BW5A 3T7SA 1E0AA 1GPWB 3K0FB 1EWQA 5GONF 2BBOA 2PX3A 3LD9A 1WMDA 1JKFA 3I6QA 4M83A 3WKBA 2B5VA 4HRYA 2FFHA 1VHLA 3UGTA 4I9HA 5GOTA 4V1CI 4MA5A 2P9GA 5L3QB 2YN0A 2YNMD 1GITA 1JDVA 2O7QA 1VPVA 3AVOA 3HBJA 4NJOA 5CHYA 4DB2A 1V3TA 3VBEA 4DV0B 4MKHA 5J5CA 3DZIA 1GU0A 1QHHA 3VKVA 4L73A 3WR5A 1NOIA 1LK0A 4CM5A 2J9ZB 4Q4LA 1OVMA 3RVNA 2UZ1B 5TY0A 4FW9A 3MTDA 2KBEA 2NZ8A 4NBWA 3EUWA 3R7FA 4E5UA 3AEQA 2Y4NA 4IYJA 4W8OA 2R7LA 1KY3A 3CS3A 4QHYA 4WNIA 2AEFA 3OCZA 3WYNA 5LOVF 2HDOA 4RFVA 1FS6A 1RM3A 2GCNA 3GFRA 5K8UA 1JHOA 4B3GA 1N6OA 1PG2A 1OLUA 3F49S 1J49A 4UXIA 3Q5EA 1DQRA 1YDGA 4J7AA 1L8XA 3G2PA 3Q7RA 3ET5A 3M6AA 2VDUE 1KEEB 4NU8X 3O4GA 1AE1A 1DTEA 3W9BA 3PNBA 3TSZA 1P7CA 3R0JA 1P3JA 1MJ5A 2R6ZA 4D9CA 2NTNA 1KBQA 2UVPA 1AUOA 1S1MA 5K8IA 1BYUA 3QNMA 1BVHA 3OPMA 4RTLA 4R41A 2WKPA 1KIFA 2P2YA 3G8CA 1U2ZA 3EDCA 2V7VA 5KBYA 5AVJA 4MS3A 2AOXA 3AX6A 5F64A 3UYKA 1YL5A 2XTNA 3LQYA 2FW7A 5AXCA 4IW3B 4Z9FA 4EJ0A 1FP4A 1JVNA 2FG7C 2QL5A 1DBSA 3FPHA 1M6VA 4B2IA 3SE7A 1CQJB 1T25A 2YFYA 3AFGA 4TV9A 3T0FA 2WWYA 2MJLA 2F1HA 1MPTA 4UHDA 1II0A 2PLRA 3F3KA 4AG5A 5EZYB 2FSUA 7ABPA 1J9GA 2NNLD 3TTXA 4ZI7A 3ER9A 1SXJE 4CMIB 1OAOC 1SCNE 1JVBA 3WY9A 1TVEA 1BWRA 1ZHHA 1KPHA 2JJYA 4UHCA 5CCXA 2EW8A 2XCLA 3WGZA 1Y8AA 2QMEA 2P7IA 5CYFA 1LTHR 4WNAA 3WSWA 1QQBA 3FZNA 2HRBA 1ABEA 4MH0R 5BSFA 2EIXA 4EEZA 4C22A 4PN7A 2BGWA 4CN8A 4U5XA 3T3NA 3UUGA 1U3TA 4JSYA 2PYDA 1O4VA 1OX4A 4N8EA 4FYVA 1V11A 1Q1GA 3HA5A 1B16A 4PBSA 4RHUA 4LF8B 3ABRB 4EUEA 2XYHA 1LCIA 2DC1A 2V8BA 4PBRA 3ADBA 1M1YA 4HDSA 1OGIA 4E51A 3JD2A 2LXNA 4P4TA 2J3DA 3ZJ4A 4U2GA 1YNOA 2ILVA 3CRZA 4ZAXA 3QM1A 3EEOA 1X94A 4BRUA 4HMQA 4I1YA 5HGXA 4IQJM 4NYIQ 1ENZA 5HDBB 4OP2A 4GYWA 4HEJA 4Z9AA 4AKIA 3B5EA 1CHNA 3WS7A 3ONDA 1HBJA 1M3SA 4FIDA 3E03A 4TLEA 5AYVA 1RYHA 3DFZA 1MV5A 3HB0A 3OOJA 3QU4A 2ACKA 2EFDB 1JDZA 4MW5A 3E3LA 1EUCB 3HCOA 3RS2A 3GHYA 3I8OA 1FB5A 3WYFA 3HJUA 5FUXA 4AF6A 3K94A 1C7RA 3HDYA 1OZAA 4RJ2A 4KKXB 1F9EA 1QOZA 1B8UA 1X7GA 4WBSA 3WIBA 1PD1A 1GG8A 2TECE 3M2PA 1DADA 5LZ8A 2EQ5A 4M53A 3N6XA 2X2OA 4ENTA 1L3CA 1MF7A 2XKAA 5D84A 2VPTA 1G5FA 2OGWA 4LTNA 4L78A 1VE9A 1R8SA 5JRJA 3VYWA 3EH2A 2VQEB 2EOAA 4IV5A 5DCLA 3F6YA 3JZFA 3Q6IA 4ND6A 2YJTD 4OSEA 4JGGA 1W4LA 2JBAB 3PG5A 3NRJA 3O92A 5FL7A 1Y1SA 2P78A 1KAGA 4L51A 3FCYA 4MUKA 5ALZA 1OU4A 2B2XA 1PR1A 4RHTA 2CGEA 4PFQA 3COJA 4CN9A 1TEXA 1DXHA 2QY6A 2H06A 3DEZA 4GBJA 2A9FA 4RK0A 5DGIA 3ROZA 4Y9TA 3SMQA 2HCFA 2VZLA 3RJMA 4X6XA 1NRJB 2B92A 3BH6A 1BMFD 2ZAYA 1Y7LA 2HRCA 1TM1E 2F67A 2BMJA 4WIAA 3QKTA 4X41A 4G8DA 3UPDA 3AY7A 3VZQA 5EPEA 3LX5A 1FDIA 2G1PA 3KT6A 2FEOA 3PNLA 4WW0A 4QDXA 4RD4A 1JDPA 3P2OA 4BATA 4LF9B 2HCBA 3ASYA 1EFKA 2R8ZA 4RMNA 2HM7A 3N39C 4WSOA 2QLJA 2RBKA 2R8RA 1U5BA 2V7PA 4K3VA 1GTVA 4OP1A 3CF4G 1MO4A 1CZUA 4IZIA 1W1UA 4G26A 4DJDC 4KQJA 1PKEA 4K9SA 1VLHA 5AM2A 5DM70 1XQ9A 4LWPA 2JB9A 4IHJB 5AFSA 3E5RA 2XMGA 1EZZA 4J03A 1YDEA 3WIVA 4YRQA 2Y68A 1NN1A 1GEEA 1G66A 2WIGA 4II2A 3O8QA 1OGYA 3OE4A 1HRDA 4JJIA 3T15A 4XW2A 2OFFA 2IUSA 4B6GA 1BEUB 2VQSA 2YY5A 4AFNA 1KGSA 1Z35A 3KVRA 1JV2B 2FPIA 1QS0B 4WJZA 4H1TA 2C8JA 4Q7EA 2QROA 1I3NA 3GJRA 4H3SA 4OP3A 3WLPA 3I61A 5BVGA 1GZ5A 3OJLA 1C7ZA 4OQQA 1WNFA 3DBLA 4RAOA 2EBUA 3P26A 2FZCA 1PZXA 2GN2A 4H3HB 4F6RB 4Q7LA 3SEAA 4NHOA 3QJ5A 5ENDA 4JX8A 5K0GA 1JEOA 1NUSA 5JYBA 2IY9A 4JT2A 3FPSA 4KNYA 4F4IA 1D6SA 1TYDE 1F6WA 2HY7A 1EFRD 4Q37A 2GILA 3P9IA 3ZWPA 4KL8S 2CV1A 3HB4X 4G5SA 2IBMA 3DSRA 5CVCA 2H8GA 3A4IA 1FRZA 2QM8A 1NNEA 3ANNA 3C8UA 3EFHA 3EBOA 3ISJA 4IEEA 1M8GA 3JZAA 4RIEA 2OXIA 3KIPA 4A82A 4YQZA 2ZRMA 4ENRA 4ZHQA 3JD3A 1QZZA 1DTSA 4OJTA 5A1JA 3OOSA 2I4NA 2WJWA 2ZXEA 4URYR 3U3DA 3VR5D 4RW0A 5AVYA 1Z4NA 4J75A 4QIHA 2O2EA 1XTKA 5BUSA 2BFNA 1O6FA 1TF2A 1X39A 3NBFA 1P74A 4XFJA 5F33A 1I3CA 1Q22A 3JD4A 2QUJA 4NZMA 4O2BA 3ZCQA 4D4JA 2VNHA 4D9MA 1WXIA 6AT1A 3C1UA 4GXRA 1JSZA 5HZGA 5I3CA 2HO5A 4G4SP 4AUNA 4EECA 2YMQA 1M54A 4BE7B 5HR5A 1TK3A 1RAHA 2AUNA 5DN9A 1U6KA 1HDRA 3HR7A 4A92A 3OQMA 1AGYA 4CEJA 4E03A 1ISSA 3TLXA 1A4RA 1E7RA 1ZMXA 2V7UA 1GPNA 4F6LA 4P22A 2M6KA 3UMBA 3Q7QA 3WRYC 2O5RA 1IN4A 3BMNB 4ZVMA 2Q4RA 4U6QA 2OLKA 4RO0A 2JIOA 3BXXA 3V32A 2I6FA 3K9FC 3FI9A 5DOVA 2BV3A 2YOGA 1WR8A 5HS6A 2H1LA 3PC6A 1PBTA 1J25A 1XTIA 2IELA 3BCRA 3ZQ4A 2YC2C 3AQ4A 4E5KA 3QEMB 3KSAC 1O94A 4AJPA 1B8NA 5CEEA 1Z56C 2OV1A 1DT5A 1QH9A 4E5NA 1VRVA 5AVVA 1JT2A 2OCGA 3EIWA 3TD6A 3OZCA 4I4TA 1Z4PX 2A0UA 3AO0B 3F5DA 3NNDA 4QTYA 5DRTA 4BVKA 1QWOA 2YWEA 3T1VA 3C2QA 1UXJA 1A69A 2WJ4A 5KNBD 5KSWB 2CC2A 1MDFA 4QOEA 3L6OO 4PPNA 3KJXA 1LBSA 1ELOA 3CPEA 3QG1A 5FR2A 3W5BA 3ON5A 3V8PA 4PPYA 4C78A 3KV1A 1QHXA 2ZYVX 3NIWA 4ENQA 4JL5A 3LX4A 1ZUNA 3LC0A 4XYLA 1ZKDA 1MXHA 2DOKA 4RS3A 3VZSA 3NV7A 1OLUB 5CT8A 5EAIA 4M8KA 3B9PA 2O3RA 2CD9A 5LQSA 1L9XA 3BERA 4BGIA 4K81B 2VBFA 3LHKA 3AU8A 2HBQA 3KYCA 3TS1A 1UWLA 4YPVA 1N8SA 2Z43A 1T2EA 2BW0A 1NI4A 4O59O 1JDUA 4LZPA 3L4BA 2B4TO 1EVEA 3U19A 3EVBA 1NXSA 3P2EA 2D27A 1L9KA 3WMWA 3KAJA 1QH1A 2JI9A 3EA0A 3WLFA 3OJ0A 4ZDIA 2W0SA 3N3AC 3L06A 5JJKA 4JWKA 5G02A 4MMXB 4DIDA 1FP4B 3TW0A 3IHTA 2PX6A 4JUIA 5DLEA 5EUQB 5F1KA 1M6VB 3RWBA 2PBZA 4TV9B 3GZTB 5EESA 1CUVA 4LZNA 4PVDA 4DV7B 4B32A 1NY6A 1FJ2A 2X76A 4ZI7B 2DX7A 4JITA 3DFFA 3SC6A 1LC3A 5EXSA 5C52B 2UUBB 1Z29A 3GGDA 1KKLA 2FK8A 3KTFA 4H7KA