4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
b'SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
3AR2A 3N8GA 4FYPA 1Z4IA 1ZD3A 1T9ZA 1RMQA 2YBDA 3WK8A 3IB6A 2IOHA 4C4SA 2CFTA 2YJ4A 5ALXA 5AVQA 3NAMA 2ZG6A 3ZWDA 4JDPA 4UATA 2C8KA 1YDFA 1Z4KA 3KZXA 3SD7A 5AKHA 1RLTA 4BX0A 2I7DA 3SMVA 1ZD4A 4DWOA 1O03A 3DAOA 3KC2A 3L0BA 3RFUA 3SHQA 4Y2JA 2R8XA 2B8JA 2HDOA 2FUEA 3KD3A 4HAIA 3B8EA 4H1WA 5AM1A 5AK6A 3OPXA 4OCZA 2YMQA 5AI6A 3A1CA 2DQSA 1U2SA 2JAWA 5ALFA 3D6JA 2AMYA 2G80A 1Z5UA 2ODAA 2OM6A 3ET4A 4FFDA 1YJ5A 3W5BA 4QQFA 1SU4A 2IYEA 5ALYA 5AW3A 4Y2SA 4F71A 3WK4A 4YIKA 3ZUPA 3NANA 1RPZA 5AW5A 3K1ZA 2RAVA 2B8EA 2JAUA 3WKCA 2HCFA 2YFYA 5ALUA 2IOFA 5AW8A 2WM8A 1NF2A 2QYHA 1Z4QA 1XPJA 1NRWA 3PDWA 5AW6A 4HGPA 5AKYA 2GO7A 1LTQA 2G09A 5A3QA 3PCTA 2WHEA 1L7PA 4OFZA 1ZD2P 1N8NA 2O9JA 3HYCA 3E8MA 2B1QA 3SF0A 2ZXEA 1FEZA 3L8HA 3WKDA 3R4CA 1ZRNA 3QXGA 4UM7A 5ALGA 3KOOA 4IG4A 3A3YA 3I76A 3WK7A 1U02A 1CR6A 1SWVA 3HLTA 4Y3UA 2MSNA 5ALPA 3N07A 3ZI4A 4BEWA 5AKZA 4O8CA 5ALLA 1Z4LA 3DNPA 1IWOA 1RKQA 2B0CA 2WF7A 2HF7A 1U2TA 3EF0A 3NRJA 4UMVA 3FZQA 1L6RA 4PNHA 5ALRA 1X42A 3WGVA 3PGVA 2GHQA 3AR3A 3DV9A 4F72A 3ZX4A 4ZEWA 2JAOA 5AM2A 5ALIA 3QUQA 1RQLA 4C4RA 3WK5A 2G07A 3UMCA 2YJ6A 4UMFA 4HGOA 4XQ0A 1TA0A 2WFAA 4GIBA 4KX5A 4MUMA 2AGVA 2QLTA 3QNMA 4UAUA 2HI0A 3J7TA 4J2TA 4YGYA 3FPBA 5AK3A 4CNQA 1MH9A 5ALNA 2HF2A 1SWWA 3ET5A 3SLRA 1YV9A 1Z4NA 1RC8A 1RDFA 3FPSA 2PKEA 1T5TA 3U7GA 3MPOA 1L7OA 3QU5A 3U7FB 2GMWA 2Q4TA 3MN1A 2WF6A 2FPSA 1TE2A 2FUCA 5ALEA 2YJ3A 3ZTWA 3SKXA 4UMDA 3QYPA 2OBBA 1KYTA 3U7HB 2C88A 2WF9A 4Y2XA 4YH1A 5AKIA 4EELA 5FP0A 1YMQA 2BDUA 2FI1A 2ZOSA 5AVSA 3L8EA 2FPXA 1U7PA 2OA0A 4HGRA 1Z4PX 4KYTA 5ALOA 2ZBEA 3N28A 3UMGA 1L7NA 5AW2A 2FPUA 3SKYA 1RRCA 5ALHA 4NABA 3QUCA 4HGQA 4EENA 4CF4A 3WKBA 2YMPA 2P27A 2FDRA 3NUQA 1QQ7A 4G9BA 5AI4A 5AKLA 2B30A 2YMMA 3EWIA 4QJBA 1EK1A 3A1EA 1QH9A 3IRUA 3W5DA 4UM5A 2CFRA 3P96A 4BX3A 1CQZA 1Z88A 3DDHA 1T5SA 4L6CA 5AIAA 3L8GA 5AVRA 1WZCA 4Y2VA 1AQ6A 5AW7A 2YY6A 2G1AA 4UU1A 1TJ3A 4HYTA 1YS9A 4NWIA 5AI9A 2JGAA 1L8LA 3QUTA 2NO4A 2NYVA 2EARA 2RARA 3I28A 3QX7A 5AM4A 3QUBA 3M1YA 2Q5EA 2CFSA 3KBBA 1Q92A 1O08A 2YN4A 2GHTA 5AW0A 5AKXA 5IT4A 5IS2A 4KX3A 2IA5A 3GYGA 5JJBA 1F5SA 2BDEA 5ALDA 1Z4OA 5AI0A 5ALSA 2RB5A 3W5CA 4XOUA 3ZU6A 3OTQA 1QQ6A 2B1RA 3FVVA 5AHXA 3OCWA 2FPWA 2I33A 2W43A 3QLEA 2W11A 4DCCA 3QU9A 2W4MA 5AVVA 4CF3A 1QYIA 5AKKA 1XVIA 5AK4A 2JARA 2I54A 1PW5A 1S2OA 5AVXA 5AW4A 2CN1A 5AESA 1EK2A 3OCYA 5AKGA 2MU1A 1RMTA 3ZTYA 1VJ5A 2RBKA 4J03A 1RLOA 4Y2RA 4EX6A 5ALWA 3L0YA 1RLMA 3N1UA 1ZJJA 4JB3A 3MMZA 2R8YA 3R09A 4IFTA 3CZ4A 4ZEVA 2ZBDA 1WVIA 1RKVA 3F9RA 1RKUA 3FGOA 4GXTA 5AM3A 2P11A 4L57A 4I9FA 1ZD5A 3ZVLA 3W5AA 3L5KA 3AR4A 4HGNA 1JUDA 1Q91A 3AR6A 4DFDA 4YCMA 3RF6A 4AS2A 3OCZA 3WK9A 2WF8A 5AVTA 2P9JA 2C9MA 5AI5A 4CE6A 4XE5A 5AW9A 2R8EA 1VJRA 5AVUA 3TLMA 3ZVMA 3R9KA 4KNVA 3M9LA 2Q4RA 4Y2UA 4RESA 4Y2YA 4RETA 5IT0A 3L1UA 2HOQA 2P69A 5AIBA 1Y8AA 2EATA 4BEVA 4EX7A 3ED5A 4BX2A 3AR5A 3BA6A 2FPRA 1J8DA 1N9KA 3NASA 4DW8A 2BY4A 3AR8A 4BNDA 4Y2TA 5AKEA 5AI8A 1Z4MA 1Z4JA 4FE3A 4NAVA 5ALZA 5E0OA 2GFHA 5AM5A 3PGLA 3MC1A 5AW1A 1XP5A 3AR9A 4EZEA 4I9GA 3L8FA 4MWOA 1ZRMA 2C4NA 3QU4A 3L1VA 2OYCA 3B9RA 1WR8A 2YMLA 4L6AA 1TJ4A 3A1DA 4YCLA 2HO4A 3ONNA 3UMBA 2G0AA 1LVHA 1NNLA 4E88A 1YNSA 4BKMA 3I6BA 1L8OA 5AVYA 5A3SA 3WKAA 2AUTA 2B82A 3QGMA 3E81A 4YIHA 3EF1A 1ZOLA 4UU0A 5AKJA 3CNHA 1U7OA 3B9BA 2X4DA 4OHFA 5ALVA 3OCXA 5AVWA 3QU7A 2PQ0A 5ALKA 4ZEXA 4XPZA 4NV0A 1VFPA 3OCUA 2HHLA 1QQ5A 5A3RA 3N5KA 2I34A 3QU2A 4BNDB 2NO5A 4UARA 1K1EA 4NFLA 2R8ZA 2VKQA 2ZBGA 4EEKA 2HSZA 4AS3A 2HEGA 5T41A 2D2VA 2AH5A 2G08A 2I6XA 4UMEA 4Y2PA 4OD0A 4B6JA 4CF5A 1TJ5A 3U26A 3FM9A 4BBJA 5AICA 3AR7A 3I1YA 5ALTA 3EPRA 3VAYA 2YJ5A 3ESQA 3U13A 4KNWA 2ZBFA 5ALMA 3ZX5A 4G63A 3IJ5A 1RMYA 5ALJA 5AK5A 1WPGA 5ALQA 3OCVA 2FEAA 4C4TA 3E58A 2IOFK 3WK6A 1S8OA 3KDPA 2C8LA 3S6JA 4UASA 1J97A 3ZW7A 2I55A 3ESRA 1L7MA 3WGUA 3ZWKA 3U19A 2WF5A 4AP9A 3L0CA 4UAVA 3L7YA 3WKEA 2EAUA 3NALA 2O2XA 3BWVA 1ZS9A 1RQNA 2PR7A 4Y2QA 4UW9A 2G06A 3NIWA 3ZVNA 1Z5GA 3U7EB 4YCNA 3E84A 3UM9A 4BYGA 2HX1A 4KN8A 5AM0A 5AVZA
chains in the Genus database with same CATH superfamily
1AQYA 4GM4A 1VLJA 2ODQA 1T8TA 4D8TA 1Z8NA 3F6SA 3HR4A 2J85A 1L4LA 1QIMA 4HNRA 4CM8B 3JQ6A 3R3HA 2AXPA 4KB5A 1KO7A 3VR1A 5F91A 2QD5A 1JR2A 4GZMA 2DGDA 1GITA 3QEAZ 3TE6A 1YQQA 3EK2A 3ZCUA 1QONA 3OD5A 3KFLA 4GXQA 3KQYA 4IUDS 3CPEA 2VJKA 1H4SA 2NVUB 1PUJA 1EI9A 1QGOA 1EHIA 3GGDA 3QF4A 1ZFNA 4FMPA 3WB9A 4AC9A 5JHHB 1CQJA 1OBFO 1PR4A 2GEJA 1XELA 3AEUA 3EDMA 4U1RA 4WUVA 4BASA 3V7WA 1TKAA 2ORVA 4KO4S 4M7RA 2L69A 3U3RA 5AJXA 1RAIA 3NHZA 2JFQA 4V0KA 5IASA 4RVDA 4DLAA 5B7PA 121PA 1CNFA 2PUCA 5TEVA 3QLVC 2CYAA 1SRRA 4EVQA 5CXQA 4CIYA 1X38A 2PIAA 4RFSA 1W29A 3E22A 3H11B 5KTMA 1NN1A 5B2FA 3KYCB 2YMQA 4A4DA 2VDJA 4QGGA 1QO9A 1C3OA 2QTAA 3DTNA 4EA8A 2GK4A 2JRCA 3C3KA 1NPYA 1WXDA 3HK2A 3ER6A 1PQPA 2VNAA 4BO8A 2DHEA 3ILHA 3DKPA 4PYOA 4IS3A 3UCEA 2HK7A 2NADA 5LP6C 1G2QA 4Q4CA 2I9KA 2JRLA 1VA5A 3EIWA 1SU4A 2IIPA 4ZT3A 1QK4A 1P5FA 1OLXB 1QHXA 2YNMA 3GX1A 5H3LA 1PD0A 2CMHA 3HCRA 2NTJA 3MOGA 1Z39A 4GNRA 2EJTA 1PSWA 3DEIA 4MPDA 1W0JA 3VU3A 5JDIA 1ADCA 3G2QA 3E35A 1BGXT 4UDXX 4BKQA 2O20A 3MGGA 3BXHA 2AYZA 2C4UA 3GQBB 3GCDA 3MWJA 4MR9B 4D4IA 2JLZA 4J90A 1IY1A 2DFTA 3GLVA 5B1SA 4TRMA 2GXUA 1QZZA 5F4BA 1BX0A 4BBPA 4CMGA 4V24A 3GUCA 4TLEA 3LA8A 1T3TA 1GG2A 3LT1A 4EG5A 2XMGA 5ADVA 4WKCA 1H2HA 3BMQA 4M0MA 1TM3E 3GROA 3Q9NA 1C3VA 2Q7OE 3SYNA 3T5BA 2O2YA 4DT1B 3GRVA 3LCRA 1VL5A 2OMKA 3OPVA 2FHSA 3HWRA 3MJTA 2CZGA 4XX1A 3R3UA 2E21A 4JK3A 1Q0RA 4DLSA 1EFVA 1XPJA 3TCKA 4DV6B 5DMXA 4F6CA 3R7BA 4IMPA 2FOLA 1MZVA 2WSLA 4BQQA 1GGVA 4ZAXA 4CR7A 1PDVA 4TUYF 1LC0A 3MFQA 4KU4A 4RYLA 4BVLA 1E6KA 3EXEB 1IFXA 3JWGA 4ZOLB 4DBLC 1Z83A 4YJ3F 3DMTC 1SUDA 2GPJA 1FVFA 3OLZA 4NDAA 5U4XA 1O6FA 1LLUA 1XZAA 2BVNA 1EWTA 1P7CA 1WQ1R 4P22A 5K8CA 3U39A 2ZIXA 1XF1A 2OHFA 2PLAA 7REQB 2JBAB 3D2BA 4K3UA 1ZONA 4EPVA 1MIHA 4IWYA 3VXKA 2EKZA 3HEBA 4YRFA 5IJ0A 2GZ3A 3NHBA 4X8LA 3RFCA 1MABA 2VDKB 4RTMA 4FYIA 3JQBC 3FFBA 5C1PA 1QP4A 4HB2A 1ZL0A 1JIJA 2PMFA 4G0NA 4GPEA 3NT5A 1T34A 2HSEA 3UJAA 1E4YA 1QQAA 4UU8A 4UPDA 3BG5A 4RH1A 3UAWA 2PRYA 1P0PA 1VHJA 1FJGB 1OOEA 3CCFA 4Q0MA 2Z2YA 2IWHA 1ADGA 3N58A 5LPNA 2ZRNA 2Q3MA 3UJCA 4G0UA 4FK8A 3OF5A 5FUYA 2EHJA 1ZK3A 1KPGA 1GU1A 2NAFA 4L4XA 1Q11A 5JCOC 4BN4A 3OBBA 4KRYA 2R5NA 4OOFA 4UCXA 4YJHB 5JARA 2YICA 3F46A 5DN9A 4D5GA 1XP8A 5J5VA 2RJ3A 5J2UB 5E4YA 4EMTA 5EP2A 5CCDA 2IHJA 3P52A 4L5AA 2LR0A 4DYDA 4JITA 2OB2A 1P44A 4C4RA 4CJXA 5JASA 2MSWA 4C7MA 4IDGA 1K6MA 3UAVA 3OFNA 4FLFA 1X39A 3T1OA 1Z2NX 3LGSA 1HNWB 4FNAA 4A91A 2BI4A 4TWRA 4Z2AA 2IUYA 1DFGA 1J2JA 2C98A 4IUYA 1CS0B 4JUDX 2IXEA 2QLTA 4EO7A 3PTAA 4PHGA 3V9AA 1R5NA 2A5YB 2FEXA 4RQBA 5AK3A 5D6NA 3WQQA 1QQTA 4BQPA 3IA2A 1F2TB 4YC7A 1WBBA 4LK2A 5KNDA 3WIVA 4X0EA 4LGCA 1U63A 1DC3A 2FRDC 3CF6R 4ER3A 3A37A 2YYZA 2B78A 4EYSA 1T2DA 1JIKA 1Q74A 3HJHA 3ZXYA 1XQ6A 4YNBA 3QLVA 2WKQA 1QVRA 1SZJG 4M49A 4ZRDA 3KSAC 3EYWA 1FUEA 3E8XA 5D1NA 4HDMA 1Z5OA 3TSWA 3DZJA 4OI2A 1T5TA 5CG1A 3QU5A 1GPDG 1CUJA 1XLVA 1KDTA 1PZHA 2C2BA 2HV8A 3QQ5A 4JENA 5F9HA 3GRFA 1LVUA 4J49A 4YB8A 5BUSA 5LP6A 2ZWAA 1OFIA 4QAQA 1MT0A 1Y80A 2XAUA 3GT4A 4V2UA 1Z37A 1I30A 5GINE 3K4QA 2GM4A 2AMLA 1Y9AA 3KZVA 5BSVA 4MVWA 3EGOA 2D2XA 1UM8A 1E3SA 1FVHA 5DNYB 5CIYA 3L7OA 2QTWB 2PFSA 4MUXA 3FJYA 1NT2A 2PFGA 4J1TA 3H3XA 1L3BA 4PBRA 4BWFB 3HVUA 4W7HA 2XB2A 2ZM6B 2XECA 1I8TA 4RK4A 3KELA 4TZTA 4QNMA 4B2PA 4K6GA 3E9DA 1VI5A 3P2JA 4HWRA 4KXQA 3AUTA 4P36A 1DQRA 4RADA 4X6LA 1BWQA 4TKUA 3T38A 4CF4A 4F84A 5HKAA 2V98A 1H6DA 1M1YE 1P1HA 4G9BA 4R2HA 4IIDA 4TZ0A 1Q0HA 3C97A 5F3RA 2ZJ5A 4MUFA 2I71A 3AI7A 5BMVB 5AHRA 2EBFX 3ASUA 4DLPA 4PYNA 1T8SA 2HU8A 3VOSA 3CLRC 4CKYA 4ARIA 3JWHA 3ZR4B 1OFUX 2H1VA 1Y3DE 3C7KA 3O75A 3D8SA 3F6YA 2RKOA 2V65A 3KEQA 4PC1A 1DIAA 4NP6A 3HA2A 3P32A 4JJKA 4RSMA 3H1PA 1PR9A 4BZXA 1O5IA 1WMEA 2YFHA 3WJ7A 2R48A 3WYAA 1DGQA 2Q4OA 3DMTA 1KJYA 2IYYA 3EJWA 1Q0QA 1AVTA 3L0OA 2JVIA 4MPRA 5JCJD 2PFMA 1H8HA 5AI9A 2QUIA 1FW8A 1OX4B 5IHXA 1I3LA 3FHTA 4WOBA 1S1CA 1CUZA 1XTKA 2RARA 4ZRNA 1OMOA 2ZT6A 2IV3A 1NX6A 4NL4H 3OEHD 4ETWA 4P4NA 1NBWB 1YQWA 3SC4A 3UN1A 3ZCRA 1N5JA 1RPTA 1H05A 2FGJA 4PG8A 2QTNA 3U4CA 1AIPA 3KZMA 1QLHA 2DERA 5JXJA 4X84A 3JQRA 2CL5A 2AQHA 4DSUA 3IAXA 2IA5A 5BMVA 2PH3A 2SKDA 1CTQA 2XHEA 1E7RA 4W8HA 2J4CA 1V7ZA 3WRXC 2ON6A 1XCBA 3RYTC 3TNLA 1GAXA 4EHIA 5KNCA 3HS3A 5HYVA 1JSWA 1UQRA 2VC2B 3I1FA 3GRRA 4L27A 3ZHYA 1UH5A 3A3KA 2CDBA 1RHQA 3JD2A 4J76A 2VZ0A 5JCOA 2V5AA 4POAA 5GM2A 3CNBA 3CR3C 1DWQA 2DP4E 2GD1O 2TRSB 1HY3A 4PNZA 1FFCA 1P91A 5JU6A 2W11A 5EYPA 2VHZA 3ZDQA 1QF6A 1QK3A 2HCBA 1D8TA 2C8JA 4H3SA 1KO4A 3WGLA 5CXUA 5EN4A 2ZIAA 4ER6A 3ZG6A 3S2ZA 1JHQA 1OD6A 2B1JA 2I54A 4F0JA 1D2RA 4YCBA 1WHTA 4ZCTA 2CN1A 2FCAA 2QNRA 3C98A 3NGXA 3HR8A 4IDEA 3X1XA 1ZM7A 1KWKA 3QXSA 2IYZA 2A1UB 3WGJA 1T6BY 4EQ6A 5AD1A 4MLDA 1RW4A 4P83A 5FL7A 1T0IA 4QXPA 2NU6A 3LO5A 4Q1CA 3LFHA 1T3LA 5CXSA 3WXMA 2HV9A 3ORSA 1XQ9A 2MYNA 3PJGA 5L7WA 3CXUA 3P9XA 5J1SB 1Y7LA 4NLEA 1DBIA 2IIBA 3CZ4A 4IHJF 5TQ2A 4F8JA 4ZI7F 2HBQA 2DJIA 2FRDA 2ST1A 3I61A 1UM9A 1XTJA 4LMRA 4P0TA 3NV9A 1T91A 4PC3A 3EGIA 2QSUA 3DZCA 4CU5A 1APBA 3EEYA 4YI3A 1ZOIA 3IERA 5LIPA 4DQ0A 3LYUA 1ZK2A 2QRJA 4FNOA 1WZUA 4AN1A 2BKEA 4YCMA 1A50B 2XE8A 2XNHA 4KWIA 1AXGA 4KDCA 2YZ2A 3WK9A 2HLDD 2ZVJA 3FVWA 4F5DA 3EVCA 2BUCA 1MC4A 1YIAA 3A9TA 3HY6A 3BTUA 5KHOC 1BVUA 1IUOA 2A4KA 2X8AA 1SUBA 4P08A 1E32A 5EAIA 4F2HA 1J3UA 1TK9A 2X9LA 5JZVA 3K71B 4JI5B 4WY8A 4Y6SA 2FG7C 3G9TA 1ESDA 3UPDA 4X6XA 3FWHA 1C2TA 3OX1A 3M4YA 2PKQP 3I6YA 2CKDA 2OXEA 2YOFA 1NURA 3OLWA 4R1MA 4UUNA 4Z1OA 3C7TA 4BO2A 1YS6A 4EHBA 5K3AA 1F6BA 2UZ1B 1MBZA 2O07A 2HIMA 2WIJA 2A9JA 3O2JA 2IE8A 4CPDA 5JRZA 1GN8A 4BNDA 4EF4A 4JN6B 1U2EA 4HX5A 4R2XA 1NW6A 3RVMA 2FSIA 3BHNA 5E7QA 4M1MA 4X71A 5DSTA 3MCWA 3KYDB 5CJJA 3ORHA 4D8UA 4Q47A 2GFHA 3ICCA 2DXIA 4YO8A 3IUNA 1CERA 3OU6A 5T5QA 4JLPA 4WLVA 4K9LA 1RAGA 3LKVA 1DZ3A 1XD9A 3WWDA 1OT3A 3QWHA 5KU1A 3OX3A 1B8VA 1SA0A 4N7BA 4NS4A 1XDDA 1O96B 1GKLA 3OM0A 3IURA 2QP3A 4O59O 5HQTA 1X9IA 3K94A 4ZZIA 1Y8RB 2VWQA 2X7XA 2BD0A 1O54A 3CINA 3PEVA 4QLOA 2CJYA 4KKXB 1KDZA 2H1SA 3OQJA 3VYTB 4TYPA 3TZQA 2AOUB 4XGQA 2P6RA 4L8LA 4B47A 4IIYA 1DAEA 1JR3A 2EZ9A 2JFXA 2ZRFA 3G2IA 3JRXA 1Z2CA 5ENVA 1FQOA 1ZHFA 3TNFA 1LX7A 5I47A 3IQIX 3LUBA 5I5GA 3RSSA 3FMIA 2BGLA 1J20A 3DL7A 2UUBB 1Z7EA 4QL3A 1HG0A 1VSBA 4LC1A 3VKVA 1O97C 1ZH0A 4LHSA 3GDFA 2ZAYA 2JKZA 2XUGA 3O3OB 2EOAA 1ONBA 2WT9A 3FRHA 3WRXA 3R77A 3NGMA 2NTVA 2DKNA 4B6PA 1N57A 1VECA 3AF2A 4IPTA 2GCNA 3QVLA 4WZAA 1WHSB 4IYRA 1KQNA 2CNWA 2GTIA 3H05A 3IP3A 2Z1DA 4IJWA 3WQHA 3JSXA 2VZ9A 1WPXA 3ORFA 4HMOA 2B5WA 3RC1A 2DR3A 2BCGY 1T1RA 2VATA 3TLAA 1REQA 4HNTA 1ZA1A 4RSRA 2O7VA 4JLNA 1K6JA 1UIRA 3IXMA 4Q3LA 2HC9A 1QMGA 1E1NA 2XX3A 3NS7A 4EFNA 5GGXA 4BAZA 3B5EA 3CBGA 5JPIA 2AJBA 1K3TA 1O8CA 1TZ2A 4JLJA 3VTZA 4UFNA 5JT1A 2HSZA 1E7WA 2HEGA 1VRWA 2ZYRA 3IE2A 1A8PA 1ZH8A 2V7GA 4WXEA 4M98A 3ZN2A 4BZPA 5KO2A 3OJOA 5K8TA 1CFJA 1CFZA 2O7QA 4CF5A 1JT2A 3FYUA 2DF8A 4BBJA 1DEOA 2E1RA 1PT6A 1EHCA 3D6AA 3AUYA 3T3MB 4BQSA 3FZNA 3RSHA 1VJ1A 3H4TA 4RH0A 1XMIA 2DVMA 4R0MA 5FX2A 4L76A 1ZG3A 3WWYA 3PTZA 5P21A 3IS3A 2HNAA 1BD4A 1IUPA 1YVDA 3FOWA 4KTTE 4KXUA 4Y6GB 1KK0A 4WCVA 4N0PA 4G67A 4W1SA 1YA6A 3HKBA 2BH9A 4WBSA 3RJTA 2C7VA 2I6SA 5FRDA 1CZLA 4ILEA 4C6HA 1CB0A 4GC5A 3S55A 5BQ3A 1B15A 2P2SA 1SXQA 1FYXA 1YDEA 4QNNA 4BMSA 4Z53A 3KOYA 5FUVA 1GOTA 1S96A 4N5DA 1C7RA 3GJZA 2W2VA 3WMGA 2XMSA 1VJTA 1ZIYA 3DOEA 5DM4A 4E03A 1OZFA 1YZTA 4KWEA 4PCVA 4JSRA 1W52X 4LJ5A 4EGQA 2PGDA 2WY2D 1GTVA 3NQ41 3WGUA 1F48A 2GWHA 3BYZA 2PZ8A 4B3SB 1TM4E 3ZHOA 4Q7KA 1X1DA 3T15A 3MGBA 3DLBA 1IQPA 1RRMA 2Q28A 3L7IA 3NJ4A 4GMKA 4NBNA 3IPXA 2GJ9A 4FHEA 5DCUA 5CDSA 1AMNA 4KR6A 2Q5CA 2REBA 3WWPA 3GUZA 2QGAB 3PJDA 3V8NA 2D1TA 3KCNA 3VUEA 3L6RA 4OLFA 2B37A 5F23A 2NLOA 4GQBA 4Q21A 4TOIA 1X1BA 4R8LA 3OLCX 1W25A 2CSUA 2HXYA 3BCSA 3I9V6 2CJPA 1BRMA 1ICIA 4QOIA 5TARA 2XCTB 2ZRAA 4FYJA 4TLCA 3QLUC 1S4MA 3ND5A 3AR2A 3NPMA 3IH5A 1Z4IA 1LBEA 3BXPA 3LP6A 4TV8A 1L3CA 2O3UA 3KYIB 2X6RA 3PQ3A 1BJRE 2V8OA 4LVNA 2VNIA 2Q99A 1MG0A 3FSGD 3MB5A 5DGDA 1FJXA 1D03A 2PJDA 3C6MA 3BE4A 4E2YA 1JA9A 3TZ6A 3T9AA 2A7QA 1XU9A 1FP2A 2Z1MA 3DAGA 1QRRA 4D79A 4EHJA 4JI0B 1Z16A 2A5FA 3KDAA 3ZIAA 3TECE 4FU0A 1BS9A 4Y7DA 2H52A 3OWOA 2C95A 3ICOA 1E3TA 2PS3A 3K20A 1NG1A 4BP3A 2QSZA 1V2HE 5B57C 3KZXA 4M7PA 4GDFA 2CCJA 3FCUB 5HIJA 4INJA 4KGDA 1MRSA 1EESA 5IULC 1T5LA 2YWBA 2ZXFA 4N9QA 3LI2A 3G0IA 3B5IA 4P3XA 2ZSDA 1JJVA 2H5IA 2V74B 2R7KA 4TTTS 4KO8A 2E2WA 1HOXA 1DCTA 2HQRA 3VPCA 5KHLB 2BBWA 2GR9A 4MGKR 1F20A 2G0TA 3PWZA 2CLHB 4NMMA 2JEOA 4QRHA 3LLVA 4R4JA 5BOSA 1XWIA 2ONJA 4DLBA 4KQWA 1P1RA 4WN9A 5DN6A 3OEWA 1JG3A 1ISFA 2V96A 3B1KA 3Q6IA 4IUCS 2IW3A 4REMA 1N4AA 4BNHA 4EKIA 3PZRA 2FEPA 4NFYA 1QOZA 2QJOA 5DISB 3JZAA 5DNCA 5HJ7A 2ZUDA 1CT9A 1JDNA 1XZHA 2ZYSA 3JRNA 4ILKA 5BPHA 1OXVA 1YGPA 5TGDA 2ZB7A 1W9HA 4EFLA 1TKBA 1Z68A 3OP1A 4LZNA 4ENQA 5IC4A 4DRXB 1DKMA 1U65A 3PT5A 1WUIS 4KR7A 1UT6A 1RM5A 3ICPA 3S99A 3THWB 1G42A 4MQ4A 1ZK1A 5C35A 3WGHA 3ROTA 1E1LA 2QTFA 2Z9BA 2YHIB 3UJ8A 1F2UB 2ATCA 2EX1A 4JQOA 3T3EA 2XNCA 1EVIA 2HIGA 1WOYA 3PUZA 5IDQA 1QS0B 2JI4A 3ZE7A 2WT4A 4XWWA 2UZ4A 1II8A 3NC4A 5EVCA 2E18A 3O0DA 4Y98A 4KPYA 3FTCA 5F52A 3QHPA 1J2RA 2GCPA 3CF2A 3OKAA 4DM3A 2CUKA 5H16A 3DDNA 4YAEA 2Q8QA 5EIBD 2YZKA 1G8GA 4KP7A 2P75A 1GRQA 1FYWA 2J3QA 1KAHA 4AT1A 4OYLA 4AUNA 3MS2A 2W6MA 3RWBA 2WYWA 5BN3B 5K5EA 4O2BA 2AG8A 1HLGA 3CMCO 1DL5A 2QNBA 2R65A 3QY9A 2WHEA 1TYDE 16PKA 3IQGX 3CRNA 4JLAA 2IU6A 5E3JA 3HYCA 2PUDA 4OI0A 3THWA 4S2UA 1KKMA 3QLJA 1POWA 1CUWA 3JRWA 1NUUA 3H18A 1J33A 1SCBA 2WM2A 2PO7A 2PUVA 5TPZD 4QTXA 1W2GA 3TR6A 1UL1X 2WJPA 3Q8WA 2UXBB 1YE8A 4BB9A 3SVLA 2QMYA 1RHMA 4LS3A 3T7DA 2J3EA 3W4KA 3GD5A 3V5NA 1NXQA 4URYR 2D1RA 3GRCA 3L4SO 4CM9D 1XC7A 2EWWA 5SY4A 3LJKA 3K0KA 3G8AA 3LG2A 4NBWA 4MRNA 1NW3A 4GSKA 4MV5A 3S1AB 3ZI4A 4A0RA 2HHCA 1AGRA 3OPNA 4BEWA 2G9UA 1ZMOA 1NDUA 3PHGA 2ZI9A 2ZUSA 3UVEA 4DCTA 3ZE9A 1H6BA 1UIMA 4E6PA 3KXKA 5BV1A 2BKVA 2CE2X 3V7UA 2EGUA 3LBIA 1MRNA 1CQPA 1FNDA 2HF7A 1DDIA 3QLUA 4QE3A 5F78A 3RHFA 2ZSUA 5A6SB 2WUVA 2EYUA 4G1UC 1RJFA 3AKYA 1LNZA 5ALRA 4C89A 2X6QA 4DR4B 2NX2A 3E3NA 3PJEA 4EJ0A 3B3QA 4Q9JA 3KUXA 3OIVA 4I1RA 4RLSA 3BQ9A 1X1QA 4YN3A 2G4LA 4TKLA 5KWEA 4GKVA 2C57A 2L18A 2VJMB 3I9FA 3PDJA 2V4ZA 3R24A 4JJEA 5HF5A 1I4LD 4G8DA 4BMPB 4CL8A 4ZICA 1WB5A 4X1IB 2E49A 1HOTA 2VDOB 1WXHA 3DUFA 4UVGA 2NUPA 3DV0B 4JL8A 5JCPA 2X8LA 4G5OA 2I80A 2JJ1A 2D1YA 5B1DA 3QXCA 4LMAA 1C9NA 3P9ZA 4O4JB 3ZYCA 3BA1A 2JIZA 1PYOA 1FJ2A 2R2GA 3I37X 4FW9A 2ZUBA 4EY8A 3RNOA 4DSNA 4U9IS 1P9NA 2P2NA 2QQ5A 3JQAB 4J7AA 1N34B 3A1FA 2R85A 1ZX1A 5LVAA 4NMXB 3NYIA 5GONA 4KQJA 2ID9A 1CJMA 3D7MA 1YOVB 3NP9A 1IH8A 2XDQA 5BQPA 1GPLA 3I0NA 2R84A 1UJ2A 1G5TA 1NFFA 4RMJA 1K6XA 2HYIC 3RVOA 4RXUA 4BN0A 4CTKA 3CLSC 3KKLA 2JGNA 2WW8A 1R9JA 3L6BA 2B4QA 3O2NA 5BOVA 4NCHA 2GMWA 4LTNA 4U5QA 3BGVA 3A25A 4A6EA 1T9CA 4TL9A 4B46A 2GRAA 4OYHA 2B5OA 5FORA 3BFKA 3RFXA 3F3YA 3E3OA 3PD0A 4DDWA 5IYZF 1EH5A 3QA9A 1E9RA 2AJCA 2Y05A 4E51A 1I4DD 3LY5A 3RUHA 4UTPA 5DNWA 1JDZA 3DD5A 4PO3X 1L3IA 4APBA 2C58A 2CYCA 3H97A 4OQNA 4AYWA 4AD8A 4DRZA 2FZ5A 4LYAA 2IZ6A 1ODIA 4DQKA 4QICA 1NVWQ 2V45A 4O29A 3A8TA 4PZPA 3O47A 5SZJA 1ML4A 3O8QA 4C0QC 3WTCA 2QD3A 4IIUA 5AW2A 2FPUA 2NSLA 4E3WA 5ALHA 1GTRA 1AF4A 1TO2E 2IF2A 3QEMA 4HMQA 4MWDA 5D7BA 5KEIA 4FR2A 4P80A 1E8NA 5KJCA 1QE3A 2E4UA 3ZWOA 3NUQA 3OECA 4LJ4A 4L5CA 1BWPA 1DTSA 1H4TA 4EY3A 1EDEA 1KPIA 1XMQB 2KHZA 2M6KA 2CFRA 4V38A 4IXTA 3ES9A 4Z4CA 2J3MA 3AC0A 1ZIOA 4WEOA 3U2QA 2IY7A 1UJCA 1NBMA 3UUFA 1RCUA 1RXYA 1TKRA 3DDHA 1Z5VA 3HB1A 3IUYA 5EJAA 5JNVA 5KYWB 1QH8A 2LNDA 5ICSA 4JC4A 4Z1MA 4X64B 5CDTA 1JDJA 4CCWA 1CY7A 1TIPA 5K0BA 3HHPA 1M1UA 2OHIA 3DVQX 1FP1D 3PR3A 1AQ6A 1JHDA 1JZTA 3L40A 1BGWA 1X8LA 4YJFB 2NZ2A 4ZOAA 2G1AA 2QWXA 1G3MA 3LO8A 4C7XA 2IYXA 4G0QA 5F5XA 3LDGA 1GPH1 1KJWA 2RIPA 4HNSA 4AZ0A 2UKDA 3ROZA 3FPHA 1WEKA 3FJOA 3LYHA 1P1CA 2RAUA 1E96A 4RSHA 3X43A 4BJ1A 4EJSC 3VR3A 2V1XA 3RSFA 3FWPA 4OUKX 1X7GA 4BJ6A 1Q0TA 3N2LA 2IS1A 1XFDA 3M1YA 1C9EA 5F1KA 3THXB 3RGGA 4R54A 2AD5A 4ZAWA 1NSFA 3JQGB 2OQVA 1NUTA 4GP7A 3W2TA 5FBRB 1M34E 3EDRA 3K1AA 4D81A 2UXCB 3VAAA 1UKEA 4QBGB 5LA6A 1T8PA 2EWVA 4TGLA 1YB2A 3FMFA 3O6VA 1BRTA 1PV2A 3ELBA 4H35A 4MMZB 4Q7QA 4H9GA 1Z75A 3F5SA 3P9QA 4YMLA 4PPQA 3FTNA 2QX8A 4PPNA 4RPKA 4L4UA 4XQ9A 4G1FA 5DSXA 4BXOB 5FPKA 2QL6A 1LKZA 1T8UA 2O5VA 3COWA 4HC4A 4GZ6A 4R2WA 3QOXA 3RVLA 4BVEA 4YRSA 3DUWA 3VV2A 1FFGA 1HSOA 1E5VA 3HACA 1KVUA 2ZW9A 3TDKA 4C14A 1J09A 4IH1A 3KM0A 3WC4A 4B6JA 4A27A 1M8FA 5BVGA 4GZ5A 2JFHA 4OHUA 5U9CA 3C6QA 5LP1A 2H18A 2IIQA 4BFVA 5KTTA 5T4BA 1EXVA 3L0SA 1X8KA 4MICA 1K08A 3M1AA 4B09A 2VP9A 4E2FA 2G8LA 2HQBA 1L5ZA 3WAKA 1V3QE 4AICA 5TSDA 5HHTA 5HNKA 1GVHA 1N3YA 3DKIA 3KZOA 4AJ4A 2GPYA 2HLPA 1GNQA 4ZDJA 1KE1A 3ABQB 2H5JA 2Y3IA 1XTIA 1BW9B 4H0NA 4RNCA 4OX9Y 3BGOS 3AJAA 6PFKA 1ACLA 3IEKA 1XVTA 1KVSA 2QV7A 5L9AA 2IUUA 2YQ4A 2C3UA 1P8JA 3H1GA 3IOCA 4LTDA 3WICA 3C1AA 2G5TA 4HUQA 3ITNA 5KQLA 1CUGA 3U3OA 3WHPA 2ZVDA 1Q5PA 1NYTA 3QVTA 3RYCA 4NCNA 3UFXB 4C7KA 5E6SA 1Q22A 3A2NA 2XQGA 3G1WA 4CM1A 4TVSA 5JYBA 4Z4GA 2BRUC 5JSFA 3MSXA 4AS2A 1E3EA 4CV2A 3VR0A 1NW5A 3AP2A 2WF8A 4ASUD 3AGPA 3CE6A 1A9XB 1V1RB 4FC6A 4TXLA 3OZCA 1I2MA 4EABA 4R1PA 3SP1A 1OJLA 2WU8A 2YCBA 2JFFA 3IV6A 1ELOA 5DTJA 5HOQA 5JAZA 1P2BA 1O7JA 3P2IA 2GM5A 1QPGA 5JQGB 3H2ZA 3RFVA 3WV4A 2B69A 1QHHA 2J30A 4U2KA 4H2DA 1I33A 3L92A 3UAZA 2QYSA 1O1YA 3AI3A 4OIFA 3FAZA 3WOHA 4PPGA 2YRFA 4E2XA 2OHGA 4LY6A 2R44A 2Q3HA 1XMXA 4FIZA 2I2AA 3EG9A 4WH0A 1K66A 1TCCA 4B2LA 4NU5A 3CF4A 1U5CA 4QPNA 4UNSA 3Q7QA 4PV7A 5ELLA 1P6XA 2WTUA 5F2EA 3IKTA 4H6XA 2QGNA 3BKWA 1I7SB 2RH9B 1Y9ZA 4J0IA 4L5IA 4J7XA 1VIYA 2IYAA 1UJMA 2BR5A 3I72A 4FE3A 5ALZA 3RVQA 1POXA 4EG4A 3EEFA 4KO1S 3KVNA 5M34A 2QAGC 4AP6A 1XP5A 5EVJA 1RXWA 1IOWA 2PBZA 1XHFA 2V6MA 3AM1A 1R6XA 3L4KA 2ROQA 4Q9DA 1T9KA 1TUBA 4F5WA 3T1QA 5FWAA 2PV0A 4KRFA 2D8MA 1ECGA 3NHWA 2Z56A 3NOXA 3ZWXA 2P4EA 4QULA 4L6AA 1A2KC 1TJ4A 4ZAGA 1EKXA 4IDCA 3MOIA 1XVUA 2GEFA 2GCOB 3THYB 5KNDH 4MO9A 1DEAA 4Y9SA 4XD7A 1W5FA 2FA9A 2VCHA 4EJSA 3ZIDA 1YAJA 1LDBA 1DAOA 5I8WA 1M8PA 3V4RA 2BTEA 5EE9A 1C1DA 1XRSB 4UZSA 3WZMA 1LLCA 3LPLA 4TKZA 2C82A 2GKOA 4LKOA 5E3HA 5INTA 3JW8A 3K05A 3O8OB 2X4DA 2X40A 3B1YA 2QTHA 3RJMA 3UYKA 1K5HA 2XMPA 5K8IA 2D27A 2XGMA 4RTNA 3IBGA 2G5CA 3JVEA 2VYCA 3CEJA 5P8WA 5EFOA 5J9FA 1ID1A 2P62A 3ODPA 2W90A 1VFPA 5KKNB 2J9FB 3BQNB 4KQ1A 1E1YA 1NZJA 3TD9A 1TVKA 3V7FA 3Q0EA 2IOQA 5GJWC 5MHTA 1BQ4A 2QRZA 2X76A 3H2BA 4JJAA 5HZGA 4S05A 3OQNA 3K9GA 3U3KA 4BQRA 2KBFA 3V4FA 5FBWB 2R86A 1W88A 3A06A 4CR8A 3UNXA 1QVVA 3CWCA 4XRGA 4R2IA 3ZY6A 1RXEA 1C8BA 1HK7A 1XZBA 1MB2A 3AB3A 4DLKA 3RD8A 2R8OA 1SVSA 4P5DA 4AULA 2JLYA 2HVGA 1E3WA 4JB8A 1SQFA 3ABZA 4OD0A 3X1MA 3M6LA 1MOSA 1U0GA 1VDZA 3TTVA 4K81B 3RBVA 3RODA 5CA0B 2BTQA 3SZ3A 4MVJM 1BEZA 4FD3A 3I1YA 3EQ8A 1PV4A 3JCZA 1RYEA 5SY6A 1QR6A 4JQZA 2V3CC 2VPZA 4DLUA 2LKCA 3I3SR 4LYEA 3MM4A 3QE3A 4HX9A 4KLAA 3SS8A 1IK6A 1EB8A 2PG3A 3W2FA 3ZV6A 4IUBS 1YE3A 1UZUA 4MYUA 5JMTA 2FPLA 5IXYA 4QASA 1MX1A 4XPIA 3OT1A 2E5WA 7ADHA 3E4DA 1GKKA 1E92A 2G9QA 1B8OA 3NGLA 2PMCA 4MQ5A 3RC7A 4ZV9A 1MQ8B 2C1EA 4O08A 5F33A 4N54A 1GNVA 1QV7A 3U6KA 2BFFB 5K3FB 1SK8A 4JXKA 4UASA 3DNMA 2BRUA 2HT1A 2W93A 3GJ8A 1QFXA 3A05A 3Q98A 1SU8A 2BEJA 2GVDC 5I7HA 1MPTA 1DAMA 3TQIA 5JYCA 3L7YA 3NP7A 2ZS7A 1FBNA 4FI3F 1FRQA 3SQLA 4J0DA 3NALA 1PT5A 1W5AA 3F47A 3BWVA 3GJ6A 3RUCA 4CUKA 1UZLA 1ZK0A 2V4MA 4OGGA 1EPUA 3ANYB 2G06A 3SXUB 3ZEAA 1A9QA 3IXQA 3NIWA 1T0UA 4X20B 3ZVNA 4FS8A 1D6MA 3D3KA 3EJ6A 2W6JD 3EY9A 3KHKA 4RAOA 4EJ2A 3DBVO 3P9NA 1QB7A 4X9XA 1VLQA 2Z9CA 2Q5OA 3A27A 3BDIA 1SVMA 1V8PA 3N6RA 2WZDA 4H59A 2XMRA 3RREA 1EP9A 1KKUA 2DCMA 2V9PA 4L5YA 1QGDA 5FWXB 5EQJB 3H42B 2BFCB 2P0EA 3HL0A 2ECQA 5DYYA 4QNRA 4L0QA 4G0WA 2WZCA 4IV8A 4ZKEA 1RI2A 3L0ZA 3N75A 4B40A 2QAGA 4M99A 1T4CB 5IAEA 4ANFA 2JKVA 5CCXA 4ZYXA 3LPNA 1Z25A 3FDFA 5I7OA 2VPYA 3C24A 2O23A 4ZEOA 5CT5A 1KYIA 4RPIA 2HJSA 1VMAA 3HSYA 3T1VA 4HDRB 3HJNA 5KOJA 4JQSA 4JBGA 4BVKA 5G3YA 4V0OA 2FMIA 2REQB 3OU2A 1JW9B 4YONB 1C30B 4BX0A 4EHDA 1V16B 5A4JA 1ZAYA 1XRPA 4HS4A 1M1YA 1E2IA 3FOAA 1QF7A 4RTSA 1CJBA 1E62A 3KDSE 4RKEA 3SKVA 2IE0A 1PR2A 1SBTA 3HB9A 3DAOA 3KUDA 4BP1A 4DG8A 1CK4A 4E09A 4PGHA 5KNLA 5BN1A 3K9HA 1N78A 4C7VA 1V4NA 2N1MA 3OZEA 5BV8A 3LSYA 1JFSA 4D80A 5K3SA 3H7AA 2OC9A 4I55A 3DO8A 3O9MA 3PI7A 1JHOA 1H42A 4DJTA 1JQKA 1SUPA 2AWOA 4X1YB 3QE9Y 1WW8A 2LRHA 3AVQA 3CUKA 3MS4A 4IKEA 4FQ7A 1ZJ4A 2XEDA 1CZKA 1G20E 5CYPA 2QY9A 2J4FA 2JHPA 4FFDA 4M87A 5GJCA 2BOVA 2ZS8A 2OBNA 5EHNA 1WG8A 1Y81A 5ALYA 3VOTA 1BOOA 1LD3A 3ESYA 4M22A 4ZO6A 3GLIA 4JBIA 2NZWA 1Q17A 3G23A 3STTA 4M8LA 4N3BA 2O2JA 1VBKA 4MA5A 4YAKA 5HIKA 3FTQA 4B3IA 3W5SA 3WK4A 3JX9A 1WOMA 3QI7A 4RVSA 5BPFA 1ES9A 1QZ3A 2YWEA 4L74A 3WBJA 1AY0A 1MB4A 3C4JA 3V00A 5A02A 5GV7A 5H4HA 1M8KA 2JFBA 5HBRA 1W85B 1UINA 2HCFA 2PTSA 1SD1A 4LPSA 3L18A 2PT6A 4MARA 2P1RA 3I5UA 2HJGA 1NBHA 2OAP1 4UDOA 3SS7X 4B4VA 2C5AA 3G1TA 4E4YA 3GBPA 2C5GA 4YAWA 1PG0A 2QYHA 1TL7C 4RVUA 2WP8J 1FFDA 1Z0JA 4LHYA 3ZLBA 4ED9A 1UBEA 4XVUA 4JLMA 2YC4C 2A33A 4QOFA 4UHDA 1I0LA 4E1BA 1NRWA 2VK8A 3F4TA 2X9QA 4C03A 5K4GA 1GSIA 1U80A 3EPJA 1Z0AA 4HTFA 3A0RB 3B89A 4KSYA 1RE5A 1Y1SA 2CCKA 1W1IA 4IIJF 1W96A 4X7RA 3R9IA 4EM6A 4F6RA 1I2BA 5A3QA 1HDGO 3OLQA 4C5AA 2Q2OA 5FWYA 2I8LA 2R9VA 5BQXA 2AXEA 3OIFA 4MCJA 4GSLA 5DK4A 1JHXA 4M1QA 4IWXA 1ZEMA 2BDTA 1C7IA 3BL6A 4ND1A 3G59A 1UADA 1ULSA 3LV8A 2H6EA 3LT0A 3A4LA 3RYHA 2DM6A 2ZRPA 5C4MA 3C3DA 3L8HA 3IQHX 4RVNA 3ESCA 4YQFA 2JI7A 1QP0A 1XZKA 3JQ8A 4RY8A 3I39X 1P3JA 4CG2A 1K0FA 5C34B 4JMPA 3ZY3A 3ZHSA 4Y3UA 1EWRA 2CJFA 3QHAA 1T43A 2WIKA 1P1KA 3CBQA 4DCOA 2AKEA 2BMEA 2ZRKA 1YBHA 3C7CB 2FSSA 2PWPA 3TEMA 3IO3A 2Z2IA 3D3WA 3VKWA 4DPKA 3IE1A 3IQXA 3FCXA 4FFBB 3JAWB 4HDNB 4LHWA 4WZBE 5EUBA 4ALLA 1G9SA 1LF5A 3NRJA 3DZBA 3EF0A 3UPUA 1L6RA 4TUYA 1NMXA 1FMJA 3JQQA 3PGVA 2Q1TA 4P0QB 3OF2A 4YJ3A 4I81A 4DLRA 2XXAA 1VMEA 1A0OA 5ED4A 4H6WA 3NEAA 1L5QA 1Y42X 4ZC1A 3I6MA 3RHSA 1S6YA 4Z5XA 2JAOA 1R12A 2H0QA 4M36A 4CCAA 1NY6A 5DB4A 1N0VC 4LC0A 3T95A 3WK5A 2FP4A 2Q3JA 2O2CA 3B2QA 2RGUA 3CZQA 4RACA 1ZJ6A 4O33A 1MJHA 4W6QA 4HWOA 1KEEA 2DY1A 2JNWA 3R6LA 4NOKA 3TLEA 4WL0A 4ETNA 1GRVA 4BLSA 4LHEA 3PEWA 1DXOA 2QRVA 3V46A 1T2UA 1G8SA 2GBFA 1QWSA 5FI1B 2GAJA 1ZGAA 3CTMA 1XF9A 1TMKA 2FJ0A 4QA9A 2WJ3A 5CEJA 3KUCA 4IGEA 1ZU5A 3K70B 2AR7A 1A4XA 1XU7A 5DLQC 1V4BA 1M1XB 3RU3A 2KJQA 1AQNA 5CX4A 3DLHA 1HFJA 3C3CA 1AGNA 1L5HB 3KSUA 1TM2A 3IT0A 4G1VA 3UAOA 2EP5A 4EP1A 3KJZA 3G5MA 2AWNA 1DOZA 3V55A 3EGEA 3HN6A 3WV5A 4AYTA 2BHRA 2CEAA 2QMOA 3BRWA 1NI3A 2GN1A 1JP7A 5DYGA 4IEEA 1FZTA 1T1JA 3PEYA 3HUTA 3Q10A 2NW6A 1DHTA 5DE3A 5CU7A 4UMDA 2NU9B 1OKKD 4F1WA 2UYYA 4BVFA 4OI1A 1XWWA 1E3LA 1O6ZA 3CG4A 2BKLA 1CIJA 2IYPA 3W9UA 3RQSA 5A4MS 5IWAB 2EBUA 2JAQA 4MQBA 5DNDA 2BMWA 4YRIA 4MP8A 1DBRA 2C2HA 1G64A 3EA5A 4ALMA 4AJNA 2HJRA 3IDQA 3LXUX 4Q03A 4B84A 4ZT2A 3DQPA 1OZGA 5IT5A 4DV7B 1U8XX 2IHBA 1W4CA 4KPUA 3GPCA 5E9WA 5I9BA 3SJAA 1U7DA 4LHXA 4C0WA 2EJVA 1SVOA 1T36B 4MKFA 2C1XA 4EENA 2B3DA 2PXHA 4DKJA 1TT7A 4UBMA 3NJRA 1I4WA 2VYND 1R6AA 2CBGA 3LECA 1GY8A 1VB3A 2JI8A 4LJAA 4DV2B 3VOAA 4DQVA 4ZYZA 1IHYA 2LW7A 1Y5MA 2SCUA 3HDYA 4LE1A 3AIOA 1QBGA 3UJDA 1FYFA 2VSFA 5AIAA 5IPFA 1P1IA 1WM1A 4FFOA 5FYDA 3T12A 1Y6RA 3GWZA 3LPMA 2BI8A 3TNJA 4XW2A 3VU1A 3NTUA 3DA8A 1E2EA 2JLRA 4W9RA 4X61A 4OJQA 4HNAA 3EA4A 1AKUA 3EG5A 2H9YA 3FCSB 2QQGA 4XIGS 5H80A 1YZHA 2QRUA 2B8WA 4KK4A 4MPPA 4QDXA 1YS9A 2OO3A 1I6KA 5D3KA 1NU6A 4HN4B 3H9QA 4PCLA 3W5VA 2PM8A 2HHJA 3FNEA 4ER7A 2VTEA 4J4BA 4X91A 1NQOA 2CGEA 2RBEA 2VH2A 1QNLA 2PRKA 3OIWA 2OKCA 4RZSA 4RK6A 1YS2X 4FR0A 5K7SA 1SIWA 2ZI4A 3QH4A 4NCIA 1EUZA 3VH4A 2MYPA 2RI0A 3PQ5A 4Q7MB 2AEMA 3ETHA 3VUFA 1YB4A 5IJ9B 3GYGA 1NC3A 4HDCA 1GPMA 3P45A 2M2IA 2IYUA 1BFUA 2A67A 2EEZA 1U0LA 1TOAA 5CVTA 1ISSA 2AX4A 2QYOA 1PZGA 4YV0A 4UTNA 5K0SA 3SBOA 3H5OA 1I5RA 3ABSB 4G8CA 3H6GA 3I4FA 3NI2A 4JLKA 1XDUA 4RHCA 5I9MA 3ZNPA 4C1BA 4KODA 4MAAA 4LOJA 4QPJC 3BWXA 4TTQA 4FFSA 3LQYA 3OOEA 2VHEA 5J63A 2XB9A 1G6HA 4J3NA 2HQ1A 2ZJAA 4W5JA 1V1MA 1F4LA 2VPXA 3L6CA 1FTYA 4JC5A 4LCJA 3M1LA 3W2EA 4H7FA 4COOA 2WI8A 4GFDA 4ZP1A 2PUBA 2I8CA 3HEMA 2NZJA 3D7RA 3HUFA 3JYOA 5D51S 4JT8A 1GPUA 4KXVA 3PGXA 1XVIA 4F8EA 4UQPA 4X8OA 4JP8A 1L1EA 3B20A 3LLSA 3AX6A 3FSRA 5EQTA 3TJMA 5L40A 3Q2IA 5CA1F 4CYMA 3ZU3A 3PNQA 3OCYA 4AKSA 5C51B 1GPYA 1QH1B 2C1ZA 3EAFA 1BKSB 3TL2A 5HK8A 2HYDA 4BKRA 2PZLA 1T9DA 4RPLA 3H2IA 4P35A 1ZGGA 1M3SA 3DEKA 4H7IA 1YDWA 2XQIA 3TKLA 1GSHA 3L9WA 4DVJA 1ZIPA 1NRJB 2Q1YA 3CX7A 2PY6A 4WK2B 1XEXB 2JZOA 1BKYA 1EXMA 1VP9A 4ZEVA 2GRUA 3QVSA 3EIQA 5I5EA 4CQJA 3TR5A 4MMXB 3W7AA 3ORRA 3ZVLA 5F7OA 1GRRA 2H4HA 2NXEA 4J1NA 1DP4A 4HAZA 1W75A 3HTXA 2PXCA 5JD4A 1K97A 4FM9A 2WSBA 2PKWA 3DZGA 4O2AB 3QRWA 4CTMA 1KH1A 4OP2A 1TB4A 1TPZA 3NDBB 2XGJA 1SULA 2VDRB 3DB1A 4JI7B 1I6WA 1U3DA 3AY0A 3FRIA 4UREA 2HM7A 4LNUB 1ZQ9A 2ERCA 4ID3A 3MCAA 1CUEA 3H75A 3QIVA 4QYSA 4L85A 1FUUA 2QVLA 3M9LA 3WG9A 1A77A 2XH8A 4MW4A 4LFBB 2X2FA 1E2UA 1H3FA 4F5YA 5JSHA 3R7WB 2WE8A 2E4XA 1UOEA 3F3MA 1FQWA 4UTRA 1K4MA 4M9CA 3B38A 3AFGA 4D6PA 1PFQA 1TW2A 4TLDA 5E0KB 3RS9A 4D5EA 1Q77A 4EOGA 3AR8A 3UXHA 3BJIC 4A73A 1INLA 1NL3A 2IEBA 4ZI7A 2WJWA 4MS4A 1T9HA 5AQEA 2AEFA 4D96A 1Z4MA 2FWBA 5IP5A 4K8RB 1DOAA 1GU7A 1BN6A 3WJ2A 1YNOA 3TZKA 2Z30A 3KB2A 1OWOA 4K40A 2HSGA 2QXYA 1JDUA 3L8FA 2BF4A 2Q46A 4W1RA 3I5YA 1TAQA 4KBFA 1DBSA 1FUKA 1T0JB 1UJ4A 2DY0A 4PZDA 4Q24A 2W2XA 2ET6A 2CXUA 3S28A 3GDOA 2NYAA 1WL8A 2QEQA 3VNBA 3V6LA 2DC1A 1NV9A 1TF5A 1XKLA 2BHLA 1BCSA 3FF1A 4FOOA 3MQFA 4ECAA 3DBHA 5FTLA 4DLYA 1Q14A 3GVPA 3DCIA 1OI7A 3WQSB 4I1VA 2VNJA 1D6NA 1L8OA 2FPGB 3EH2A 3IAAA 3NFRA 3NWBA 1ZINA 4U6SA 4AWXA 2GQ0A 4D3FA 4RJTA 2I9PA 3M6VA 1UXKA 10MHA 1WAMA 1SCUB 5D85A 3RS2A 2C7PA 2ZK7A 2QTCA 1MJ5A 1P7WA 1EMDA 4RKRA 1WXFA 4W63A 5CB0A 3F73A 2YWHA 5E1OA 3H65A 1C0LA 1HQYE 1QHIA 3FUCA 3JZIA 5E8RA 3U49A 3UFBA 1L8XA 3WRYC 5JAOA 3OKFA 3TZCA 1QHSA 5GWXA 3NXSA 3V4LA 2XADA 4MEAA 4CMIA 3CU5A 3QU7A 3OE5A 4EZBA 5ALKA 4U6QA 1WWKA 4WCFA 4XLLA 2WSMA 1AU9A 5AVJA 4I5IA 2C2YA 3GRPA 4UBKA 1UWCA 1SB8A 1X92A 2G63A 2MYUA 1LQUA 5ILQA 3VPAA 2EVWX 3AGQA 1DBVO 3DBLA 1GQYA 2QLMA 3QVGA 1CZUA 4LZWA 4NFSA 1V3VA 4DGQA 5D5PA 4AN4A 3VA7A 5HA5A 4JZYA 2JAPA 3KJEA 1E2FA 1ECCA 4D56A 1ODLA 5IKMA 2Q1SA 3SYRA 4PXAA 1FDVA 4NFLA 1TK2A 2F55A 1XOIA 2MINB 3DNFA 5LBTA 2QHXA 4JEIA 2QR3A 1JQDA 3D59A 5T41A 5C80A 2VBIA 4F4FA 3AF6A 4PEVA 2XTZA 5B58T 4RLHA 1E3DA 3FVTA 2QRPA 3EVAA 3U26A 3K0SA 3FM9A 2C54A 3BRQA 3RM3A 1B7GO 4RQTA 3TAXA 1URPA 1Z8HA 4BNIA 1VJDA 5ALTA 1U8YA 3KQUA 4BQOA 2PQ2A 4IWNA 2ZJ2A 4HWSA 2IGBA 3G5TA 1TUEA 1NN5A 1ZUHA 1G38A 1HQKA 3K2EA 3LC1O 3SR0A 1LPNA 3G82C 5EMMA 4Z6KA 4XWTA 2WHPA 2JLQA 5K03A 1RMYA 3AHIA 1ZMTA 4LY9A 4BLWA 5LXTF 1IB0A 4N82A 5BSUA 2IPMA 1D5WA 1P39A 2AN9A 1D7AA 4XARA 4AB1A 4GC9A 5ES3A 3ZNQA 1IG0A 2X9NA 3GJ7A 5J59A 4JHXA 1RWOA 4B4UA 4ZFNA 1RC0A 1GUBA 1ESNA 3CLUD 3EBLA 1CDEA 2ERYA 3E6AA 4MHSA 3ZS8A 4EL0A 2IXGA 2WU4A 1J0XO 4AP9A 4D9BA 1MLDA 1C5KA 3NYRA 3UA3A 3ESAA 1JFFA 5CX1A 5LOVA 3OOJA 1ZVJA 1YRHA 4CLOA 5B1IA 4TYMA 2O0MA 3C3WA 4TMFA 4ZGGA 1JIXA 1W47A 4QDTA 4Y2QA 1WD5A 3CE9A 4A0HA 2ZSBA 4YO7A 3HJUA 4FGLA 1QCCA 5FFNA 1PYGA 4OREX 3GLFB 2XJ4A 1JQ5A 2L82A 1B16A 1M67A 2H2AA 3IHLA 3NJ8A 5C18A 2UU9B 4IXMA 4ZO7A 1Q1AA 3EDOA 2QRGA 3IJPA 3MPUA 3QV2A 1ZJWA 3N8GA 1DELA 2OHJA 3F4KA 1SJ9A 1UBOS 2RHOA 5C31A 1NUPA 5LD2B 2J67A 4UFPA 5B4TA 1AXRA 2P67A 3MG9A 3UCFA 4B7CA 4CM4B 4ZHSA 3E7FA 4MK4A 1CNMA 1YR2A 5JFGA 1HFEL 1BHJA 2BGMA 4RAQA 4APAA 2RC5A 3AF3A 1OBCA 4E5YA 2V3VA 1ZISA 2POCA 4RPJA 3MWGA 2EFGA 1NXWA 4PR3A 8ADHA 1J2EA 3H5LA 4ZVRA 2IXBA 2C8KA 4YDHB 1GYPA 2I62A 3OEYA 4DMUB 2E87A 2A84A 2I4MA 4PO1A 3VI4B 3DMDA 2WUWE 3V8RA 1O0BA 1GAWA 1ZVQA 1YS4A 1TQ6A 3T3PB 2HHHB 3HN7A 5E6UA 1UC8A 1P7ZA 3OKPA 4N12A 1H2XA 4HDQB 2PR2A 3WAGA 3OQMA 3FOFC 2ZEJA 1J0BA 1GRCA 1E1RD 4O4IB 3PWSA 2OQ2A 3HADA 1AHIA 5JISA 2R8XA 1GCIA 2B8JA 2FPKA 4JVNA 2VHWA 5IMSA 1SBCA 2P41A 3AIIA 3HRIA 5EJ4A 1XCPA 1YR8A 3EC2A 2RDMA 4KO3S 1QHNA 1GZDA 4WY2A 1YJQA 1N9GB 2WVHA 4KK3A 4MI3A 1IBRA 3ODGA 1GUYA 5CAEB 3WRYA 3A0UA 2HLNA 1LSOA 4NE9A 1XZPA 2CE7A 3PL1A 1FFYA 1XTVA 1JN0A 3BCRA 5C46F 4BFTA 1NVTA 3ZNNA 5ICGA 2HA6A 4IH4A 1JLKA 3KQQA 1DKLA 3X1DA 3FLMA 4XX0B 1W4LA 2RSLA 1UP4A 2X1HA 5KNBD 3TGWA 4GW3A 1JF8A 3W05A 1H2FA 2OR3A 3V34A 6Q21A 4AXXA 2XA1A 5KBYA 4XJSA 2BTOA 5FO0A 1Y8QA 4DPMA 1MW8X 5K3DA 3M6IA 4NENA 4V0LA 5G0TA 4CT4B 5AW5A 2QE6A 4L3WA 4IRMA 1ESEA 4F4CA 2P4UA 1YQ9A 4PSAA 4JY7A 2JH9A 5KOHB 2H8GA 1EBFA 1V6AA 4BFZA 1A27A 3PQ2A 5DMHA 5IMBA 1F8FA 1KU6A 1HEIA 5MN4A 3GG9A 3LZDA 3LTEA 1ONPA 4LJ7A 4KRGA 4NJMA 1GGMA 1NRIA 5K0JA 3AEUB 4NECA 2Y9MB 2AN1A 2ECKA 1NQTA 5C81A 3W9SA 4HLNA 3LDFA 3BMOA 1TAGA 2FQ1A 2VJPA 3DFFA 4GGPA 4ZVUA 2DLNA 4QG3A 4M0FA 4G5HA 2RMKA 2PUGA 1L7PA 1FRFS 2FSUA 5CLHA 2NYRA 1Z0ZA 2GF0A 5E9QA 5FO1A 2H7CA 2IP4A 1HKUA 3ITDA 4RJIA 1U9IC 4KHZA 1RM3A 4C0SA 4HDOB 4RFSB 1R7RA 1JU9A 1AXEA 1XZEA 2I7XA 3E22B 1VSQA 3IOMA 3J81k 3ER8A 4PLWA 2HBRA 3GJRA 1IJFA 2B2CA 3R4CA 3QXGA 3SM9A 3PB3A 4IDNA 4KMRA 3DO6A 4NU6A 4WXHA 4CFYA 2P90A 1MG5A 3ITKA 4G5RA 5BN5B 3Q3IA 4FC7A 1KJQA 2J7PA 2Z3ZA 4MUKA 4N0QA 1Y9JA 3E9QA 3HLYA 3IV7A 3LVRE 4WINA 5IK2A 3J7AC 5EMHA 1OW3B 2A9PA 3EW9A 3KEOA 1H8EA 3CLTD 1TJNA 1ECFA 4X7PA 4HZIA 4UHFA 2FX3A 1BVRA 3C7AA 3AW9A 4Q4HA 4A6XA 3PRKE 2WJ4A 1M2HA 3D4OA 4EVSA 1JAIA 4HEA6 2WF7A 1FDRA 1FMLA 2X1VA 1MC8A 4GP6A 3G5AA 3ZS9A 3ZGXA 4AF6A 4F45A 2LVBA 3D8BA 3VZDA 4EHNA 1G5QA 2GHRA 3BDAA 3ITEA 1J2TA 1C50A 1GL9B 2G9VA 3BMQB 3CPSA 3DD1A 3EXIB 3R7FA 3VKHA 2W98A 2AA3A 1V39A 1B74A 5IZ4A 3DV9A 1QORA 3D2CA 3HGQA 1QRUA 1PGNA 2MMCA 521PA 3ZX4A 2Q8NA 2ZR7A 1R8YA 2JJ2D 4I4NA 4JLOA 1GYQA 2CBXA 3WQRA 4D6YA 1EFVB 1OLUA 2V59A 4QFMA 3JYQA 3DJFA 4YRTA 1HDYA 1L9XA 3DXXA 3NFYA 1K92A 4OHMA 1CB7A 2A5JA 4LE0A 1Z2AA 3LP8A 5EWMA 4N8SA 5TPZA 4BNXA 5A04A 1D0VA 2DMRA 4EH1A 1NG9A 2OZLB 1ZVVA 3LL7A 4D3YA 2QRLA 3ZU4A 3K30A 1USIA 2P7IA 2VK4A 1RHKA 1XR3A 1FZQA 1KY3A 2PWBA 3FX2A 4MV6A 4N3GA 4MW0A 3OHMA 1PX2A 3X44A 2Q6OA 2QTBA 1YL6A 4LQ4A 4QUIA 1S7CA 2ZIXB 2VQ3A 5A9TA 4CM9A 5KPDA 721PA 2GEDA 3OOWA 2VQ6A 2AQKA 1FX0A 1V7QA 4NQZA 5TGZA 3AI2A 3WLMA 5IJ0B 2NOAA 3L7KA 4YP0A 1HY1A 5EKSA 4W9MC 3DOOA 2PV7A 1O94D 2E85A 2V7VA 2WG2A 3HCWA 2R8PA 4RNDB 3WNBA 4BC0A 1TEZA 5DYIA 2X3UA 3IJEB 3OUTA 3MPOA 2V03A 1IVSA 3WLIA 3NHRA 1WBDA 3CT4A 4LC9A 1BN7A 3M0EA 2BGUA 3IP7A 1FU8A 1O58A 1FVOA 1UAGA 3A9WA 2OBBA 3AOGA 1KYTA 3HYNA 4JXJA 3JQFC 4YH1A 1UDWA 4FB4A 5BYKA 2H2IA 3U7QA 5A7FA 1YL7A 3WB2A 3D0KA 5AVSA 3MUEA 3STUA 2GD6A 4EYGA 1IOZA 1U1GA 3COVA 4P7KA 2P2LA 3TMYA 3PVZA 3CLVA 3ZQJA 2OZPA 4GPAA 1HM5A 4KLNA 5DX8A 3HSKA 3EASA 3ROQA 3VPBA 4DA4A 1UEIA 4RZQA 4CVNA 2D7JA 4EECA 4M1OA 1W5SA 1MF7A 4BIIA 1Y1QA 2YOHA 2OGTA 4YAFA 2HREA 1C1YA 1Y3CE 2JAXA 1IEQA 4JI3B 1J9EA 4CM6A 2DFLA 5FCDA 4KDRA 3UATA 3NTVA 1X7XA 2C2WA 2XDAA 3GEEA 5LA6F 3JTMA 3IKMB 4JKIA 4RK5A 4CG3A 1YJAA 2BCEA 3JD3A 3IULA 4XGIA 4C7OB 5LZ9A 1Z88A 3ZKAA 2VCYA 1XQ1A 2J3DA 3QWBA 3ZV7A 5CFQA 3R5XA 3D5QA 4LFCB 1BYIA 1W46A 4DR6B 1JLHA 3DF7A 2J32A 2BSXA 2ZI6A 1P2TA 2X8BA 3MQ4A 1BQEA 5HBGA 3VVBA 4DC0A 5IF3A 2I7CA 4XCVA 2D0OB 1ECBA 5CK5A 2IZ0A 3QKRB 3KJIA 2DE0X 3RYFB 4WFQA 3O74A 4TYQA 5FXMA 5HS4A 3GP3A 1VE7A 2B83A 5HKOA 5EWLA 1NVKA 1R0YA 4L3VA 1U9CA 7YASA 1LDGA 1JU4A 3K9BA 2Y77A 4O4LB 3CH7A 4K2AA 4BKOA 4V1CA 2EERA 5E7IA 2LCQA 1MOZA 4M60A 3HABA 2P9FA 4JH0A 4IINA 3SF8A 1OREA 3PUYA 4B6OA 1UOPA 3FXAA 3CEPB 3VPGA 4B87A 4BBAA 4PSCA 1Y3HA 2K6GA 2O0KA 4HMPA 1VIMA 4CV3A 5JJBA 1N2CA 1CEXA 3HA5A 4AXBA 3U44A 2QM3A 2NSDA 2XA2A 1B41A 1Q0PA 2RJOA 3HB0A 3DGFC 1XRMA 5JDCC 4WW0A 5A3JA 1PN3A 2JLSA 3ADOA 4OB8A 1Y33E 2WWXA 3S5UA 4FTWA 3H4MA 3CRZA 1HA3A 2QUAA 4FS3A 1GG9A 1J1UA 4MQEA 1E2LA 4D9HA 4MO2A 5CW1A 2GILA 4I9UA 1KYVA 3K4PA 4OHRA 4W5TA 1QMPA 2A2ZA 2P5TB 3EDYA 3GOQA 4ZK6A 1CUAA 3BHIA 2ZWOA 3LGAA 3RC9A 2OBXA 3OQIA 2YVKA 5G0WA 4F21A 1W4ZA 4Z8XA 2RKBA 1KJNA 1E7QA 1YVEI 3P0IA 4LJ8A 3WVNA 4PQYA 4Q3AA 4W99A 3KZNA 1A82A 4Q3CA 3LW8A 1RKBA 1XA4A 2JCVA 4U4AA 1NDQA 4B17A 1ULAA 2O2EA 2J5BA 2HIHA 4ND3A 3H4VA 3C3AA 4ZRMA 1TEVA 3B6MA 5I9NA 4MRMB 2PJUA 4HBGA 1BEEA 1GNTA 1M2JA 3JVIA 3QPAA 4E1AA 1FS5A 4O5OA 1KOLA 4G4SP 5JCZA 3LVBA 3O8LA 2FTKE 3PLRA 3LWDA 5EZYA 2JLUA 2OWEA 2ZRHA 1J0CA 2OCXA 1XJCA 4X5OA 2QJTA 3GEPA 3TDMA 4LXYA 3FNIA 1HTWA 1AK2A 2A7XA 3VDMA 2YHBA 2Y99A 4MAMA 3SIRA 1RZRA 1SKBA 1CPYA 2Y1OA 4P4SA 4PWYA 5LC1A 3DDSA 3BWMA 2XYVA 1N2BA 1T0BA 1W6UA 1XMSA 4J43A 2DUMA 1P2VA 4IICA 5KWVA 3A6HA 1FP7A 1PNVA 3FUWA 2IEDA 2EW2A 3JQFA 2G67A 1F51E 2R8EA 1ETHA 3C43A 3RVNA 2XQFA 1JKJA 1Q84A 1GLNA 2JH8A 2C00A 4R6WA 3RTBA 2JW5A 1YHYA 2PT9A 4MW2A 3CZCA 4JWTA 2FLKA 2NVWA 5JZMA 2NWQA 4QU5A 3DMHA 5LQRA 1B0AA 2IYTA 2LDBA 2PKQO 4H15A 5FLXA 3MINA 2O1WA 3PDIA 2VDWB 3UKJA 1XHLA 3L9XA 5IFKA 2J7KA 1UCFA 5EYPB 1X1EA 4I1PA 3U7IA 4GF5A 5B64A 1W0CA 1Z36A 3PNKA 4HXEB 5AMXA 1RVV1 4G41A 4EX7A 2J9RA 4Q9HA 4A3SA 1U0BB 2WQ7A 5GZ1A 4DW8A 4BLUA 1WHTB 3JSAA 4P7FA 3IUPA 1PWYE 2IYVA 4PAMA 1YTLA 3JYHA 4DG9A 3GLQA 4XJVA 2C07A 1A4UA 3PQ7A 4UCFA 5LLSA 1X7ZB 1Z34A 4I9HA 1XROA 5IVKA 4ZV4A 5DI9A 2EHDA 3A9SA 3RC8A 3DTVD 3TZLA 4LGVA 3WSWA 1JHUA 1XIVA 2BGIA 1WKCA 3VI3B 1ZRMA 6ADHA 1CXZA 3JD4A 4CG1A 3D6TB 3GGJA 2EJCA 3QU4A 4WBNA 2VLIA 5DTMA 5AWFC 3SJ7A 5BMOA 1WXGA 3I9JA 1UM9B 4HWKA 2QUZA 3N0RA 3HJTA 3PXGA 1A9RA 1KI2A 2G0AA 1HLFA 1E64A 1XRNA 2AFIE 4Q1FA 1VZ3A 4WESB 1YNSA 3U62A 2CK3A 3ZEIA 3TLZA 2P4HX 2LCIA 3AERB 4PLGA 3WIBA 2PANA 5JBNA 3JV7A 3ICWA 2IJGX 4MVJF 3K70D 1DLIA 1OB5A 1G5PA 3UV3A 3ZV5A 4C9BA 4CEJA 2QU8A 5TQ0A 5FOXA 1CUDA 4J0FA 3U16A 3NTRA 3Q2OA 4KZKA 4MW1A 4WKOA 4ZT7A 4UU0A 3RK4A 3NM6B 3ZJYA 1DV2A 3EULA 5L53A 5EMKA 2B99A 1U1CA 4RY9A 2GB4A 1CR0A 4DTIA 4LJKA 1LLQA 3N2NA 4TRJA 3UMMA 3T9BA 1KEVA 4DIKA 2VJQA 1KK1A 2CFCA 2RH5A 2WD7A 5JDCA 3ANXA 2R6FA 5E4TA 1IW7D 1BQ3A 3DT9A 1Y6FA 2H2WA 1SD5A 4INZA 4S0ZA 1NC1A 3R5SA 4ESVA 1LJUA 1B43A 1QLJA 3B3GA 3Q5GA 2F1KA 2JCXA 2JIQA 2PSJA 3CYFA 2WTXA 3PQ6A 3RROA 1MB0A 3C85A 3FJ1A 5G41A 2NO5A 2OOSA 4CUZA 5TMPA 4QU8A 4Y7CA 4D8WA 4DABA 5JS7A 5KYYB 1KU0A 4AS1A 4UXHA 1VMKA 3BIFA 3ZWQA 1WNFA 1G7TA 2PGOA 3O4JA 1J70A 4ISCA 3ANMA 3AP1A 3CKKA 3MMXA 3N0VA 3EZ9A 4XB2A 1T8RA 1PVDA 2O3JA 3K7EA 5CDHA 5IBCA 2ZLBA 1YS7A 3B6KA 3BB4A 1IE3A 1P0CA 4Q02A 1V9SA 4IL5A 3NU1A 1SA0B 3JYLA 3MCVA 1JGTA 3ZZNA 3IC5A 3AR7A 3I09A 4IDDA 4DNOA 3VAYA 2V58A 1NF8A 4RLQA 3RBAA 4G97A 4KNWA 4RD0A 1N3LA 3GA0A 5ALMA 5J2TF 5KKAA 4CV0A 4RZIA 4GI7A 1QGUB 4C7BA 1B0ZA 1LI4A 3AM5A 3P2OA 1BXGA 2HK6A 5AOVA 5LKAA 3A4MA 5AK5A 2IDKA 1A95A 4EW2A 2FN7A 4Q1EA 2Y0BA 4EG6A 3MGKA 5DZSA 1OGJA 4M0DA 3E4CA 1C4OA 2CXRA 1KHHA 2F48A 2R6AA 4KWTA 2JATA 1CIPA 1DTWA 1EZ4A 2AKYA 3G2PA 3Q9LA 4TV9A 3KDPA 4TM7A 5BP7A 2BFPA 3EMKA 3EDQA 1FFEA 1M76A 3RBZA 5A1JA 1DG3A 1H4QA 1WMBA 1ISRA 2AXNA 4JUCA 3WQBA 4A8JB 4PNEA 4ARCA 2IPNA 1RQRA 4EFMA 3MJRA 4Q1AA 3PHJA 4QOEA 1ORIA 2JANA 4EZIA 3L7BA 4WZAB 4C4PA 1H65A 1CJKC 2BUAA 3B1XA 3LY8A 4GMGA 2AZXA 4R41A 3ZU5A 1ECPA 2PS0A 4RTOA 1VYTA 1U0OC 2YWDA 3N3BC 4YRMA 1SH7A 1YULA 3ILYA 1REQB 4N3AA 4EO9A 1TU0A 3QSYA 4I1YA 4TQAA 2P1ZA 2PGIA 5DKFA 1U7XA 5DTEA 1YMUA 3I2YX 4O5AA 3WL5A 4BMCA 5JVDF 1ZD3A 1Y6GA 1TX4B 2E6KA 4JP5A 4NFHA 2ISQA 3BQMB 2EP8A 3RHTA 3TDNA 1EFRA 3ZK8A 2PVSA 2CXOA 3R6DA 1GP2A 2VJOA 1PGOA 1BFDA 2LKDA 1QC5A 4DLTA 3O1JC 4KVFA 3C6YA 4EITA 2I1VB 4WFIA 1DEHA 4GP9A 3ZKWA 4MDEA 4KR3A 4B8YA 2FW8A 1W48A 2OCKA 3A4TA 3ASYA 4N18A 4QRIA 2ZJ3A 1CX9B 2I29A 3NVAA 3PFNA 2HF8A 3VNQA 4ZA2A 1HETA 3UIEA 3MWKA 2GI4A 3AVTA 4N3NA 1G21E 3A31A 1FXSA 3I8XA 4X63A 3N3AC 2B2XA 5JMOA 3IMFA 4K0RA 1MAUA 4JP2A 3UOWA 4FHFA 1E2DA 1GPWB 1Z5PA 2CXTA 1WY5A 2ZJ1A 3CI0K 1KA9H 2JS7A 1FSSA 4MR8A 5GM1A 2HDOA 1L7QA 4OTZA 3P71T 3M4ZA 1QHGA 2O1XA 3ABIA 1BAPA 4PLVA 4DR3B 3PFKA 3IT2A 3G8YA 4OCZA 1KRWA 2M32A 5H4GA 3QPUA 3WHIA 1OAAA 3OPQA 4D3DA 4DLLA 3OUZA 5ALFA 3HPRA 3SXPA 2EKDA 3D6JA 1E2GA 4EARA 4IHKA 1LLFA 4IEFB 1AGYA 1F6WA 3QMWA 4OQLA 4PS1A 3ET4A 4QBFA 2XQVA 5T67A 4BLQA 1O77A 4ESHA 3HCFA 2IYEA 1FJHA 5BV2P 1Y1PA 3RSLA 1Z17A 4TV8B 1HUQA 1N7JA 2Z2JA 5K9ZA 1EXDA 5KWJA 3ESZA 3GUUA 4XUEA 4B85A 3BIOA 3IIKA 4S35A 2P68A 5K01A 4PQEA 4XIIA 3DE3X 4NOMA 1TJVA 5H82A 2XZLA 4ARAA 3JWEA 5JS1A 2RAVA 2YXDA 2WRZA 2EKQA 4Q18A 2XWBF 4R1TA 1HE1C 2B61A 1SM4A 3EZXA 3G17A 3GLRA 1KS9A 2H54A 4OHCA 2SKEA 2UV8A 4HAXA 1P19A 4JI6B 4ARBA 1SBHA 2FWRA 4P38A 1NJSA 1FK8A 2R7AA 2XE7A 3QFTA 1Z4QA 4RS4A 1R4ZA 3T7EA 1MO3A 4LW8A 1UP6A 4JCOA 1GDDA 4P53A 4U2BA 5M04A 2RHDA 3UF0A 3TGLA 4KAAA 1R8XA 1L4UA 1ABEA 1MEJA 4RANA 1QYRA 2HBYA 4C4XA 2DUJA 1ZD2P 2CD9A 4LKRA 1C3LA 4D0LB 2UYHA 3OE7A 2DULA 5LQMA 4JL5A 1X80A 1Z74A 3C5CA 1SUAA 4BFUA 3RRBA 2WSSD 4WN9B 5U4QA 1L7RA 2A14A 4L8WB 3AUJB 2C5HA 2J33A 2JD0A 3A4YA 3ZHUA 1GNRA 4ZIRB 5KDDA 1BXRA 1XJ0A 3HFGA 5EMNA 4YAGA 4RGQA 4IXDA 1U8CB 2FEOA 4N5HX 4UEWA 2CLEB 4MUBA 1PJ2A 3HLTA 3PQ4A 4MKZA 4XEHA 1YA4A 3UAGA 3N07A 2CL0X 2XOKD 3BWBA 2BONA 4P34A 4RS3A 3ZHRA 1IK4A 1O95D 2QDKA 4H6PA 4HZGA 4JR1A 4Z4FA 1M7BA 3JR7A 1QHFA 1Z4LA 4I6EA 3V1MA 3M6XA 1E6EA 1L7EA 2YTZA 1PWEA 2B20A 4ONEA 4X94A 1P9LA 3PF9A 1R6BX 1TU3A 2FN4A 3ZBTA 4BMDA 1N5OX 4UMVA 1G59A 5H81A 4G5YA 4K87A 3TH5A 3OJLA 1QIDA 2F3SA 1II8B 4NNJA 3DAFA 2GHQA 5KQPA 1T3SA 1XL1A 3NW9A 4KFRA 2H85A 1YB5A 1N6PA 4H4EA 3BH0A 4QEDA 5AM2A 3F8TA 4YRGA 3OMXA 1IXZA 1RQLA 2LTAA 2OZVA 3GEHA 4KN9S 4X54A 2J5RA 4NESA 4BS9A 1UBGA 4BNLA 2R68A 3AKCA 4UMFA 5I9TA 4CCYB 3S7ZA 1ZMRA 2QVXX 3G0HA 3S44A 4BB5A 3IUEA 1FP6A 2H1FA 1RWQA 2NT4A 2WWGA 1IN5A 2AV6A 3EYAA 3GVHA 2P3SA 3G2KA 4M0CA 4ZO9A 1I2ZA 1T8YA 2AEJA 4OQEA 4PQGA 3UW3A 1WZ2A 1O6CA 4M7WA 3U1VA 5B2EA 5JXIA 2ANCA 2OPBA 4HT3B 2CJWB 5LLDA 3FWKA 1LV7A 4RH3A 1Q0ZA 3ZQKA 4CKCA 2EFDB 1YJ8A 3IKLA 4XD2A 3PDHA 4QU0A 3W6UA 1RABA 2VTBA 3K9NA 3NHUA 3I58A 3CB4A 4FGJA 3WR5A 3OZBA 5HKKA 1UFKA 2JA1A 5AOAA 1N2EA 3GJXC 1PR5A 4B43A 3ZGVA 1IEXA 3CWQA 4PSDA 3ZTWA 3RAFC 1X74A 3QVMA 5I7EA 3PKIA 2IXAA 4HL6A 2GNPA 5A9RA 5L8VA 5J2UF 1R88A 3U7HB 4EELA 1P62B 1PP4A 4OJYA 4NYMQ 3L8CA 2PGXA 2FI1A 1RWBA 1JA1A 4C4ZA 5J3JA 3GFSA 2NXWA 3QUAA 5LMZA 2G5PA 3Q40A 1T4GA 1VPTA 1H5UA 5HG0A 2IBTA 5C52B 3R5FA 1SURA 4EG3A 1KWGA 2QK4A 3IIJA 3WFIA 3RABA 5IAOA 1EDOA 2QD4A 4CR6A 1KQOA 3EVBA 4DR5B 3FIUA 2ESRA 5AKLA 2Z2XA 4EHAA 3LTNC 1ITZA 2KI5A 3E9YA 3DUFB 3LBAA 1P60A 1K8RA 1W2HA 2H1WA 2IYOA 2NUPB 3H5AA 3O91A 2KX7A 4LXHA 4QYIA 3X1WA 1JI3A 3NORA 1YQXA 3CSUA 4X44A 5DU2A 3IVGA 9LDBA 4HN9A 2QBYA 3NBZC 3HFSA 1T5SA 2Z3VA 4QDJA 4WY5A 3FVRA 4RELA 4RWZA 4RA6B 2HXGA 2F3RA 5EHQA 3GMTA 2PJRA 1YMVA 4N3CA 4JA2A 4JS0A 4LXIA 3OI7A 1YT5A 3M6AA 5IN4A 3VDNB 2XDQB 4D42A 1R4AA 1LWOA 1QG4A 2BT4A 3IT3A 3N5CA 4EHFA 5ADWA 3N2IA 5DXFA 3UJ9A 3JVVA 1NWHA 3F1KA 3LYLA 4D8VA 4Z49A 1N92A 4ODIA 5EMLA 4LRYA 5TVKA 3ZQ6A 2JFGA 3T5AA 1T2VA 1J5XA 3JXEA 5B3JA 5LZ5A 2WP0A 4XGNA 2QOEA 2EBHX 3ABRB 1MO6A 1EFPA 2WSIA 3LRXA 4FMDB 2MDTA 2VO1A 3NEYA 4WLFA 3U9LA 3RSGA 5FB3A 3GNTA 3I9KA 1JG1A 1WW3A 4S0XA 2HH9A 2OKGA 4Y1FA 1JT9A 4YBZA 3KQWA 1LW6E 1N5RA 4JUIA 1Q3KA 3O8QB 4XIYA 2OYSA 5I7VA 1PJSA 2HPHA 3OQPA 2C61A 5D2CA 1PT7A 2OAQ1 3OIGA 4OAPA 1Q7CA 1WF3A 5AHXA 1LZLA 2JCGA 1F0KA 2B1IA 1Q1EA 4LXUA 1U7HA 4RQAA 3RAJA 2VWPA 4FB5A 3L4JA 2FVXA 1NKVA 4CT5A 4V02A 1A97A 2CDAA 2Z58A 3ISTA 3QLEA 4IDAA 2Z2KA 1L4BA 2P30A 8LDHA 3O3NB 3QPCA 1Z13A 3RAGA 1KI6A 1I2DA 5KTSA 1NQVA 2P6UA 2P4SA 4CEIA 4CODB 1CYEA 2PBFA 2PS9A 3N7TA 3OTWA 4I8XA 1L6IA 2P9QA 4JYPA 4MUGA 3KJFA 1GTL1 1B2LA 1LFAA 2WYHA 3EGWA 4OY3A 1HZZC 1G8PA 4TMVA 1D6SA 1QH8B 1K06A 4DCNA 1C9MA 2DUUA 4FBGA 1QAMA 1P7VA 1OFVA 5B7QA 1XKXA 5FI5A 4D9MA 4HI0E 3KE8A 1MA3A 5FNVB 5E1DA 4KC0A 4FLEA 2VRNA 3BICA 3D0OA 1YJXA 2DKOA 2QSJA 1AM4D 3VPDA 4AZ0B 4BOYA 4N1AA 1N36B 2M1XA 1S2NA 3HDTA 2DHQA 1JB1A 3HEAA 1T24A 3BJMA 3VC3A 5HPYB 2XMCA 2WJJA 4H7EA 4D3XA 5JNLA 5GP1A 2W6NA 1BHSA 3F97A 2DHDA 3QJ5A 1QO0A 2RONA 2R0QC 1I3CA 1YRLA 2WQ6A 2AJ8A 4X3CA 1GV0A 4XJXA 4HS9A 1BU5A 1LBSA 1KBQA 4HYEA 3K1AB 4X3OA 3LF1A 1C80A 2AJDA 2KW5A 1FTWA 2OV4A 3I32A 3AZQA 3PXXA 1BFKA 5CPFA 3H2HA 4NAUA 4X97A 4KEAA 4RF3A 1ORTA 4WDQA 2ZDHA 4BQIA 2AZ4A 2JPDA 2WJVA 5FBHA 4B3HA 2QLFA 5G0VA 3S1SA 1WXQA 2K7FA 3I62A 1IOLA 1BWSA 1NMEA 1WCIA 2YNMD 1I1NA 4Y2YA 4DSAA 2ENUA 2HHAA 3O3CA 3R40A 3VZQA 3HM2A 1ND6A 2XIJA 2YUTA 1ZITA 5FUMA 1NX9A 2G36A 1W0JD 5L4NA 2EATA 5C1IA 3PF8A 4WVLA 2Y1WA 2VTDA 2NIPA 3RWOA 2C94A