4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
2AUTA 3L8GA 1SU4A 1Z4PX 2B1QA 4JB3A 3IB6A 5ALPA 5AVVA 4Y2RA 4YIHA 4KN8A 3AR7A 4YH1A 2G09A 1ZRMA 4BBJA 4NFLA 5AW5A 3AR8A 3WKCA 5AM5A 5AKIA 5AICA 3NALA 1ZRNA 1K1EA 4G9BA 1Z88A 3AR9A 2JARA 2HOQA 1EK2A 5AI0A 1YNSA 2B1RA 3OPXA 4KNVA 3FPSA 2MSNA 2ZBDA 2WF7A 3VAYA 4KX3A 5A3QA 3QU2A 1JUDA 3E81A 1U7OA 5AM0A 2Q4TA 3A3YA 5ALFA 4BNDB 5ALRA 5ALWA 5ALTA 5AVYA 5A3SA 3L1UA 3L7YA 3QU7A 4XE5A 2OBBA 2BDEA 4NABA 1WZCA 4EELA 1T5SA 1X42A 3GYGA 3L8FA 4UATA 5ALNA 2DQSA 4MUMA 2HSZA 5ALQA 3MPOA 1RPZA 2HF7A 1TE2A 4EZEA 1RLOA 2FUCA 5AI4A 3B9BA 3QLEA 4OCZA 2Q4RA 3RF6A 3NAMA 4YIKA 2YJ6A 3FM9A 2G80A 4HGRA 4BKMA 1Z4IA 4GIBA 1AQ6A 3N8GA 1RKUA 3PGVA 3ONNA 4UMVA 2C4NA 2I54A 3ET5A 3TLMA 2YN4A 4CNQA 4BX2A 3NIWA 1QQ6A 3ED5A 5AI9A 2FI1A 2Q5EA 2CFTA 2GFHA 2CFSA 5AVXA 3UMBA 3OCZA 3M9LA 5AM3A 1L8LA 4DW8A 2P9JA 1ZD5A 4DFDA 2RAVA 1QYIA 1XP5A 4E88A 3L8EA 3ESQA 3KC2A 2HEGA 4C4RA 2FEAA 3AR2A 4ZEWA 3ZVMA 5ALVA 4OHFA 2JAUA 5AKYA 4DWOA 3MN1A 1S2OA 3AR6A 5AVSA 4BX0A 5AK5A 1U2SA 4CF4A 3N1UA 5AKJA 2YMLA 2HI0A 2B30A 4OD0A 4UARA 4C4SA 4UM5A 4L6AA 3N28A 3BA6A 1Z4QA 1CQZA 3WK6A 5AW7A 2C9MA 1YDFA 3NUQA 2JAOA 1RMQA 4Y2QA 5A3RA 5ALLA 5AW3A 4AS3A 5ALKA 3SMVA 4Y2UA 2PQ0A 5AW2A 2AGVA 2FPRA 4BEVA 3KDPA 4RETA 2B82A 3ZX5A 2PKEA 3HYCA 3E84A 2NO5A 3SKYA 3U19A 3ZUPA 2IA5A 1RLTA 1ZJJA 4YCLA 3CNHA 3U7HB 4HGOA 2C8KA 5AM2A 2IOFA 2VKQA 2G07A 5AKGA 2OA0A 1XPJA 2YJ3A 2RB5A 1SWWA 2O2XA 1YS9A 2RARA 3QX7A 4Y2SA 3ZTWA 4OFZA 1N8NA 1YMQA 3B9RA 1QH9A 5ALHA 4Y2VA 2YJ4A 1RMTA 3WK5A 1Z5GA 4C4TA 4AP9A 5ALUA 4L6CA 2QLTA 3B8EA 2YJ5A 2D2VA 3U26A 1TJ4A 3NANA 4NWIA 2WFAA 3E8MA 2O9JA 5ALJA 4UAUA 3RFUA 3KOOA 1U2TA 5IT0A 3DDHA 1RDFA 4KNWA 4EX6A 1Z4NA 1RLMA 3I1YA 4Y2XA 3A1DA 2YMQA 3I28A 4RESA 3ZU6A 2WHEA 3SKXA 1L7OA 5IS2A 5AK3A 3EWIA 1QQ5A 4EEKA 2PR7A 2WF6A 2I34A 3ZVLA 3EPRA 2B0CA 4BX3A 4XQ0A 5AVZA 3KD3A 3WKAA 4Y2TA 2G08A 1VJ5A 1XVIA 3ZX4A 3QU4A 2G06A 5ALGA 2IOHA 3K1ZA 4UAVA 2EARA 1L6RA 3ZW7A 2CFRA 2EAUA 1T9ZA 5ALMA 5AW8A 4CF3A 4UASA 5AI6A 5ALOA 3FPBA 2P11A 4QJBA 2NO4A 4DCCA 3HLTA 4HGNA 3WK9A 3I6BA 2RBKA 2HF2A 3ZWDA 3ZVNA 2BDUA 5ALXA 3OCYA 4FE3A 4Y3UA 1J8DA 1ZOLA 3MMZA 2YMMA 3W5CA 4J03A 1NF2A 4ZEVA 4UM7A 4UW9A 4F72A 5AI8A 3N07A 5AIAA 3W5DA 2R8ZA 1PW5A 5ALDA 2HO4A 1L7NA 2OYCA 3L0BA 3FGOA 4FFDA 4Y2PA 1Z5UA 5AESA 5AW0A 3QUBA 1WR8A 2W43A 3QU9A 3QNMA 5AK6A 5AW9A 2JAWA 2P69A 3M1YA 5IT4A 3I76A 2GO7A 1ZD3A 3FVVA 1QQ7A 5AW1A 4CE6A 1ZS9A 3R09A 5ALYA 1L8OA 4KX5A 1IWOA 3WGVA 1L7MA 2ZBGA 5AM4A 2R8YA 5AI5A 3QUQA 3IJ5A 2GHTA 2FPUA 3OCWA 2R8XA 3ET4A 4I9GA 4HAIA 4NAVA 3WKDA 5FP0A 4BEWA 3KBBA 3E58A 1NNLA 5T41A 2JGAA 3S6JA 1RRCA 4BYGA 1KYTA 1F5SA 3L0CA 3L5KA 5ALZA 1RKQA 3DNPA 2HHLA 3UMGA 3CZ4A 3D6JA 2FDRA 4UMFA 5AKHA 3EF1A 5AHXA 1U7PA 3U7EB 1LVHA 1ZD4A 4HYTA 4UU1A 1Q91A 5AKXA 5ALSA 5E0OA 3MC1A 3QGMA 1T5TA 3F9RA 2BY4A 4BNDA 1MH9A 4O8CA 4YCMA 4J2TA 3R4CA 2G0AA 3OCVA 2FPSA 1YV9A 1RQLA 4B6JA 4IFTA 3DV9A 3ESRA 1Q92A 3AR4A 2YMPA 3N5KA 4JDPA 2ZBFA 1SWVA 5AKEA 5JJBA 1Z4KA 2EATA 4XOUA 2HX1A 1WVIA 3SD7A 3A1CA 4UMEA 2HDOA 3UMCA 2QYHA 4EENA 2I6XA 3L8HA 2YFYA 5AKKA 3OCUA 2ZBEA 3BWVA 4UMDA 3WK7A 3QU5A 3U13A 3PDWA 2C8LA 3UM9A 2B8JA 2G1AA 3AR3A 2FPXA 4Y2YA 1ZD2P 3DAOA 4F71A 2W4MA 4CF5A 2YBDA 4XPZA 1YJ5A 3WK8A 4GXTA 1Z4LA 3KZXA 3PGLA 3R9KA 1O08A 2X4DA 3OTQA 3WKBA 3NASA 3NRJA 2WF8A 2C88A 2I55A 2IOFK 1TJ5A 2GHQA 2ODAA 3SF0A 3L0YA 4YGYA 3SLRA 1N9KA 3U7GA 2FPWA 2WF5A 1VFPA 2YY6A 3W5BA 1RKVA 4NV0A 1U02A 3L1VA 3ZTYA 4G63A 1J97A 1Z4OA 5AIBA 2ZOSA 1O03A 4AS2A 1TA0A 5AW6A 2W11A 3J7TA 3WK4A 1FEZA 2CN1A 1RMYA 2R8EA 3QYPA 5AVRA 2P27A 2MU1A 2I7DA 5AW4A 5AM1A 3FZQA 2ZXEA 3IRUA 3SHQA 2B8EA 3EF0A 4H1WA 2GMWA 3U7FB 4EX7A 1VJRA 4HGQA 3WKEA 1Y8AA 1CR6A 5AVWA 2AH5A 3WGUA 3OCXA 3PCTA 3QXGA 4QQFA 3AR5A 4Y2JA 4FYPA 2HCFA 2I33A 4I9FA 4IG4A 1L7PA 4YCNA 4KYTA 1Z4MA 1WPGA 4ZEXA 5ALEA 3A1EA 4MWOA 4PNHA 2WM8A 5AVQA 4L57A 1S8OA 2ZG6A 2IYEA 2AMYA 4HGPA 3P96A 2WF9A 5AK4A 1RQNA 2OM6A 5AVTA 5AKZA 5ALIA 4UU0A 1TJ3A 1RC8A 3W5AA 5AVUA 1NRWA 3ZI4A 3QUTA 3ZWKA 2FUEA 1Z4JA 3QUCA 1EK1A 2NYVA 5AKLA 1LTQA
chains in the Genus database with same CATH superfamily
2V65A 2P9BA 3EUEA 3U5TA 4LV8B 4NE7A 3N8NA 1R0XA 3WL3A 4MVJF 2WR8A 3AL3A 2H5LA 1GNSA 3M33A 3O75A 3PHCA 4CU5A 5C1OA 3IB6A 5AR1A 5COBA 3EPJA 3EPKA 1A4UA 1K86A 1IXZA 4QODA 3OMXA 4YIHA 1J0BA 5IP5A 2H2DA 3Q6IA 4KN8A 1ST3A 1YVPA 2QRMA 1T5OA 4JJ6A 3DMTC 4LI0A 4RKWA 1I6LA 3I9V1 2QNIA 2QXUA 4UAGA 2VVTA 2E1PA 721PA 2D7JA 3GU3A 2AVNA 1PL6A 1WSWA 1GG9A 2VTDA 1KS2A 4K03A 3EVTA 3PEYA 1JPUA 4GT1A 2CNDA 5FWXB 1V6SA 2M98A 1ATZA 1OY1A 3PJEA 2H11A 1UOOA 3MK31 1UXJA 1YBAA 2IP1A 1LI4A 1DMRA 4JJGA 4OQFA 5K4AA 4DIFA 5IU6A 2Z8YA 3IP7A 2AC4A 2PU5A 1Z6PA 3OPVA 1QG4A 4GOJA 2FDCA 1MOPA 1EXVA 5IVKA 4QOIA 4I4LA 2C9YA 2DXIA 3GZNB 1QX4A 3WJ7A 1UDBA 2QQ5A 5DM2A 1KXJA 13PKA 1GCOA 1SVKA 1P75A 4BBAA 3LO8A 4R1OA 2I29A 5AVYA 1VCIA 3FYDA 1XD2A 4DOMA 3DAPA 2BKXA 4HLUC 1M1NA 2HLPA 3GGSA 4URHA 3WHLA 1XK6A 4D8VA 1P62B 1QYVA 2X41A 2IXGA 1BSVA 1ZKDA 4IL5A 5JQGB 1EM8A 4YLEA 2VUTA 4ZAWA 4OPMA 1T5SA 2C5LA 1T9CA 2PMDA 3AFNA 4TV9A 1XYVA 2Y0DA 4LYGA 1DAIA 5LMUB 2A7XA 2AK2A 3JV7A 4ECEA 4DV7B 1U9IC 3E70C 4I19A 3SS8A 3RAFC 3MPOA 2J41A 2VXCA 1ZINA 2WA1A 4GGOA 4JC5A 4JJKA 2ONYA 1V5EA 4H7DA 5BSTA 1EXNA 4NU8X 1P6QA 2JVJA 3R7LA 4YPOA 1I1NA 2DJ5A 5EJIA 2EFYA 3DE0X 2R65A 4C89A 1E99A 1NI4A 2Y9PB 1XQVA 4W82A 4B47A 1LPAB 2FUCA 3E3LA 4BU1A 4Z1OA 3B52X 2WUFA 2KPOA 2IYXA 4NDNE 4Q4JB 3S2ZA 3BHMA 4XYMA 4QNNA 1EZZA 2M6KA 2XITA 4EWLA 4FWBA 4UZSA 2QTWB 1R27A 1C3VA 3PGVA 3OHPA 3UK1A 4JYBA 2XUZA 2YDXA 3RYIB 1JVSA 4PICA 4IKOA 3GRKA 2G5PA 2UZ0A 4WXRA 5CVDA 1VYHA 5SY6A 3UJDA 2YN4A 3OFSA 2F1RA 3A11A 2G7ZA 1VPLA 2I7TA 4MP3A 2EP7A 3W04A 3NPMA 4LHSA 3TJMA 5DNCA 5CB6A 5M34A 2PUFA 1PBTA 3EFEA 1OZAA 2ZJBA 2XHZA 1E3SA 4U63A 1N5MA 2WHRA 1UPCA 3R7BA 4ZU6X 4ZKDA 4BY9E 4O3MA 2PXCA 3IVMA 4MITA 3KYBA 2ZIXA 1DX4A 1AN9A 3UUFA 4HPJB 1CZNA 2EEPA 1ESDA 4JI6B 2BC9A 2ET6A 3LCRA 1FRQA 5FPKA 3WB2A 3RC2A 1FNBA 2C2KA 2YC2C 3DEFA 2FEAA 3OEYA 1E2JA 1SFRA 3KT6A 2WYVA 1XZAA 4LHWA 1B3RA 3I5YA 4JGIA 3OIYA 4DKXA 3M9XA 1VG0B 3AUUA 3BCRA 2I9KA 1LDGA 3RFXA 1EQAA 7ABPA 4BRWA 2AJ8A 2GXSA 4B8WA 2TSYB 3GRCA 5FWDA 1GZ6A 2BH9A 1Y8QB 1WSDA 2OFXA 3CLSC 3H5OA 3F6BX 4PYRA 3TRFA 3ZJUA 2BMFA 2ZWMA 1ZGAA 3JD2A 1XZGA 2IYRA 3RU7A 4YMTA 4B74A 5IKMA 4D45A 2JLSA 3JQGB 5KNDD 3KQKA 4CCSA 4TYMA 2HN9A 2PKYX 2EG9A 3NHWA 3PIRA 3TOCA 1IJEA 5GJBA 2IEBA 3HL0A 4HXFB 2J9YB 1LB1B 1LW7A 2Y76A 1D2HA 4FILA 4OKIA 3SMVA 1F8GA 3BD7A 2CFOA 2AG0A 3GP3A 1A5ZA 4RK4A 4WCDA 4ERXA 1Q0LA 3DYIA 1AZTA 2PGNA 1T8YA 4DZTA 1KFEB 4BEVA 3U39A 4ZT3A 4QTXA 4B3RB 1S9DA 1XKLA 4FPXA 4HH4A 3NOVA 4N3NA 4JSYA 5KB3A 3U19A 3VZCA 1DNPA 3KPVA 1SCAA 3ANYB 2GOYA 3H87A 1YQUA 3I3OA 5DYWA 2ZSJA 4YDSA 3GRUA 4AKEA 3GVIA 3IDAA 5HIKA 4BVEA 2Q3JA 2AN4A 3ICOA 3STXA 4IGKA 4Q18A 1GYPA 3L8MA 1LY1A 1JLLA 3DBVO 3IP3A 2ZSBA 1NJ8A 1RQPA 3ELYA 2ATIA 1PL8A 1U5BA 4RPCA 1XZHA 3OFKA 1LK0A 1K5PA 2EW8A 1NYTA 1SG6A 4EYGA 3DLBA 2XKAA 4HDOB 1YS9A 1X38A 3FCYA 3K0FB 1YZQA 4ZAYA 2EKQA 5LQJA 5LWQA 1J8QA 2XZLA 3ZTWA 4EFMA 1MJHA 2EQAA 2R8OA 1WG8A 1AB6A 2PEZA 3STYA 4ERNA 2B94A 4N8SA 4FXPA 4KXNA 4KOEC 5KTNA 1RMTA 4URFA 2FSIA 5HIJA 3YASA 1SZCA 3BRWD 2WZQA 2GYVA 2CVPA 5DMHA 5FR2A 1M8FA 4W7SA 4A1OA 1MR3F 1XL1A 2HSWA 1N8SA 4AJ2A 1IAVA 1HKHA 5IZCC 3SJUA 4EMTA 1NJSA 4MVWA 4L50A 2QUIA 3LW7A 4KQ6A 3RUFA 3HB4X 4HVAA 4X95A 3BDAA 4M86A 1W1IA 3V33A 3ZU4A 2XNCA 1T2AA 3Q0EA 1JJFA 3T5GA 4DLNA 2RKWA 5KMGA 1PQWA 4ZCSA 4KNWA 1QE3A 4M0KA 4J4HA 5LOVB 3DOEA 2FPIA 2H4JA 1B73A 5I7SA 3N0WA 4WASA 4DXDA 3AUXA 2C7RA 1F1BA 1H9AA 4GI2A 2OHHA 1KI6B 1WMAA 3M5PA 1CUZA 2EWWA 4F5YA 4TLEA 1KZ6A 3MBOA 2WJPA 2AJCA 4JUFA 4EF4A 1RXUA 2O23A 2QVLA 3HQ4O 3QX9A 4KHZA 3HFJA 3U0VA 1SG0A 2AOTA 4M8IA 5CU7A 3UK6A 1HC7A 3UYKA 5C7IO 2ZU6A 3K15A 5I9LA 1F2UB 1U1GA 3A9CA 3FPFA 1WVGA 3JSAA 1VP9A 3KE9A 3NC1C 3QU4A 3C6QA 1DE0A 1SBHA 4DLXA 5AQ1A 1QU2A 4J0IA 3TTYA 4G8DA 4QBGB 4PZUA 5L45A 1BEUB 3AUYA 5ERYA 5F5XA 2CFRA 4WUTA 1WAMA 3WWCA 3L6RA 3GJZA 5CEJA 4CIYA 4L08A 1I24A 2X8LA 4CHTA 3Q72A 2HNBA 4GM1A 3T3PB 4B9EA 2G5CA 2ORIA 4I1VA 4LHEA 4W7IA 5HCUA 1T1EA 2SECE 4DRZA 1FLDA 3A4NA 4JFAA 2IQ5A 2AFHA 2FXVA 4EG3A 4P0PB 3ERCA 2PUAA 1PTKA 4WHMA 2WW8A 4RK5A 1DCMA 1JIKA 2GPTA 3HO8A 4F4UA 2O4CA 5FNZA 1IATA 3BIOA 3L3BA 4L3OA 2VQSA 2HLHA 2ZJFA 1HQYE 4JWTA 5CYOA 4B7XA 4EW6A 5T4HA 1NF2A 3JYLA 1KFCB 4E46A 1JG3A 4ER3A 4ZEVA 3K0SA 3RR2A 4IQJM 4AF8A 1MEOA 3ICCA 3R7WB 2CK3D 1A9QA 3AB7A 2F17A 4AL4A 4B45A 2XUFA 1XE3A 3O7MA 3G0BA 1Q2UA 3QE2A 4BNXA 1PE0A 3L0BA 1MB3A 5TT0A 5HZHA 3IUPA 4I8DA 4QRHA 4HMPA 2EFGA 2L18A 4QT4A 2BGWA 1Y6RA 1IVSA 1VG1A 4M55A 5C80A 5AW0A 1I13A 3GW8A 3DO5A 2LKCA 4GOOD 1BXRB 4TVSA 3B5IA 4FQ5A 4HQNA 4TVKA 4BWYA 3JVDA 3KQTA 1QQ7A 2CJFA 1RYBA 5EQJB 3M4NA 2JGJA 3B1KA 4GQBA 4GMHA 4M0MA 2ODTX 2O5CA 1AS3A 1P17A 1ODJA 1SVMA 2O2ZA 2O50A 3AF5A 4TL8A 4G6ZA 3BXXA 3WY9A 4S1TA 3WL4A 4P5DA 1SVSA 1M5UA 5BOSA 2P9GA 4GMFA 3T9EA 1URPA 4JJEA 1GLVA 2AEEA 1VGRA 3JALB 1Z45A 2F3TA 3AERA 1G2IA 1MX1A 2ZM5A 2AFIA 5E6UA 4LX0A 2IYWA 3ITKA 2QWXA 3JQFA 3LUFA 4JVNA 5L3ZA 3TSOA 2PCJA 3ZGVA 5DM70 1UFRA 3TR5A 4Z1MD 5GWXA 1X80B 4MCIA 1S2NA 1H2EA 3V6LA 5KMGB 1HE5A 1M33A 3CGGA 2QLNA 3EH1A 2WWHA 4MV0A 1ZK3A 4E5KA 1RKQA 1QUFA 3DNPA 1TVKB 5CK5A 4J16C 2ADMA 2UYHA 3TTVA 4ZYUA 2P5YA 3G8AA 3S68A 4ZCRA 1OXTA 2R8PA 1E2NA 4L9SA 4HAOA 1OROA 4AQDA 2O8DA 1N2CB 2HXGA 1FVXA 4EJSC 1QIIA 2ZU0C 2QRPA 3RM3A 4C0SA 3UOWA 1CS0A 3DOJA 5LQUA 1TFRA 4YDHB 2GT1A 4OXQA 4CR6A 3ZIAD 4DSUA 2IUFA 2EOAA 3EWSA 3QMPA 3PEVA 3CNEA 4EPVA 3DJFA 3EYAA 4YT5A 2XMDA 1I2BA 1F2UA 1A0OA 1UBNA 1GZDA 2HREA 3KEGA 4L4ZA 3ZCVA 5JU6A 2IITA 1RQLA 2WABA 3D3QA 2BELA 3D4NA 2Q41A 3EYWA 4OB7A 1AMOA 4YONB 3TLXA 2IP4A 5HYVA 5LYYA 4BCBA 2X4LA 2ZJ1A 2GBLA 2I66A 3CLRD 3RGWS 3JASB 4E5DA 3WS7A 3MQFA 3QG1A 4TWRA 4YJ2F 4X0EA 3B6IA 2O0JA 4UHBA 1E0KA 2Q5QA 4EBFA 1PR2A 3ZDBA 2DQYA 3GEDA 3GOHA 3KHKA 3D81A 2JHAA 3QV2A 2QTTA 3KVYA 4I5FA 4UXHA 2JFXA 1SHUX 1T9AA 3G0CA 2XVYA 3MAAC 3C3CA 4MUYA 1QANA 2A9QA 3AY3A 1I94B 3EAFA 1P0QA 4UXJA 4WZ6A 5BRAA 1DC5A 4KFUA 3PVCA 5WRFA 5FNVB 4C78A 1HDZA 2QVXX 2XMPA 5G02A 2C9ZA 2FYTA 3OA0A 3USZA 4BFTA 1UK6A 1Q12A 9GPBA 1MIOB 4EGAA 4MJ3A 1PZHA 1IULA 1ZNZA 1YF3A 2Y6UA 2WD9A 4FKZA 4WFJA 4DSTA 2IY8A 1E7YA 1XWWA 1F8UA 1WW2A 1BTOA 3HKBA 1W8IA 3JAKA 2P65A 2QTFA 2A1UB 3JQPA 2JFZA 2XJ4A 2FMFA 3AF4A 5H68A 1A2OA 1XLTA 3WK8A 1FFYA 2PH3A 3KZXA 4JBWA 1E9DA 3E5NA 4HVCA 2C4WA 4EY6A 4L3VA 4BP1A 3TW4A 1VI6A 4GKVA 2FUG1 1C30A 2I55A 1UOEA 3HGQA 2DWCA 2GBCA 4M37A 1I3NA 5TIIA 2J4FA 3E48A 1OZFA 3L0YA 2N9UA 3EGOA 1TYZA 1P9RA 1XRJA 2EX4A 1EFLA 3V4VB 4I50F 1RJ9B 4YMLA 3S2GA 2WF5A 3K2BA 1E20A 1NR7A 1RKVA 4II7A 3MA0A 2J9RA 5AMXA 3OD1A 4AMGA 4RHEA 4EA8A 2JLWA 4G63A 1GXSB 1B23P 2O8FA 2PNFA 1DBPA 3LPMA 3PNKA 5KYYB 4U39A 4WERA 1Z4OA 3FTPA 2KYRA 1ZUNB 2YXNA 4XCVA 1Z8FA 5JIBA 5A5EA 2DTEA 2FN8A 5KTOA 2IYZA 1SUCA 4RZ2A 4LSZA 5BVHB 1Z63A 3CXRA 2P2CA 4MVCA 4B81A 2PXAA 3AJRA 4I3GA 1GR1A 2BGTA 3NNNA 4NI5A 4BWGA 1OA1A 4LZOA 4QD3A 4CM4A 4E5PA 2RBGA 1FEZA 1XZ8A 5FL7A 1NW6A 2CXHA 4HB0A 1K06A 1MJGA 4YMUA 1WZ2A 3R7WA 3LDAA 1IM2A 1E61A 2PPVA 2CJWB 1KORA 3GLSA 2KI5A 4W1RA 1XTTA 4KSBA 4EUKA 3ENNA 1XZIA 1I2MA 3IUMA 4GI7A 2ZYVX 2DBRA 2ZROA 3EGDB 4FCWA 5A4KA 3U7FB 1ECLA 2O7SA 1ID1A 4LUCA 4WJZA 5FO1A 2FWPA 4I1OA 4XUCA 4HMQA 5AVWA 1MAUA 2ZE5A 2X0KA 5K0ZA 1ZNYA 1H6BA 1WXGA 4JLNA 4UE2A 2XLBA 4BVHA 1VCHA 5DSTA 2XB4A 4QWMA 3P94A 5HKBA 3F73A 2DUMA 2WMYA 1ZQ1A 2WWRA 1J24A 2C20A 3MUEA 4R0VA 1TNDA 4RY9A 4E4YA 4MVJD 1LTHR 2ABWA 2CYAA 5D8DA 4J9UE 4A8HA 1QHGA 2YRFA 3GFFA 1OX4A 2BAGA 2DHRA 1BX3A 3PS9A 4O2RA 5AJWA 1W4BA 4BIMA 4B6QA 5COQA 4YR7A 1H66A 1L5SA 3DDOA 3KJFA 3QE3A 2HIMA 4MRPA 3R3VA 4S2UA 5J5CA 3VHRA 1NURA 4GMDA 1VE9A 1J7JA 3MFQA 1GFIA 5GONF 3D8BA 5E2BA 2WT8A 4D7AA 3T1TA 3VNQA 3ASYA 2NUPA 3OY2A 3K70D 2V0NA 3PX3A 1FQOA 3WQHA 1JPJA 3OZWA 4QL3A 5KX5F 1DTWA 2BBOA 4LYDA 2FLWA 3H5TA 3OQBA 4E5YA 3GJ0A 3ZDFA 4M98A 1AS0A 1OYOA 2OBMA 1A9OA 2V6FA 3G5UA 3LHSA 3PUXA 5A1TA 4EGSA 4MV8A 2X5KO 3HEBA 4GZ3A 4AKHA 4F6RA 3ZUGA 1TVCA 2GM4A 3D5EA 3STVA 4GL4A 1NXVA 1OOEA 2AHOA 1JWBB 1Q0PA 2CDAA 2M6RA 1PZFA 3GA5A 3ZWMA 1D1SA 3LUAA 4BNKA 1HMYA 1K98A 4JLMA 4AXXA 2WJVA 4AMZA 5LP6A 4RWZA 2AFRA 4CIAA 3G0HA 4XW2A 3ZY3A 2GA9A 5JYCA 3DCIA 1ORVA 3HA2A 3U7IA 3PX2A 1DIGA 2A78A 1DRWA 5CVUA 5THKA 1CHNA 2BMEA 2VT6A 2GCGA 3L0IB 4LE1A 1L4GA 3ODPA 3VU9B 3X2FA 1TT5B 4MTCA 3TIIA 3EGIA 2PO5A 4JKIA 3RYFB 4Y6OA 4DYHA 4OHPA 3U16A 1GNQA 1GN9A 4QNRA 3SNHA 5FTLA 4G5YA 4R0NA 2G1UA 8GPBA 1PJRA 4B3IA 4CUJA 1CP3A 3ENWA 1JR3D 4ILEA 1UPTA 1P9NA 1UP7A 2H4FA 4FFLA 4QULA 3AR9A 4BDTA 3D2LA 2Y1XA 3GCXA 3KK0A 4H31A 1WF3A 3EJWA 3GT0A 4TKLA 1E1RA 3WIBA 3FDJA 3U7JA 4B3BA 2CF6A 4XGIA 3FTEA 1YI8A 2GBGA 1JIQA 4OSEA 1UFVA 1R6TA 5A3QA 1GTSA 1JUDA 1QGDA 2BR5A 4L27A 2H92A 1DBWA 4ZVLA 2GAOA 2Z58A 5DHUA 1K8RA 3O8BA 3DTNA 1N25A 3FHJA 1L4EA 2JI6A 2DFNA 3M3DA 1KYXA 3F0TA 5GZ3A 2G1PA 4GLOA 1N4AA 2AKYA 2VNHA 3LVFO 1HH4A 3BERA 2E4UA 3FTDA 3ON5A 3DVLA 2O8VA 1S6YA 1T29A 3IESA 3THRA 1ATIA 2VG8A 1U6KA 3B53X 1NI5A 1A3CA 3E7WA 4TN1A 2OAP1 1Y9JA 5HG0A 2WJYA 2PA3A 3A58B 4ALJA 1U3WA 4BAUA 4I5GA 3TNJA 3LUJA 3UT6A 3KSZO 2Y1DA 5A7GA 1R9MA 1KGDA 3PTLA 3NRBA 3W7VA 1KBQA 2OXTA 5CAEA 1VPWA 1CIPA 4LSMA 2B37A 3FMVA 4EZEA 2QTHA 2WTBA 2PZAA 3C6XA 3C3WA 5JVDA 4TZ0A 1EJBA 3QFRA 4W9RA 1G59A 1NOKA 4YIKA 4DV5B 3DEHA 1WJGA 2FB9A 1Z4IA 3LHIA 2VA9A 3OQJA 4I8IA 3V00A 2ZSAA 1D7AA 2PMCA 2QQEA 4L4SA 3AI1A 1JQ5A 5CVTA 4WH0A 3H9EO 1VRWA 1ZISA 4XVQA 3VKHA 1GAEO 1J09A 3H5IA 1T9HA 3A6DA 4QARA 1ZBQA 1TC2A 2EDAA 4G86A 1VG8A 1RFLA 1P1RA 3EAQA 1CLUA 2QSZA 2CFTA 4CTNA 4BGDA 3DDUA 2W7TA 5DM4A 3ZCUA 4DE5A 4FOSA 5DW0A 4S24A 5JG7A 3TE6A 2NUTB 5I7HA 4MO2A 1ZD5A 4DRYA 3NHLA 3THXA 1V71A 3TEFA 4KMMA 4UHHA 4YRSA 5ESXA 2QUKA 1QYCA 3SZLA 1DAHA 1QH0A 1TCCA 1VLJA 4YRPA 2BHRA 2P5SA 1CUDA 4LSWA 2ZUTA 3ZKWB 1FU4A 4LCJA 5TVGA 2CBXA 5AKYA 4RLFA 3WGMA 4OX9B 3C7DB 3RUAA 3HDVA 4BC0A 1DU4A 2ZIFA 2J3MA 3MWEB 3N1UA 2VWQA 4QFDA 4D3DA 5BQPA 4HQKA 5J4LA 2OSBA 2R2AA 5C32A 4LYAA 4DV2B 3UT5A 3KV1A 1HZZA 4P3OA 1SC6A 5BQFA 1KJNA 821PA 4PCAA 2J6HA 4DV0B 4EHFA 3A1VA 3H17A 5DOVA 3LQ1A 1EGHA 3WRVA 2AZTA 5AXAA 4OM7A 1E0JA 2OZEA 1I2ZA 4EG5A 1LF0A 3WTCA 4OLFA 1T2DA 2JZOA 3B1YA 2PUVA 3K1JA 3EODA 4JGGA 3HDJA 4OF4A 3BQNB 1GGVA 1ZRSA 3PEUA 3VR5H 5LU8A 3I64A 4IIEA 3W5UA 1R7RA 4GXQA 3F4KA 1WDLA 2ANCA 1ZGZA 3WE7A 4JIGA 4RW0A 5ER9A 3EVNA 3H0CA 2JGIA 4Q3AA 1XQ9A 3H2SA 3M7IA 3PVZA 4OFBA 3R3YA 1Q7GA 2DRIA 1E2EA 3AHFA 3OOSA 1W4CA 3TNLA 4Z4CA 2PVCA 1QBGA 4D44A 2IBSA 2H63A 2C8KA 2FFBA 1FTYA 2IYOA 4MV3A 2A2ZA 3UFBA 2WQ6A 3CN9A 2LCQA 2A5DA 3OTIA 4HZIA 2PTRA 1F2TA 4UHCA 1TD1A 1MVNA 1TL7C 1GRNA 3GFVA 3P9IA 2IYVA 2ZQYA 4L6IA 3ZY4A 1BW9A 4DDHA 5BMOA 1N75A 3ORFA 5ILGA 4D26A 2OOSA 2C77A 1T0HB 2GN0A 1LSUA 2QGZA 1CUBA 3WBFA 4FYYA 1AUPA 2GN8A 3VO1A 1S0UA 2GCPA 2WICA 3U4QA 5AJXA 3FKSD 2H2IA 4RV4A 5GGYA 2X14A 4FT4A 2X75A 4Q1CA 1G5RA 5ALHA 4AQYB 4A0HA 5BSWA 3EBLA 3COYA 2YIMA 4YXWD 3KQNA 1E3WB 3R8CA 4HDRA 4MQFB 4CLOA 3H11A 4NMMA 4IO0A 4KODA 4XZ3A 3OFVA 2LDXA 1EK5A 4V02A 4XUGB 3RS4A 1E8NA 5B64A 3HRHA 4K46A 5GJWC 1EHYA 1LRKA 2GAIA 1GCUA 2H4XA 3O03A 4HUQA 1CY2A 4YJFA 2R3SA 3BMCB 2BKEA 4KLNA 4NE9A 1U80A 2AMLA 2GPWA 3OKPA 1KI7A 3ZIAA 2AL7A 5HP4A 1PUXA 1ZI9A 4HH0A 1RDFA 5BR8B 4CU2A 1SCIA 5DNUA 5CLJA 3DLTA 3PHLA 3GL9A 5D6OA 1RLMA 2FSPA 3L18A 4LRYA 4X3OA 3AJDA 1O6GA 1BS2A 1PDOA 2HRCA 1E5XA 2HUPA 3A1DA 5AOCA 4IYRA 5JDCC 6PFKA 4XB6B 5DWDA 1IEXA 4AMUA 4L7QA 1NRIA 3R0JA 5AK3A 3RVOA 3NETA 4DPKA 2O2GA 2WF6A 1J8FA 1WXXA 1D5CA 1KJ8A 6ABPA 3AHCA 1WB5A 3WYFA 1QUEA 1W85B 3LA6A 3ESYA 1U0NA 2WYUA 3JTEA 2I2FA 4Y2TA 3VYUB 4PLVA 3ZX4A 4R2LA 4NOMA 4TRJA 4Q6BA 2XGGA 1SKQA 2ZS9A 2X7XA 3CLSD 4UZEA 3GCDA 1XAHA 3AL0C 1E3LA 4DGSA 5TGDA 2EF1A 1IK6A 3VKFA 1AKVA 5H70A 1Q0UA 4JGBA 4YPFA 1ECBA 3WGTA 2O8BA 1WB4A 2N46A 1TKAA 1BROA 3NWJA 3G2OA 1I7QB 4MUGA 3ZNQA 4MYDA 3VR4A 1SXQA 1IN7A 3ZE1B 5L3QB 2CUKA 2Q5HA 4QLBA 4HGNA 4MWZA 1JHRA 5LOVA 3OP4A 4AURA 5EGSA 4ND2A 2GXAA 1N7HA 3I9KA 1G8JA 2JJQA 4B0OA 5C4GB 4OQLA 3U09A 5BMVB 1YUMA 4H77A 2GJ4A 5LP6F 3D7MA 1YC5A 3INRA 4G85A 4OI1A 1TZKA 5KTMA 4I4NA 1XDUA 3DQPA 4F2DA 1UFOA 1L4BA 4O4HF 3IHKA 2ISQA 1NXOA 2IS1A 2AZDA 3UGQA 4OK3A 3NEYA 1FXWA 3RLIA 1X19A 4F72A 5AI8A 5HJ2A 3BJIC 3OQNA 2V74B 1JHOA 1EB8A 2AOVA 1JU9A 3O8QA 4UVGA 5A4JA 1YDEA 5EQTA 2XVZA 4RACA 2LUOA 2FZ4A 3PDIB 3Q6MA 4O63O 4UHEA 5J5VA 4FB4A 2JCGA 3GFQA 2XYRA 4WK6A 1F3OA 2HXYA 3DNFA 3OA2A 1W0KD 4HEA1 5CGQB 3SP1A 4C4OA 3FVTA 5AW9A 1JZSA 4EMSA 2CXXA 4BNGA 1SOVA 3ZWNA 1Q21A 4K05A 3X1ZA 2H1VA 1N7JA 2G8LA 3K8QA 3BIJA 5GAJA 1ACLA 2WQZA 4X24A 3OEEA 4P4UA 3FTQA 3L01A 1DCFA 1DRKA 1GY8A 3OX3A 5DNEA 4OX9Y 1FSSA 4YV1A 2PYZA 2A1IA 2B2NA 1NJ1A 1Y4AE 2R1UA 3AZQA 4FFRA 5DI9A 1KE2A 4AY5A 5KSZA 2PJRA 3AK4A 3HSYA 4DL9A 2QE7A 3CRMA 5BOVA 4KR6A 1TU4A 1LLCA 3COZA 1M2HA 3D0QA 3QOYA 1X1RA 2G8NA 1DLIA 1U31A 1X7ZB 2EBUA 4IPTA 1E5DA 1OLXA 2GZ3A 3GEPA 4FEYA 1N0UA 4Q3CA 3T1YB 2F8SA 2JH8A 1KYTA 2UYYA 3IDFA 5MN4A 3FPKA 5EA2A 1V26A 1TW2A 3EBOA 3MTBA 4GPEA 3KR2A 1A5BB 1JEAA 3PLAE 4ZMRA 4NXMB 1D4AA 3AUFA 5TJHA 3OQ1A 1JDSA 3CZ4A 2Z3VA 2OPHA 1XI2A 2WFZA 4B33A 1U65A 1ZGBA 1U7PA 1TFUA 4G41A 2VRCD 1FSPA 1I7SB 4M8SA 3CW9A 4EO9A 2PKXA 4ZTBA 3LIIA 1QMPA 5E0OA 3WLEA 4HDKA 1SU6A 1I1HA 1VHLA 3K0BA 1H5NA 3D7KA 2I2WA 1XEWY 2ZI3A 2A0FA 2Q3MA 3ACDA 3DO8A 4EOGA 4RDHA 3JZDA 5HIIA 1YS7A 3FYUC 3STTA 4B3DA 4C20A 4YRAA 2VJCA 2FPSA 2OBNA 3PFBA 3I53A 3QXCA 5DRTA 1KAHA 1X7ZA 3WOHA 2JASA 1RHRA 4C4ZA 4JLUA 4L5YA 3DV9A 1G3MA 1TA9A 5BUZA 1JFTA 1COWD 3FB4A 1CW2B 1SXJA 3QE0A 4WZZA 5K45A 4LJYA 3G8CA 4Z54A 2XKBA 5E0KB 4H4EA 2Q4EA 3NXKA 4BMYA 5K8CA 4WA8A 2DETA 1G6Q1 1JSWA 3FB1A 1KDZA 5KINB 5HKOA 2EU8A 4M1YA 2ID4A 1X9IA 3D8TA 3BRSA 2J4CA 1D6MA 4ME6A 3W2EA 3FTFA 4HUQB 4FSXA 1L4YA 2GD0A 4ZOBA 1JA9A 5B1SA 1UBTS 2WV7A 1KK1A 1UKCA 4UCQA 221PA 2J07A 1E2GA 3NRCA 3FW1A 5AD1A 1RR6A 4BZXA 1Q15A 3P2MA 4P6VF 3WLOA 5U9CA 3COSA 4GW3A 7ADHA 1KMNA 4LJ7A 3CLHA 3NH6A 4L4YA 2WUGA 3BH7A 3WNDA 3QX3A 2VN8A 1V8OA 2XOKA 2CV2A 2BEUA 1E0DA 2AT1A 4IIJB 2Y8EA 4PYNA 2IU6A 1FYFA 4XB1A 5BNIA 3D7SA 5JATA 1Y1TA 3GAAA 4FR0A 1Z4LA 2Z1MA 4LDPA 3PWTA 4PTLA 4BWFB 3R7DA 1I5OA 2PKQP 4EL0A 3GP8A 5I3CA 4QDTA 4CTMA 3GJ6A 2C42A 2RAUA 3TVYA 5I9TA 1TJ5A 3HS3A 2PX3A 1QP8A 5CB4A 1PQYA 5ER6A 4AROA 1YVUA 1UBJS 5C4MA 1QGED 2BFAA 5HIMA 1EFPB 2AJBA 1GILA 5TT1A 4D02A 1AKEA 1P0CA 3ANSA 3CVUA 5EHXA 2B1JA 4BU0A 1LPNA 3DP7A 1Y80A 4R54A 3K30A 1FFGA 4PYOA 2RGRA 1XQ6A 4NNJA 1RXIA 3DVQX 2IHBA 2A5FA 5H1YA 3P2JA 2ZUEA 5DE3A 2W11A 2BGNA 4KDEA 5DM1A 1HSZA 4A73A 4ZYYA 1DFGA 4AIIA 1GIAA 5PGMA 3OZUA 1ADYA 2HLDA 2RKBA 1YQWA 2CN1A 4RA6B 2R8EA 4UD6A 3UHPA 4C6TA 1G55A 2O4UX 5HQJA 2XMRA 5IMBA 3I5UA 2ETVA 2QGNA 4QGFA 3LX5A 1IN5A 1FTGA 4RE5A 1T15A 3R0VA 3A4TA 3BE5A 3RSGA 4ARZB 4TL7A 4MW4A 4F8YA 1UT8A 2CFIA 3AB3A 3QFFA 3S7TA 4Y9SA 1QRAA 1YCDA 3O73A 4V0NA 1NQWA 4X8LA 4Y6SA 1X0VA 4H35A 4M54A 4TMXA 3HPRA 4PZCA 2HJSA 1JLHA 1FQKA 4CVNA 4GPZA 5DFAA 2VRWA 4W5RA 1HK7A 2EXXA 2F67A 3CUWA 3BQ9A 1CKEA 1ZJ5A 3HCNA 3P9RA 4NMWA 4RKFA 3I34X 4ZVVA 1E3DA 1YFZA 2WSSD 1CJVC 2VKTA 3SQWA 1ICIA 3DOIA 2ODWA 1L7PA 4FGUA 5CBKA 5EHQA 4CKCB 2CXNA 4I3FA 2PVSA 5F33A 1TPYA 5LYJB 2JFNA 2RGNA 2MYTA 1Y0BA 2VPYA 3RV3A 3K9BA 3DT8A 3AHIA 4FUTA 4WXEA 1R8YA 3LK6A 1RACA 5G4LA 3SLKA 1IHOA 5DNYB 4HGPA 1DINA 1RAIA 2MSDB 4YJKA 4DLRA 2JRLA 2M2IA 5I9NA 2WT9A 3WDMA 4DA6A 5KOYA 1IG0A 2D3WA 5IJ9B 2PZ8A 5JNWA 1N2HA 3LXXA 1MNAA 3VUFA 1SQ5A 1Y8ZA 5AVUA 3TOSA 3OZSA 2BN4A 1GG5A 4GUDA 1QNFA 3ODGA 4TKMA 1RXEA 3IMKA 2A33A 1TM5E 3PQFA 2XB9A 4DLUA 4GEKA 1ZN8A 1XQWA 4MWSA 3KSRA 3OZ7A 4H3VA 2D00A 1D4FA 2VATA 4G4SP 3NU1A 4I66A 4BP3A 3B2NA 1MCZA 1CY7A 2QM8A 3A9UA 2QN2A 1UMCA 1M7BA 1TVKA 3H1BA 2FGJA 2QUJA 2YNMA 1DQZA 3H7AA 4FGLA 4R9RA 4GMXA 4R40A 5HGXA 3ZN2A 5BXYA 3OIDA 1GL3A 4X1IB 3RIMA 5CG2A 3ZWAA 1I6KA 1EUDA 1ZWKA 4WRRA 1X1CA 2EC5A 3ACBA 4HZUA 2WTEA 3EQ8A 4ZQFA 1GARA 1BX0A 1G42A 1PG0A 2W2KA 3DYVA 3RHTA 3ZV5A 2C94A 3TQQA 4HEA6 4PG5A 2W2LA 3COPA 3KP1A 3E15A 2E9FA 1QYXA 4RKQA 3CF4A 3OO0A 3TQSA 1W7AA 1VHQA 2PX8A 2RI1A 4V0KA 3PQEA 3L6BA 2Q8PA 1S7CA 4QJIA 3TCXB 3EQ2A 3AM4A 1WSAA 3OLWA 1CNFA 3IE0A 2Q2WA 3UUEA 5LUBA 1DELA 5JXGA 1OF1A 1XRLA 5G1NA 2J3IA 2DPYA 1XZPA 1VLHA 3NC4A 3TDNA 5IM5A 4OSPA 3SQDA 2VC2B 3UFXA 1Z5VA 2NU6B 3GFOA 3R5KA 5A7HA 3QVJA 2FY8A 2C4MA 1Z6XA 3Q98A 1M1UA 4UM9B 4LXHA 4ZVSA 1DO8A 2AXEA 3IC5A 3TOVA 4YWHA 1JTFA 1ORTA 5B4VA 2PTQA 4NJMB 1X7DA 1RIFA 4NS1A 4BE9A 5JADA 2W2KB 1Z0ZA 1FYDA 1QTRA 3ER6A 4QYTA 4RSGA 3RSZA 1F6BA 4H0NA 4EELA 5LZ9A 4ZOLF 1FDRA 3QOFA 4N0MA 2HV9A 1K5HA 1SVOA 2WYOA 1POXA 1QIGA 2XUIA 1ZPDA 3CX8A 4BO0A 5LQMA 2BD0A 1RWPA 2ZJ5A 4F56A 5CA0B 2UXDB 1C3OB 5I8ZA 4Q3OA 5JH7A 3BDVA 4CGYA 4KJXA 3SEFA 2ECPA 1Q6YA 1TE2A 4M9QA 2IBMA 2WD8A 3TI7A 3ZV6A 4B3SB 4IIUA 4YP5A 1NLYA 3ZYZA 4DMHA 1E18A 2CDRA 2GKOA 3ND9A 3H86A 3WGOA 2CLSA 3ZXUB 2C5AA 1W5SA 5IFLA 1W581 3BWXA 3BXHA 1UK7A 4NCKA 1P4GA 4L0QA 4Z8XA 4OQZA 4B48A 5BP7A 2LTAA 3VRHA 1M8PA 1X87A 1E4EA 4ZWNA 3HVUA 4FS3A 8ATCA 3GJYA 3F4TA 2JLAA 1E2MA 4N41A 4J0CA 4XGRA 3MWFA 4KEAA 2ZZNA 1QQ6A 2ZRIA 1JFFA 1EBFA 1L7DA 3ZQ4A 4ARUA 1HT1E 4I0WB 3PENA 4B80A 2YHSA 4OV6B 3EVBA 4BLPA 3L7CA 3VKGA 2P0AA 2QVBA 1XJQA 4EK9A 1M72A 1U0RA 4LFBB 2QMHA 4I5EA 2GBPA 5L6MB 4DFDA 2VPPA 2WLTA 4JLKA 1P39A 4Y1EA 1R8QA 4US0R 5A7FA 1PD1A 1ANKA 1IH8A 4F96A 1DT5A 1NBME 4FGZA 2X1HA 3CLRC 1UKZA 3STUA 3A70A 2CF5A 1SQFA 4UM9D 2F3RA 5CDTA 5EHNA 4F3RA 3ECCA 3MN1A 4MAFA 3AR6A 3UVEA 4HYQA 4HRXA 5AK5A 2JFWA 2NZYA 4JI5B 2FRXA 1N77A 1X8XA 2I1QA 3BB1A 5E7MA 3W5IA 2C9DA 4XYBA 3EGDA 1NT4A 3WL7A 2QA5A 3PYLA 4S1OA 4PC3A 4FMCF 3ZHQA 4KPYA 3HWRA 1L4UA 3G9TA 2PFMA 3ORYA 4EMBA 4EB0A 1JEDA 1T5IA 4XWWA 1OFIA 3ETJA 3CB4A 4G4JA 2JAOA 4Y2QA 1Z25A 4GLLA 1L1QA 2CJYA 3OPNA 4JQOA 4TMZA 1Z7WA 2IUEA 2PQ0A 4LDRA 3T0GA 4DQVA 2R1ZA 4YK7A 1NC1A 3FRIA 3F74A 4NZMA 3UHJA 3THXB 1NMEA 2Q49A 3GVCA 1KA9H 2DUNA 3TTSA 1JIJA 1U7UA 3HXOA 2PLNA 3L93A 3Q0IA 4LC0A 4DA0A 1FP6A 1NATA 2AQHA 5JCJA 3MT0A 3OPYI 2HT6A 4XYGA 4EI9A 1MRZA 5FLYA 4NMHA 4Q01A 4HYYA 1DQPA 4YJ3F 4JNKA 1Q95A 2VA8A 3OE1A 3P97A 4WZAB 5F76A 1TK3A 1YONA 4LF7B 1EE2A 1UZLA 3NOOA 3VU3A 1CY4A 5FI1B 5KC8A 3DVRX 3WGNA 2G07A 3AY0A 4S3MA 4E22A 4G5RA 4W8GA 1DJPA 1EP3B 1RZVA 3KAJA 3Q8WA 3VR6H 1JQJC 4JBYA 4I55A 4RJLA 1L1EA 1PFWA 5KWJA 3JWPA 5JNLA 3V8PA 1NMSA 2XNJA 4NCJA 4OGFA 2QP3A 2ZS8A 5FTKA 1BWPA 1Z16A 2CMGA 3MGGA 4AM8A 4UEQA 5I4KA 1ABBA 2BFDA 4DV3B 1H4TA 3O47A 3EQ9A 3I6MA 4E12A 2CB9A 4PX3A 5JMPA 1YB4A 2BGRA 2PT9A 3TQFA 4AWAA 1LVUA 1FMFA 1TM1E 1UOQA 5DLQC 2HTFA 4ED9A 4DARA 1YR7A 5G0VA 1YBVA 2B35A 4E70A 3NXSA 1VE7A 4ZYLA 4NX2A 2EJVA 1NVGA 3OE5A 2Q21A 3OAAA 2GTIA 2FTKE 4OXYA 3JQ7B 1I0AA 4XPIA 2PJDA 3CW2A 2CHUA 4KZKA 5CUQA 1C1DA 3MD9A 3ZDAA 1ILWA 1D9ZA 4ER7A 1GNPA 2ICAA 2SICE 4KJZA 2Z04A 4KUGA 4QAQA 4W63A 1AQJA 3KS9A 1ISSA 2HWKA 1BQ4A 2O9JA 3Q4GA 4K2HA 4RTQA 2AOWA 2ASVA 1NE7A 3CYFA 3F8TA 4HMOA 3RYHB 1R64A 4UHDA 4HNAB 2HQSA 1VLLA 2RHBA 1VKOA 3LXMA 2HA0A 4WCFC 1YTLA 3V8EA 3IKLA 5LL6P 1HR0B 1EUZA 3SKXA 1GDTA 1FFBA 2Q6TA 3K5WA 2C3OA 3IUJA 2OO3A 2G4LA 2IKSA 1QQ5A 2B6HA 3E8SA 3LUCA 2VTBA 1HDCA 1MEEA 3QVWA 2I7CA 5K8UA 1VIVA 3QPWA 3QZUA 1V6AA 1G2PA 3EGCA 3L02A 1BHO1 4JC8A 4KH1A 1T3TA 1ZD1A 4XQ0A 4WDRA 4ZI7F 3GZ4A 1PZMA 3ZVKA 1XLUA 1MVLA 1VCMA 4ZZ0A 5H3HA 4XA8A 4UPEA 1FXWF 1WXIA 1L5KA 4NSLA 2GVZC 3KSMA 3NDPA 4L8LA 1V7ZA 3LUBA 1LS6A 2EARA 2KX7A 4JU8A 4KACA 1EGVB 4G0WA 4KIJA 1VL8A 2R44A 1MG0A 3IEIA 4F1JA 1C9MA 4E13A 5EXPA 3ETEA 5ERGB 4LZNA 3IX7A 5C8YA 5BYAA 4BAGA 1KKLA 1TAHA 2B61A 1KO5A 1YDMA 3OECA 3THWB 5CMLA 2XWBF 1ZK0A 4WOKA 5FPQA 1WMBA 1PV1A 1T3LA 3GLFA 1ODIA 2H9AA 4BJ1A 5CX1B 1QGOA 3PC3A 5KJEA 3QKTA 5A9SB 3L4EA 1M54A 3SYKA 1DKPA 1KMHB 1TRHA 5ALXA 3MXTA 3CVOA 2TECE 4A2WA 1LPMA 2XJ9A 1XC7A 2NO7A 1SVWA 1XDGA 4J4TA 4E6EA 1GNTA 5M7EA 1ZY2A 4UW9A 2IY9A 1VBNA 3CKMA 4C7OA 4H1VA 3UCEA 5BV1A 1NR5A 1O58A 4C7BA 1YZ3A 2H85A 2JLQA 3LWBA 4OKSA 3KSBC 3GT4A 4ZKEA 4LY9A 2Y9MB 2AVDA 5AESA 1BXGB 3E22B 5JAMA 4ARCA 1FPMA 1EP2B 3CZRA 4B3XA 1TK9A 1EH5A 4WKGA 2QP4A 4CM6A 2OCIA 3M83A 4M89A 4OM8A 2PZFA 4HNSA 4U2DA 4D80A 1TUGA 4DA7A 1FTSA 3GPLA 2YQZA 1UMDB 4DF3A 3HBJA 4YT2A 1K4YA 4IBOA 1QB8A 2Q3BA 4IGAA 4C21A 3BGDA 5AVKA 3JQ6A 3IUNA 2FPUA 4RORA 3OFND 4E14A 4QSHA 2TRSB 9ATCA 3ROFA 5EWMA 1BWRA 4IOMA 3E58A 3H65A 1X7XA 3QIAA 1U7TA 4ZI5A 1W5EA 3HJHA 3F96A 3ANTA 1X0XA 2JJ8A 1WEKA 2IOYA 1SEPA 1OXSC 2QAIA 2F62A 1ZCFA 2QL6A 5F2KA 1RNLA 3ONDA 1RRCA 3TB6A 4L73A 4GC9A 3A2LA 5TNXA 1LLUA 1V1JA 2COUA 4YMIA 2JKZA 1UMKA 3VH3A 2I6SA 2O48X 3FMGA 3SBDA 4E5MA 5ITSA 2IU3A 1G0OA 2QV0A 3RQSA 4I8XA 5BQ3A 1US8B 3DAFA 1YUNA 4PHFA 4IF6A 4PPNA 4DWWA 5KDDA 2AKEA 1Q22A 1C0EA 2D1QA 2W2XA 4JEUA 5E7JA 1N9GB 2WDPA 1Y9DA 3TD9A 4J9VA 2QRJA 2VHZA 5EHIA 1MT0A 3SBXA 5B37A 5BSGA 3M6FA 4UU1A 4L02A 4AJKA 3KUCA 3PC2A 4XYEA 3UENA 2B7BA 4J0HA 4DNXA 4EKIA 4BNDA 1WPXA 1HDXA 2AFVA 3JARA 4ZAXA 2X8JA 4D9BA 5IF3A 1IJKA 3WAGA 1J06A 1JEOA 2VJNA 2PVPA 2Q6LA 1AA9A 3T4PA 3ANXA 3RRBA 2W42A 1G2OA 3PTAA 2AWNA 2ESRA 1Z33A 2GGSA 3RVNA 2Q1XA 4UBMA 4TQAA 2NVUB 3UWKA 2CV1A 3OC6A 4KR9A 1RHJA 2GHRA 4L5IA 1SVUA 3QELB 1SUPA 4HTFB 4EHAA 4B6SA 5F7OA 3UPUA 1R5NA 1WD7A 4ZHQA 1OGIA 1BW9B 1HLPA 1K8ZB 1R5JA 1FYEA 2X4IA 1K68A 2XGOA 4R8KA 4R5MA 3LPCA 1PX0A 3LUGA 3V8NA 4PLWA 2OHXA 4ZCIA 3A1CA 2I6FA 3WYGA 1EFAA 3QFSA 2JC3A 4Q4LA 2IYLD 1I10A 2PFSA 1MFPA 3ZK9A 4YJHA 2Z9BA 3U4IA 3N8IA 4G8BA 3NHPA 2O5RA 4KLZA 3EOBI 3BWVA 1E3WA 2JJ1D 2MSKA 3HJAA 3AESA 4JUCA 4PVCA 4ZXFA 3SXJA 3WZ2A 4HDSB 3M6AA 3ADCA 2C4KA 2C7VA 2JD0A 2OO5C 4IQFA 4KFTA 3USCS 3Q41A 1ZBDA 1JEQB 2D2IA 3QPCA 3KXKA 1W0CA 2FPXA 5EPOA 1WCV1 2H5EA 4I6GA 1H42A 3BE6A 3MSXA 3GEEA 4XQEA 5EHZA 1VE5A 2AYYA 1ULSA 3KVRA 2OGTA 2WWIA 1DJQA 2R25B 3NHYA 4LECA 1YJ5A 2EFDB 5YASA 3PGLA 1UT6A 3R9KA 1V4BA 3N53A 2DULA 1UWLA 2FWBA 4FJ2A 4FNMA 1P45A 3BTUA 5DHSA 4CQJA 4RZHA 4H7PA 4OMFG 3IAHA 4LQCA 2VFAA 3QVLA 4EG6A 1WWKA 1GZ3A 3S1AA 2Z6VA 4KSYA 3UMVA 4P08A 2IC5A 4CEHA 3VJRA 4PHTA 2OD9A 3D1VA 1QHYA 3MMNA 3HUFA 1F2TB 2PKWA 1ADFA 2XQFA 2EIXA 2B1GA 1R16A 4RY8A 4W5HA 1IBLB 4LNAA 1Y7PA 2HWYA 1AQNA 4II2A 4KE8A 3V1LA 2FX3A 1CFJA 2A92A 1Z0IA 4GUAA 5F4ZA 1XF1A 3CUKA 3NBAA 4U7TB 1NV9A 4B3CA 1KQ7A 2Z1NA 2M6SA 4MUFA 2NPOA 3MF4A 3EGXB 4DIKA 4R1UA 3QXHA 4MR7B 4WVFA 4KPFC 4EY5A 5KVSA 3WWEA 3PYXA 1H94A 1NF3A 2AOTB 2X0RA 3BD8A 4G5SA 1TM4E 1A04A 3AT1A 3FCSB 3H2JA 3DDWA 3L0DA 4HDRB 4CLOB 3GRYA 5AVRA 2PL1A 5JV5A 3FVQA 1ENZA 3OLCX 1BCRA 3IRUA 4DSAA 5FUMA 2QE6A 5BWBA 1VL5A 1ZESA 2UUOA 3Q88A 5H9WA 1OIXA 3NLLA 2A4KA 1UBSB 2YOGA 4TQGA 2IL1A 4P8RA 2GMWA 3ZJTA 2GN6A 4BMOB 3SSNA 4R01A 3P0JA 2QZJA 1KQNA 3HL4A 1G6KA 4F9FA 5FWAA 4POAA 2CBZA 2E48A 2WVGA 4IV0A 3OCXA 3WGUA 1NVMB 3KPWA 4JQZA 4ND3A 3WR5A 3QXGA 4IFIA 4MR9A 5C0OE 3RVDA 2YVLA 2I71A 4EPRA 2GRAA 4Y2JA 3NO9A 2X15A 4KOAA 4IVRA 3HWX1 1BCRB 1JLKA 2NX2A 5DVZA 1CF4A 1QWOA 1W88A 3PXUA 1A1SA 2BLLA 3H3XA 3RC7A 1N78A 2Q1SA 1JR4A 3VYSB 4FHDA 1P3Y1 1HFEL 1BEZA 3IAFA 3GLGA 5A5GA 3CF2A 2C3PA 4MUJA 1WKBA 2C3UA 5EI5A 4C7XA 3D0RA 4MUHA 5KQGA 2ZCJA 2B2CA 4KWIA 4XQ9A 4U2KA 3SX0A 4C0QC 4M7RA 3RS0A 1ZMBA 1JVNA 3JSXA 1PT5A 3P2KA 5JJ5A 1RSZA 1V2GA 2WPNA 2R6AA 1TJ3A 1K88A 2NP6A 4HGVA 1QLHA 1Z37A 1A88A 2V6IA 4N7MA 3REQA 4CCAA 1E1MA 1TM3E 2UYQA 3NIBA 4BFWA 3QE4A 4EB3A 3H7IA 2GZDA 3MCWA 4Y9DA 2FUEA 3JQ8B 4LBZA 4Z51A 1LBTA 1UEXC 1MKYA 4DM7A 2BEKA 2I2DA 3TXYA 5AKLA 5CYGA 4NTZA 5KSYA 2WTXA 4YO7A 4RF3A 2CZCA 5BMVA 2YZ2A 4OQDA 3B9QA 2D1RA 1GQOA 3OJFA 5E1BA 3L6UA 1FB5A 4MYHA 1GNVA 5FEUA 5IG2A 4QUJA 2JJYA 3U6BA 3MB5A 2O3UA 2CBGA 4N7JA 3QUAA 2ZW9A 4EHHA 3QEAZ 4QYIA 3KAKA 4LWZA 2QJTA 1QK5A 2X3UA 3SQXA 4NFLA 3U44B 4ICIA 5B4UA 4O2BA 2XWSA 3QBPA 3L6OO 4AC9A 4YX9A 3H5LA 2QN1A 5M3BA 3ER9A 4I7EA 3KR9A 5LXTB 4DQKA 5JS1A 3I2FA 1W8DA 5IUKC 2WVHA 2RGDA 2XD4A 3C87A 3JQGA 3I2KA 2QRGA 4X93A 3HCRA 2GFIA 2ECFA 3JZIA 4FHGA 2G88A 1C9JA 4U0KA 4ZHSA 2B1RA 3OPXA 3DOCA 2CEKA 3N05A 4RC9A 1PJCA 3O4RA 5C3UA 1AU9A 1KI6A 1R5BA 3ZHXA 3O9MA 1X92A 7AT1A 4KX3A 3OWHA 1A98A 4IXWA 5EIOA 4G67A 1KY3A 1P6UA 5K6AC 3OZVA 2IWRA 1MB9A 1WEHA 2JIOA 2QB5A 5ALFA 4O4JB 1IJBA 3TAHA 2NZWA 1VSQA 5KJCA 1NW5A 2QN9A 4B6OA 1JJAA 1GDDA 1ODLA 4E15A 1GZ5A 2VYND 3QOWA 3R6WA 3VPBA 3WJAA 2BDEA 1OT5A 1XVUA 4G09A 4K0RA 3S99A 1WZCA 2XSZD 2QD1A 2VZLA 3QF4B 4CM8B 5CDUA 3SICE 4AF7A 1O8CA 4FEAA 2VZEA 2VHJA 5KVAA 1QFXA 4GX5A 3IPXA 6Q21A 4G5HA 2X6TA 1FE8A 1KKUA 1EE9A 1PFGA 4UQOA 1BE1A 4CF6A 3DP9A 4CMKA 1V8FA 1WCIB 1F17A 3KDAA 5HK8A 3ST7A 3MRXA 3DWEX 3IVXA 4H1TA 3LVBA 1IOZA 1IPEA 1K75A 3FIJA 2CJPA 4W9NC 4L15A 2ZFUA 4IZ6A 3F7MA 3ME5A 1LXCA 1X74A 3P0FA 4IDBA 3HSSA 4UAJA 2HQOA 4H7IA 4I9NA 3FIUA 1AHIA 3UPDA 4Y6RA 3OAAD 4XJXA 3IJPA 5J2TB 3KWJA 5JJKA 3OIVA 1QVVA 3AVWA 1UP6A 2OVBA 2BMJA 3DDNA 3ET5A 4R3WA 2DG2A 2DHDA 3C41J 3ZD9A 1JQLB 4YJFB 5AI9A 1UC5B 3W4IA 1ZN2A 1XLWA 1SN7A 3HRKA 3GRZA 2GFHA 2PJUA 2WDZA 4LOKA 4MINA 3FMPB 5LLDA 3IFSA 2B83A 2VO1A 3PT9A 2XUGA 4JI2B 1JFVA 1L6IA 2I4TA 3HN2A 4CMIB 4DV4B 3EIEA 5B1YA 1QDLB 2LD4A 1ZD8A 2CVZA 2ORYA 3HR7A 2VZ9A 2DC1A 2R47A 4YMVA 4JI7B 2I6UA 1A72A 5JUWA 3HBAA 3OI7A 4NG5A 1GV1A 3NHKA 4N47A 1ZL0A 2VJLA 2QY6A 3RBAA 1H2RS 2LCFA 2MT9A 2XDQB 1DIOB 4BLSA 4CKYA 5BNWA 4HAXA 1N2IA 4MVJH 5KKAA 1TO1E 4LHZA 4RCYA 1F5NA 4L4UA 4M0UA 4DWOA 1LDNA 2DKOA 1TYBE 2B3DA 1P7PA 4Z99A 5AVSA 2ON6A 1PS0A 4D9KA 5L4NA 5JSKA 4GX1A 3D3KA 3OH8A 3QY9A 1KVUA 1XMSA 1JW9B 1E9AA 2E5LB 1HFJA 3O2SB 3AV0B 4YP9A 4L6AA 3I37X 2PT5A 3BL5A 2XY4A 4JEHA 1YL7A 4PPYA 3TSCA 5IVPA 3F8SA 1CT9A 4INPA 4DDKA 2HRQA 4BXOB 1UFKA 2GI4A 2I6GA 2MSEB 5K0LA 3ANMA 3KBOA 1GA4A 3RS8A 1YK0A 1V11B 2C4TA 4OQQA 2B4KA 3N74A 1EWVA 1V95A 2F9FA 4LQDA 4ABTA 2OAGA 2Y27A 2HK6A 2VT3A 3JVEA 2FEPA 3EN0A 4XD2A 1ZLYA 3K1YA 4PO3X 3HKBB 4B1FA 2HJWA 4ND4A 5K0BA 4P1ZA 1I01A 3K72B 3MBIA 5FLEX 121PA 4HB4A 2Y2UA 3OU7A 4UEJA 1E98A 4HHEA 3AV3A 4CKWB 2VH5R 3T5AA 3PXGA 1BE6A 2J3EA 3K2IA 4O6VA 4R2HA 5CXUA 1FW6A 1VA4A 4RZ3A 2RH9B 1ZJJA 4MKFA 4WNIA 2A0UA 3BKWA 2ZB4A 1NP3A 1P7CA 2NU9A 4HGOA 4L4RA 5E9AA 2PUGA 2DUWA 4E2ZA 5BWNA 4G0UA 4WZBB 2DFVA 4II3A 5TX7A 1ILEA 4NEQA 3JR7A 1JEEA 1JBQA 5JXIA 2NIPA 2XADA 5DGIA 4Z4QA 3DMPA 1H2AS 2BVNA 3L7DA 3EXHA 3MIZA 5REQA 4XR4A 1OXVA 3GWGA 3H13A 2QQ0A 5BRNA 3IGFA 3RVJA 3DTVA 1GGEA 4ZOCA 5J2UF 2IX3A 2C29D 1JPNA 1B2LA 1N8NA 1MT3A 2DX7A 1DP4A 5FPHA 1YMQA 2JI9A 5DBHX 4DHEA 1E4YA 1TTPB 1XZBA 2W83A 4Q05A 2X0DA 5KHLB 1SG9A 2D74A 2FV8A 1XT6A 2DGDA 2DFLA 3GVHA 4JVOA 3U17A 1FMLA 2BYTA 1Y6FA 2WPDA 3C8ZA 3BWMA 3PQCA 1JHYA 4L6CA 3AXTA 1NN3A 4XCQA 4F0JA 4XLZA 1GLGA 2W6PA 3ELDA 1KC1A 2X9LA 4ZOLA 1VL6A 3JAKB 4C0WA 4BX9A 4ACBA 3C98A 1ISGA 3DF7A 1NLUA 2B5WA 4D79A 3PGA1 4CL0A 1YJQA 3WRWA 1PK9A 3N0XA 3UA4A 1E0SA 1G8AA 1SUAA 5C46F 3MS2A 5F1KA 1JILA 2HV8A 4I55B 5LZ8A 2JL1A 4RESA 3F4SA 4K1LA 4R9SA 4R1QA 1I7DA 1XN1A 2GM5A 4WOJA 1W30A 4KBGA 5IKPA 5IPFA 2QG6A 1FRNA 2XDWA 5IS2A 3DULA 5K3AA 4BNJA 4IDNA 2I76A 2PUBA 3NPAA 4KP7A 1T0JB 5LVAA 2QTGA 1A9XA 1E2PA 2OCBA 5AP9A 3GLQA 3V8QA 2ZUSA 5CGZA 1F8YA 3MWDB 2I78A 1W52X 2QR2A 1UP4A 2J5BA 3CHYA 4MYRA 3ZE8A 5BWMA 1QRDA 1U0FA 3BD9A 3FCUB 3F78A 1UBRS 4K9KA 3CPJB 3DA8A 5GONB 1VKRA 3RARA 3IEUA 2PUDA 4F9TA 1K5GA 1NMQA 4RJJA 2QVZX 2H3HA 5C18A 4M60A 5FPSA 2V6JA 4DMCA 3MCTA 3EIWA 5EE5B 3FPBA 2C00A 2JF0A 4UBJA 3ZV3A 5CA0F 1G5FA 4M46A 4ONEA 5MFZA 4WA7A 2FNAA 1GKIA 4GQAA 4YI3A 3RWMB 4QELA 3A06A 3RS5A 4MTLA 4JXKA 1XTBA 2VXBA 4U6SA 3A14A 4ZVRA 2I80A 3LNTA 1CUJA 4L2IB 3Q7IA 1DQNA 3K31A 1I36A 5E6RA 1XNHA 3M82A 4B43A 3ZZTA 4Y3UA 1C8LA 5HDBB 1DDOA 1YZLA 1N0IA 3SGLA 2ODPA 3CR7A 1CRWG 1RRKA 2FWMX 1XLTC 3CMMA 2QUHA 1BOFA 1YZHA 2H2WA 4O3FA 2V9ZA 4UM7A 4URUR 5FAKA 1PP4A 5ESWA 4US2R 2UAGA 5JVDF 1G21E 3S2IA 2P9QA 2XV1A 3RJ9A 1HLDA 1KAEA 2J67A 3NYIA 4MGEA 1PJAA 4WK2B 6CHYA 2GVDC 1BKYA 1JQBA 4FFDA 1MW8X 3LSTA 1IDOA 3EIFA 4QU0A 1QIEA 1UIMA 4LBWA 5U4QA 5PNTA 4IGEA 2QN3A 2AI1A 3QNMA 4IXNA 5SV2A 3CH6A 3BHIA 2HR1A 1R4MB 3Q9SA 3AKDA 4XFJA 1VPTA 1ULBA 3V9AA 1THMA 2GO7A 3WLPA 3ZTTA 4AIRA 3T5PA 4BGUA 4D0SA 4FCCA 4EG1A 2B25A 3K0HA 3ZG6A 3N2LA 1VGVA 4HBZA 1ZS9A 2VH1A 4HLQB 1BKDR 4NBRA 3WRYA 5BSKA 3AY6A 3IJ5A 1AO3A 3I2GA 2GN4A 2A9KA 3IP5A 4FW9A 4TWBA 4HAIA 5FBQB 4A0QA 1XAGA 4O4JF 2PRYA 4B6PA 5CA1A 5JWRA 2HWUA 4V38A 3F6YA 1M6YA 3PG5A 1NNLA 1YU9A 2H1SA 3G8BA 3ZLVA 4YAWA 3TFQA 4JI8B 4HWSA 2CXOA 2EJBA 4FHZA 3FZGA 4R51A 2XCUA 5J5AA 1D0VA 1KMHA 1LH0A 1ZFNA 4EF5A 2PKQO 3RAGA 4KBYA 3RSLA 4FMCB 4KFCA 5T8KA 4IYJA 3TMYA 3BXGA 4R1MA 1W5TA 4FYJA 1HE1C 2I03A 3UTCA 3AX6A 3HR4A 4IOJA 5ECYA 3D6JA 3FBGA 1M76A 4MS1A 4PBRA 4K2AA 4DR1B 2QK4A 3OT5A 3DM5A 1RPNA 3G5LA 3P27A 4ZCQA 4DIMA 1MEJA 1HORA 3PDJA 4R6XA 5LXTF 5GZ1A 1R1DA 2O3RA 2OC9A 4A91A 3WLFA 1J1UA 3IBYA 2PSJA 4JSRA 4A8JC 2WB2A 2XBMA 3F6RA 1G16A 1MH1A 3ZD7A 1CP2A 2BHTA 3B1ZA 4A8PA 2ZP1A 3IIIA 1N2SA 1YV9A 3D8SA 4N6GA 2OBXA 3A3PA 4B6JA 4CM1A 1N32B 1HYQA 5FORA 3GNLA 1M8KA 1QYDA 1U2PA 1V9CA 2AUNA 1BS1A 4E3ZA 1L5QA 2VYVD 3L7IA 4FMPA 1C41A 3ZDDA 1DC8A 1FDSA 4AO7A 2AMJA 5CFNA 1OX4B 5K6AA 1ISMA 5DXFA 1RPJA 4ODIA 3RVMA 1KI9A 1CJCA 4YCJA 3IEMA 1IVNA 4LC9A 3NBYC 4ZVUA 1S96A 1X8KA 1FK8A 2NUBA 1JDZA 3GD5A 3V2GA 5KX5A 3NNSA 2HA7A 5DV9A 3RAPR 2X5XA 5ES4B 1A8SA 1G8YA 5A2QA 2AI2A 1UWVA 1AKNA 4NF2A 4Q21A 2H7XA 4YY3B 1D2NA 2YFYA 1D0IA 2H51A 4Q1VA 3T1NA 1RJGA 4MK4A 4TTAA 4ML3A 4ZC1A 1P19A 3IV7A 2DQKA 4QUEA 2DLNA 2BFWA 3O38A 3JARB 5CLLA 1YZKA 4CDGA 5TQJA 4XIYA 1XZJA 3EUFA 4PZ0A 4X65B 1XCGB 3LA8A 3TR6A 5KNLA 3HV2A 4HQ0A 3GRAA 3EC1A 2HSDA 3W4JA 3E9RA 3PNQA 3I12A 3SBOA 1RJEA 3BE8A 1DAFA 2Q4BA 3HXTA 5DXJA 2RCYA 1VE3A 1KOLA 4RMJA 1TEHA 10MHA 1XBTA 2AEMA 1CIJA 2G17A 1YQGA 5I8PA 2BM1A 3U60B 2PYDA 1UBUS 3L1HA 3T3EA 2YZ7A 5K0NA 1H05A 5C8XA 1P1BA 1Z28A 1W87A 4UU8A 4WNYA 2ATCA 1VCOA 2WFLB 3ES9A 5ECWA 5GVRA 1E9EA 2J6BA 4A0FA 1N9KA 1ZN7A 2WI8A 2AF4C 5C8DA 1EINA 4Z4GA 3DL7A 2AIRA 1V3VA 3EMKA 3K4PA 4IJWA 1TMYA 1F8FA 4L85A 2V7QA 4MICA 2FRDC 3EULA 3WL8A 1NQVA 1II9A 1O03A 4FYHA 4O2AF 2ZRAA 4KQXA 4YQZA 3RSOA 1GA6A 2QVGA 4IDOA 2B4YA 1FMCA 5DCYA 3U3DA 2Z6AA 2J3QA 3LH5A 2XMQA 1HX7A 4WNCA 3QA9A 3CX7A 2ONKA 4S1VA 1SUSA 2POQX 1L5HA 4CT5A 3OZRA 2P27A 4WEQA 2HSGA 4WKBA 4IICA 5K0FA 5TRTA 1G38A 1MGPA 1ZP6A 4MB6A 1AVTA 3RYHA 1MXHA 1TXGA 4EEXA 2ZWOA 1N2EA 3A05A 3B1VA 2F48A 4LRXA 1LEHA 2GAAA 3N70A 4HNQA 3SFVA 4H1WA 3F9CA 5KYUB 3ZY5A 1NAIA 2ROQA 3D5QA 4R81A 4V1CB 2HPAA 4OK6A 4EUFA 2DM6A 2OV3A 4J0QA 2XZTA 3KQHA 3PX7A 4HBGA 2CT8A 4H7KA 3IDOA 2CWWA 4J8PA 4BKPA 4ZZIA 5IJWA 5LCXA 1W46A 2NYAA 3RWOA 3CUUA 1H5UA 4M1KA 2QBYB 2VRBA 1I5EA 2A14A 2RH5A 2IIQA 3SOZA 1UAAA 4QOJA 2FU5C 1X7HA 4FVTA 5FV4A 5CJPA 3VUEA 5A4IS 1AH2A 5E6SB 3SNKA 3DS8A 1KJIA 1QVWA 4RJ2A 1Y8QA 3ZLBA 1LQ2A 1HOXA 4H15A 2YOHA 3L9WA 2FMXA 2QEQA 3NHMA 1U2GA 4LOLA 4G0OA 2Z4SA 4OYYA 4BQRA 1GQYA 3AVTA 3L7KA 1QH1B 3LGAA 2JGLA 4CLDA 2QSUA 1V96A 3WIVA 5AVQA 2FFRA 3CR3C 2ID7A 4RVDA 4RYLA 7REQB 5EWLB 3P96A 5ELLA 1J1ZA 1RQNA 2W2QA 3R0XA 4PU0A 2Y71A 4EABA 2YBEA 1GR0A 3DXZA 5T5QA 5AVTA 5JSHA 4J0KA 4MZDA 3UY4A 1EUYA 2WAOA 1D6SA 1H23A 2MIIA 1NUTA 1RJDA 2NU7A 2P4EA 2PLAA 4TLBA 1VHTA 2GQ0A 2PRIA 4HNGA 4G97A 3WHKA 3GLFB 3HBMA 3SAJA 3D6UA 2PPLA 3UJ8A 1C0IA 5ICSA 5EPEA 2R85A 1K6JA 4PIVA 1U15A 5KU1A 3GZJA 3TIGA 1Z4PX 3NTQA 5DYTA 3FYUB 3RRYA 5H59A 2JB9A 5ALPA 1Z5ZA 3JD4A 1NSFA 4BB0A 5DK4A 2WAYA 2ZPUA 2J0SA 1R74A 3TV2A 1D8AA 2RG7A 3S4YA 1SJ9A 5U4XA 3NT2A 2G09A 1FFHA 5E6UB 3E61A 3ECSA 1GU1A 2NNWB 3AJEA 4OH1A 3IT1A 5I4BA 2ZXUA 1USVA 3OC0A 4QDZA 5AW5A 2GHIA 2D7DA 2V45A 4KRFA 2R1VA 2HK7A 1GAJA 4HX2A 4TV9B 3A9TA 4O33A 2ZJ3A 3RPEA 1Z88A 5CB0A 1SD2A 5KTPA 1UJ2A 5AI0A 5TDHA 4IIYA 4Q12A 3PDHA 3P9SA 2PRSA 4DTIA 1ZJYA 5CBPA 2K2WA 1YR9A 2ZBDA 4KFRA 5G40A 2HBRA 3GCGA 2C92A 1QKKA 4WPGA 4R31A 1Q20A 2LXNA 2VWGA 3QU2A 3PD7A 2IIVA 4WXPA 2YNMD 3BXEA 4MVYA 5BT8A 3HMKA 4R8RA 5JAPA 4TYPA 1EWKA 4ID3A 1T13A 5K4GA 5ALRA 1KWGA 5IHPA 1EVQA 4YA6A 1IN4A 1NPYA 2H7YA 3BH6A 1FU7A 3FPEA 3L7OA 4LGCA 1FBNA 4EO7A 4AKGA 2CJXA 4J0JA 4DR3B 1KL7A 1ONBA 1VJTA 1W85A 4ZQHA 5FTMA 3OT1B 2W71A 4RYDA 1KRXA 1QORA 5F7JA 4EB8A 2WSYB 4IFBA 1O4WA 2AQKA 2KW5A 1CVLA 1UKBA 2LDBA 4FS8A 1AXRA 1JAZA 3FFTA 4Y0NA 4RS3A 1TX4B 3D4OA 4WXHA 4CI9A 2C1ZA 3I9FA 4ENVA 1HZZC 2CNWA 3MHTA 4K1XA 3MUOA 3MJVA 4HDSA 1P4JA 2XT0A 1G1MA 3EFOB 1W1UA 2IV3A 4MV7A 4N3GA 3WSWA 5K20A 4PSVA 4FIZA 2OE2A 4IDDA 2R6DA 2JJMA 4ARZA 5FHRA 3HWWA 5LIPA 5LXTA 2IPLA 4BQSA 3HADA 4R1PA 1N5IA 1OBHA 4IIDA 3ZE6A 2H1WA 2WJHA 2IBTA 3VHXB 1J99A 1XTPA 4TMWA 4Z7OB 3S2YA 1TW3A 1H4SA 1W93A 3BFKA 1AQ6A 3EG5A 4H0CA 1MAHA 3QKIA 3N8KA 4HWRA 4PG8A 3GBPA 3ENZA 1A50B 5NLLA 6YASA 2YN0A 1Z3CA 3N7UA 2C4NA 1ZZGA 1GGMA 1KZYC 2I54A 4KTVE 5MGNA 4A82A 1OASA 1HG1A 3RD5A 2R6CA 4P4SB 4AUNA 4AF6A 3TH5A 4XKJA 3EFOA 5IX8A 2DFKB 4QGHA 2Q5EA 4UQPA 1EWQA 4F4FA 1N7IA 3EEBA 3ZCSA 1II8A 4ZHQB 1HDYA 2HZ7A 1RC1A 2QN7A 1XL0A 4HDNB 4FFPA 4WUVA 5J1SB 4FCTA 1OFVA 2XWJI 3SJZA 1P61B 2XA9A 2R7KA 1RRMA 4MMXB 5IBCA 1H6DA 2H57A 3TLGA 2J9XB 1Y3IA 2QOEA 3PFIA 3ZH9B 4QSMA 2BLNA 3DONA 1W0JA 1FZQA 4HAYA 3EGXA 3B12A 1UDAA 3A4YA 1EVJA 4CFZA 1L3BA 2QTRA 4XGQA 4PC7A 3HC7A 2XQIA 3LW8A 2EGUA 2P2YA 2GEUA 1VSBA 1I4TD 5DN9A 1DWOA 3B8HA 5B55A 8ADHA 2J7KA 2CDBA 3UMYA 4K8OA 1YS6A 2HC9A 2F1HA 2LCIA 2Q9UA 3SDZA 2B30A 1J8MF 1NVXQ 1ZEJA 1N3YA 2VK2A 3GFRA 3PXDA 4XWOA 3AUKA 3CRW1 3ZHVA 1F38A 1SM4A 4DM3A 1WPQA 2HU2A 2NG1A 3OG9A 4PXAA 3R77A 2C98A 1E2LA 3KNZA 3FSJX 4YMHA 2ZSFA 2PWPA 3SVTA 4Q1AA 4DB2A 2H7CA 5ICMA 3OBBA 3TOZA 4UVDA 3NHBA 1XRQA 1TM2A 2IIBA 1RLIA 1ZOIA 4FGJA 3VMFA 2CCJA 3C16C 5D5QA 3PNPA 4AT1A 1J7KA 1OHHA 3D5TA 3UJHA 3W7BA 1S3FA 2DCMA 2X2OA 4L9AA 4U7GA 2ZBRA 4D9EA 4DLVA 5K05A 5KYKA 2JHCA 2BEUB 2X7JA 3M4XA 1BXKA 1CYEA 1ZHHA 1N1GA 4DQDA 1X1BA 3SHTA 1DL5A 2XUAA 4Q3BA 4RETA 3ZX5A 4YR9A 2UXCB 4L28A 1U2EA 3J7AC 4BRZA 1B6SA 5GM1A 4ZYVA 4DCVA 1T1JA 3H5RA 4IY1A 4F2HA 1G7CA 1NT2A 5L40A 2JD1A 5JAQA 4MB0A 3CLTC 1JE1A 3V4LA 1PN3A 3BS4A 1IUOA 1QNLA 1X14A 2O8EB 3GEMA 4BZWA 3L4JA 5IDYA 4NJMA 2GUGA 3HGTA 1DJOA 2PX4A 5B7NA 1VG9B 1MC5A 3P9PA 4V1CI 1KMQA 1P6XA 3DLCA 4LDQA 3JQDA 4Q4AA 3AL2A 1WB6A 4RIHA 5DULA 4ZVNA 2NMVA 3K70B 2YUIA 3QX8A 4RBNA 1GQQA 3KJEA 4M1TA 1I51A 2WJZB 5EP4A 3WLKX 1QHIA 1YB5A 2G0TA 1AV7A 1UKVY 2RHJA 1UK9A 2XQVA 3Q5EA 2HTEA 5JH7B 3K8OE 4ITRC 1JN0A 4X41A 5KNCA 1NP7A 1TKCA 3S81A 1C9KA 2FF5A 2Q62A 1E64A 4MKHA 4OHBA 4Y2VA 1A9ZA 1V11A 3DL4A 1YE5A 3KJGA 5EL0A 1CJUC 4BFSA 4BUZA 1CUGA 4ZJZA 4LQLA 3AGPA 2UUCB 1Z5GA 4O8ZA 1CUYA 3ROPA 5IJZA 2W0MA 3CCCA 1QGYA 4GOLD 4KGVA 4TWJA 4YNBA 1L1RA 4NNOA 3N2KB 3SZOA 5AJTA 4JLJA 4BDSA 4F6RB 5JSFA 5L51A 2VF2A 5IF9A 1QQTA 1N2XA 1L0BA 4B79A 3K6SB 1U9YA 2MMGA 4LJ6A 3AF2A 3EUAA 1AY0A 5CW2A 1JBKA 2C84A 3VO9A 3W9BA 4EAAA 4RULA 2A5GA 4NEHB 1UJ6A 3DDHA 4IXMA 2GK4A 1EM6A 4QTTB 1IN6A 1JH9A 2WNIA 3LYLA 3V1KA 3I1YA 2DWPA 4M0EA 2WD7A 3I04M 3AZOA 4PIPA 3SYLA 4CMIA 2QX7A 1FY2A 2DSTA 1U99A 2WSMA 2GYUA 5H4GA 1R8SA 3ASUA 5DI3B 4ZZ3A 1L7OA 3KWLA 1H93A 4N4AA 1NIJA 3EWIA 1ZD9A 8AT1A 3KV3O 4EEKA 4RY2A 1EIWA 3CLUD 2F4NA 1IZ7A 2YQ5A 1ZITA 3TBFA 2I34A 2ZIGA 2X9NA 4NPHA 4QYXA 3K6RA 1ECCA 3ZR4B 4NH0A 4BX3A 1Z5PA 4OOFA 1S02A 1NG9A 1Y3AA 4IH1A 4LG1A 3TQCA 1U7XA 3IH5A 4EDFA 4L8FA 1GUBA 3H2KA 1XVIA 1L1FA 4NZ9A 2Z9CA 4NU0A 3WRXC 4N8EA 2IS2A 1CUCA 3ECAA 5G1PA 3WX0A 3AOGA 3HN7A 3KLNA 2IYQA 4NS4A 4KMOA 2CLHB 2YXBA 4DM4A 2R4UA 2YZMA 5KQMA 1KERA 3O9ZA 1GUYA 1T9ZA 1RYDA 2P9CA 3NCTA 2HHCA 2ZB7A 1MORA 4GPIB 1P9WA 3W05A 2HMTA 1AB5A 3LWDA 2P11A 2D7CA 1N2JA 4GPTA 2WTUA 1MBZA 1M0TA 1C4KA 1MMFB 5JBIA 4QE3A 3KRTA 2VNJA 2AFHE 3H0KA 3IO5A 5EJGA 3ZCXA 3I6BA 2NO0A 1XVAA 4F4DA 2QN6A 4R7TA 2QL7A 1OFUA 2PGLA 3AM3A 4J94A 2BDUA 3PNYA 2JA1A 1CNEA 3VPGA 3DMGA 4HQRA 3WQRA 2FW9A 4LJSA 2PQ2A 3NJ8A 1LGYA 3UB3A 3ZCPA 4AMYA 4NCBA 3PI7A 1R18A 3LQFA 2B21A 2WWXA 1N5LA 3GROA 2NTEA 3N07A 1Z74A 2CHEA 2R8ZA 1USUA 5LQDA 2RAFA 2QT9A 3B3QA 4UZFA 4ARSA 1HDEA 3DB1A 1KVRA 2Y2VA 1NKSA 1FP4B 1Y8RA 1I7PA 1XTUA 2EZ8A 3K05A 4FN5A 4QX6A 4UCWA 5GONA 3ZWBA 4CKCA 2ACEA 4F8JA 3MELA 3CCFA 5AK6A 1NUHA 4B7UA 1AHHA 3BZWA 3FPJA 4MX2A 3ZLUA 5CFQA 1V4VA 5B7QA 5BN5A 3SM3A 4C2UA 5J43A 3LS2A 1C30B 1X1DA 5GV7A 5JALA 1AK9A 2JW5A 1KQOA 2FEWB 2X76A 4Q9JA 3ELWA 3RT9A 3WGVA 1T0IA 1EFPA 4EKNB 4M6WA 2HGZA 2XNKA 4JI1B 3O3MB 5T3YA 1F0YA 2FW8A 3CU5A 2GHTA 3EG9A 1D2MA 4I9GA 3V1UA 5ICCA 3SYRA 2O3TA 3B7WA 4BEWA 5CM8B 5LU9A 1BGVA 5DT9A 4F4IA 2NZJA 1FP2A 1GQRA 1RRFA 2C0QA 2F1KA 2QRVA 3BX1A 5CDSA 4YRRA 3HPQA 4L5CA 4URVR 4PTYA 4DDTA 4FFBB 1PQ4A 1B0ZA 2E5FA 1EJ6A 4FE4A 1I2DA 3QQ5A 4ZK2A 1QF7A 4MAMA 1XDSA 2QRNA 5I7RA 2DPLA 3GGJA 3M6MD 4GR9A 3IYLW 3EPPA 4BGEA 5JSYA 4KQHA 4BHTA 2I91A 1I3LA 2NPFA