4L57A

High resolutin structure of human cytosolic 5'(3')-deoxyribonucleotidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
SVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, cytosolic type
publication title Structures of human cytosolic and mitochondrial nucleotidases: implications for structure-based design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4l57A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4l57A01
1JUDA 3ZX5A 1TJ4A 3SKXA 4UW9A 3SF0A 5ALVA 3TLMA 3WKDA 1ZD5A 4YCLA 3I1YA 1VJRA 4EENA 2YBDA 5AW0A 2DQSA 2P11A 3IB6A 2FPXA 3ZVLA 3FVVA 1U7OA 1ZD2P 3ESRA 3U7HB 5ALNA 1Z4OA 2R8ZA 3NRJA 1RLOA 1QQ7A 3OCWA 4FYPA 3KD3A 5ALUA 2MSNA 1NF2A 3OTQA 5ALQA 5AW5A 3QXGA 5AK4A 1Z4PX 2QYHA 5AKKA 3L8FA 2GHTA 3WKCA 2IOFK 3ZTYA 3FPBA 2WF5A 5ALTA 1Z4IA 2HCFA 4E88A 2G06A 5ALYA 5AVRA 3DDHA 4KN8A 3KBBA 3L0YA 2BDUA 5AVSA 3AR2A 2I33A 3R09A 4QQFA 4CF5A 3W5DA 3KZXA 1ZRMA 2YMMA 5AK6A 2GHQA 3QGMA 1ZD3A 2FPWA 4XPZA 3U26A 3QUQA 4YIHA 2ZBEA 3E81A 3QUBA 1TJ3A 5AK3A 1X42A 4I9GA 5ALZA 3WK6A 4CE6A 4FE3A 2HF2A 3NASA 3AR6A 2G80A 3L7YA 1J8DA 3N5KA 2HI0A 1Y8AA 2HO4A 1QQ6A 3NIWA 2P9JA 1CQZA 3OCZA 2I7DA 5AI0A 3ZX4A 3SHQA 4ZEXA 4NV0A 2WF6A 5ALIA 4BYGA 5AVWA 2CFSA 1Z4LA 5AIBA 2NO5A 3I28A 3PCTA 2ZBGA 4QJBA 5AI4A 2ODAA 4ZEVA 3DV9A 2I34A 4OD0A 1Q92A 3WGVA 4GIBA 1S2OA 3N8GA 3QLEA 4BEVA 1L7PA 3J7TA 3QU5A 4IG4A 4NAVA 1RLMA 1RMYA 1ZJJA 2FPUA 3MC1A 1YDFA 5A3RA 4HAIA 1F5SA 4J2TA 3ZTWA 1O03A 2B30A 2IOHA 2FUEA 3WK7A 3L8EA 2JGAA 4Y2PA 5AVQA 1Z4QA 4RETA 5AW6A 1L8OA 5ALRA 4HYTA 2B8EA 2WFAA 4Y2YA 5AIAA 2EARA 4JB3A 1VFPA 1ZRNA 3ZW7A 5ALWA 4YCMA 2GO7A 4OCZA 2C9MA 5AVYA 3U7EB 1N8NA 3CNHA 2HX1A 5AKXA 2VKQA 3AR5A 5AI6A 2AGVA 3L1VA 2WF9A 5ALPA 2JAUA 2WM8A 4EEKA 4EX7A 2O2XA 4Y2VA 4UM5A 1RKUA 4UMVA 2B0CA 2C4NA 2PR7A 2HEGA 2GFHA 1RDFA 2YMPA 3B8EA 1U2SA 5E0OA 3ZVMA 2HHLA 3S6JA 5AW3A 3ED5A 2B1QA 3U13A 3OCUA 5ALFA 1S8OA 3QNMA 4NABA 4Y3UA 1SU4A 4B6JA 4MWOA 2JAOA 5ALKA 4EELA 2RAVA 5AKHA 4L6AA 2G07A 3EF1A 5AESA 5AI8A 4F71A 2ZXEA 1U7PA 3E8MA 4F72A 1MH9A 5AVVA 2RARA 3NALA 2ZOSA 4ZEWA 2HF7A 4HGNA 3QU9A 1RMQA 3F9RA 5AICA 1Z88A 1Z4MA 2EAUA 4UMEA 4YCNA 3A1DA 2D2VA 2Q4TA 3QUCA 1YMQA 2G1AA 2NYVA 3DAOA 3U7FB 4BX0A 3AR4A 1KYTA 2WHEA 3N1UA 2IA5A 5T41A 5AW9A 2R8EA 1WZCA 1L7MA 2YJ3A 2YJ5A 1L7NA 3OCXA 1RLTA 4AS2A 3FM9A 2GMWA 1ZOLA 4FFDA 5AVUA 2R8YA 2FUCA 3KOOA 1IWOA 1RQNA 3OCVA 5FP0A 2ZBFA 3L1UA 2WF7A 4UM7A 2FPRA 2YY6A 2JAWA 3K1ZA 3P96A 1YNSA 5AW1A 3M9LA 3ZUPA 5IS2A 1NRWA 4Y2RA 3L0BA 5ALGA 3B9BA 2RBKA 5IT4A 3HYCA 3OCYA 3NAMA 2W43A 2AH5A 3SKYA 4XOUA 3L8GA 4YGYA 2O9JA 1Z4JA 3SLRA 4JDPA 1XP5A 3IJ5A 1YJ5A 1NNLA 3WKEA 2BY4A 5ALOA 3W5BA 1J97A 2G08A 4KYTA 4BEWA 3UMBA 2I6XA 3I76A 4H1WA 5AKYA 1RQLA 3N28A 4O8CA 4UU1A 3ESQA 3A3YA 5AI9A 4HGRA 5AVZA 3W5AA 5AW2A 1PW5A 4DWOA 4L6CA 3D6JA 2YMQA 2G09A 3QX7A 4KX3A 3NANA 1K1EA 1RKVA 2CN1A 2R8XA 1XVIA 3U19A 5AW8A 5ALMA 3RFUA 4CF4A 2I55A 5AHXA 5AVTA 1VJ5A 3EF0A 1L6RA 3RF6A 4BNDB 4G9BA 1WR8A 4KX5A 5A3SA 3WKAA 3DNPA 2C88A 1YS9A 1WVIA 3PGVA 4BKMA 1Z4NA 2BDEA 4UAVA 1TJ5A 2AMYA 2HOQA 4BX3A 5AM3A 4NFLA 1LVHA 2P27A 3MPOA 1RMTA 3BA6A 4UATA 1N9KA 5AM1A 5AKJA 2FI1A 2YJ4A 3EPRA 1FEZA 2W4MA 5AM4A 2Q4RA 4Y2JA 3QU4A 5AK5A 3WK9A 3W5CA 2B8JA 2I54A 1Z5UA 3AR3A 1AQ6A 3BWVA 2IOFA 5AKEA 4HGPA 3UM9A 2AUTA 1YV9A 3ZI4A 2FDRA 3MN1A 5AI5A 3FGOA 2W11A 3WKBA 2CFTA 2HSZA 5ALLA 3PGLA 2MU1A 2PKEA 4BNDA 2C8KA 2YFYA 5AM0A 5AKZA 4I9FA 1RKQA 3QUTA 4NWIA 3QU7A 1QYIA 4AP9A 4AS3A 3OPXA 3L0CA 3ZWKA 4UMDA 3HLTA 4OHFA 2B1RA 1Q91A 3E58A 3SD7A 4YH1A 5AKGA 2HDOA 4UASA 1Z4KA 2JARA 2EATA 3ET5A 5ALSA 1QQ5A 4BBJA 4RESA 2CFRA 4KNWA 1T9ZA 2WF8A 1Z5GA 1RC8A 5ALJA 2PQ0A 2OM6A 2B82A 3R9KA 4J03A 1U2TA 3U7GA 2Q5EA 4IFTA 2FPSA 2ZBDA 2YJ6A 2QLTA 1U02A 3FZQA 5AW4A 1TA0A 2YMLA 5AKLA 1RRCA 5AM5A 1QH9A 4HGOA 1EK2A 3M1YA 3ZU6A 4CF3A 2C8LA 4Y2TA 1T5TA 4EX6A 1ZD4A 3L8HA 4GXTA 3KC2A 4Y2UA 4HGQA 4UMFA 5AM2A 3PDWA 5AW7A 4YIKA 4Y2XA 3A1CA 3EWIA 1EK1A 3QYPA 5A3QA 4Y2QA 4UAUA 3UMCA 5JJBA 2P69A 4UARA 3QU2A 3AR9A 1WPGA 2IYEA 3AR7A 5ALXA 3ZWDA 3NUQA 3GYGA 2RB5A 4UU0A 2OBBA 2ZG6A 3A1EA 2YN4A 1TE2A 4DCCA 1L7OA 1RPZA 2G0AA 3R4CA 5IT0A 5ALDA 2NO4A 3E84A 2OYCA 3VAYA 4C4TA 1ZS9A 3WK4A 3WK8A 4CNQA 2X4DA 3ONNA 4DW8A 3IRUA 3WK5A 3SMVA 4L57A 3AR8A 4XQ0A 3B9RA 5ALEA 1LTQA 1SWWA 4PNHA 4C4SA 4EZEA 3ET4A 4DFDA 4OFZA 4G63A 5ALHA 4C4RA 1XPJA 3UMGA 4MUMA 3ZVNA 3N07A 2OA0A 5AKIA 1SWVA 3FPSA 3I6BA 1CR6A 2FEAA 1L8LA 1O08A 3CZ4A 4KNVA 4Y2SA 4BX2A 3L5KA 3KDPA 5AVXA 3MMZA 4XE5A 3WGUA 1T5SA
chains in the Genus database with same CATH superfamily
4YBZA 2IV2X 3P9SA 2ZCUA 4QZVA 4WESB 5KC8A 1PFUA 2GM9A 2GZMA 1DBRA 3TE6A 4B74A 3TVYA 1Y4AE 2YW9A 2PMWB 2ZITA 3MB5A 3EVFA 4R0VA 1RQ7A 1MBZA 1VJRA 2HADA 2GRJA 2H7CA 2YRXA 3GQBA 1E1RA 4ZREA 3MRVA 4B81A 1JAIA 4PC2A 1CRLA 1ZYUA 1SQGA 4I4CA 2CXRA 1JVSA 2MWMA 1TMKA 4QTZA 4XTCS 1Z4OA 3VU9B 1M5RA 4DB4A 2WLTA 4J3JA 4JLNA 3WA6A 3E22B 4YMVA 3KD3A 4FFRA 1DCNA 2FQQA 5BPFA 1SCKA 5B53A 4CKXA 4QNMA 2QL7A 2O0LA 3H2BA 3QXGA 1RPJA 2QE7D 3RYHB 1OWLA 2BLLA 5JWOA 1SPBS 1Q77A 1NWHA 4ETIA 3W34A 1KP3A 2GHTA 4HUQA 3P5SA 1M2WA 2EJBA 4KJXA 5JMPA 1GPBA 1E9FA 1JYSA 2VIIA 3ND6A 4HDMB 3RQIA 3IKJA 5EGNA 1SVIA 3IP9A 5JMOA 3VHLB 2AMJA 1P45A 1RNLA 2HMWA 2ZIXA 4NF2A 2ESRA 2Y0PA 5PNTA 4PGAA 1J0DA 1TVMA 2PZ8A 2ZWMA 3Q3EA 4FUQA 2VUTA 2ZQZA 2JFFA 5CT6A 4ETNA 4JLKA 3CXUA 1GKKA 1VJCA 3QFCA 3BXEA 5KI6A 5B4UA 3KZXA 3D3NA 1WCYA 3UY4A 2F64A 4H7FA 2P3SA 1NTRA 4KXFB 4UAJA 4A0SA 3CJTA 2GESA 1MD9A 1XEFA 2YICA 3PDUA 3OZTA 3PDIA 5GTDA 2ZDHA 1LSSA 5GINE 1RXYA 2FPLA 2B20A 3QTBA 3B51X 1XALA 3EDMA 1C9KA 3O26A 4GSYA 4II7A 1T8YA 4BVJA 3DZKA 5JWHA 1UC5B 1X8KA 5AUPB 4I9GA 5GVRA 2IDZA 3X2FA 4DRXA 4LXXA 4MNTA 4GS5A 1NMYA 4CCYA 4Z3DA 1KGDA 2XADA 4CM7A 3RVLA 4DBLC 1W36B 4ILEA 4OREX 4JT8A 2PUFA 3FWHA 2EQAA 3UJ9A 2NO6A 1NN0A 3OWHA 1HYQA 1VE5A 4K9KA 4EOGA 4MW7A 5C8ZA 1SCNE 4A91A 3ZX4A 2D0IA 3ZJYA 4BP3A 1RHJA 3FBTA 4O25A 4DIKA 2IODA 4FDLA 5SZKB 1P7ZA 2SKEA 3U0VA 4ZT4A 5MHTA 2CK3A 4WE3A 5KX5B 1LRLA 2NZYA 1P19A 4JV5B 2CWWA 4YPFA 3CEAA 3R7DA 1Q6YA 3IERA 2VTKA 5AR1A 1Q92A 3EHEA 1XKTA 2AJCA 1A5AB 1RYEA 2DCMA 1X6VA 4BQIA 1E2DA 3JALA 1IEWA 2YXDA 2Z5LA 2VDJA 3Q7QA 4D4LA 4DY6A 1E4OA 2YYSA 1TCUA 2DFPA 4G8CA 1QK4A 2ZJ7A 3GJ3A 4TRNA 4CM9D 1OY1A 2WWRA 1JI3A 2FMKA 4LOLA 1QYWA 2HLNA 5FL7A 3WE7A 2ACVA 3WLQA 5IXSA 1KH1A 2PXAA 4JLSA 4BAUA 4OGWA 5K8LA 1QHIA 4HMPA 2RK6A 2ETXA 1PEYA 4TZKA 3CG0A 3VPBA 1H1DA 3RBZA 2WKPA 1HA3A 1WY7A 3UK7A 5DM1A 4MI6A 3TRKA 1CF9A 5F35A 3F4RA 3CLRC 1WVGA 2GNAA 1OASA 1JIQA 2GARA 3ABIA 5G0TA 5KYXA 2ECOA 2HXSA 3ZZNA 4TQAA 3ICQB 2WA2A 4IH4A 3VBCA 2QGFA 4INPA 1X1EA 4OCZA 1VE3A 3I0MA 3KX2A 5AVYA 2EWMA 1EWKA 5I9TA 4E5YA 2O4UX 3TIXB 5J23A 3GJXC 1WSBA 4MVJF 2H4FA 1YJXA 2C58A 1X7HA 2C9CA 4A0FA 4C7XA 2QTTA 3FYUC 1DKMA 5ALPA 5TGDA 3WLOA 4D4MA 3FNGA 4RS3A 5K0NA 4YXWA 1BDBA 2O2XA 3RWOA 1OPXA 2IPNA 3UPUA 1VBFA 2PXHA 2VDOB 2J0SA 4NYIQ 4GBED 1VLJA 3N8KA 3WLSA 2HUNA 1ZMBA 4P3PA 4IAOA 4UZEA 4BNJA 4CDNA 3ZVMA 1TNDA 3LVFO 5ES3A 1F2UB 1PL6A 3TZCA 3ILYA 3IR6A 4CMIB 4DANA 5BQXA 3T5AA 4HEHA 1QR2A 4GYKA 4WZBA 2WABA 1NSYA 1G19A 3FUCA 4EMBA 1T4CB 2QUIA 1HTBA 3D7SA 4FI3F 1M0TA 2ZU0C 2F55A 1CVIA 3KJFA 4XWYA 4DARA 3TFOA 3BD8A 2HB6A 1VCNA 4X92A 3SHOA 5BRNA 2ABWA 2QROA 1GXSB 2AYZA 2KYRA 3LUKA 5AVVA 4QLAA 3O5AA 3EVZA 3HCDA 1Q1BA 4UTXA 1WCIA 3EGDB 4Q18A 1XVLA 2HF7A 5LP6F 3UGJA 5HIIA 1RMQA 2NW6A 4FMCB 4J3NA 3KYJB 2V96A 1VKJA 2CL0X 1EWTA 3BK2A 4BX9A 3JPYA 5AHOA 3B5EA 4LF8B 1SAYA 4P92A 5CIWA 4N6OA 1S9DA 3NDPA 4QNRA 3TCXB 3L49A 3PQ2A 4IQGA 1DO0A 1R12A 2QAGA 1II9A 1JP7A 4P4LA 4TL6A 1ZDMA 4Y0VA 3IBFA 1SIBE 1PG2A 3TKAA 3QBTA 1B2LA 2G9UA 2DR0A 3PNLA 1T6YA 3MHTA 1OZGA 3G2HA 4P4TA 2O7VA 2YJ5A 4FFBB 3A37A 1DRWA 2IF2A 3DEAA 3KQQA 1Z6YA 1XLWA 4Z0TA 3SICE 2AG6A 5LD2B 3OVMA 4MS4A 5DRYA 3AOEC 3NP9A 1Z3CA 1VL5A 2QR5A 3BMNB 3KFVA 3OX3A 3R3ZA 2IPMA 4FP9A 4IL5A 5EMKA 1LI4A 2QLFA 2VNSA 1OT3A 2GDJA 4ILKA 3SBDA 3V46A 3W5UA 3CS3A 3K71B 3D02A 1HC7A 2D3TA 4IPTA 4OLHA 2PJZA 5A5GA 4PHFA 4CHTA 3EXHB 5CT8A 1GEGA 3DQQA 5IFKA 2FPRA 4AO6A 4HCJA 3LP5A 3K1ZA 1AKUA 4HB0A 1E4VA 4IIXA 2DWQA 5IVKA 2ZRAA 2XHZA 1XHFA 3BRQA 4GVXA 4AUNA 3YASA 2X41A 3DWFA 1E5QA 1KZGB 3NWJA 3ZHCA 2FFBA 4N5LA 3ZDRA 4BP1A 1Q5PA 1RWWA 4A2WA 2CJPA 4C43A 1QP8A 2A78A 3HYCA 2PR2A 3PXBA 4UBLA 2AFRA 3VC1A 1LY1A 2Q4EA 2AH5A 1KRWA 4QRIA 4FYVA 3SKYA 1ZRHA 3VZPA 2R7NA 2RHDA 2X4LA 1IUPA 4X6LA 4M37A 4PLHA 1U6IA 2C0CA 4P3NA 1FURA 1B41A 2VO1A 121PA 4IIVA 4J9VA 1T1RA 3AUAA 4U6SA 3CNNA 4QX6A 5LP1A 2HIAA 2PTHA 5B1YA 4BKQA 4RGBA 4WFKA 3LO8A 2YIVX 2Q0QA 2H6EA 3KJZA 1KU0A 4C78A 4ZAYA 2C00A 1PL0A 2E4VA 4KLAA 5H3HA 2VBGA 1A5ZA 2VL7A 4NK5A 1JG2A 2AJDA 3EQ7A 2VZ8A 4LJKA 4EG7A 3U3MA 1YULA 2NUTB 4O8CA 4XR4A 4UU1A 3EFOB 4UEQA 3EW7A 4GM0A 4DAOA 5C8YF 3I9FA 1GNTA 3SF8A 1GOTA 4H60A 1O94C 3VR4A 3W9SA 1ML4A 1YB2A 5COBA 1NWCA 1ID8A 4OGFA 1I4LD 4UPDA 4JI4B 2YMQA 1BMTA 2W6NA 4TWZA 4N4AA 2TMDA 4QO7A 5EXPA 2OBYA 4HWKA 3GLKA 3OTGA 3RFFA 2VDQB 1K1EA 1TK9A 4BVKA 4YRKA 3K0AB 1UEXC 2BFCA 2WG2A 3ILXA 1FS5A 2DCUA 1P2TA 4KYVA 3GBSA 4JT9A 1NNSA 2XVZA 1Y3AA 1UT6A 2FMHA 1ZVKA 4IXTA 3OZBA 3VPCA 3EPKA 4BASA 1QPZA 2CV1A 1HKUA 3FR7A 1WP9A 1XELA 2OUIA 2ZWPA 4PGFA 4FJ2A 2IBTA 3IMEA 3S2FA 1B26A 5C5CA 5J63A 2YZMA 1BA2A 2P9QA 4CMGA 2WSIA 4D92A 5EZ5A 3V8PA 2IY8A 4JLWA 3BJZA 3AUSA 1JDNA 4L4YA 2IKQA 5KDDA 2AMYA 1Y34E 3HO6A 3CUYA 3QENA 3VPGA 5A1TA 3PWSA 3ICCA 4NOLA 5EJ9A 4LJRA 1TZJA 3NEPX 3HEBA 4GU5A 4NMHA 3DVRX 3MGAA 1U7XA 4M9ZA 5JMTA 4WEQA 3ZZ1A 1XZDA 2WNIA 1PJ3A 1GGKA 3LGXA 1T91A 4R9RA 3W06A 2ZP1A 1DCFA 4FIZA 5FTMA 1N7IA 4INOA 3ZKWA 3ORYA 3I5YA 2HUPA 1UZUA 3MQ2A 3LAWA 4BV9A 3A9UA 3BAFA 3JD1A 4RTSA 1JB1A 3IPXA 1Z5ZA 3EGXB 4OLFA 2R47A 2VHJA 4URUR 4XQCA 1I13A 1BWPA 2OBLA 2PG3A 4LRQA 4ZGGA 3C15C 3W2TA 1Y5RA 1U2PA 2VYNA 1EA5A 3TW8B 5K3SA 3WYBA 4NMWA 1JL3A 4MCAA 4OBBA 3C7KA 3IUSA 2IV7A 1AQYA 4YRRA 1AD2A 5BNWA 4EVSA 2ODEA 3OPXA 5KB3A 2ID7A 3RW9A 4DVJA 3OJXA 5K09A 4TN5A 3EXFB 2R8OA 3HLTA 3DONA 3JWHA 1ZZEA 2XKKA 3F6PA 3HJTA 1X39A 3O8OA 1K8YB 3WDSA 2A0XA 2PMCA 1EFCA 1WW3A 3QVLA 4RJJA 3K35A 4C9BA 4KBFA 5FTLA 2PUAA 3L46A 4OSOA 3VPXA 1Q6ZA 1OKKA 2HDOA 3W6UA 3L93A 4PYIA 1DXQA 4IIBA 1XZKA 4MCIA 3R41A 4Q05A 3LT2A 4A03A 4ARZA 3LZCA 1DOFA 1OIVA 1ZSNA 3OZ7A 3JQDA 4R2JA 5BMVB 4V1CB 2AD5A 4B3CA 1ONPA 3IAM1 4HRAA 3C4VA 1G5PA 3SEQA 3BKWA 3SM3A 3HSYA 1Y3IA 2O1WA 3O03A 3GN1A 4JEIA 1FTSA 5EWMB 5LYJF 1K8ZB 3HB5X 2XUGA 3I9LA 1J8QA 2JATA 5JJKA 2QJWA 1P5RA 1KI7A 4GYWA 3EAFA 4MQ4A 3ZTTA 4UPEA 4D1YA 2HXYA 1KMCA 4KQIA 1SCJA 5I4BA 1MIOA 1N5KA 4QUIA 3AU8A 1Y7LA 3GB9A 2NZ2A 1UBGA 4RA6A 2AG1A 3RSGA 1GTJ1 4QGBA 1SBIA 3KEQA 4PIVA 1V5GA 4IHJA 2E82A 4CF3A 3RSLA 3B5JA 1DDOA 4LBZA 4AKHA 3KJXA 2O8BB 4C6SA 1Z0SA 4XM2A 4D9IA 3AJRA 2WUGA 3T3GA 2PXCA 4W1PA 5AW7A 2GYUA 1F06A 4PQGA 1Z35A 1VGQA 1W0JA 4UKDA 1DAMA 1Q0PA 1QOZA 2BIFA 2XUFA 3EWIA 4OHKA 2V7QD 1E1YA 1SKYB 2C97A 3UMCA 3NNSA 3TTXA 3GMSA 2VHVA 3E1SA 4JB2A 1DWOA 3AF4A 2R68A 4MPTA 1W5BA 1YL5A 4D4GA 4D0LB 3SC2B 1YAJA 4PZ0A 4YK7A 4D3FA 4GGPA 5C2JB 1FMLA 3SZRA 3ZWDA 2X40A 3OOEA 3QV2A 3IQXA 4LKOA 1XYYA 5ITZA 1AKQA 2J5RA 3N05A 1CQPA 5BUZA 4TS1A 1PYGA 2AE2A 5DNAA 4NJEB 1KXZA 2YOFA 1FFEA 2IHYA 4BLWA 3KJEA 1JG6A 4C7OA 4MS3A 1TRKA 1GZ7A 1KYZA 1SRQA 2JI6A 2X9GA 3M0EA 1NIPA 4DCCA 2B8NA 4UFNA 2XI4A 1Y3DE 4FYXA 4P33A 1OGYA 3DL7A 3UJPA 1T4MA 2AW3A 4NZOA 2XCIA 4B6SA 2EWVA 4DMLA 3FPEA 4OKIA 1VIMA 2ATXA 1QIKA 4WNAB 2VQSA 4TKZA 3EG5A 1Q1QA 3AR8A 3NC1C 4JP8A 1TTQB 1EE2A 2AYXA 5BOSB 2F8MA 3EYAA 3K6KA 4JUBA 5EWLA 5K45A 2KE5A 2ZUVA 3OTOB 3AM1A 5A4JA 4AZWA 3G7SA 4B6FA 3S81A 2PYIA 4DR7B 1CXZA 2B2CA 1IU9A 4DJTA 1QZZA 1XROA 2XYGA 3A9SA 1RI2A 1I3NA 5KNDH 3ZQ6A 2C54A 2IHUA 5K0BA 3DEJA 1UP6A 3PUIA 5HS6A 3SYNA 2CYBA 3A0RB 2ONYA 4FEGA 1P0FA 4QDXA 2ZRCA 4RVHA 4C01A 4M1WA 4TZ0A 4DCTA 2YHIA 3ABRB 5LMCA 4W4TA 4CIWA 5CP8A 3ZDCA 1OJLA 3MJTA 1SKUA 1XYVA 4S1PA 2DYKA 1PQUA 4ZK6A 4GPIB 3CCCA 1JZQA 5HUJA 1R7RA 4QXAA 3LRPA 4MDHA 4HAZA 4K9LA 1XU4A 2GFIA 1LTHR 3EDRA 5EXTA 2NU7A 4BFVA 4D9NA 4ZDJA 1KDZA 2QD4A 4A0HA 4NMXB 4ZCQA 3ZS8A 3AVOA 1TM7E 1W9HA 3WYGA 5L4SA 4G23A 2R86A 2JFZA 4XD7D 4FGWA 4Y2GA 3KIPA 1HDXA 4ROSA 3WISA 3AP1A 1LUAA 3IDAA 4R51A 4LJ9A 1N34B 4FYPA 3VJKA 3UJHA 3UHPA 3DHWC 1U3UA 3ECAA 3LXRA 3NWEA 2I7TA 3L4EA 2GNPA 3D6UA 1EB8A 5DZSA 1XRNA 4TMFA 4DJAA 221PA 3P45A 3W3AH 1K88A 2WG1A 3GFQA 4PPGA 3K94A 4YP5A 3SSMA 4B83A 3W5SA 1IBKB 3TQOA 1OTXA 2HT6A 3AKYA 2DZDA 3HU3A 4G0XA 5ALYA 4BMPB 4CTKA 3EUFA 3HA5A 3PV0A 1W581 2I2DA 3DOUA 1TEHA 5CB4A 2MTBA 4Q3BA 4HL6A 3AETB 4U6NA 1AB6A 1YUNA 4G1VA 2W2PA 1H1LA 3OKPA 1T0PA 3ANYB 4CL2A 5ADHA 2QE7A 3SWWA 2O3UA 2EWWA 5FJIA 5A9TA 1CU1A 3IMGA 1YJAA 3RAJA 4PSCA 4LTMA 1LKZA 1T2AA 2W2MA 3A6HA 4P5PA 3MJCA 3A4YA 3ZWPA 4U00A 1XWIA 1B0ZA 2HK9A 1E5VA 3IEKA 4QUDA 5AK6A 4PHGA 2EFGA 1U7HA 4B3FX 1V8FA 4F7WA 5JXWA 1HF3A 2PX5A 1U2GA 3FJ1A 1UFOA 2FJUA 2ZIGA 3W05A 3RTDA 3FIJA 3IUMA 3LUGA 5CCEA 4HNAA 4JUFA 3RVPA 3JYLA 5C32A 3A6PC 5HZKA 1ZM7A 5JTTA 3CT4A 3P9KA 3PYLA 1XRQA 4DQDA 4JVMA 2W7TA 1BKSB 4H1VA 1U8UA 2YXNA 3PF9A 4PO9A 4XH9B 2ATIA 4EEIA 1YQTA 2FWJA 3CH7A 3K4HA 3N5KA 5G1PA 5TJHA 4J0DA 3A14A 2PFGA 1Y4DE 3R3SA 3OY7A 4GOXA 3NNDA 3TLAA 3U7JA 4LFBB 4YLGA 1AKEA 4ND2A 3VR1A 3QF4A 1CRWG 1T5BA 2OBXA 4HY3A 4F93B 3GG2A 1RZUA 3OHMA 1KO4A 4H6WA 5SYAA 1XD2B 4MRRA 1D2MA 5CEJA 1TA9A 3ED1A 2OYRA 4C4PA 1X9GA 6NULA 3FSEA 3UHFA 4EA6A 2WB2A 1LBHA 4ZIRA 1JBKA 3K32A 5FD8A 1R4NB 4JGIA 4HBGA 2AQIA 3WGVA 3IVCA 4FS8A 2PJRA 2IEAA 3DZIA 4G41A 4BEVA 2RDMA 4IIUA 4ER6A 3MXTA 4IX9A 4F60A 1GNSA 1BEEA 1BXKA 2C2XA 3ZIUA 5KHLB 2B1GA 5CA0F 2J87A 2I3AA 3RE1A 4WBXC 1TVEA 5LM3A 2IV3A 1XTKA 1AO3A 1KMHA 3KKQA 1H23A 5G53C 2H54A 1E5DA 3CZ9A 3IQIX 4HATA 2ON6A 1D1TA 4LZJA 1SQ5A 2RHOA 5JJCA 2FEMA 2APJA 2X1HA 4BN4A 3CVWA 1LU9A 3O0TA 1QJ4A 3AB7A 1P2DA 3OZVA 4E4YA 1CRZA 3AGPA 5IZ4A 3SDSA 1LLQA 1LCIA 1JGTA 1PFYA 1K5HA 3EASA 5CT5A 4JJKA 4WHMA 3RRYA 1KSGA 1UBLS 1VRCA 1CR0A 1WPQA 2CHEA 3NTLA 1VPVA 3WRYC 1KFJB 3MXOA 4CM9A 5JYCA 1L1QA 2J6CA 4FZ3A 1J2YA 4HPJB 4ZV9A 2AFIB 3ESDA 2O52A 1A8PA 4CIVA 1NVMB 1ONSA 4MX2A 2FWNA 4EBFA 3IE1A 2QMEA 3GJYA 5EP4A 1GQRA 1I4DD 3GT3A 3BSSA 3BL8A 4DLPA 3T06B 2QJTA 3RJ9A 5WRFA 3OO1A 3VU8A 3QELB 1QFZA 3NJ4A 1GDHA 2W2VA 3DEFA 2H06A 3V8EA 3EWAA 1G18A 1GT91 2QGAB 1YQDA 2GI4A 2WTNA 3EXEB 4TKMA 3W6NA 1DELA 1ZK4A 5H3LA 1E9CA 4PGGA 1NOKA 2ZM5A 2F1RA 4A4DA 3D0RA 3SIRA 3Q2OA 2B0CA 4PRZA 2PR7A 1NIJA 4CKWB 2NAPA 1GCAA 3EBOA 3TG8A 4ND4A 2ZT5A 3ULKA 3S2SA 3DAPA 2EXXA 5JALA 1UK9A 2CXUA 1C3EA 1QRTA 1BS1A 1T3HA 1NONA 2B0JA 4FSHA 2G1PA 2VQEB 1NYTA 4NABA 5LSAA 1BRTA 4L8VA 3DOOA 2X2FA 4MWOA 5FOVA 5HG0A 2FE4A 5E2IA 4DCGA 2IS1A 4GO1A 3KUUA 1WEKA 1UMBA 3I83A 1XNQB 3O2SB 2I2CA 3Q6MA 1H9CA 4YCAA 3KQPA 2P5TB 1SVLA 3H4MA 2J5QA 3SQOA 4B9AA 4B0OA 4M0CA 2Z98A 1FYEA 1NX9A 2B5VA 3NYIA 3VH4A 3VU0A 7YASA 5JW6A 3K2EA 2ZB8A 5ERYA 1NPTO 1QH8B 1VMDA 5ER9A 3DMGA 4OHUA 5U1PA 2UYYA 4NYMR 3B9QA 4PTLA 3HNOA 4RE5A 3FLEA 1VM6A 4UD2A 5TF4A 4CJXA 4LUCA 3QNWA 4Q48A 1H5NA 2Q3JA 4GP9A 1NDHA 4F86A 2P78A 2FUSA 3AP3A 4NE9A 5EJGA 1T36A 3A1DA 5I8PA 4YT2A 1BU5A 1EHYA 5AUQA 4F3NA 2W2OA 3U7FB 4JBNA 4ENTA 5BR8B 3PZRA 3M6AA 4I4TF 2IY7A 2Q2WA 2IA5A 4HJRA 1VA4A 5GJVC 3UK6A 4IQ0A 4C03A 3H17A 2P6PA 3Q7IA 4E1BA 2QJFA 1UMKA 2FW1A 4QATA 1OBFO 3ZWXA 2OM2A 3CPSA 5ICFA 4OQDA 1S3IA 4D3DA 3DBRB 4EARA 3L18A 4O2BF 1H0KA 4AS2A 2XZLA 2YIMA 3I30X 1T3ZA 4RPIA 2VPXA 1O57A 2DY1A 2QAIA 2WIBA 1SC9A 1TZ2A 1Y8QB 4QE3A 4Y1FA 4JT4A 3ZR4B 4WBNF 2ZYIA 1RQNA 3CCBA 5B3JC 3BHGA 2R5FA 2W2LD 2LKDA 2IYZA 2WYOA 1W6UA 2OV2A 2HAEA 1V8BA 4G09A 4LCBA 5B6JA 1GM5A 1SQ6A 1GZDA 2FSPA 2YY6A 4HTFA 3PPXA 3C39A 4ZYXA 2ZI3A 2R6HA 4FFVA 1T5HX 4CHGA 2HO5A 4KLCA 2A8YA 3ZGVA 3WICA 4PBTA 3MLAA 4RPKA 2WPNA 3PU6A 4AX8A 1K3UB 2JH9A 2H00A 2REQB 1I3KA 1OREA 1U4OA 2DTDA 3RIXA 4RNDB 3VDQA 3DFZA 2FA9A 4K6OA 3TEMA 2GN8A 3MCWA 2NTYC 1W5AA 4UDYX 3HKDB 1ISGA 3H9EO 4U5QA 4XOUA 1DEHA 1XLTC 3L8GA 4GKBA 1AA9A 2R1ZA 3DCNA 5TIIA 3EW9A 4PZEA 1QE5A 3ICPA 4IZIA 3PD7A 5T4EA 2YRWA 2MT9A 2NTEA 4QPPA 4X97A 3UAXA 4ENVA 3EGOA 4R1OA 5A6SA 4JLAA 4O4JA 3PR2B 5FBHA 2EHJA 3RRZA 4F8YA 2W6OA 3TWOA 1BMDA 1JEDA 4XRRA 3HEMA 4YJGA 3I76A 4H1WA 1JW9B 1VZ2A 1X1BA 2LIPA 2B2NA 4OM8A 4P86A 4Q4AB 1DSSG 4L2IB 1IMJA 4AAYA 2GK4A 1X7YA 4PTYA 3MTDA 1D2NA 1K68A 1YK1A 3GZJA 5ADWA 5K2OA 4ESVA 2BH9A 4AN1A 4TLMB 3UWMA 1I8TA 2IEBA 2ZSHA 3KYCA 5KNCH 1LPAB 1ONBA 3UICA 1TM2A 1OQAA 4B3TB 1GRQA 2I3ZA 2YV2A 2ZJZA 3K20A 2BCJQ 3JQ7A 4G9EA 1OI2A 4BAZA 4L16A 5AW8A 1JPNA 1E4EB 1KBOA 2PV0A 3ANLA 2PGNA 2JA2A 4JP2A 1L8XA 1KI8A 3QA9A 3FF4A 3HZRA 1WBDA 1C2YA 2FXIA 3L1JA 4DC9A 1XRRA 4JEUA 3WKAA 1DIOB 2OKGA 3SG0A 2DB3A 2VN8A 3ANSA 1AGPA 1Q0ZA 1T2FA 1ZEJA 2FCAA 5CR9A 1IL0A 4C4OA 16PKA 3RIYA 5JD5A 3PZBA 3SHTA 4YAKA 1X7WB 3FVWA 3ZD7A 4KWTA 1MDBA 1QF7A 3DLTA 2X0DA 2HJVA 4GZ6A 4R05A 2KHZA 5KTTA 3EMKA 4KSCA 1EVEA 3NHMA 3TMKA 1UZAA 3TLGA 3WK9A 5BWBA 3Q2IA 4KH1A 1I1QB 3JVDA 1ISMA 4NESA 3CZ5A 4YB8A 3DVAA 2WJ3A 1YBHA 5L6LB 1E3JA 3QW4B 3FTNA 2YOHA 2XOEA 3H5RA 2PL9A 3LQYA 3HN6A 4TWJA 3NUGA 3CZPA 2VAMA 3VV2A 4F85A 1EP1B 3N59A 1NBHA 3UENA 2C78A 3B6ZA 3SX4A 3U4DA 1MQSA 4DT1A 1I4TD 2CL7X 5KYYB 1Q21A 5FKJA 4QEKA 1JHPA 1OUMA 2ZANA 4FI3C 1DC3A 3G2JA 3A2KA 1WIWA 4YJ3B 4Q4CA 2MU1A 2OGWA 2JCYA 3AKEA 5HUHA 5L95A 3THYA 1JEYA 3PGA1 4ACAA 1DTWB 4XLLA 1EZ1A 4AO7A 3JD3A 1RKQA 1TL7C 1MAUA 2HJHA 2Q27A 3QU7A 1JT9A 2RD2A 1NG9A 3I5MA 1CDZA 5F77A 4BXOB 2XCOA 2FN7A 4BNYA 5LP6C 1NVVQ 4AS3A 1V37A 3BTVA 4QPJC 1GAXA 2XNDA 4J9UE 3AM3A 4E6PA 3D6NB 3EA4A 4OHFA 3FETA 2ZTVA 1ETHA 2HWXA 1XDWA 2PLWA 2D5CA 1PJ4A 2HU5A 2PX2A 5EPOA 2PGXA 3FRIA 1PKXA 3NVMB 3Q6IA 4YI3A 3F4LA 4G5RA 2QENA 5BQFA 1ACJA 3CG4A 2FV8A 2O57A 4Q03A 5J2UB 3T1QA 1A4UA 3R9XA 3PHJA 3DWGA 2YX1A 5B1HA 3P4XA 4D9CA 3FDXA 1LQUA 2XCLA 3GOHA 4ZI7A 2ZPTX 1XU7A 4NU6A 3W4JA 4BBJA 4ZHQA 1IWPB 1CJUC 1JLLA 1RBQA 3LXXA 4PW0A 5B4TA 1VSBA 4CEIA 2UV8A 3JX9A 5K6AA 4FNOA 5MDHA 2VUUA 3GMDA 3OTIA 4ZDKA 5K3OA 2Q7DA 1AT1A 2X76A 2ZTLA 3TBHA 5E3HA 2AFVA 1Z2CA 4RABA 4XCXA 1XCLA 1KC3A 3MF4A 1EGQA 4KQ9A 4RMIA 3WMXA 3PFCA 1AA6A 5DASA 4E08A 4E1AA 1QH9A 4DIMA 4RY2A 4A2QA 2WEKA 4KLZA 5LU8A 3OLWA 4RTJA 4Q1FA 2OXRA 2IOYA 2JCSA 1MN6A 5ESDA 1FOEB 4KO3S 4AUEA 3R5TA 1ZD4A 4XB1A 4TXLA 2HLPA 1IK6A 3LU1A 3RVNA 2BV3A 4ZA2A 5C1BA 2XXAB 1E1MA 2VHXA 3L0SA 1I0IA 1JBEA 4FX5A 1P73A 2I67A 2H9YA 3Q98A 2BAGA 4Y2QA 2XNSA 2F1OA 4OA8A 4PPYA 1JDPA 2CDCA 2GDZA 2GD6A 5HW2A 3DMDA 2QUKA 3KVVA 4HQOA 2ZBPA 1WXWA 3C97A 5I3ZA 4UARA 2WU3A 3L4SO 2C29D 4XQEA 3A1FA 4G0MA 1WQ1R 1ODSA 2CZGA 5EL0A 5FBQB 2AFHE 3NDBB 1U2QA 4PC7A 3LO5A 4D8VA 5EHNA 5I4CA 1O7JA 1RAEA 1TGYA 4JL5A 3NGMA 1YT5A 5EKDA 3ZE2B 3MTAA 4GPTA 4H4EA 1AU9A 2J7PD 3ABQB 2UYOA 3ZYCA 4BMOB 3KSZO 3MCAA 4CODB 3E3MA 1TK3A 2B1IA 5JFOA 3H8SA 2JRCA 3RTBA 3HUFA 1RI5A 4L08A 3KJIA 3F97A 3E0XA 4JJ7A 4D5EA 1FFWA 2X2PA 1AQNA 3CISA 1ENPA 1E5XA 3B70A 3PFWO 4I46A 4MJXA 4LXTA 4AJ9A 4ZTBA 5A7GA 3P9ZA 4UHFA 2G0NA 3FSGD 3JU3A 4RZHA 2OBMA 1GLNA 1QK5A 1CZUA 3GGOA 4U7HA 3RTAA 4EHNA 3C16C 1DBWA 4RX1A 1XHLA 1ZC3A 2M9MA 3P26A 3WK5A 2XGOA 3MSCA 5BO5A 2P9BA 2Q0HA 1TT7A 4PU0A 2WD7B 3GGGA 3PQDA 1A2BA 1P1CA 1VMEA 2ACKA 2JFNA 4B8WA 5GONA 1M5UA 1KIAA 1HEUA 3BXGA 4JOBA 3ZN2A 2ZZMA 3RTCA 4MWGA 1RQGA 2CYAA 3HB1A 4JR1A 4E07A 3HR8A 5CM9C 1XPJA 2GA9A 2HV8A 2WJVA 4C4RA 1XXLA 4HWGA 2FK8A 4KXWA 4E2XA 2H5EA 3UJCA 3MWEA 2V4MA 1CDDA 1XTRA 2BH2A 3EHDA 4BB6A 5CK5A 3I6BA 2R8PA 3TW6A 5EIAA 3WHPA 3M5PA 3OWXA 2Y4OA 1EDDA 2F00A 4NU0A 5B1DA 3RAEC 1E3MA 2XZTA 4K3UA 3WO0A 1LBQA 2BE9A 1E9SA 1D6NA 1XTPA 2VDPB 1S3FA 2JHPA 2XMQA 1QUEA 3KOUA 5E9JA 1R3UA 5ECYA 1VHQA 2D5BA 3OPNA 3RSQA 4C0XA 1AV6A 4U9IS 4BLOA 1X14A 2W2TA 1CZHA 1E66A 4XYEA 5EA2A 2FGJA 5E1BA 3JRWA 1GZ3A 1HT0A 2XGSA 2ZYWX 2AN4A 4K28A 4N0MA 3CLUC 2VK4A 3GFTA 1Y7TA 4D4KA 4RTLA 2ZCVA 5BUQA 2KS6A 1H3NA 1T5LA 4YUAA 5KTOA 2GN9A 3CH6A 3GPIA 4NEQA 4XXHA 4FEYA 3V7UA 4BRSA 1AK9A 3CF2A 2E89A 3LKBA 5CBKA 1L4EA 8ADHA 1Z6QA 5KHOC 5J58A 3HY3A 1JKXA 4IMIB 2IYFA 4QTYA 1FFSA 3DJFA 2GT1A 3OD5A 3DLCA 5F4BA 5LXTF 1GNPA 4ZYVA 4LHXA 5EXSA 3OPYI 2LV8A 4B2YA 1OYVA 3QLJA 3L3BA 3PIIA 4NIMA 1PR9A 3UUEA 3WKCA 4CM4B 5JATA 3LQKA 1JXMA 2RG7A 1L7EA 3HJNA 1FVHA 1US8B 3CNEA 3WLMA 5JEEA 1U04A 1UAGA 1PNTA 4PAQA 1ILWA 3UOGA 3WRXC 2JZNA 2B4YA 1SU7A 5TQ2B 4MITA 1H85A 1OBVA 3AKZA 5LDHA 2CVZA 2R44A 3HUUA 1RYZA 2ODNA 2OAP1 4MQ5A 4R6WA 1KFCB 1RQRA 4JK3A 4IKOA 4JITA 3TZBA 1LBTA 2OB1A 3AEYA 2X9QA 2AF4C 2BR5A 2C4MA 3GVPA 2W5UA 2G8LA 2HMTA 2IGBA 1Q50A 4DUZB 6PFKA 4PY2A 2HGSA 2ZRIA 3REQB 3FWPA 4J1NA 3U26A 2D0PB 3TZ6A 5JFGA 4M8SA 1OBHA 4B34A 5FPHA 3D5EA 1BHSA 1TFRA 3HFRA 3ZDXB 4CI0B 3DYBA 4RVOA 4UXJA 4EY8A 2ZSUA 4IMJB 1G2OA 3BD6A 4X20A 2O54A 1YI8A 2QRLA 3B60A 4FB4A 1BAPA 1SEVA 4F4IA 2FX5A 2ZSDA 4JLMA 3F7MA 3LM8A 1O0BA 5ESRA 4QJIA 2Q1SA 4KJZA 3HCBA 1W5TA 1YOVB 3A26A 3OQHA 4JJ8A 5EN4A 3SHQA 5DNCA 4IJQA 2JHAA 3WNVA 3BFPA 2BZ1A 1P81A 2VHUA 5CU7A 5E6UB 4B4WA 2VDWA 1Z4LA 1Z75A 4RGQA 2BFMA 5CGZA 2HCRA 1KO1A 1PWYE 4X3OA 4CKYA 2GM3A 1Q83A 2E4AA 3H6HA 3V7YA 1E1QD 2NVOA 3G1TA 4IQ8A 4KPUA 4OI0A 3OKFA 4QBIA 2J33A 2W6ID 4DR2B 1MPXA 4N41A 1DCTA 4TN1A 1I1OA 1OXKB 3QLEA 3R6VA 2AX3A 3LWNA 4P5EA 4UNRA 1DKUA 4RD1A 3V9PA 3NBKA 5JUWA 3BMQB 4I5FA 1QFXA 3DBHA 1YHYA 1O94D 4UHDA 4BDTA 3RB8A 2Y1XA 3W9YA 2LIVA 3PPVA 1N1MA 4IVNA 2R6ZA 1BCSA 2QRHA 3K0CC 5JE8A 1V7CA 4MGIR 3TB6A 5JNUA 1BQ3A 3TNDA 4HAIA 3P9CA 1Y4UA 5IC5A 2ZAMA 1PS8A 2TYSB 2FUEA 2PSDA 4C4YA 4Y2PA 4J6FA 3RVMA 5AHRA 4EF4A 5CCXA 2BGWA 3IOMA 1J2TA 2O23A 3DZ8A 5ALRA 5E1MA 1ST2A 5KX5F 1SG9A 3L7CA 1JDJA 4ID9A 1BFUA 1X3LA 1VP9A 3L0OA 3KLNA 4G8BA 1VJGA 3WIEA 4G5FA 3HO1A 3WRWA 5IAOA 1ACLA 1FP4B 3LKVA 4X8OA 1MOZA 3LBAA 4GC5A 4NBUA 4M1OA 1O1YA 3ROZA 5I47A 3M6UA 3FPCA 4OA5A 1Q0RA 1RBYA 2G28A 4OGKA 3WS7A 1Q7EA 4Y30A 1GKYA 4NBSA 4UBNA 1M2NA 1YJCA 3A6LA 3CCFA 4G36A 4KQEA 4LRXA 4W6ZA 4EUHA 3VNAA 2BHSA 4I55F 5H70A 1M2KA 1TECE 2GO7A 4B6RA 1CD5A 5DK4A 3L0IB 4G86A 2J3MA 1P2BA 4RUKA 1N2CB 4H18A 3DTYA 1NQAO 2AOWA 1NBEA 5FA6A 2QT1A 3OUTA 1XVVA 4LOHA 3NHUA 3BIWA 5AO9A 2ZRDA 3LF2A 4GD3Q 2QZPA 2YZNA 3P2OA 5F33A 2OVBA 4RHEA 1G7RA 1PU2A 1RWKA 1M6HA 2JKYA 4ZAZA 1NUQA 1L4FA 3HACA 3Q7SA 4IV8A 3WIOA 4EITA 1M6VB 4HFJA 5FAKA 1TW3A 2CZCA 4GL4A 4P32A 2WDZA 1RDFA 3JSAA 3O3OB 3B8EA 1A8UA 3AJDA 5E0OA 3VR6H 1K63A 2QPLA 3BWYA 2JGKA 3LI2A 3RBXA 4OOEA 2I65A 2GILA 1HTWA 1TC1A 3A04A 3V8BA 2H2DA 1U1IA 4TYMA 2JEOA 2PU5A 1D5CA 4KTTE 1KEKA 1T2EA 3KLMX 4RD3A 1Q19A 2JAOA 1E3EA 1V95A 3MMPA 2ZBVA 2WIDA 3A2NA 3FD8A 3KTFA 2LBPA 1AVTA 2PUCA 5EOVA 4QBTA 2WKQA 1EFHA 1S0UA 4L8LA 4M0FA 1NR5A 1W85B 1CUVA 1FP6A 1X1RA 3IDZA 1UBFA 3MINA 4FFLA 3RWBA 4BKUA 5BN3A 2DU8A 4E12A 2WHPB 1C1XB 1QIMA 1HFEL 1X7ZB 3JR7A 1QVAA 2FKAA 2ODPA 5F3RA 4BHTA 1EP2B 5DCYA 2PKYX 3C6QA 3TEJA 3LUDA 4FDVA 1YTLA 3G0HA 3NOXA 1PK9A 2O8EA 2NYVA 4HH4A 1HQCA 1ORRA 4BX0A 1NJGA 5K3AA 4S2UA 4MHSA 5FTKA 4M60A 1J21A 1XQ6A 2OCLA 2FW8A 1IZ7A 1ZD1A 2PLAA 1QGED 1L5VA 4XA8A 5T41A 3G8CA 3T1OA 2X2EA 3O38A 3IP3A 3LFTA 1G8FA 3DOHA 3OZXA 4FQ7A 4U7PB 821PA 4JEHA 1P1RA 1A1SA 1TADA 1NURA 1UWCA 2E1RA 3GV0A 4LF5B 3S1AB 2WUFA 1XK7A 4AQYB 2DQKA 3DMTA 3NHJA 3EC2A 1MH1A 3LUCA 2GMWA 4YDSA 1OXMA 4L3VA 4ZVUA 4EPRA 1T3SA 1Y80A 2ONCA 4FMCF 3KOOA 5TMBA 3SDZA 4IFIA 1H2XA 2Q8QA 4FEAA 4B6QA 1JR6A 3CXRA 3ZY5A 5B1EA 1I94B 1MF7A 1YZGA 4BY9E 1AKNA 4H7HA 4GX1A 2JFQA 1J06A 4J49A 5DOVA 3UO8B 3Q7EA 3OPYA 1AM4D 4JOCA 4BRUA 3FZEA 1QXSA 2C5EA 4O4IF 1UFRA 1T3TA 1Z16A 1DQZA 3FBWA 4MWDA 4DGSA 3L6RA 4K9OA 2A0UA 3ZUPA 5F12A 4P2GA 1NRWA 3R77A 1QIEA 1JJFA 3STWA 4JZYA 3UF0A 1BW9B 3VZDA 1ZUWA 1T9CA 3QBJA 3U4IA 2Y05A 5C31A 1DLJA 3P52A 4NATA 4ZT3A 4BWYA 1M2FA 5AXBA 2W2LA 2RHHA 4UEOA 1L4HA 3PXGA 1GV0A 1N78A 1W5SA 1JHDA 2OCIA 3C1UA 1PX0A 3ZQUA 4BZZA 2GBLC 3GJ5A 1UKYA 4W5JA 5L8VA 3M4XA 5B2FA 1LZKA 1YZNA 5KDLA 3MFQA 4PPQA 3IJ5A 3WKEA 5FWAA 2PZAA 5ALOA 5BR7A 2YUTA 3UAOA 4AN4A 2IYLD 4A73A 2Z2ZA 3A06A 2BBOA 3CC8A 4HR7A 4HP8A 1Z17A 4YCJA 3IXQA 1K8QA 3MUOA 3X2EA 4IDCA 4X6XA 2I4LA 2XRFA 4N76A 1TVKA 4Y98A 4QHYA 2A7XA 3BHIA 3GPBA 3W5AA 1XCJA 1PW5A 4BBZA 4Z3KA 5A4KA 4EYOA 2PH5A 5CAEA 1TJWA 1JTEA 3LV8A 3R5FA 1XDBA 4RHYA 5D1HA 4MULA 1J9EA 4I8IA 5FOWA 1TKCA 1X7XB 1RXWA 3DFFA 3FF1A 1FDIA 3M33A 1ECFA 3PIRA 4P98A 3THWB 1PDWA 3S2YA 4JROA 2OV8A 3U44B 3BQ9A 2V0CA 1EDBA 1W88A 2Q2OA 4IQFA 3EAGA 1UXHA 5KVCA 3BX1A 1QQBA 1R8YA 4ALKA 2X7HA 1WV1A 4UDOA 3PQCA 1DG1G 1F2TA 2ALJA 4PQRA 4RLFA 4Y6OA 4QG3A 2JLXA 2XRYA 4IV5A 3PEFA 5H80A 3DQPA 1GYQA 4D42A 5JHHB 1Z73A 1FS4A 1GSHA 4L75A 4OYLA 4BO1A 4WH0A 2WSYB 1WMFA 3EG9A 3PI6A 2C99A 1AUPA 1A76A 3PC8C 4US0R 3ZJUA 2ZBQA 2PKWA 3ENQA 4R5HA 1OXSC 1N9KA 3VAAA 2C94A 1JTFA 5MFZA 1NMQA 4R9SA 1DXHA 2OL4A 3LDUA 4JLJA 2DLNA 5HQJA 5F9FA 2QTAA 3S2GA 3NEYA 2UU9B 1GADO 5FQOA 2C42A 3UQZA 1G66A 1QFSA 3NHYA 3F74A 4XLZA 2VJOA 5J2TA 5CIQA 3HB4X 3U5TA 1EGVB 2PNFA 2V65A 4YX9A 3ELYA 1YI0A 2UVPB 2CHVA 2HPVA 2YHBA 2WAXA 5JZ9A 3TW0A 3PX2A 4COOA 3BICA 2ODWA 3THWA 1M8KA 5K8CA 4FWIB 1NVWQ 2HQRA 2O48X 3GLHA 5JT1A 3GBVA 4WXMA 2AOTB 2QX7A 1FLVA 2ORVA 5AM0A 5TT1A 1XEWY 5F73A 1COWD 1F0KA 1Y5MA 3V48A 5JZVA 2XIJA 3CINA 4UFPA 3HR4A 2D5IA 2CXHA 1I7DA 4PN7A 4AP9A 4WJZA 3WMWA 1ZHOA 2OXCA 2O8DB 2IZOA 1XUOA 1FBNA 1GFSA 2R8RA 4OY3A 4QVGA 5K0EA 3E3AA 4YDQA 3S40A 1W4CA 2HLDD 2RJ3A 3K6JA 4F6CA 2X22A 3QE2A 3TUIC 1DFGA 2HIHA 3T99A 1YR7A 2VRCD 4JX8A 5TEWA 1F7UA 1EH5A 4PLTA 4AS1A 2JJMA 3VA7A 2GYVA 3DW1X 3D64A 4II3A 3BMCA 2GZ1A 1NI5A 3HJHA 4DCNA 2FX3A 2RKOA 2OQ2A 4QTUB 4AUKA 1FFHA 4H2DA 1I2DA 2IYAA 3IMFA 3DZDA 1IBLB 1CP2A 2B8WA 2R2AA 3W6OA 2KB0A 1ML3A 3LCMA 5IC4A 3KYDB 2ZI6A 1D8TA 2B35A 2LW7A 3DP9A 1YO6A 1YVUA 1QYDA 3GVXA 2N75A 3JWIA 3LBFA 3K05A 1XTIA 4J03A 4X3PA 2ZBDA 3UA3A 2QLTA 4ZQCB 5TC4A 2IDMA 4C5CA 2EOAA 4WN9A 5C1IA 5AP9A 4Y9SA 2PCLA 2BDTA 1E2EA 5IJ0A 4R0NA 4QUAA 4Y1RB 5CB6A 1NF9A 1ZOOA 4L15A 4ZCIA 1RAFA 3HMQA 3T5GA 3FLAA 3O4JA 1XZBA 2VP0A 4I5IA 2JCGA 2PE5A 1HG0A 5TY0A 2NXWA 5AM2A 2MINB 4Z1OA 3IBTA 4Y2XA 3G0DA 3P9IA 2NU8B 2ZJ2A 4C0QC 2QN8A 1V16A 1WOYA 1N0UA 2AXQA 2V7UA 1F5NA 3ZDAA 1EVQA 3TYXA 2DSNA 2FH5B 1N5RA 2H2AA 5FFNA 3E4CA 4OFXA 2XECA 3RYFA 3TNFA 4R81A 3EGCA 4YCBA 3CLTC 1V7QA 2HA3A 3AR7A 3AVQA 3M2TA 1XKLA 1YF3A 3G0IA 1MB4A 3PGMA 5DHQA 3U3KA 2ECFA 4I50B 1J9GA 3ONVA 3OQIB 5B2ZA 4BVGA 4BU0A 3K6SB 2EFJA 4FT4A 1HOXA 2YN4A 5E9QA 1K5DA 1DMRA 2H1VA 3DULA 4M98A 3FNHA 3QVGA 2JRLA 4KFCA 1HYGA 4AJKA 2G36A 5F4ZA 2JAPA 2HHJA 1QKJA 1YVRA 3OJ0A 1BCRA 2DEUA 3QFRA 2FZWA 1G5IA 4WLUA 5BY2A 3KUKA 4JJZA 4MKFA 1RI4A 2C82A 5EYPA 4K9PA 3QI2A 1K7WA 4DN6A 5EJ7A 4Z9BA 1WCV1 2BMEA 2B8TA 2WT8A 3L8DA 1STOA 1PTJC 4G4JA 2A94A 1A8IA 4XQ0A 4DRYA 2WKSA 2J7PA 2ZB3A 4CM5A 5ALEA 1YE8A 4LYHA 1E99A 1QFJA 3LHDA 3ZV7A 2POCA 3W9UA 4MAFA 2VUSA 2PZGA 1FMJA 4LNUA 1PW7A 1XDGA 3D3KA 4G63A 1FUIA 3SP1A 3QY0A 3B1ZA 4IIJB 3G9UA 1ODIA 1QPBA 2Z9BA 3OEHD 1Z15A 5EXDA 4CUJA 1M7BA 2JBAA 4JQYA 1WCXA 5A5DA 2ZQYA 5L7WA 3GLFA 1RABA 2CKDA 5EC8A 1XN4A 2OA0A 4KFTA 3RHSA 3ZE1B 3F8SA 3SNHA 5CYPA 1Y63A 3FWZA 1RWBA 1ULZA 3II6X 1KDOA 1L8LA 2FZLA 2Q21A 5D7NA 4DAEA 1EUCB 2HK6A 2CLLB 1M3SA 4BMYA 2O7QA 4J1TC 5FEUA 4H6XA 1XCGB 1MOPA 2GPWA 1UK7A 2W9XA 1QWOA 3DVSX 1L6IA 3FYUA 5DLDA 3VRHA 4C89A 3L77A 5BW8A 7ADHA 1OYYA 4Z4QA 2BHRA 3D1VA 3KZVA 2UYQA 4MIEA 3U49A 4D0NA 4RXMA 1ZZGA 2HA0A 4LJLA 2WJGA 3BIJA 2FMFA 4BFLA 1B8OA 5IH3A 1GZ4A 3WKDA 4O3FA 1B16A 1IBMB 5E7JA 3NTRA 3C24A 4MR9B 2EEZA 1VHTA 4YMSA 5BWCA 4AQ7A 1B8PA 4E70A 2P11A 5A6VA 5JSFA 1QIGA 1M76A 3PUVA 5DP1A 5M7EA 2DT8A 4II2A 4EP1A 1XNGA 3BCRA 1L5ZA 4HADA 4EEXA 3NRJA 2JVJA 4N5NA 4OFWA 2UXCB 5A4IS 4G0ZA 4EKNB 3OICA 2P41A 2YS7A 4GZ3A 4Y6PA 5FA8A 1CEXA 1CY7A 4P7BA 4F4CA 3ZGZA 3DV0A 2BGKA 4EJ6A 3T5TA 1WUIS 3GEHA 1FXSA 1DIAA 1MRZA 1Q84A 3M89A 1QGUB 4OYHA 4AO8A 2Q5FA 2B83A 1A9XB 4KQWA 2HN9A 1D4AA 2G17A 3I64A 1QP7A 1OI4A 1G63A 3H5TA 2VSFA 5ALTA 4PN3A 3HYTA 1V6SA 2VPYA 2XRMA 1TUBB 3N6RA 3PXUA 5DHRA 4BGIA 4G5QA 3SR0A 1V4VA 2YR0A 4X24A 3KYIB 2AIRA 1WDKA 3ST7A 3ROEA 3THSA 5AVSA 1F8FA 4DLBA 1XZEA 3MMXA 1XR3A 1U65A 1XZGA 4Q1DA 2DM6A 4QQFA 1JQ3A 5FLKA 4HAVA 3LVQE 1CEYA 3MS4A 1OAKA 4C0AC 4D43A 2PH3A 2A9KA 2XB4A 1ZRMA 2B34A 1G8KA 4OKNA 2UXBB 1CUAA 1V1JA 3EFBA 4JELA 4YMLA 1QVVA 4MKIA 5C34B 1N3IA 3NDJA 4NYJQ 3LMKA 3QVJA 1HZZA 2FPWA 1GU7A 2XLBA 1P6QA 4KTVE 4P7FA 3VMMA 3W8NA 2HL6A 1T6ZA 4DUGD 2NYAA 2Y71A 1KAGA 2Q1YA 3MVEA 3G9TA 2EGGA 3QUBA 3DFMA 4JP3A 1FTQA 1X42A 1SXHA 3WAJA 3AVXA 4OGLA 3WB1A 1LK0A 3AOEA 1V8ZA 2B2XA 3L7YA 1XPUA 4QARA 4A6PA 2GUGA 3VXKA 3GRCA 3I12A 1XI2A 4DL9A 4K26A 3NM5A 1Z25A 4ZK2A 3O94A 3W9BA 1EPUA 3ER6A 2FY8A 2G3YA 5H0IA 4EI2A 3AKDA 3LFHA 5CTJA 1KA9H 2MR5A 2MHCA 2ADFA 3C3EA 3IAM6 3LPMA 4TTAA 3DDUA 2FZKA 4GGOA 3OPVA 4OPMA 3GP8A 5DM4A 2FP4A 4DCSA 4B47A 3SM9A 1X9HA 3R7WA 1MX5A 4KPYA 1P1KA 1KRXA 1Q7GA 3I09A 3M4YA 1QH1A 5DBGA 5AFSA 1Z0ZA 3GTDA 3TV2A 1QFMA 4NENB 3WBFA 1UC4B 2R6AA 2XUOA 3E2IA 4V0NA 4OMDA 3D81A 2Z8ZA 4ZVPA 3DB2A 5BRJA 3WGQA 1L5RA 1YS7A 5BSVA 2AVDA 2WJJA 4C30A 1XL0A 1AHPA 1YDFA 3AEQB 1Q0TA 1ZW1A 1UBHS 3KUXA 1ORDA 3K30A 2XNKA 4XASA 1A8SA 2GXSA 2WT4A 4HDSA 5IMBA 4E2WA 3ZDQA 2VYVA 1Z8NA 5DBOA 2Z6QA 3UFBA 3KZCA 3UAGA 2W6IA 3N0TA 1AXRA 1HM5A 3R5XA 4YRQA 3MOGA 5TS2A 3TZLA 1XRSB 3B7PA 4B6PA 5JTUA 2ZT7A 2PUDA 5C5EA 3HJCA 1NPDA 3EDYA 1IYZA 3OE1A 3A3OA 3DE2X 3OIYA 1O94A 1ONNA 4TOIA 5HE8A 4RDXA 4RTRA 3MHPA 1BJRE 4TUYB 1U3WA 2Y8EA 3FUUA 3U4AA 3KXKA 1KHHA 2GXUA 2H63A 4X95A 2V98A 5FWXB 4MVJD 1UKBA 4J3FA 2VF4X 2Q45A 2Y3IA 4UVGA 4DM7A 1BEUB 1VA5A 1MJ5A 2C2ZA 2QT9A 1U8XX 2PRIA 2WJYA 1DAPA 3MT8A 4HNQA 4P38A 5HFNA 1S96A 1BFKA 5FWDA 2C7OA 4GPAA 1FYWA 4FN4A 5DKFA 5ESXA 5F1PA 2SHKA 2G5TA 1U2EA 4ETMA 1Q1GA 4L0QA 4EF6A 2JAUA 1Z0AA 2GHRA 3IUBA 3KRTA 4V2UA 5LNK1 3LA8A 3E9QA 2QW8A 2ZIXB 2XA2A 3L4BC 5HGJA 5KAPA 3CUKA 1U0OC 3HB7A 4AMBA 4MRNA 3VDXA 1GG9A 2O2JA 4UULA 1C29B 4I8DA 4F6RA 3OFNA 3EAQA 3LS2A 1NHGA 1U0NA 1W30A 2XYHA 3DNMA 4N12A 1QS0A 4PG7A 4R8MA 4GNRA 3VYRB 2PUEA 2EBUA 2IY9A 3B20A 1KOGA 2F4VB 4YRZA 3JRXA 2VPTA 1IQUA 1VECA 3O8QB 4YJDA 5J5CA 1IZ0A 2HJSA 2TMKA 3KELA 4MINA 5JZBA 5KDOA 4HN4B 3RASA 1RTTA 4DB2A 1BS9A 2PGJA 1AKYA 2KMLA 3UV3A 4DRXB 2V7EA 5FOXA 1PHRA 5BSMA 4CCYB 3BFJA 4ZO4A 1FE8A 3RUAA 3MA0A 4N3GA 3X3HA 4K5QA 1JHYA 3CPHA 2C4KA 3JZDA 4P5DA 3WLJA 3PC4A 3EPHA 3LGAA 1ESNA 1GA1A 4D81A 4H27A 3GJ0A 3Q0IA 3COWA 4KRGA 3E9ZA 4DKXA 5LJLA 1W94A 1Y7IA 4AL4A 4F1JA 2D8MA 1KDPA 1VRVA 3A6FA 4CR7A 3ZHUA 2JFUA 4CN8A 3RYIB 3QPCA 1YR3A 1NYRA 2E6UX 4DIUA 1ISIA 2G1AA 2VSNA 1QCCA 2VP9A 2YS6A 4KYIB 3UATA 1LF0A 4EW2A 5I7RA 5ED4A 4RTMA 2F9FA 4Z4EA 3DG9A 1XZ8A 2QLMA 1UBCA 3G8YA 2NV2B 3ZOZA 1CE8A 2XCSB 5J1SB 1KQ3A 1HGXA 4TRMA 4NONA 2D3WA 2I22A 5FR2A 1JWLA 1SC6A 2YN2A 3UMYA 1BG6A 3DE3X 5JNVA 1K66A 2MYTA 2WG0A 5LQMA 4EVQA 5JI2E 3M4ZA 1GZ5A 3K0FA 4G56A 1VQ1A 4Q3OA 4MAAA 2ZREA 4WX2B 4EFKA 4D6YA 5TQJA 1JSXA 3O90A 3EE6A 3DZJA 4ZOLA 2BOVA 3U7QA 1B15A 2KW5A 3R23A 2MYNA 4KQ6A 2D27A 1EQAA 3FMVA 3CEMA 2CW5A 1F8XA 2Z95A 4KSYA 2CXSA 3G1UA 3L7AA 2P9HA 3BB1A 4Z7OB 3S99A 3S2ZA 5I5EA 5E6SA 3G9QA 3WLRA 4BB9A 1T15A 4QOIA 5GOZA 1YNSA 3M9LA 2UYHA 1WRBA 1PT6A 3L84A 2V6GA 2C3UA 1CEQA 3BORA 5F76A 4A8PA 1JQJC 1HE8B 3Q12A 5CPBA 5IS2A 2D59A 3MGGA 2CEAA 3DGFC 5ALGA 4QYTA 5J43A 5KEIA 3NTVA 1YBAA 3AEKB 1LLFA 1LVGA 1VKZA 1Z29A 1Z2EA 1ZN9A 2BEUB 4MV3A 4ZGBA 3RT7A 4QJ4A 4KQCA 3LWDA 1V8OA 4ECAA 1P4JA 1WABA 2GX6A 3R9IA 4JI0B 4I0WB 3S70A 2MOKA 5JJIA 1SUAA 5KBYA 1SBQA 1EWRA 2QM3A 1VKOA 1XDDA 2JLCA 3FNQA 3GDOA 4NCKA 3VZQA 1A5BB 5JYBA 2XAAA 2UYGA 2C4VA 2MYPA 4DLKA 2R3SA 5K0CA 1R0BA 4MO9A 1XP5A 4IJKA 5KPDA 4YUZA 1EP9A 1B23P 2IXBA 1DZ3A 1I33A 3OIFA 4M2LA 1FTYA 4UEJA 1QB8A 4KYTA 4NBKA 1W36C 1FSSA 4PSKA 5E8JA 5ENVA 1N6RA 1QO9A 1DVRA 4X8MA 5TARA 3I9V6 4M0UA 3CZCA 5DBHX 1WA5A 4J4TA 2X0KA 3EUAA 4WZBB 2DXIA 5B1SA 3WTCA 5JYDA 1EFAA 4C7BA 3L1HA 4ZZ3A 3V4OA 4HFNA 2BFWA 1QIJA 2XYRA 5TRTA 1T43A 5EE9A 2V74B 4JNKA 4KX3A 3AMVA 4CQMD 4LMPA 2NU9A 1YS4A 3PGXA 2PN1A 2HBQA 4JVOA 3HNPA 2NU6B 4HAOA 4R3NA 4YLYA 2VTBA 1DAOA 2CN1A 3BIXA 4Q1EA 4RZIA 2R8XA 5F98A 4EUKA 1XVIA 4QYXA 3JRNA 2Q5CA 5J9FA 2I7VA 2DKOA 1GCOA 4R7ZA 4KIUA 4M7RA 3RFUA 5AJZA 2P3QA 5AHXA 3U40A 2IP1A 1OWPA 1WHSA 2C7PA 1PFVA 4LDZA 5E0KB 3HJUA 1RIFA 1S3SA 4JN6B 1G8PA 1J00A 3GEPA 2X5KO 3NCHA 1Z4NA 3AHHA 4UAVA 2BP7B 4LNHA 5TPZD 5AM3A 1QRSA 2RC6A 2QHXA 5IVPA 5FWYA 4FXOA 2G70A 3OLQA 2QAGB 1R6DA 1W5FA 4NBLA 4F7DA 4XARA 3G2OA 1K7CA 4OV6B 1NQWA 2JB9A 5CLJA 1CJVC 5KHAA 2WSSA 5IZCC 5BSRA 4FPXA 1MU0A 5MN4A 4ZT6A 5DM0A 5HF5A 2ZAYA 1S7CA 2PYDA 3NYWA 1K0UA 1VJ1A 1O96A 2ODQA 3M9WA 4D9HA 1NP6A 4XWWA 3CLUD 2I54A 4EYEA 3T95A 3NHBA 3F9CA 4MS4B 3B5IA 4WIAA 3TQQA 1LLDA 2XAUA 4U9HS 1QRUA 1M72A 2VPIA 3LZDA 1YV9A 4N7MA 2EYUA 1QTRA 1KJJA 1FFYA 1GWNA 4E11A 2WSLA 2GXAA 2K87A 2OP0A 3AHEA 2VLBA 5EIBC 5EMLA 3ZH2A 1F2VA 1XZFA 3WGTA 2CMHA 4BMNA 3IQDB 2XDQA 3PQ6A 2ZSBA 4L74A 4UVDA 4CG3A 1D6SA 3KFXA 5GVSA 1VCOA 3P1JA 2PIAA 1WU8A 5FOQA 4I9FA 2HIGA 2UUOA 4DZTA 2ZRFA 4M87A 1WCWA 2RC5A 2VNKA 2AOUB 4DXDA 1C0PA 1W29A 2VZ9A 4R8VA 4RMNA 1JDZA 1GD1O 3KE8A 3LZ6A 2ZTMA 5D3MB 1YC2A 4MEAA 4DQUA 2R9VA 3GMTA 4LYDA 1H69A 1XQYA 3PQFA 4NS1A 3U3OA 4AZ3B 1QIIA 5DN6A 5H16A 2B1RA 4JMPA 1ZK0A 1P2UA 1EFTA 2PKXA 1FC0A 3LCJA 2BFFB 4HQ0A 4M1TA 3ZUGA 4YQYA 3ZJ4A 3EUWA 1V7PC 3SD7A 1UXKA 1XEXA 5EHQA 5DHFA 4ZEMA 4B4DA 4X64B 1NXPA 1COWA 3CNOA 2PU7A 1OIWA 3LKDA 4YJ3F 2EATA 2O3QA 5DLQC 3M3HA 4ZYUA 3MRSA 3A4LA 3IA7A 2WW8A 4YJ2A 3JQ8B 4X60A 1OBCA 2VXOA 5FOUA 2AEEA 1IMOA 1F0NA 2P6NA 2WBLC 1J7KA 2PQ0A 2C77A 2OM6A 1MX9A 2PWBA 1ODCA 3FPJA 1C1HA 3FYHA 2VRCA 4DXAA 4EVIA 1NATA 2OUKA 5CDSA 1WD7A 4YUWA 1DTEA 2LWIA 4QGFA 4XIYA 2QR2A 5DNDA 2NSHA 5M2QA 1E9AA 3BE4A 4XZ3A 1FUKA 2WWIA 1FRFS 3PPIA 2ZIAA 3RK0A 3VHQA 1D07A 1Q3TA 3C74A 3I23A 5J2UF 2V3CC 2P1DA 3FLBA 4NH4A 2COUA 1VIVA 2Q3DA 4QLOA 2HA7A 3L8HA 4RV4A 1NUSA 2YVAA 2BFCB 3KC2A 1L5LA 1P75A 1U81A 1HFWA 2W8ZA 2ZYTX 4O1MA 4HGQA 2G8NA 3IP1A 4PLWA 4WACA 5LCXA 8ABPA 3GWZA 3T6KA 1M1ZA 1IQ0A 3UWOA 2ZJ5A 5TNXA 1ACMA 1HG1A 1S2NA 4GI5A 5LD2C 4YAJA 2ZATA 2V3WA 3T5DA 2PUBA 4UTVA 4I6GA 3N86A 2R25B 4DSUA 3K53A 1TJYA 3HCWA 1EVZA 1U8FO 2YASA 1DX9A 2HJGA 1MOQA 2O5VA 3HJRA 3QU2A 5JCJA 4JIGA 2G77B 2HPZA 3NUQA 5KYUA 4E51A 4GX5A 1NJ1A 3IEIA 3GD5A 2DFLA 4MLZA 1VSQA 4I7EA 2W6PA 4Q7LA 3DLPX 4IDAA 4I9UA 2C2OA 3SJAA 4KAAA 5A5FA 4ZOBA 3WNDA 2R79A 2ZYDA 4PHCA 2ZJBA 3VBEA 3H2GA 1ZBQA 4D56A 3PFHA 4YYZA 4GMXA 4INJA 1C8KA 1N2HA 2WD8A 1ADYA 2YWJA 3AFNA 3NT5A 4CQNA 1VZ3A 5FLEX 1IHOA 2R66A 1NR1A 2C61A 2H4WA 1EX6A 2VHQA 2LD4A 4GMDA 2C04A 4YAFA 3G02A 4MVJI 4XGIA 2OORC 3TQRA 3UUFA 4DA7A 2NUPB 3R7NA 3MLEA 2WHRA 2GJ4A 1Y0BA 1CW2B 1GSIA 1LK7A 1Y9JA 3CVOA 4JKIA 2IYXA 1NW6A 5HA5A 3U09A 4ENUA 1HTTA 2RH4A 1BKDR 1C3VA 1DU4A 3SZLA 5I7OA 1DC4A 1VHJA 2I4MA 4GOLD 1WXDA 4WVLA 5DXJA 3UMJA 2RHGB 4LQDA 3ZK7A 1DHTA 1R6AA 2PGDA 1VHDA 3SX0A 2QIOA 3AUTA 4OQEA 2EQ5A 1WB9A 3FNBA 3TD2A 1VMIA 5AXDA 3ZK8A 4ZQGA 3CEHA 3NHKA 4V0OA 4GR4A 2QA5A 3K4QA 3M7IA 4H0FA 4LY3A 3C8HA 3WRYA 3O8OB 4KXNA 5G1NA 1AOXA 5D3ZA 3KOWA 3ZWVA 2NUAA 2P4UA 1ATIA 1AXGA 1E0JA 1WUHS 1Z68A 2NPIA 2O20A 1XXHE 2PVCA 2V55B 3DEKA 3AI2A 3PDHA 2EJCA 4OXNA 3TQHA 4QWMA 1NZJA 5CFOA 5IDXA 3A2LA 3G5TA 4AK9A 3AUKA 3CZ4A 1SXJB 2ZJOA 1N9ZA 3HG7A 3LLMA 4IDEA 4NHOA 2HK8A 4BQPA 4DVGA 3OH8A 5BXQC 1KDTA 3A05A 5GM1A 4YV7A 5HSGA 3TBKA 1OLUB 3V1KA 4POOA 4QUHA 3WGUA 2BEWA 4RZ3A 5KNBD 1Q17A 1HY3A 3CR3C 4NHEA 3G2PA 5LQRA 4G9GA 3BCUA 3L5OA 3JSXA 5CXUA 1G8SA 3NBYC 1Y3BE 3OEHA 4KAJA 3U17A 3UMRA 4J0FA 2ZUEA 1PR0A 3BSWA 2MSLA 1S2LA 4PINA 4W1QA 3UB4A 3DKIA 4NZZA 4RCZA 4B2IA 2PTRA 1L7QA 2MJLA 4IEFB 5ICSA 5KC9A 4ZKEA 2GKSA 4RU1A 1MIOB 4CFYA 5JBQA 3UOWA 1GPLA 3O8BA 3OETA 4OEHA 4PQYA 4RA6B 4EA7A 1QOPB 2FEOA 2JAHA 1KH2A 3PRYA 5JVDB 4BN5A 3V1UA 1ZJ6A 3MEQA 5EP2A 3THOA 3QE9Y 2FR8C 2XIQA 2GPSA 3VKWA 1AGNA 2BCEA 2MSNA 3DHVA 3JASA 1I6LA 5JSZA 4MJLA 1JJIA 5KVSA 5ITVA 1CEEA 1GR0A 3OY2A 1YHNA 5EHGA 5JQWA 2I91A 3UIEA 1L5SA 5K51A 4JJFA 2HJWA 1KR5A 4LY9A 1MG5A 3ZE6A 6YASA 4B80A 2IIQA 3B85A 3FYTA 4U2EA 4OLBA 2ZI9A 1G5TA 1LGYA 4WXRA 4ZCLA 1EUZA 3EXG2 3HYSA 1D2HA 3OLCX 1Z4IA 1FU7A 4NDAA 2F9MA 4PYLA 2Z4TA 2W8BA 3D7KA 1I14A 1XZNA 1R1DA 5DTIA 3D8BA 4E15A 1PNOA 4EHBA 2C7QA 4O08A 2AHOA 2ECQA 1DT5A 3L0YA 3VYSB 3RC8A 1A5SB 1IONA 3MCZA 5ITZB 2B6HA 1JTVA 3F98A 3E9RA 2NWQA 1MB3A 3ZV6A 5K8JB 2FUKA 4CF5A 4WKNA 4B85A 1MVNA 4C1NA 3LT4A 4QO8A 2V3VA 3CNQS 4KODA 2IEIA 1QLWA 3H5AA 4R8RA 3HKCA 3O84A 5KMGA 1VG8A 1Z34A 1PSWA 4MS3B 2J0VA 2GHQA 4BVAA 3CRZA 1NDQA 3ENKA 2G9NA 3E23A 5BV2P 2ZWAA 3O1HB 1EFVA 1JQDA 1LQTA 4RHCA 3SYRA 3VZRA 4H1HA 1RBMA 1NW7A 4HDRB 1RS0A 4BB5A 2CDBA 1XXHA 1OFGA 3OZGA 2PWAA 3C98A 5ALZA 3ZCSA 1SR8A 3WYCA 4RTKA 3ETJA 2GAOA 2JIBA 1B6SA 1GZ6A 2V45A 3FOBA 3G2LA 5HWSA 2MDTA 4MVJE 5B3JA 4FLEA 4KXXA 1NJ8A 1KYIA 1KDRA 3OX4A 2I6GA 5EWLB 2ECPA 1L8AA 3OCZA 4LDPA 5AI0A 5BNFA 5FIUA 5G0UA 3HY6A 3VH2A 3MTGA 5D00A 4WY2A 1JVNA 1GG5A 2IFTA 3AQ4A 3LUFA 4FGJA 3OZSA 1E6WA 1OILA 4H3KB 3V6LA 4B3HA 1P31A 2WYWA 4NL4H 1HV8A 1EDOA 1QJCA 1B8UA 3E3NA 1WW2A 4GH5A 4TWBA 5AOVA 5F7JA 4NCHA 4UC0A 4YROA 3EN0A 3T1TA 1IXZA 4BNHA 5JISA 1GSAA 4OG2A 3HYLA 4LZOA 1QKKA 1U8TA 2E4UA 3NWOA 3QQ5A 5KX5A 1S2OA 4EEZA 1EXVA 4BS9A 4QU9A 7AT1A 2R7AA 4NYJR 3OTHA 5FUBA 1F1JA 1ZJJA 3TH5A 4CN9A 4YAGA 1XLTA 1RRKA 3O4FA 2VF5X 5EKXA 3MC1A 3QJYA 3QXCA 4TTTS 4WV3A 4Z1MD 4M9XA 5TE9A 3L0ZA 1W1WA 3A7EA 1FX1A 1AKRA 3W6ZA 1V3TA 2F43A 3GVCA 4GLFA 2J8ZA 4GNKA 2LTAA 6LDHA 1P8AA 4HNSA 1EX7A 2JGAA 2QTGA 3IH5A 2VJMA 1Z4QA 4WLOA 3KU4A 2EZTA 4WZAE 1TJ7A 1AMUA 1NF8A 4PQEA 1PZHA 1L8QA 1M2EA 1IY8A 1WOMA 1PR5A 5NULA 2IUEA 3ESBA 1QTQA 1RBZA 1RWQA 2YJNA 1PJLA 4UU8A 1QRRA 3PHGA 1C8LA 1UFKA 4M1YA 1P0IA 4PX2A 5ESWA 4BNIA 2OECA 4L5YA 1II0A 2X8JB 10MHA 2HYIC 3FHTA 2P2ZA 1SHLA 1VFPA 5AVKA 2QBYA 2JJ2D 2LDXA 4JKYA 3M6WA 3TOVA 4KDFA 1BGVA 3EMDA 2SCUA 4S0XA 4X7PA 3UT0A 3O4VA 4G07A 4B4VA 4YV1A 2DJ5A 1OD6A 1C3OA 1FLNA 2JFVA 3QI7A 1N2EA 2A0WA 4OLJA 2BGIA 2GFQA 3FFXA 3SQNA 2O2HA 3UG7A 3PXXA 1IM2A 3VGJA 2WWYA 3MRXA 4XDGA 3LX6A 2AUNA 1SVUA 4Q6WA 2DLDA 4EFNA 3GUYA 3RANA 3S1SA 1V48A 4MVJA 4KK3A 4F4FA 1H1LB 3D2BA 1C9MA 4ZTZB 1ES9A 3LPLA 5K0FA 1QIDA 4KEAA 5B30A 4BTLA 5BW4A 4G0WA 4JGGA 2FFJA 5BMOA 1E96A 2Y0CA 2O8FA 1QHYA 4F5EA 2G1KA 1MC8A 3INNA 1DMSA 2GEBA 3OJWA 1W8DA 3QVTA 4PG4A 4A2PA 1CIJA 4I1VA 1U9IC 4EYSA 1MA3A 2DPLA 4ZZ1A 2QRQA 3KPVA 1IHPA 1II8B 5KU1A 2WYVA 1POXA 5IEBA 2DPMA 4J2OA 3D7MA 2QD3A 3RFVA 1YB5A 3JD4A 4KVGA 4OF4A 3TZHA 4S04A 2VQDA 2QTRA 4MQEB 3BHMA 4FD3A 1MKYA 1Z74A 4XCQA 3AVPA 3SHFA 3WGIA 2QMYA 1G21B 4LDNA 1T26A 3GELA 3MWDB 3L02A 2EZ9A 4ENRA 3BERA 3FCEA 4POAA 4QBGB 1EQUA 1N9GA 4A0RA 1RWOA 1C30B 1F7VA 1NQXA 4JODA 1C3CA 2FMXA 2IU4A 3KSUA 4RNCA 3L7JA 1ZX1A 5AICA 4URVR 5BW5A 1YI1A 4G4IA 1Z2PX 4EVRA 4E3ZA 4G5GA 2C0QA 1GUFA 4QNNA 5B57C 3WA7A 3ICOA 1E6MA 2ZXFA 2D2VA 3L6EA 2QSYA 4HGYA 1Y1RA 2GJAA 4XWGA 3T3IA 1W73A 3DAOA 3TL3A 3HS3A 3LY7A 2W93A 4L4XA 1ZLYA 2WHQA 4G5XA 5HEKA 3STHA 4TM7A 5A62A 3ECCA 4TT3D 2VHZA 1VBNA 2F1IA 3FDZA 4FC6A 4N40A 2WZQA 4A7PA 1SVOA 3ABZA 4X91A 3T0IA 2BFAA 3IQWA 4D3XA 1S4QA 1RP7A 1X0XA 3A6KA 3JVUA 4CMEC 4TLBA 1YZ3A 1RE5A 1J2RA 1HDGO 3OCXA 2IZ0A 1RJEA 3MJFA 4KRYA 3EIOA 1KMHB 4E2ZA 2JZOA 1TJVA 4E2YA 1GGVA 5IC6A 2ZYUX 1WBJB 4M0KA 2CVQA 3U48A 1CUSA 1AE1A 3K9HA 3SYMA 5HOQA 1SVKA 2GHIA 3RV3A 2QPAA 4MPPA 1NG1A 3RV4A 1JIVA 1RVV1 2WF7A 3TIVA 4FS3A 2CVFA 2JIZA 2PH7A 1XFDA 3GY0A 4WY8A 2D00A 3G5AA 4OATA 4D99A 1U90A 3QNUA 4F4HA 1E1CB 3LPDA 3MAGA 1Z26A 4DNOA 1IY2A 1EXMA 1N6NA 3BD7A 3RUDA 4JCOA 1THTA 4O5OA 1LLUA 4DLSA 4Q3LA 5E4TA 4ENWA 3SQXA 3CLTD 4P53A 3TG2A 2ZYAA 2NTNA 4OXKA 4AN0A 3QKTA 1K9VF 2FSFA 5ECDA 3PDJA 1R9JA 4KN9S 4Y1EA 5HM8A 1UKCA 4KE7A 3B1KA 5T57A 5FHRA 1OLXB 4KR9A 1RYBA 1Q7CA 1XJWA 3OMLA 3NHAA 2XE7A 4Z2AA 4J75A 1K4MA 3WMEA 3IEUA 1L3CA 5DGDA 4KFSA 2I62A 4B32A 1T6BY 4GBGA 4GPBA 2I8CA 2Z09A 4L76A 4BNLA 4M9UA 3ND9A 4FNAA 2PKQP 5LR6A 4ME6A 5JCPA 5IVIA 4A5OA 3DXZA 1JR3A 1Y3FE 3EA5A 3ICWA 3MQ4A 3PITA 3B3QA 4PANA 2OXTA 2FFHA 2IHZA 3JWGA 3VOTA 4PBRA 2IXAA 1N5LA 3UHJA 1TKAA 2DBVO 5AI9A 3VVCA 4NU5A 2P4EA 3QLTA 2VJPA 4NAUA 1M9NA 3WZLA 1ZONA 4P4NA 1R0CA 3HXKA 3ICVA 3KZNA 4MJ7A 5FV7A 2OKCA 1X87A 1Y81A 1Y8RA 3AFOA 3INGA 3EVCA 3IHWA 1UDCA 3IP6A 3GG9A 1ZJYA 3C3KA 1FNDA 1IZYA 2D5AA 2PQ6A 3E53A 3FMPB 4ZAXA 1MO5A 1PBNA 4BX8A 5AJVB 2H2IA 3LL7A 1IJFA 2C2GA 1FNBA 4QTTB 1U0GA 2ERXA 2RAFA 1SUSA 5EP1A 2X0NA 5L7TA 1UEIA 2GPNA 2VG8A 3KT3A 3NBAA 4C88A 1KE1A 4E22A 4CIBA 5AVTA 5DSZA 2ZQ5A 2JFBA 3RF6A 4ALIA 2OK8A 1G291 1GCUA 3CBQA 3DM5A 4OP1A 4TMXA 3GRPA 5DMHA 4JYCA 4MQLA 2VJYA 5SYMA 3N2ZB 1Y98A 2XT9A 3T0GA 2F3TA 1T36B 1HRKA 4CQMA 1BFDA 2V7WA 4BJ6A 1O0CA 5IW8A 3MPOA 4C7MA 1KO5A 3K1YA 5JECA 2TRSB 4H7PA 3GLIE 4D6XA 5E6RA 1DWQA 1GP2A 4ADMA 1GU1A 1UCFA 1YXMA 4F2GA 1X38A 2CLOB 5K8UA 2IH4A 1P4HA 3SX2A 4M1EA 2F48A 1NQOA 4JL8A 4KUHA 2QN2A 3I4CA 4Q1CA 1I2ZA 4QU0A 4XM1A 5HNKA 1Q0SA 1RWVA 3KEOA 2EW8A 4OL0A 3PI7A 1Z2OX 1BKYA 1MUUA 3LOQA 1W96A 5F78A 4IJ5A 4WXHA 5CH3A 4LHVA 5TPZA 4E5MA 1WEHA 3IUQA 2B36A 2IU6A 3K72B 2BBTA 3VKFA 2JBWA 2GLUA 2XVXA 3KZMA 1XF9A 4E5KA 1D5WA 2GF9A 5T4HA 3W5VA 3NHSA 3ZNOA 2PKEA 4KMOA 5IULC <