4L5LA

Crystal structure of 26 kda gst of clonorchis sinensis in p212121 symmetry
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
MAPVLGYWKIRGLAQPIRLLLEYVGDSYEEHSYGRCDGEKWQNDKHNLGLELPNLPYYKDGNFSLTQSLAILRYIADKHNMIGNTPVERAKISMIEGGLVDLRAGVSRIAYQETFEQLKVPYLQQLPSTLRMWSQFLGNNSYLHGSTPTHLDFMFYEALDVIRYLDPTSVEAFPNLMQFIHRIEALPNIKAFMESDRFIKWPLNGWSAYFGGGDAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione transferase
publication title Crystal structures of 26kDa Clonorchis sinensis glutathione S-transferase reveal zinc binding and putative metal binding.
pubmed doi rcsb
source organism Clonorchis sinensis
molecule tags Transferase
total genus 77
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4l5lA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4l5lA01
2HXKA 5HR2A 1RK4A 3RBTA 3P8WA 4GLTA 2DJKA 3D4TA 3LGCA 4TVEA 2JZTA 3ZTLA 3C71A 4IP1A 4POMA 3PPUA 2ZUPA 3GYKA 3F3QA 1M9AA 1SYXA 2OACA 3UVTA 2IMFA 2A2RA 2ON7A 3FYGA 1GUMA 1B9YC 1TKDB 2L6DA 4TR1A 3D21A 2F9SA 5G30A 5CO3A 2O89A 3GSTA 1SD9A 4G10A 4IVFA 2H1BA 5EL8A 3EWLA 1TI3A 4K7NA 4HJ2A 1U3AA 3QFAC 10GSA 4IELA 2CV4A 5KEJA 2VCZA 1X0RA 3IK7A 4MPGA 1GSEA 6GSXA 2JU5A 4MF5A 3H1NA 4MH3A 1ML6A 2FCHA 5GSSA 3NIVA 1XW9A 1A8YA 1ZL9A 1F37A 5D8IA 1K0MA 4NAXA 4QQ7A 2FD3A 5J3RA 1PKWA 5IMAA 4OMVA 5JCWA 2NPBA 3KEBA 1TTZA 1YJ6A 4EUYA 4NHWA 2KP2A 2HSNB 4LMWA 4JU5A 3KIJA 4OFTA 5INYA 4KH7A 3QAWA 4PNGA 1J0FA 5ECHB 1Z3EA 3M0FA 2DIZA 2JSYA 1T3BA 4HS1A 3UAPA 3TKQA 1TXXA 2JZSA 3L4NA 2WULA 4LMVA 1JFUA 3C73A 1F3BA 2LQOA 3KTLA 1AAZA 1M2BA 2VL3A 2NDOA 3HJPA 4IN0A 2H71A 3BOAA 4PTSA 1XVQA 3P90A 3GH6A 1T7PB 4TRXA 6GSSA 2H6YA 1SJ6A 3I9V2 3GHAA 11GSA 2H01A 2X99A 2VIMA 2HYXA 2PU9C 2M72A 4TR3A 2NBSA 3TDGA 2H74A 3F0IA 3A5WA 1IYHA 3WD6A 3VURA 3NOFA 1FVKA 2CAIA 1YF0A 4Z7XA 5A4VA 14GSA 2I3YA 5F05A 3M9KA 3IA1A 2WJUA 4PUFC 1DUGA 5J9CA 4GQCA 2RUEA 3ZL5A 4FYBA 4ZL9A 2LRTA 2DJ1A 3EINA 3VLNA 3TKRA 4USSA 2GLRA 1PMTA 2JADA 3ED3A 1ZMAA 1K0AA 1MEKA 3HCZA 1SK2A 1EGRA 2C80A 1M2AA 1FAAA 3CTFA 5B7CA 4HZ2A 2B1KA 3AY8A 1M9BA 5FT3A 1XFLA 1HNAA 1M0UA 1O81A 3LWAA 3IRAA 1G7OA 1SU9A 5ABRA 1GUKA 2CAQA 1ON4A 4HOJA 2HI7A 4GQFA 1SK1A 2GDRA 3MSZA 4JR4A 3GNJA 2WS2A 2DJ0A 5AN1A 2I1UA 3UVHA 1CQHA 2BJXA 1TRSA 4GSSA 4L5OA 4V2MA 3H4KA 4F0CA 1YQ1A 2YJ7A 1EP8A 2H6XA 5ECSA 2WDUA 1USBA 4AF2A 5E59A 2L57A 3GKKA 1MD3A 2HT9A 3TJKA 4WBJA 4ZBBA 1GSUA 4V1Ag 3TGZA 2H1AA 3S9FA 3D5JA 1JHBA 2PBJA 4K7IA 4EC0A 1U6TA 1G6YA 2GZPA 3EU3A 1GNEA 2YV9A 2DMMA 2OBIA 3BD2A 3RPNA 2X8CA 4RI7A 1GLPA 1A8LA 4WF4A 2LJKA 4XS4A 1SYRA 4IHUA 3CSHA 3ZFBA 1Z6MA 2JZRA 3UBLA 2IMDA 2C0FA 2LRNA 3HJMA 2H70A 4MA9A 3GH9A 1Q98A 5IPHA 4BPYA 3I6AA 1X5DA 1AW9A 3FKFA 3IOSA 1DSBA 3WYWA 4ML1A 2QKEA 3A2WA 5D93A 4XCSA 1AC1A 5J41A 3K8NA 3WGEA 4AJ7A 1CQGA 1PX7A 4XS1A 4DSQA 2HRAA 1T4YA 5JCGA 1FB6A 2Z9SA 3IHQA 3EC3A 3GKNA 3A3TA 1EOGA 2WCIA 3MWHA 1XW6A 1W4VA 4BVYB 1Z7RA 2VOCA 4IQ1A 5DDLA 1JZOA 5JWRB 3LYPA 4WETA 4EVMA 5IPGA 4EF0A 3V1WA 1UC7A 4XRDA 2H66A 2VLVA 2GZYA 1UVZA 4ISDA 4XHMA 3PR8A 4YQVA 3GL5A 1R4WA 4G0IA 2MZCA 3OR5A 4IQAA 2H1GA 1YF1A 1O8XA 4TKYA 2NVLA 3F6DA 1AXDA 3Q18A 4JBBA 3ZMLA 1FB0A 3FR9A 3CRUA 4O7HA 3HVSA 3HKRA 3RHBA 2ES7A 5IIZA 2BTOT 3HZ8A 5ECPB 2TIRA 3P2AA 1OC8A 3GV1A 1TJDA 4DVCA 3UJ1A 4BVYA 4PQHA 2FWEA 3KCMA 1B8XA 4OFNA 3MNGA 4KGIA 5CRGA 2FHEA 5F07A 4N10A 4KB3A 4K8MA 2YZUA 1R5AA 4GSNA 1TRVA 1PN9A 2QGVA 5IOXA 5HFKA 5G5FA 1LJRA 1TOFA 2MBSA 3U5RE 3R3EA 2YOIA 1J08A 1O6JA 2YZHA 2H73A 1FG4A 4TXOB 3APSA 1K3LA 4RQXA 2HSMB 2X8GA 3TJFA 1O7UA 4ECBA 2PUKC 2MBTA 4JR6A 1ILOA 3HYPA 1YKCA 4JE1A 3CTGA 5G1KA 4TOPA 4WR4A 3TOTA 3KH9A 1OYJA 1R26A 3WGXA 4K1FA 3TRXA 1SL1B 2XPEA 2N5BA 4V2NA 5GSTA 2L6CA 4MJAA 3VFIA 2PERA 4NWYA 2HQTA 2C3NA 4YH2A 1F3AA 4TXOA 4YAPA 3SBCA 2B7JA 3F3RA 4OWYA 3SWLA 4FYCA 1QXHA 2F8FA 4CHSA 4HJMA 3L9SA 4H86A 1EP7A 3UOMA 2PGTA 4KDUA 1THXA 2XBIA 4MPFA 3D0ZA 4F03A 4JRRA 3CYNA 4NPBA 1ZZYA 4BWQA 1MDIA 1FW1A 5AIXA 4XS6A 1V98A 4YAVA 5DVBA 1WMJA 1V40A 2V2GA 1GWCA 1BQ7A 3ERWA 5CP1A 2H30A 1SJZA 4WF5A 1BYEA 3G9BA 4NV2A 5G2ZA 4NXIA 1DE2A 1XPVA 2LUSA 5JCUA 3ME8A 3DYRA 5EPFA 5ECNB 1BEDA 1DBYA 1I9DA 4CW9A 3VI5A 2R3XA 2P5RA 3APOA 2LRCA 5COHA 4AJ6A 3E0UA 3DD3A 5B8BA 2C4JA 1V58A 5ECQB 1A0FA 5B8AA 4LA1A 1V9WA 1YEXA 3ZYWA 5ECRB 4RQRA 2FA8A 4O92A 1X5CA 2L5LA 1B4QA 3IAM2 2IL3A 4KCEA 2OBKA 3W6GA 4MMMA 5D9TA 2L4CA 1ERVA 1WWJA 3F4RA 4KX4A 2PVQA 5IMZA 2B3SA 3GMFA 2H76A 16GSA 2V1MA 2I81A 3HZ4A 3DMLA 3UMAA 5KN2A 1IYIA 3US3A 2K18A 2K8SA 1BX9A 3LSZA 1Y6EA 4FYUA 3EYTA 2O7KA 2V32A 3KGKA 3IDVA 1GTAA 3D6IA 4MDCA 2HLSA 4IW9A 3FK8A 3TRPA 2JSZA 1ERWA 3DIEA 5KN0A 3F6FA 1O85A 1NHYA 3PGTA 3ZVJD 1N8JA 1X9MB 2AJQB 4KF9A 2KLXA 1F2EA 4GSTA 2ON5A 1K3OA 2UZ8A 1XVWA 5BMUA 2DJJA 1THOA 1TK0B 2GQLA 3F63A 3VPQA 2B1LA 4I6XA 1S3DA 4ZB8A 1I5GA 1GSYA 5D9WA 2H6ZA 5HR3A 3O3TA 2C3QA 2IJYA 4WBRD 3IBHA 4POBA 5LNKe 3HHVA 4K0NA 1K0CA 1PD21 1B9XC 3APQA 1GH2A 4IP6A 5G31A 4HI7A 4KDXA 1TK5B 3EMXA 2HRKB 5CRHA 3IPZA 1K0OA 3M9JA 4MP4A 4ZL7A 4ACSA 2FGXA 2DIYA 1GSQA 3IR4A 2KUCA 2CVKA 2H0HA 1NSWA 2LNTA 2IFQB 4PUAA 2YANA 2E2MA 3IE3A 4ZL8A 3KMOA 1M2DA 3TCOA 3LXTA 6GSYA 3EMPA 3IV4A 2V6KA 2K9FA 2VAFA 2B5XA 1GL8A 4K6XA 4GWRA 3HA9A 2YWIA 1JLWA 3UIWA 3GKXA 2LKUA 2GS3A 2PVOC 4X43A 1E6BA 1FHEA 2HRKA 1OC9B 1JZRA 2VCVA 3D4MA 1FOVA 1JZWA 3BJ5A 2B5EA 2VM1A 5DQYA 5IO0A 5EY6A 4HQSA 4XS4B 1XWBA 4HDEA 2DC5A 3CXGA 1MD4A 4CDOA 1YKAA 3ZREA 4Q5RA 2KHPA 2IFQA 2MMOA 3GTUB 2KOKA 4NMUA 1T1VA 2VO4A 1XIYA 2R2JA 4TN8A 5J5NA 2FUG2 3CRTA 1WRYA 3GUSA 2FLSA 1XWKA 3IC8A 1X5EA 3QD9A 1EV4A 2GQKA 1K0BA 3FHKA 4L0UA 3FZ5A 2C3TA 1WP0A 1TU7A 1NM3A 3GX8A 1QK8A 3DWVA 1OC9A 4AJ8A 3G7JA 22GSA 5C04A 3GIXA 4EE0A 3TB2A 4PQ1A 2E7PA 4L5LA 2H0IA 4FQUA 5ID2B 3GTUA 3A2VA 1A2JA 5HQPA 3ZVJA 3CSJA 2R5GA 1YEPA 3BCIA 4Q5FA 2VL2C 3BCKA 5H5SA 2CZ3A 4IBPA 4IS0A 3ERFA 2IIYA 1XCCA 3U6VA 2DMLA 2H0GA 4BA7A 3DVXA 3HY2A 5GZZB 1HD2A 2E0QA 3O6TA 1E2YA 2JACA 4F82A 4WR5A 3DEXA 3HDCA 4KE3A 1A2LA 3RPPA 3A2XA 1AQVA 1XWAA 2MMNA 5ECKB 3TKPA 3TKSE 1EOHA 1ZYEA 2G2QA 2HZEA 3HD5A 5B6MA 8GSSA 2YWNA 2XBQA 2GSQA 5ID2A 4ILFA 3WT1A 1AUCA 3M1GA 5D96A 2C0EA 4K2DA 3ZZXA 4ZB6A 5GAND 4ZILA 20GSA 2OE3A 3D22A 2PPTA 4MJBA 1MDJA 5F06A 1URMA 4GCIA 4BWSA 4GTUA 1PRXA 2OE1A 1N2AA 3E9JB 1G6WA 3E3EA 2O8VB 5DALB 3FEUA 3FZ4A 5FWGA 4K9ZA 1HNCA 1ERUA 5D73A 5ECOB 1WPIA 1V57A 3I43A 1GSFA 2AV4A 2OA7A 3DRNA 1PSQA 2GGTA 4G19A 2QSIA 3FR3A 3C1RA 1A2MA 2H72A 1HYUA 2J23A 5DAKB 2BMXA 4WEYA 1AQXA 3QPMA 5IMVA 3KZQA 1GTBA 1O73A 1XWCA 3ZLPA 2TRXA 2VCTA 2PMTA 2GQMA 3FZ9A 3LFLA 1XXUA 2HFDA 2FNOA 4RI6A 4PURA 2HSHA 4X0XA 4ID0A 2PWJA 6GSUA 3ERGA 2WGRA 1LBKA 1WJKA 3GN3A 4O32A 2DJ2A 2XPDA 1SL0B 1SKRB 2H19A 1OC3A 2CX4A 4XTSA 1FVJA 3QCPA 1TU8A 1U3IA 2B7KA 5E4WA 2R4VA 3ZMKA 1XWGA 5DALA 4EXJA 2YP6A 3P7XA 3CSIA 1RW1A 2LV3A 4XRAA 4GRFA 4N11A 5G5EA 3EURA 3DGQA 4OCFA 5DAKA 2RIIA 3TRQA 2VLTA 12GSA 4OCEA 1Z7PA 3F8UA 3UBKA 6GSTA 2RM5A 1SKSB 3WGDA 3MAKA 3RAZA 1A23A 3IXRA 2D2ZA 3GX0A 3IAS2 2VCXA 2EIRA 1U87A 2YCDA 4L8EA 1G7EA 1TP9A 2YV7A 1ZCPA 3H8QA 1GTUA 4LL1B 1PX6A 2IWTA 4QL7A 1GSDA 3L9VA 4KUNA 1LU4A 1QMVA 2C0GA 1AQWA 1GULA 4HZ4A 4LLRA 13GSA 2VL2A 2PN8A 4ULXA 3QAVA 4KW6A 4WKWA 3KMNA 4TXVA 3F9UA 4EKZA 4EDZA 1M7TA 1Z9HA 5FHIA 1KBNA 4G0KA 3TJBA 5DBQA 2HSYA 4IKHA 4F0BA 3J7Yk 3MDKA 2HRNA 3VWWA 3VWXA 1EEJA 2CVDA 3JCML 4MCUA 1HNBA 4TR4A 2TRCP 5KN1A 5IQYA 2F3MA 1DE1A 1XZOA 1EV9A 3L9UA 3CMIA 3LQ7A 4E8EA 1G0TA 2A2SA 2CT6A 5IO2A 1HQOA 4OFMA 2ZCTA 5CYYA 3EE2A 5CREA 2FWFA 3FZAA 2RUFA 2K8VA 2YJHA 3KJYA 2ALBA 2VUPA 4I2UA 1SL2B 1GSSA 1EWXA 2LJAA 3TUEA 3EU4A 2FWHA 2M46A 1OKTA 1JLVA 1FO5A 5HFIA 1VF4A 1XOAA 3TJGA 4YQMA 4KSMA 1F9MA 3H79A 5ECLB 2WRTA 4HU7A 1Y25A 5JWQB 2VCQA 5KN3A 3G7YA 3PH9A 3EVIA 1VF1A 2B6MA 4F9ZA 4N30A 1S3CA 1R7HA 3C7MA 2GTUA 4NV5A 1K0NA 3HXSA 4I2TA 1GUHA 1H75A 1NHOA 3KXOA 5C00A 5H5QA 3UARA 1OAZA 1QFNA 5ELGA 3DVWA 2MMAA 1Q4JA 2YWMA 4MJCA 3F4TA 3J7Yb 3N5OA 5F0GA 4POLA 4FO5A 3QDNA 4HU9A 3Q6OA 3FW2A 4MZBA 1OVNA 3TJJA 1SENA 3QR6A 1A0RP 2LNSA 1WE0A 1T8EB 4KNDA 2VM2A 5ENUA 3VWUA 4IGJA 4BL7B 4FIWA 4HUAA 2CA8A 4IJ3A 3ZIJA 2GSSA 4FH8A 1GNWA 7GSSA 1S3AA 1BG5A 4ZXGA 3ZITA 1BJXA 5J9BA 2LS5A 2IN3A 3LEFA 3VK9A 2M80A 2IPAA 4MZCA 4Q5NA 5AGYA 4OO4A 1AIUA 2AAWA 1J9BA 2LQQA 1R5PA 2IMIA 4J56E 5HR0A 3QAGA 1MDKA 4HEA2 17GSA 5JWOB 3GURA 5IMCA 1Z6NA 2REMA 1X9WB 2CQ9A 3UL3A 4QL9A 1TRWA 4BL7A 2GVPA 1V2AA 2E2GA 1OE7A 3L78A 4AGSA 3Q19A 3RHCA 3UEMA 3FR6A 2VL9A 1KTEA 3IC4A 1QQ2A 2YPMA 4TR0A 19GSA 1XBSA 2LEGA 3GRXA 1WIKA 2F8AA 4ECCA 4I97A 1ABAA 2VLUA 3VWVA 2C8UA 3FY7A 4ZIJA 2V41A 2KP1A 1M99A 2MYGA 3I69A 2VD1A 3KM6A 1SD8A 5DCGA 4MF6A 5HFGA 2LSTA 1H4OA 5B6NA 4X1UA 2N5AA 4DSSB 4J2FA 4ZBAA 4BVXB 2VD0A 1PQNA 4NHZA 4EDYA 4RUVA 5A5KA 2EIQA 4K7OA 1KEBA 1K0DA 1ZYQB 4LL4B 3RDWA 2XC2A 1PA3A 2GSTA 4GF0A 2MMZA 4PNFA 2P5QA 4XIHA 1C72A 5EVOA 3F4SA 3ME7A 4EO3A 2LTKA 1TK8B 6GSVA 5GAPD 2J9HA 1VGLA 4KCAA 3CBUA 1K3YA 2HZFA 3KD0A 3W8SA 2HZEB 1ERTA 3KTBA 4DSSA 4BVXA 2DJ3A 3GL3A 3G7IA 3QMXA 3ZRDA 4PGTA 2GT5A 3TOUA 5CRDA 3HJOA 2C1YA 4ML6A 4MABA 2N5FA 1Z5YE 4KDYA 1JZDA 2K6VA 3TKSC 4G9HA 2HNLA 3GFKA 4HQZA 2X8HA 3Q74A 1T4ZA 4G2EA 2G0FA 4EL1A 1VF3A 2EIOA 3KH7A 1OE8A 2L5OA 1GLQA 4MH2A 2HRFA 1XW5A 2B5YA 5IM9A 1ZGNA 1B48A 3LJRA 3ISOA 3H93A 5F8BA 4D73B 1BAYA 2X64A 3N9JA 5LD0A 3KP9A 2H8LA 1RQMA 1X9SB 2O87A 1PGTA 2DSAA 1YDKA 1TI1A 2YWOA 2GT6A 3M8NA 5D9XA 4JEDA 5CAXA 3IK9A 3QOUA 1EGOA 2OJLA 2WB9A 5A4UA 9GSSA 4P3YB 4L0WA 1KNGA 1MTCA 1F6MC 2L59A 2DBCA 2CZ2A 2YN1A 2RM6A 4D73A 2QC7A 3VI7A 2RLIA 1TRUA 4ECJA 2AB6A 2FA4A 4ECIA 5LCZA 2R6KA 3ZIVA 3WT2A 4MF7A 4G0LA 2AUVA 4GXZA 1U88A 5IMFA 4PQIA 2OADA 5DJMA 1SK0A 3HVVA 1YY7A 18GSA 3PINA 2L4QA 2YNXA 1WOUA 4I5QA 5DJLA 1ZOFA 5G1LA 4KA0A 5D9VA 2AYTA 4J57E 5CRWA 3DXBA 2R37A 3GKMA 2P31A 4F2IA 3DKSA 5AIVA 4O5RA 3LG6A 3GA4A 4TW5A 2I9HA 3NZNA 2P0GA 3KP8A 3GSSA 2H75A 2C0DA 5DQSA 2ZNMA 2OKAA 2O85A 1PL1A 4OO5A 5ECIB 5CNWA 1QGVA 5AISA 4E8HA 5J4UA 1ACVA 4DSRA 2XHFA 1W89A 2CVBA 4ZBDA 1SJIA 4MZWA 1YZXA 1TW9A 2WZ9A 1SKWB 5ECMB 4YQUA 3FRCA 5H5RA 4PX1A 1EZKA 2LJRA 1A24A 2HE3A 2I4AA 3LORA 6GSWA 1VRSD 3C8EA 5HR1A 1B4PA 1PKZA 2WFCA 4MLYA 4OD7A 2AHEA 3C1SA 1QUWA 3LXZA 2V6OA 4K0GA 2NTOA 4N0ZA 1VF2A 5IMDA 2FWGA 3BBYA 5DCHA 3VPTA 4PXOA 1GP1A 4MK3A 3M3MA 1EEMA 2JL4A 3O76A 5IOWA 1XOBA 2DLXA 2CX3A 2IMEA 4KAEA 3TKSA 4V2LA 4DEJA 3R2QA 4IJIA 3ZFLA 4MJEA 1O8WA 1GTIA 1PL2A 2A4VA 2F51A 1OKDA 4V1Ap 4WXTA 2GSRA 2GZZA 3HVXA 4N0VA 2OE0A 2HSMA 5L71A 4POKA 3LYKA 2FY6A 4TR1B 2EC4A 4I8BA 1GRXA 1UA5A 1UN2A 3L0HA 2H1DA 1T00A 3QFBC 2VCWA 5ELAA 3W8JA 1TDIA 4KSOA 4ZB9A 4JZQA 1NW2A 4Q5QA 2IMKA 1ST9A 5A4WA
chains in the Genus database with same CATH superfamily
2HXKA 5HR2A 1RK4A 3RBTA 3P8WA 4GLTA 2DJKA 3D4TA 3LGCA 4TVEA 2JZTA 3ZTLA 3C71A 4IP1A 4POMA 3PPUA 2ZUPA 4N3ZA 3GYKA 3F3QA 1M9AA 1SYXA 2OACA 3UVTA 2IMFA 2A2RA 2ON7A 3FYGA 1GUMA 1B9YC 1SVOA 1TKDB 2L6DA 4TR1A 3D21A 2F9SA 5G30A 5CO3A 2O89A 3GSTA 1SD9A 4G10A 4PI0C 4IVFA 2H1BA 5EL8A 3EWLA 1TI3A 4K7NA 4HJ2A 1U3AA 3QFAC 10GSA 4IELA 2CV4A 5KEJA 1PN0A 2VCZA 1X0RA 3IK7A 4MPGA 1GSEA 6GSXA 2JU5A 4MF5A 3H1NA 4MH3A 1ML6A 1S4BP 2FCHA 5GSSA 4CY8A 3NIVA 1XW9A 1A8YA 1ZL9A 1F37A 5D8IA 1K0MA 4NAXA 4QQ7A 2FD3A 5J3RA 1PKWA 5IMAA 4OMVA 5JCWA 2NPBA 4E68A 3KEBA 1TTZA 1YJ6A 4EUYA 4NHWA 2KP2A 2HSNB 4LMWA 4JU5A 3KIJA 4OFTA 5INYA 4KH7A 2VKZG 3QAWA 4PNGA 1J0FA 5ECHB 1Z3EA 3M0FA 2DIZA 2WVXB 2JSYA 1T3BA 4HS1A 3UAPA 3TKQA 1TXXA 2JZSA 3L4NA 3TU3B 2WULA 4LMVA 1JFUA 3C73A 1F3BA 2LQOA 3KTLA 1AAZA 1M2BA 2VL3A 2NDOA 3HJPA 4IN0A 2H71A 3BOAA 4PTSA 1XVQA 3P90A 3GH6A 1T7PB 4TRXA 6GSSA 2H6YA 1SJ6A 3I9V2 3GHAA 11GSA 2OT3A 2H01A 2X99A 2VIMA 2HYXA 2PU9C 2M72A 4TR3A 2NBSA 3TDGA 2WVZA 2H74A 3F0IA 3A5WA 1IYHA 3WD6A 2WVXA 3VURA 3NOFA 1FVKA 2CAIA 1YF0A 4Z7XA 5A4VA 14GSA 2I3YA 5F05A 3M9KA 3IA1A 2WJUA 4PUFC 1DUGA 5J9CA 2R0PA 4GQCA 2RUEA 3ZL5A 4FYBA 4ZL9A 2LRTA 2DJ1A 3EINA 3VLNA 3TKRA 4USSA 2GLRA 1PMTA 2JADA 3ED3A 1ZMAA 1K0AA 1MEKA 3HCZA 1SK2A 1EGRA 2C80A 1M2AA 1FAAA 3IHGA 3CTFA 5B7CA 4HZ2A 2B1KA 3AY8A 1M9BA 5FT3A 1XFLA 1HNAA 1M0UA 1I1IP 1O81A 3LWAA 3IRAA 1G7OA 1SU9A 5ABRA 1GUKA 2CAQA 1ON4A 4HOJA 2HI7A 4GQFA 1SK1A 2GDRA 3MSZA 4JR4A 3GNJA 2WS2A 2DJ0A 5AN1A 2I1UA 3UVHA 1CQHA 2BJXA 1TRSA 4GSSA 4L5OA 4V2MA 3H4KA 4F0CA 1YQ1A 2YJ7A 1EP8A 2H6XA 5ECSA 2WDUA 1USBA 4AF2A 5E59A 2L57A 3GKKA 1MD3A 2HT9A 3TJKA 4WBJA 4ZBBA 1GSUA 4V1Ag 3TGZA 2H1AA 3S9FA 3D5JA 1JHBA 2PBJA 4K7IA 4EC0A 1U6TA 1G6YA 2GZPA 3EU3A 1GNEA 2YV9A 2DMMA 1PFOA 2OBIA 3BD2A 3RPNA 2X8CA 4RI7A 1GLPA 1A8LA 4WF4A 2LJKA 4XS4A 1SYRA 4IHUA 3CSHA 3ZFBA 1Z6MA 2JZRA 3UBLA 2IMDA 5J47A 2C0FA 2WW1A 2LRNA 3HJMA 2H70A 4MA9A 3GH9A 1Q98A 5IPHA 4BPYA 3CHXC 3I6AA 3EPTA 1X5DA 1AW9A 1TXUA 3FKFA 3IOSA 1DSBA 3WYWA 4ML1A 2QKEA 3A2WA 5D93A 4XCSA 1AC1A 5J41A 3K8NA 3WGEA 4AJ7A 1CQGA 1PX7A 4HSCX 4XS1A 4DSQA 2HRAA 1T4YA 2R0GA 5JCGA 1FB6A 2Z9SA 3IHQA 3EC3A 3GKNA 3A3TA 1EOGA 2WCIA 3MWHA 1XW6A 1W4VA 4BVYB 1Z7RA 2VOCA 4IQ1A 5DDLA 1JZOA 5JWRB 3LYPA 4WETA 4EVMA 5IPGA 4EF0A 3V1WA 1UC7A 4XRDA 2WVYA 2H66A 2VLVA 2GZYA 1UVZA 1BF5A 4ISDA 4XHMA 3PR8A 4YQVA 3GL5A 1R4WA 4G0IA 2MZCA 3OR5A 4IQAA 2H1GA 1YF1A 1O8XA 4TKYA 2NVLA 3F6DA 1AXDA 1S3RA 3Q18A 4JBBA 3ZMLA 1FB0A 3FR9A 3A5IA 3CRUA 4O7HA 3HVSA 3HKRA 3RHBA 4EIQA 4CY6A 2ES7A 5IIZA 2BTOT 3HZ8A 5ECPB 2TIRA 3P2AA 1OC8A 3GV1A 1TJDA 4DVCA 3UJ1A 4BVYA 4PQHA 2FWEA 4FXYP 3KCMA 1B8XA 4OFNA 3MNGA 4KGIA 5CRGA 2FHEA 5F07A 4N10A 1SVMA 4KB3A 4K8MA 2YZUA 1R5AA 4GSNA 1TRVA 1PN9A 5KOWA 2X49A 2QGVA 4PI2C 5IOXA 5HFKA 5G5FA 1LJRA 1TOFA 2MBSA 3U5RE 3CWGA 3R3EA 2YOIA 1J08A 1O6JA 2YZHA 2H73A 1FG4A 4TXOB 3APSA 1K3LA 4RQXA 2HSMB 2X8GA 1ZYPA 3TJFA 1O7UA 4ECBA 2PUKC 2MBTA 4JR6A 1ILOA 3HYPA 1YKCA 4JE1A 3CTGA 5G1KA 4TOPA 4WR4A 3TOTA 5KOXA 3KH9A 1OYJA 1R26A 3WGXA 4K1FA 3TRXA 1SL1B 2XPEA 2N5BA 4V2NA 5GSTA 2L6CA 4MJAA 3VFIA 2PERA 4NWYA 2HQTA 2C3NA 4YH2A 1F3AA 4TXOA 4YAPA 3SBCA 2B7JA 3F3RA 4OWYA 1M3IA 3SWLA 4FYCA 1QXHA 2F8FA 4CHSA 4HJMA 3L9SA 4H86A 1EP7A 3UOMA 2PGTA 4KDUA 1THXA 2XBIA 4MPFA 3D0ZA 4F03A 4JRRA 3CYNA 4NPBA 1ZZYA 4BWQA 5BRTA 1MDIA 1FW1A 5AIXA 4XS6A 1V98A 4YAVA 5DVBA 1WMJA 2WZSA 1V40A 2V2GA 1GWCA 1BQ7A 3ERWA 5CP1A 2H30A 4ZB7A 1SJZA 4WF5A 1BYEA 3G9BA 4NV2A 5G2ZA 4NXIA 1DE2A 1XPVA 4G01A 2LUSA 5JCUA 3ME8A 3DYRA 5EPFA 5ECNB 1BEDA 2UV8G 1I9DA 1DBYA 4CW9A 3VI5A 2R3XA 2P5RA 3APOA 5A5HB 2LRCA 5COHA 4AJ6A 3E0UA 3DD3A 5B8BA 2C4JA 1V58A 5ECQB 1A0FA 5B8AA 4LA1A 1V9WA 1YEXA 3ZYWA 5ECRB 4RQRA 3MIXA 2FA8A 4O92A 1X5CA 2L5LA 1B4QA 3IAM2 2IL3A 4KCEA 2OBKA 3W6GA 4MMMA 5D9TA 2L4CA 2A2PA 1ERVA 1WWJA 3F4RA 4KX4A 2PVQA 5IMZA 2B3SA 3GMFA 5BMUB 2H76A 16GSA 2V1MA 2I81A 3HZ4A 3DMLA 5A5HA 3UMAA 2O36A 5KN2A 1IYIA 3US3A 2K18A 2K8SA 4YKFA 1BX9A 3LSZA 1Y6EA 4FYUA 3EYTA 4MNNA 2O7KA 2V32A 3KGKA 3IDVA 1FOHA 1GTAA 3D6IA 4MDCA 2HLSA 4IW9A 3FK8A 3TRPA 2JSZA 1ERWA 3DIEA 5KN0A 3F6FA 1O85A 1NHYA 3PGTA 3ZVJD 1N8JA 1X9MB 2AJQB 2QA2A 4KF9A 2KLXA 1F2EA 4GSTA 2ON5A 1K3OA 2UZ8A 1XVWA 5BMUA 2DJJA 1THOA 1TK0B 2GQLA 3F63A 3VPQA 2B1LA 4I6XA 1S3DA 4ZB8A 1I5GA 1GSYA 5D9WA 2H6ZA 5HR3A 3O3TA 2C3QA 2IJYA 4AKGA 4WBRD 3IBHA 4POBA 5LNKe 3HHVA 4K0NA 1K0CA 1PD21 1B9XC 3APQA 1GH2A 4IP6A 5G31A 4HI7A 4KDXA 1TK5B 3EMXA 2HRKB 5CRHA 5A4WA 3CQFA 4GDFA 5J4YA 3IPZA 1K0OA 3M9JA 4MP4A 4ZL7A 2EFDA 4ACSA 2FGXA 2DIYA 1GSQA 3IR4A 4ICYA 2KUCA 2CVKA 2H0HA 1NSWA 4O5QA 2LNTA 2IFQB 4PUAA 2YANA 2E2MA 3IE3A 4ZL8A 3KMOA 1M2DA 3TCOA 4AKHA 5A1NB 3LXTA 6GSYA 3EMPA 3IV4A 2V6KA 2K9FA 2VAFA 2B5XA 1GL8A 4K6XA 4GWRA 3HA9A 2YWIA 1JLWA 2H1LA 3LW9A 3UIWA 3GKXA 2LKUA 2GS3A 2PVOC 4X43A 1E6BA 1FHEA 2HRKA 1OC9B 1JZRA 2VCVA 3D4MA 1FOVA 1JZWA 3BJ5A 2B5EA 2VM1A 5DQYA 5IO0A 5EY6A 4HQSA 4XS4B 1XWBA 4HDEA 2DC5A 3CXGA 1MD4A 4CDOA 1YKAA 3ZREA 4Q5RA 2KHPA 2IFQA 2MMOA 3GTUB 2KOKA 4NMUA 1T1VA 2VO4A 5A1NA 1XIYA 2R2JA 4TN8A 5J5NA 2FUG2 3CRTA 1WRYA 3GUSA 2FLSA 1XWKA 3IC8A 1X5EA 3QD9A 1EV4A 2GQKA 1K0BA 5A34B 3FHKA 4L0UA 3FZ5A 2C3TA 1WP0A 1TU7A 1NM3A 3GX8A 1QK8A 3DWVA 1OC9A 4AJ8A 3G7JA 22GSA 5C04A 3GIXA 4EE0A 3TB2A 4PQ1A 2E7PA 4L5LA 2H0IA 4FQUA 4QMKA 5ID2B 3GTUA 3A2VA 1A2JA 5HQPA 3ZVJA 3CSJA 2R5GA 1YEPA 3BCIA 4Q5FA 2VL2C 3BCKA 5H5SA 2CZ3A 4IBPA 4IS0A 3ERFA 2IIYA 1XCCA 3U6VA 2DMLA 2H0GA 4BA7A 3DVXA 3HY2A 5A34A 5GZZB 1HD2A 2E0QA 3O6TA 3RGBC 1E2YA 2JACA 4F82A 4WR5A 4Z2UA 3DEXA 3HDCA 4KE3A 1A2LA 3RPPA 3A2XA 1AQVA 1XWAA 2MMNA 5ECKB 2X4AA 3TKPA 3TKSE 1EOHA 1ZYEA 2G2QA 2HZEA 3HD5A 5B6MA 4PHZC 8GSSA 2YWNA 2XBQA 2GSQA 5ID2A 4ILFA 3WT1A 1AUCA 3M1GA 5D96A 2C0EA 4K2DA 3ZZXA 4ZB6A 5GAND 4ZILA 20GSA 2OE3A 3D22A 2PPTA 4MJBA 1MDJA 5F06A 1URMA 4GCIA 4BWSA 4GTUA 1PRXA 2OE1A 1N2AA 3E9JB 1G6WA 3E3EA 2O8VB 5DALB 3FEUA 3FZ4A 5FWGA 4K9ZA 1HNCA 1ERUA 5D73A 5ECOB 1WPIA 1V57A 3I43A 1GSFA 2AV4A 2OA7A 1ZYNA 3DRNA 1PSQA 2GGTA 4G19A 2QSIA 3FR3A 3C1RA 1A2MA 2H72A 1HYUA 2J23A 5DAKB 2BMXA 4WEYA 1AQXA 3QPMA 5IMVA 3KZQA 1GTBA 1O73A 1XWCA 3ZLPA 2TRXA 2VCTA 2PMTA 2GQMA 3FZ9A 3LFLA 1XXUA 2HFDA 2FNOA 4RI6A 4PURA 2HSHA 4X0XA 4ID0A 2PWJA 6GSUA 3ERGA 2WGRA 1LBKA 1WJKA 3GN3A 4O32A 2DJ2A 2XPDA 1SL0B 1SKRB 2H19A 1OC3A 2CX4A 4XTSA 4AKIA 1FVJA 3QCPA 1TU8A 1U3IA 2B7KA 5E4WA 2R4VA 3ZMKA 1XWGA 5DALA 4EXJA 2YP6A 3P7XA 3HVNA 3CSIA 1RW1A 2LV3A 4XRAA 4GRFA 4N11A 5G5EA 3EURA 3DGQA 4OCFA 1BG1A 5DAKA 2RIIA 3TRQA 2VLTA 12GSA 4A5PA 4OCEA 1Z7PA 3F8UA 3UBKA 6GSTA 2RM5A 1SKSB 2DKIA 3WGDA 3MAKA 4K5RA 3RAZA 2O5VA 1A23A 3IXRA 2D2ZA 3GX0A 3IAS2 2VCXA 2EIRA 1U87A 2R0CA 2YCDA 4L8EA 1G7EA 1TP9A 2YV7A 1ZCPA 3H8QA 1GTUA 4LL1B 1PX6A 2IWTA 4QL7A 1GSDA 3L9VA 4KUNA 1LU4A 1QMVA 2C0GA 1AQWA 1GULA 4HZ4A 4LLRA 4EIPA 13GSA 2VL2A 2PN8A 4ULXA 3QAVA 4KW6A 4WKWA 3KMNA 4TXVA 3F9UA 4EKZA 4EDZA 1M7TA 1Z9HA 5FHIA 1KBNA 4G0KA 5J40A 3TJBA 5DBQA 2HSYA 4IKHA 4K2XA 4F0BA 3J7Yk 3MDKA 2HRNA 3VWWA 3VWXA 1EEJA 2CVDA 3JCML 4MCUA 4O5UA 1HNBA 4TR4A 2TRCP 5KN1A 5IQYA 2F3MA 1DE1A 1XZOA 1EV9A 3L9UA 3CMIA 3LQ7A 4E8EA 1G0TA 2A2SA 2CT6A 5IO2A 1HQOA 4OFMA 2ZCTA 5CYYA 3EE2A 5CREA 2FWFA 3FZAA 2RUFA 2K8VA 2YJHA 3KJYA 2ALBA 2VUPA 4I2UA 1SL2B 1GSSA 1EWXA 2LJAA 3TUEA 3EU4A 2FWHA 2M46A 1OKTA 1JLVA 1M3JA 1FO5A 5HFIA 1VF4A 1XOAA 3TJGA 4YQMA 4KSMA 1F9MA 3H79A 5ECLB 2WRTA 4YKGA 4HU7A 1Y25A 5JWQB 2VCQA 5KN3A 3G7YA 3PH9A 3EVIA 1VF1A 2B6MA 4BIKA 4F9ZA 4N30A 1S3CA 1R7HA 3C7MA 2GTUA 4NV5A 1K0NA 3HXSA 4I2TA 1GUHA 1H75A 1NHOA 3KXOA 5C00A 5H5QA 3UARA 1OAZA 1QFNA 5ELGA 3DVWA 2MMAA 1Q4JA 2YWMA 2EFCA 4MJCA 3F4TA 3J7Yb 3N5OA 5F0GA 4POLA 4FO5A 3QDNA 4HU9A 3Q6OA 3FW2A 4MZBA 1OVNA 3TJJA 1SENA 3QR6A 1A0RP 2LNSA 1WE0A 1T8EB 4KNDA 2VM2A 5ENUA 3VWUA 4IGJA 4BL7B 4FIWA 4HUAA 2CA8A 4IJ3A 3ZIJA 2GSSA 4FH8A 1GNWA 7GSSA 1S3AA 1BG5A 4ZXGA 3ZITA 1BJXA 5J9BA 2LS5A 2IN3A 3VK9A 3LEFA 2M80A 2IPAA 4MZCA 4Q5NA 5AGYA 4OO4A 1AIUA 3RFRC 2AAWA 1J9BA 2LQQA 2HSNA 1R5PA 2IMIA 4J56E 5HR0A 3QAGA 1MDKA 4HEA2 17GSA 5JWOB 3GURA 5IMCA 1Z6NA 2REMA 1X9WB 2CQ9A 3UL3A 4QL9A 1TRWA 4BL7A 2GVPA 1V2AA 2E2GA 1OE7A 3L78A 4AGSA 3Q19A 3RHCA 3UEMA 3FR6A 2VL9A 1KTEA 2EFHA 3IC4A 1QQ2A 2YPMA 4TR0A 19GSA 1XBSA 2LEGA 3GRXA 1WIKA 2F8AA 4ECCA 4I97A 1ABAA 2VLUA 3VWVA 2C8UA 3FY7A 4ZIJA 2V41A 2KP1A 1M99A 2MYGA 3I69A 2VD1A 3KM6A 2WW3A 5DCGA 1SD8A 4MF6A 5HFGA 2LSTA 1H4OA 5B6NA 4X1UA 2N5AA 4DSSB 4J2FA 4ZBAA 4BVXB 2VD0A 1PQNA 4NHZA 4EDYA 4RUVA 5A5KA 2EIQA 4K7OA 1KEBA 1K0DA 1ZYQB 4LL4B 3RDWA 2XC2A 1PA3A 2GSTA 4GF0A 2MMZA 4PNFA 2P5QA 4XIHA 1C72A 5EVOA 3F4SA 3ME7A 4EO3A 1XG8A 2LTKA 1TK8B 6GSVA 5GAPD 2J9HA 1VGLA 4KCAA 3CBUA 3HMJG 1K3YA 2HZFA 3KD0A 3W8SA 2HZEB 1ERTA 3KTBA 4DSSA 4BVXA 2DJ3A 3GL3A 3G7IA 3QMXA 3ZRDA 4PGTA 2GT5A 3TOUA 5CRDA 3HJOA 4AKXB 2C1YA 4ML6A 4MABA 2N5FA 1Z5YE 4KDYA 1JZDA 2WW2A 2K6VA 3TKSC 3MYDA 4G9HA 2HNLA 3GFKA 4HQZA 2X8HA 3Q74A 1T4ZA 2WW0A 4G2EA 4AI6A 2G0FA 4EL1A 1VF3A 2EIOA 3KH7A 1OE8A 2L5OA 1GLQA 4MH2A 2HRFA 1XW5A 2B5YA 5IM9A 1ZGNA 1B48A 3LJRA 3ISOA 3H93A 5F8BA 4D73B 1BAYA 2X64A 3N9JA 5LD0A 3KP9A 2H8LA 1RQMA 1X9SB 2O87A 1PGTA 2DSAA 1YDKA 1TI1A 2YWOA 2GT6A 3M8NA 5D9XA 4JEDA 5CAXA 3IK9A 3QOUA 4Z2TA 1EGOA 2OJLA 2WB9A 1Y1UA 5A4UA 2EFEA 9GSSA 4P3YB 4L0WA 1KNGA 1MTCA 1F6MC 2L59A 4K5SA 2DBCA 2CZ2A 2YN1A 2RM6A 4D73A 2QC7A 3VI7A 2RLIA 1TRUA 4ECJA 2AB6A 2FA4A 4ECIA 5LCZA 2R6KA 3ZIVA 3WT2A 4MF7A 4G0LA 2AUVA 4GXZA 1U88A 5IMFA 4PQIA 2OADA 5DJMA 1SK0A 3HVVA 1YY7A 18GSA 3PINA 2L4QA 2YNXA 1WOUA 4I5QA 5DJLA 1ZOFA 5G1LA 4KA0A 5D9VA 2AYTA 4J57E 5CRWA 3DXBA 2R37A 3GKMA 2P31A 4F2IA 3DKSA 5AIVA 4O5RA 4W66A 3FMWA 3LG6A 3GA4A 4TW5A 2I9HA 3NZNA 2P0GA 3KP8A 3GSSA 2H75A 2C0DA 5DQSA 4Z2RA 2ZNMA 2OKAA 2O85A 1PL1A 4OO5A 5ECIB 5CNWA 1QGVA 5AISA 4E8HA 5J4UA 1ACVA 4DSRA 2XHFA 1W89A 2CVBA 4ZBDA 1SJIA 4MZWA 1YZXA 1TW9A 2WZ9A 1SKWB 5ECMB 4YQUA 3FRCA 5H5RA 4PX1A 1EZKA 2LJRA 1A24A 2HE3A 2I4AA 3LORA 1N25A 6GSWA 1VRSD 3C8EA 5HR1A 1B4PA 1PKZA 2WFCA 4MLYA 4OD7A 2AHEA 3C1SA 1QUWA 3LXZA 2V6OA 4K0GA 2NTOA 4N0ZA 1VF2A 5IMDA 2FWGA 3BBYA 5DCHA 3VPTA 4PXOA 1GP1A 4MK3A 3M3MA 1EEMA 1SVLA 2JL4A 3O76A 5IOWA 1XOBA 2DLXA 2O3EA 2CX3A 2IMEA 4KAEA 3TKSA 4V2LA 4DEJA 3R2QA 4IJIA 3ZFLA 4MJEA 1O8WA 2DKHA 1GTIA 1PL2A 2A4VA 2F51A 1OKDA 4V1Ap 4WXTA 2GSRA 2GZZA 3HVXA 4N0VA 2OE0A 1YEWC 2HSMA 5L71A 4POKA 3LYKA 2FY6A 4TR1B 2EC4A 4I8BA 1GRXA 1UA5A 1UN2A 3L0HA 2H1DA 1T00A 3QFBC 2VCWA 1YVLA 5ELAA 3W8JA 1TDIA 4KSOA 4ZB9A 4JZQA 2A4HA 1NW2A 5J4VA 4Q5QA 4X4JA 2IMKA 1ST9A 2QA1A
chains in the Genus database with same CATH topology
2HXKA 5HR2A 1RK4A 3RBTA 3P8WA 4GLTA 2DJKA 3D4TA 3LGCA 4TVEA 2JZTA 3ZTLA 3C71A 4IP1A 4POMA 3PPUA 2ZUPA 4N3ZA 3GYKA 3F3QA 1M9AA 1SYXA 2OACA 3UVTA 2IMFA 2A2RA 2ON7A 3FYGA 1GUMA 1B9YC 1SVOA 1TKDB 2L6DA 4TR1A 3D21A 2F9SA 5G30A 5CO3A 2O89A 3GSTA 1SD9A 4G10A 4IVFA 2H1BA 5EL8A 3EWLA 1TI3A 4K7NA 4HJ2A 1U3AA 3QFAC 10GSA 4IELA 2CV4A 5KEJA 1PN0A 2VCZA 1X0RA 3IK7A 4MPGA 1GSEA 6GSXA 2JU5A 4MF5A 3H1NA 4MH3A 1ML6A 2FCHA 5GSSA 4CY8A 3NIVA 1XW9A 1A8YA 1ZL9A 1F37A 5D8IA 1K0MA 4NAXA 4QQ7A 2FD3A 5J3RA 1PKWA 5IMAA 4OMVA 5JCWA 2NPBA 4E68A 3KEBA 1TTZA 1YJ6A 4EUYA 4NHWA 2KP2A 2HSNB 4LMWA 4JU5A 3KIJA 4OFTA 5INYA 4KH7A 2VKZG 3QAWA 4PNGA 1J0FA 5ECHB 1Z3EA 3M0FA 2DIZA 2JSYA 1T3BA 4HS1A 3UAPA 3TKQA 1TXXA 2JZSA 3L4NA 3TU3B 2WULA 4LMVA 1JFUA 3C73A 1F3BA 2LQOA 3KTLA 1AAZA 1M2BA 2VL3A 2NDOA 3HJPA 4IN0A 2H71A 3BOAA 4PTSA 1XVQA 3P90A 3GH6A 1T7PB 4TRXA 6GSSA 2H6YA 1SJ6A 3I9V2 3GHAA 11GSA 2OT3A 2H01A 2X99A 2VIMA 2HYXA 2PU9C 2M72A 4TR3A 2NBSA 3TDGA 2H74A 3F0IA 3A5WA 1IYHA 3WD6A 3VURA 3NOFA 1FVKA 2CAIA 1YF0A 4Z7XA 5A4VA 14GSA 2I3YA 5F05A 3M9KA 3IA1A 2WJUA 4PUFC 1DUGA 5J9CA 2R0PA 4GQCA 2RUEA 3ZL5A 4FYBA 4ZL9A 2LRTA 2DJ1A 3EINA 3VLNA 3TKRA 4USSA 2GLRA 1PMTA 2JADA 3ED3A 1ZMAA 1K0AA 1MEKA 3HCZA 1SK2A 1EGRA 2C80A 1M2AA 1FAAA 3IHGA 3CTFA 5B7CA 4HZ2A 2B1KA 3AY8A 1M9BA 5FT3A 1XFLA 1HNAA 1M0UA 1O81A 3LWAA 3IRAA 1G7OA 1SU9A 5ABRA 1GUKA 2CAQA 1ON4A 4HOJA 2HI7A 4GQFA 1SK1A 2GDRA 3MSZA 4JR4A 3GNJA 2WS2A 2DJ0A 5AN1A 2I1UA 3UVHA 1CQHA 2BJXA 1TRSA 4GSSA 4L5OA 4V2MA 3H4KA 4F0CA 1YQ1A 2YJ7A 1EP8A 2H6XA 5ECSA 2WDUA 1USBA 4AF2A 5E59A 2L57A 3GKKA 1MD3A 2HT9A 3TJKA 4WBJA 4ZBBA 1GSUA 4V1Ag 3TGZA 2H1AA 3S9FA 3D5JA 1JHBA 2PBJA 4K7IA 4EC0A 1U6TA 1G6YA 2GZPA 3EU3A 1GNEA 2YV9A 2DMMA 2OBIA 3BD2A 3RPNA 2X8CA 4RI7A 1GLPA 1A8LA 4WF4A 2LJKA 4XS4A 1SYRA 4IHUA 3CSHA 3ZFBA 1Z6MA 2JZRA 3UBLA 2IMDA 5J47A 2C0FA 2LRNA 3HJMA 2H70A 4MA9A 3GH9A 1Q98A 5IPHA 4BPYA 3I6AA 3EPTA 1X5DA 1AW9A 1TXUA 3FKFA 3IOSA 1DSBA 3WYWA 4ML1A 2QKEA 3A2WA 5D93A 4XCSA 1AC1A 5J41A 3K8NA 3WGEA 4AJ7A 1CQGA 1PX7A 4XS1A 4DSQA 2HRAA 1T4YA 2R0GA 5JCGA 1FB6A 2Z9SA 3IHQA 3EC3A 3GKNA 3A3TA 1EOGA 2WCIA 3MWHA 1XW6A 1W4VA 4BVYB 1Z7RA 2VOCA 4IQ1A 5DDLA 1JZOA 5JWRB 3LYPA 4WETA 4EVMA 5IPGA 4EF0A 3V1WA 1UC7A 4XRDA 2H66A 2VLVA 2GZYA 1UVZA 1BF5A 4ISDA 4XHMA 3PR8A 4YQVA 3GL5A 1R4WA 4G0IA 2MZCA 3OR5A 4IQAA 2H1GA 1YF1A 1O8XA 4TKYA 2NVLA 3F6DA 1AXDA 3Q18A 4JBBA 3ZMLA 1FB0A 3FR9A 3A5IA 3CRUA 4O7HA 3HVSA 3HKRA 3RHBA 4EIQA 4CY6A 2ES7A 5IIZA 2BTOT 3HZ8A 5ECPB 2TIRA 3P2AA 1OC8A 3GV1A 1TJDA 4DVCA 3UJ1A 4BVYA 4PQHA 2FWEA 3KCMA 1B8XA 4OFNA 3MNGA 4KGIA 5CRGA 2FHEA 5F07A 4N10A 1SVMA 4KB3A 4K8MA 2YZUA 1R5AA 4GSNA 1TRVA 1PN9A 5KOWA 2X49A 2QGVA 5IOXA 5HFKA 5G5FA 1LJRA 1TOFA 2MBSA 3U5RE 3CWGA 3R3EA 2YOIA 1J08A 1O6JA 2YZHA 2H73A 1FG4A 4TXOB 3APSA 1K3LA 4RQXA 2HSMB 2X8GA 1ZYPA 3TJFA 1O7UA 4ECBA 2PUKC 2MBTA 4JR6A 1ILOA 3HYPA 1YKCA 4JE1A 3CTGA 5G1KA 4TOPA 4WR4A 3TOTA 5KOXA 3KH9A 1OYJA 1R26A 3WGXA 4K1FA 3TRXA 1SL1B 2XPEA 2N5BA 4V2NA 5GSTA 2L6CA 4MJAA 3VFIA 2PERA 4NWYA 2HQTA 2C3NA 4YH2A 1F3AA 4TXOA 4YAPA 3SBCA 2B7JA 3F3RA 4OWYA 3SWLA 4FYCA 1QXHA 2F8FA 4CHSA 4HJMA 3L9SA 4H86A 1EP7A 3UOMA 2PGTA 4KDUA 1THXA 2XBIA 4MPFA 3D0ZA 4F03A 4JRRA 3CYNA 4NPBA 1ZZYA 4BWQA 5BRTA 1MDIA 1FW1A 5AIXA 4XS6A 1V98A 4YAVA 5DVBA 1WMJA 1V40A 2V2GA 1GWCA 1BQ7A 3ERWA 5CP1A 2H30A 4ZB7A 1SJZA 4WF5A 1BYEA 3G9BA 4NV2A 5G2ZA 4NXIA 1DE2A 1XPVA 4G01A 2LUSA 5JCUA 3ME8A 3DYRA 5EPFA 5ECNB 1BEDA 2UV8G 1I9DA 1DBYA 4CW9A 3VI5A 2R3XA 2P5RA 3APOA 5A5HB 2LRCA 5COHA 4AJ6A 3E0UA 3DD3A 5B8BA 2C4JA 1V58A 5ECQB 1A0FA 5B8AA 4LA1A 1V9WA 1YEXA 3ZYWA 5ECRB 4RQRA 3MIXA 2FA8A 4O92A 1X5CA 2L5LA 1B4QA 3IAM2 2IL3A 4KCEA 2OBKA 3W6GA 4MMMA 5D9TA 2L4CA 2A2PA 1ERVA 1WWJA 3F4RA 4KX4A 2PVQA 5IMZA 2B3SA 3GMFA 5BMUB 2H76A 16GSA 2V1MA 2I81A 3HZ4A 3DMLA 5A5HA 3UMAA 5KN2A 1IYIA 3US3A 2K18A 2K8SA 4YKFA 1BX9A 3LSZA 1Y6EA 4FYUA 3EYTA 4MNNA 2O7KA 2V32A 3KGKA 3IDVA 1FOHA 1GTAA 3D6IA 4MDCA 2HLSA 4IW9A 3FK8A 3TRPA 2JSZA 1ERWA 3DIEA 5KN0A 3F6FA 1O85A 1NHYA 3PGTA 3ZVJD 1N8JA 1X9MB 2AJQB 2QA2A 4KF9A 2KLXA 1F2EA 4GSTA 2ON5A 1K3OA 2UZ8A 1XVWA 5BMUA 2DJJA 1THOA 1TK0B 2GQLA 3F63A 3VPQA 2B1LA 4I6XA 1S3DA 4ZB8A 1I5GA 1GSYA 5D9WA 2H6ZA 5HR3A 3O3TA 2C3QA 2IJYA 4AKGA 4WBRD 3IBHA 4POBA 5LNKe 3HHVA 4K0NA 1K0CA 1PD21 1B9XC 3APQA 1GH2A 4IP6A 5G31A 4HI7A 4KDXA 1TK5B 3EMXA 2HRKB 5CRHA 5A4WA 4GDFA 5J4YA 3IPZA 1K0OA 3M9JA 4MP4A 4ZL7A 2EFDA 4ACSA 2FGXA 2DIYA 1GSQA 3IR4A 4ICYA 2KUCA 2CVKA 2H0HA 1NSWA 4O5QA 2LNTA 2IFQB 4PUAA 2YANA 2E2MA 3IE3A 4ZL8A 3KMOA 1M2DA 3TCOA 4AKHA 5A1NB 3LXTA 6GSYA 3EMPA 3IV4A 2V6KA 2K9FA 2VAFA 2B5XA 1GL8A 4K6XA 4GWRA 3HA9A 2YWIA 1JLWA 2H1LA 3LW9A 3UIWA 3GKXA 2LKUA 2GS3A 2PVOC 4X43A 1E6BA 1FHEA 2HRKA 1OC9B 1JZRA 2VCVA 3D4MA 1FOVA 1JZWA 3BJ5A 2B5EA 2VM1A 5DQYA 5IO0A 5EY6A 4HQSA 4XS4B 1XWBA 4HDEA 2DC5A 3CXGA 1MD4A 4CDOA 1YKAA 3ZREA 4Q5RA 2KHPA 2IFQA 2MMOA 3GTUB 2KOKA 4NMUA 1T1VA 2VO4A 5A1NA 1XIYA 2R2JA 4TN8A 5J5NA 2FUG2 3CRTA 1WRYA 3GUSA 2FLSA 1XWKA 3IC8A 1X5EA 3QD9A 1EV4A 2GQKA 1K0BA 5A34B 3FHKA 4L0UA 3FZ5A 2C3TA 1WP0A 1TU7A 1NM3A 3GX8A 1QK8A 3DWVA 1OC9A 4AJ8A 3G7JA 22GSA 5C04A 3GIXA 4EE0A 3TB2A 4PQ1A 2E7PA 4L5LA 2H0IA 4FQUA 4QMKA 5ID2B 3GTUA 3A2VA 1A2JA 5HQPA 3ZVJA 3CSJA 2R5GA 1YEPA 3BCIA 4Q5FA 2VL2C 3BCKA 5H5SA 2CZ3A 4IBPA 4IS0A 3ERFA 2IIYA 1XCCA 3U6VA 2DMLA 2H0GA 4BA7A 3DVXA 3HY2A 5A34A 5GZZB 1HD2A 2E0QA 3O6TA 1E2YA 2JACA 4F82A 4WR5A 4Z2UA 3DEXA 3HDCA 4KE3A 1A2LA 3RPPA 3A2XA 1AQVA 1XWAA 2MMNA 5ECKB 2X4AA 3TKPA 3TKSE 1EOHA 1ZYEA 2G2QA 2HZEA 3HD5A 5B6MA 8GSSA 2YWNA 2XBQA 2GSQA 5ID2A 4ILFA 3WT1A 1AUCA 3M1GA 5D96A 2C0EA 4K2DA 3ZZXA 4ZB6A 5GAND 4ZILA 20GSA 2OE3A 3D22A 2PPTA 4MJBA 1MDJA 5F06A 1URMA 4GCIA 4BWSA 4GTUA 1PRXA 2OE1A 1N2AA 3E9JB 1G6WA 3E3EA 2O8VB 5DALB 3FEUA 3FZ4A 5FWGA 4K9ZA 1HNCA 1ERUA 5D73A 5ECOB 1WPIA 1V57A 3I43A 1GSFA 2AV4A 2OA7A 1ZYNA 3DRNA 1PSQA 2GGTA 4G19A 2QSIA 3FR3A 3C1RA 1A2MA 2H72A 1HYUA 2J23A 5DAKB 2BMXA 4WEYA 1AQXA 3QPMA 5IMVA 3KZQA 1GTBA 1O73A 1XWCA 3ZLPA 2TRXA 2VCTA 2PMTA 2GQMA 3FZ9A 3LFLA 1XXUA 2HFDA 2FNOA 4RI6A 4PURA 2HSHA 4X0XA 4ID0A 2PWJA 6GSUA 3ERGA 2WGRA 1LBKA 1WJKA 3GN3A 4O32A 2DJ2A 2XPDA 1SL0B 1SKRB 2H19A 1OC3A 2CX4A 4XTSA 4AKIA 1FVJA 3QCPA 1TU8A 1U3IA 2B7KA 5E4WA 2R4VA 3ZMKA 1XWGA 5DALA 4EXJA 2YP6A 3P7XA 3CSIA 1RW1A 2LV3A 4XRAA 4GRFA 4N11A 5G5EA 3EURA 3DGQA 4OCFA 1BG1A 5DAKA 2RIIA 3TRQA 2VLTA 12GSA 4A5PA 4OCEA 1Z7PA 3F8UA 3UBKA 6GSTA 2RM5A 1SKSB 2DKIA 3WGDA 3MAKA 4K5RA 3RAZA 2O5VA 1A23A 3IXRA 2D2ZA 3GX0A 3IAS2 2VCXA 2EIRA 1U87A 2R0CA 2YCDA 4L8EA 1G7EA 1TP9A 2YV7A 1ZCPA 3H8QA 1GTUA 4LL1B 1PX6A 2IWTA 4QL7A 1GSDA 3L9VA 4KUNA 1LU4A 1QMVA 2C0GA 1AQWA 1GULA 4HZ4A 4LLRA 4EIPA 13GSA 2VL2A 2PN8A 4ULXA 3QAVA 4KW6A 4WKWA 3KMNA 4TXVA 3F9UA 4EKZA 4EDZA 1M7TA 1Z9HA 5FHIA 1KBNA 4G0KA 5J40A 3TJBA 5DBQA 2HSYA 4IKHA 4K2XA 4F0BA 3J7Yk 3MDKA 2HRNA 3VWWA 3VWXA 1EEJA 2CVDA 3JCML 4MCUA 4O5UA 1HNBA 4TR4A 2TRCP 5KN1A 5IQYA 2F3MA 1DE1A 1XZOA 1EV9A 3L9UA 3CMIA 3LQ7A 4E8EA 1G0TA 2A2SA 2CT6A 5IO2A 1HQOA 4OFMA 2ZCTA 5CYYA 3EE2A 5CREA 2FWFA 3FZAA 2RUFA 2K8VA 2YJHA 3KJYA 2ALBA 2VUPA 4I2UA 1SL2B 1GSSA 1EWXA 2LJAA 3TUEA 3EU4A 2FWHA 2M46A 1OKTA 1JLVA 1FO5A 5HFIA 1VF4A 1XOAA 3TJGA 4YQMA 4KSMA 1F9MA 3H79A 5ECLB 2WRTA 4YKGA 4HU7A 1Y25A 5JWQB 2VCQA 5KN3A 3G7YA 3PH9A 3EVIA 1VF1A 2B6MA 4F9ZA 4N30A 1S3CA 1R7HA 3C7MA 2GTUA 4NV5A 1K0NA 3HXSA 4I2TA 1GUHA 1H75A 1NHOA 3KXOA 5C00A 5H5QA 3UARA 1OAZA 1QFNA 5ELGA 3DVWA 2MMAA 1Q4JA 2YWMA 2EFCA 4MJCA 3F4TA 3J7Yb 3N5OA 5F0GA 4POLA 4FO5A 3QDNA 4HU9A 3Q6OA 3FW2A 4MZBA 1OVNA 3TJJA 1SENA 3QR6A 1A0RP 2LNSA 1WE0A 1T8EB 4KNDA 2VM2A 5ENUA 3VWUA 4IGJA 4BL7B 4FIWA 4HUAA 2CA8A 4IJ3A 3ZIJA 2GSSA 4FH8A 1GNWA 7GSSA 1S3AA 1BG5A 4ZXGA 3ZITA 1BJXA 5J9BA 2LS5A 2IN3A 3LEFA 3VK9A 2M80A 2IPAA 4MZCA 4Q5NA 5AGYA 4OO4A 1AIUA 2AAWA 1J9BA 2LQQA 2HSNA 1R5PA 2IMIA 4J56E 5HR0A 3QAGA 1MDKA 4HEA2 17GSA 5JWOB 3GURA 5IMCA 1Z6NA 2REMA 1X9WB 2CQ9A 3UL3A 4QL9A 1TRWA 4BL7A 2GVPA 1V2AA 2E2GA 1OE7A 3L78A 4AGSA 3Q19A 3RHCA 3UEMA 3FR6A 2VL9A 1KTEA 2EFHA 3IC4A 1QQ2A 2YPMA 4TR0A 19GSA 1XBSA 2LEGA 3GRXA 1WIKA 2F8AA 4ECCA 4I97A 1ABAA 2VLUA 3VWVA 2C8UA 3FY7A 4ZIJA 2V41A 2KP1A 1M99A 2MYGA 3I69A 2VD1A 3KM6A 1SD8A 5DCGA 4MF6A 5HFGA 2LSTA 1H4OA 5B6NA 4X1UA 2N5AA 4DSSB 4J2FA 4ZBAA 4BVXB 2VD0A 1PQNA 4NHZA 4EDYA 4RUVA 5A5KA 2EIQA 4K7OA 1KEBA 1K0DA 1ZYQB 4LL4B 3RDWA 2XC2A 1PA3A 2GSTA 4GF0A 2MMZA 4PNFA 2P5QA 4XIHA 1C72A 5EVOA 3F4SA 3ME7A 4EO3A 2LTKA 1TK8B 6GSVA 5GAPD 2J9HA 1VGLA 4KCAA 3CBUA 3HMJG 1K3YA 2HZFA 3KD0A 3W8SA 2HZEB 1ERTA 3KTBA 4DSSA 4BVXA 2DJ3A 3GL3A 3G7IA 3QMXA 3ZRDA 4PGTA 2GT5A 3TOUA 5CRDA 3HJOA 4AKXB 2C1YA 4ML6A 4MABA 2N5FA 1Z5YE 4KDYA 1JZDA 2K6VA 3TKSC 3MYDA 4G9HA 2HNLA 3GFKA 4HQZA 2X8HA 3Q74A 1T4ZA 4G2EA 4AI6A 2G0FA 4EL1A 1VF3A 2EIOA 3KH7A 1OE8A 2L5OA 1GLQA 4MH2A 2HRFA 1XW5A 2B5YA 5IM9A 1ZGNA 1B48A 3LJRA 3ISOA 3H93A 5F8BA 4D73B 1BAYA 2X64A 3N9JA 5LD0A 3KP9A 2H8LA 1RQMA 1X9SB 2O87A 1PGTA 2DSAA 1YDKA 1TI1A 2YWOA 2GT6A 3M8NA 5D9XA 4JEDA 5CAXA 3IK9A 3QOUA 4Z2TA 1EGOA 2OJLA 2WB9A 1Y1UA 5A4UA 2EFEA 9GSSA 4P3YB 4L0WA 1KNGA 1MTCA 1F6MC 2L59A 4K5SA 2DBCA 2CZ2A 2YN1A 2RM6A 4D73A 2QC7A 3VI7A 2RLIA 1TRUA 4ECJA 2AB6A 2FA4A 4ECIA 5LCZA 2R6KA 3ZIVA 3WT2A 4MF7A 4G0LA 2AUVA 4GXZA 1U88A 5IMFA 4PQIA 2OADA 5DJMA 1SK0A 3HVVA 1YY7A 18GSA 3PINA 2L4QA 2YNXA 1WOUA 4I5QA 5DJLA 1ZOFA 5G1LA 4KA0A 5D9VA 2AYTA 4J57E 5CRWA 3DXBA 2R37A 3GKMA 2P31A 4F2IA 3DKSA 5AIVA 4O5RA 4W66A 3FMWA 3LG6A 3GA4A 4TW5A 2I9HA 3NZNA 2P0GA 3KP8A 3GSSA 2H75A 2C0DA 5DQSA 4Z2RA 2ZNMA 2OKAA 2O85A 1PL1A 4OO5A 5ECIB 5CNWA 1QGVA 5AISA 4E8HA 5J4UA 1ACVA 4DSRA 2XHFA 1W89A 2CVBA 4ZBDA 1SJIA 4MZWA 1YZXA 1TW9A 2WZ9A 1SKWB 5ECMB 4YQUA 3FRCA 5H5RA 4PX1A 1EZKA 2LJRA 1A24A 2HE3A 2I4AA 3LORA 1N25A 6GSWA 1VRSD 3C8EA 5HR1A 1B4PA 1PKZA 2WFCA 4MLYA 4OD7A 2AHEA 3C1SA 1QUWA 3LXZA 2V6OA 4K0GA 2NTOA 4N0ZA 1VF2A 5IMDA 2FWGA 3BBYA 5DCHA 3VPTA 4PXOA 1GP1A 4MK3A 3M3MA 1EEMA 1SVLA 2JL4A 3O76A 5IOWA 1XOBA 2DLXA 2CX3A 2IMEA 4KAEA 3TKSA 4V2LA 4DEJA 3R2QA 4IJIA 3ZFLA 4MJEA 1O8WA 2DKHA 1GTIA 1PL2A 2A4VA 2F51A 1OKDA 4V1Ap 4WXTA 2GSRA 2GZZA 3HVXA 4N0VA 2OE0A 2HSMA 5L71A 4POKA 3LYKA 2FY6A 4TR1B 2EC4A 4I8BA 1GRXA 1UA5A 1UN2A 3L0HA 2H1DA 1T00A 3QFBC 2VCWA 1YVLA 5ELAA 3W8JA 1TDIA 4KSOA 4ZB9A 4JZQA 2A4HA 1NW2A 5J4VA 4Q5QA 4X4JA 2IMKA 1ST9A 2QA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXK A;  5HR2 A;  1RK4 A;  3RBT A;  3P8W A;  4GLT A;  2DJK A;  3D4T A;  3LGC A;  4TVE A;  2JZT A;  3ZTL A;  3C71 A;  4IP1 A;  4POM A;  3PPU A;  2ZUP A;  3GYK A;  3F3Q A;  1M9A A;  1SYX A;  2OAC A;  3UVT A;  2IMF A;  2A2R A;  2ON7 A;  3FYG A;  1GUM A;  1B9Y C;  1TKD B;  2L6D A;  4TR1 A;  3D21 A;  2F9S A;  5G30 A;  5CO3 A;  2O89 A;  3GST A;  1SD9 A;  4G10 A;  4IVF A;  2H1B A;  5EL8 A;  3EWL A;  1TI3 A;  4K7N A;  4HJ2 A;  1U3A A;  3QFA C;  10GS A;  4IEL A;  2CV4 A;  5KEJ A;  2VCZ A;  1X0R A;  3IK7 A;  4MPG A;  1GSE A;  6GSX A;  2JU5 A;  4MF5 A;  3H1N A;  4MH3 A;  1ML6 A;  2FCH A;  5GSS A;  3NIV A;  1XW9 A;  1A8Y A;  1ZL9 A;  1F37 A;  5D8I A;  1K0M A;  4NAX A;  4QQ7 A;  2FD3 A;  5J3R A;  1PKW A;  5IMA A;  4OMV A;  5JCW A;  2NPB A;  3KEB A;  1TTZ A;  1YJ6 A;  4EUY A;  4NHW A;  2KP2 A;  2HSN B;  4LMW A;  4JU5 A;  3KIJ A;  4OFT A;  5INY A;  4KH7 A;  3QAW A;  4PNG A;  1J0F A;  5ECH B;  1Z3E A;  3M0F A;  2DIZ A;  2JSY A;  1T3B A;  4HS1 A;  3UAP A;  3TKQ A;  1TXX A;  2JZS A;  3L4N A;  2WUL A;  4LMV A;  1JFU A;  3C73 A;  1F3B A;  2LQO A;  3KTL A;  1AAZ A;  1M2B A;  2VL3 A;  2NDO A;  3HJP A;  4IN0 A;  2H71 A;  3BOA A;  4PTS A;  1XVQ A;  3P90 A;  3GH6 A;  1T7P B;  4TRX A;  6GSS A;  2H6Y A;  1SJ6 A;  3I9V 2;  3GHA A;  11GS A;  2H01 A;  2X99 A;  2VIM A;  2HYX A;  2PU9 C;  2M72 A;  4TR3 A;  2NBS A;  3TDG A;  2H74 A;  3F0I A;  3A5W A;  1IYH A;  3WD6 A;  3VUR A;  3NOF A;  1FVK A;  2CAI A;  1YF0 A;  4Z7X A;  5A4V A;  14GS A;  2I3Y A;  5F05 A;  3M9K A;  3IA1 A;  2WJU A;  4PUF C;  1DUG A;  5J9C A;  4GQC A;  2RUE A;  3ZL5 A;  4FYB A;  4ZL9 A;  2LRT A;  2DJ1 A;  3EIN A;  3VLN A;  3TKR A;  4USS A;  2GLR A;  1PMT A;  2JAD A;  3ED3 A;  1ZMA A;  1K0A A;  1MEK A;  3HCZ A;  1SK2 A;  1EGR A;  2C80 A;  1M2A A;  1FAA A;  3CTF A;  5B7C A;  4HZ2 A;  2B1K A;  3AY8 A;  1M9B A;  5FT3 A;  1XFL A;  1HNA A;  1M0U A;  1O81 A;  3LWA A;  3IRA A;  1G7O A;  1SU9 A;  5ABR A;  1GUK A;  2CAQ A;  1ON4 A;  4HOJ A;  2HI7 A;  4GQF A;  1SK1 A;  2GDR A;  3MSZ A;  4JR4 A;  3GNJ A;  2WS2 A;  2DJ0 A;  5AN1 A;  2I1U A;  3UVH A;  1CQH A;  2BJX A;  1TRS A;  4GSS A;  4L5O A;  4V2M A;  3H4K A;  4F0C A;  1YQ1 A;  2YJ7 A;  1EP8 A;  2H6X A;  5ECS A;  2WDU A;  1USB A;  4AF2 A;  5E59 A;  2L57 A;  3GKK A;  1MD3 A;  2HT9 A;  3TJK A;  4WBJ A;  4ZBB A;  1GSU A;  4V1A g;  3TGZ A;  2H1A A;  3S9F A;  3D5J A;  1JHB A;  2PBJ A;  4K7I A;  4EC0 A;  1U6T A;  1G6Y A;  2GZP A;  3EU3 A;  1GNE A;  2YV9 A;  2DMM A;  2OBI A;  3BD2 A;  3RPN A;  2X8C A;  4RI7 A;  1GLP A;  1A8L A;  4WF4 A;  2LJK A;  4XS4 A;  1SYR A;  4IHU A;  3CSH A;  3ZFB A;  1Z6M A;  2JZR A;  3UBL A;  2IMD A;  2C0F A;  2LRN A;  3HJM A;  2H70 A;  4MA9 A;  3GH9 A;  1Q98 A;  5IPH A;  4BPY A;  3I6A A;  1X5D A;  1AW9 A;  3FKF A;  3IOS A;  1DSB A;  3WYW A;  4ML1 A;  2QKE A;  3A2W A;  5D93 A;  4XCS A;  1AC1 A;  5J41 A;  3K8N A;  3WGE A;  4AJ7 A;  1CQG A;  1PX7 A;  4XS1 A;  4DSQ A;  2HRA A;  1T4Y A;  5JCG A;  1FB6 A;  2Z9S A;  3IHQ A;  3EC3 A;  3GKN A;  3A3T A;  1EOG A;  2WCI A;  3MWH A;  1XW6 A;  1W4V A;  4BVY B;  1Z7R A;  2VOC A;  4IQ1 A;  5DDL A;  1JZO A;  5JWR B;  3LYP A;  4WET A;  4EVM A;  5IPG A;  4EF0 A;  3V1W A;  1UC7 A;  4XRD A;  2H66 A;  2VLV A;  2GZY A;  1UVZ A;  4ISD A;  4XHM A;  3PR8 A;  4YQV A;  3GL5 A;  1R4W A;  4G0I A;  2MZC A;  3OR5 A;  4IQA A;  2H1G A;  1YF1 A;  1O8X A;  4TKY A;  2NVL A;  3F6D A;  1AXD A;  3Q18 A;  4JBB A;  3ZML A;  1FB0 A;  3FR9 A;  3CRU A;  4O7H A;  3HVS A;  3HKR A;  3RHB A;  2ES7 A;  5IIZ A;  2BTO T;  3HZ8 A;  5ECP B;  2TIR A;  3P2A A;  1OC8 A;  3GV1 A;  1TJD A;  4DVC A;  3UJ1 A;  4BVY A;  4PQH A;  2FWE A;  3KCM A;  1B8X A;  4OFN A;  3MNG A;  4KGI A;  5CRG A;  2FHE A;  5F07 A;  4N10 A;  4KB3 A;  4K8M A;  2YZU A;  1R5A A;  4GSN A;  1TRV A;  1PN9 A;  2QGV A;  5IOX A;  5HFK A;  5G5F A;  1LJR A;  1TOF A;  2MBS A;  3U5R E;  3R3E A;  2YOI A;  1J08 A;  1O6J A;  2YZH A;  2H73 A;  1FG4 A;  4TXO B;  3APS A;  1K3L A;  4RQX A;  2HSM B;  2X8G A;  3TJF A;  1O7U A;  4ECB A;  2PUK C;  2MBT A;  4JR6 A;  1ILO A;  3HYP A;  1YKC A;  4JE1 A;  3CTG A;  5G1K A;  4TOP A;  4WR4 A;  3TOT A;  3KH9 A;  1OYJ A;  1R26 A;  3WGX A;  4K1F A;  3TRX A;  1SL1 B;  2XPE A;  2N5B A;  4V2N A;  5GST A;  2L6C A;  4MJA A;  3VFI A;  2PER A;  4NWY A;  2HQT A;  2C3N A;  4YH2 A;  1F3A A;  4TXO A;  4YAP A;  3SBC A;  2B7J A;  3F3R A;  4OWY A;  3SWL A;  4FYC A;  1QXH A;  2F8F A;  4CHS A;  4HJM A;  3L9S A;  4H86 A;  1EP7 A;  3UOM A;  2PGT A;  4KDU A;  1THX A;  2XBI A;  4MPF A;  3D0Z A;  4F03 A;  4JRR A;  3CYN A;  4NPB A;  1ZZY A;  4BWQ A;  1MDI A;  1FW1 A;  5AIX A;  4XS6 A;  1V98 A;  4YAV A;  5DVB A;  1WMJ A;  1V40 A;  2V2G A;  1GWC A;  1BQ7 A;  3ERW A;  5CP1 A;  2H30 A;  1SJZ A;  4WF5 A;  1BYE A;  3G9B A;  4NV2 A;  5G2Z A;  4NXI A;  1DE2 A;  1XPV A;  2LUS A;  5JCU A;  3ME8 A;  3DYR A;  5EPF A;  5ECN B;  1BED A;  1DBY A;  1I9D A;  4CW9 A;  3VI5 A;  2R3X A;  2P5R A;  3APO A;  2LRC A;  5COH A;  4AJ6 A;  3E0U A;  3DD3 A;  5B8B A;  2C4J A;  1V58 A;  5ECQ B;  1A0F A;  5B8A A;  4LA1 A;  1V9W A;  1YEX A;  3ZYW A;  5ECR B;  4RQR A;  2FA8 A;  4O92 A;  1X5C A;  2L5L A;  1B4Q A;  3IAM 2;  2IL3 A;  4KCE A;  2OBK A;  3W6G A;  4MMM A;  5D9T A;  2L4C A;  1ERV A;  1WWJ A;  3F4R A;  4KX4 A;  2PVQ A;  5IMZ A;  2B3S A;  3GMF A;  2H76 A;  16GS A;  2V1M A;  2I81 A;  3HZ4 A;  3DML A;  3UMA A;  5KN2 A;  1IYI A;  3US3 A;  2K18 A;  2K8S A;  1BX9 A;  3LSZ A;  1Y6E A;  4FYU A;  3EYT A;  2O7K A;  2V32 A;  3KGK A;  3IDV A;  1GTA A;  3D6I A;  4MDC A;  2HLS A;  4IW9 A;  3FK8 A;  3TRP A;  2JSZ A;  1ERW A;  3DIE A;  5KN0 A;  3F6F A;  1O85 A;  1NHY A;  3PGT A;  3ZVJ D;  1N8J A;  1X9M B;  2AJQ B;  4KF9 A;  2KLX A;  1F2E A;  4GST A;  2ON5 A;  1K3O A;  2UZ8 A;  1XVW A;  5BMU A;  2DJJ A;  1THO A;  1TK0 B;  2GQL A;  3F63 A;  3VPQ A;  2B1L A;  4I6X A;  1S3D A;  4ZB8 A;  1I5G A;  1GSY A;  5D9W A;  2H6Z A;  5HR3 A;  3O3T A;  2C3Q A;  2IJY A;  4WBR D;  3IBH A;  4POB A;  5LNK e;  3HHV A;  4K0N A;  1K0C A;  1PD2 1;  1B9X C;  3APQ A;  1GH2 A;  4IP6 A;  5G31 A;  4HI7 A;  4KDX A;  1TK5 B;  3EMX A;  2HRK B;  5CRH A;  3IPZ A;  1K0O A;  3M9J A;  4MP4 A;  4ZL7 A;  4ACS A;  2FGX A;  2DIY A;  1GSQ A;  3IR4 A;  2KUC A;  2CVK A;  2H0H A;  1NSW A;  2LNT A;  2IFQ B;  4PUA A;  2YAN A;  2E2M A;  3IE3 A;  4ZL8 A;  3KMO A;  1M2D A;  3TCO A;  3LXT A;  6GSY A;  3EMP A;  3IV4 A;  2V6K A;  2K9F A;  2VAF A;  2B5X A;  1GL8 A;  4K6X A;  4GWR A;  3HA9 A;  2YWI A;  1JLW A;  3UIW A;  3GKX A;  2LKU A;  2GS3 A;  2PVO C;  4X43 A;  1E6B A;  1FHE A;  2HRK A;  1OC9 B;  1JZR A;  2VCV A;  3D4M A;  1FOV A;  1JZW A;  3BJ5 A;  2B5E A;  2VM1 A;  5DQY A;  5IO0 A;  5EY6 A;  4HQS A;  4XS4 B;  1XWB A;  4HDE A;  2DC5 A;  3CXG A;  1MD4 A;  4CDO A;  1YKA A;  3ZRE A;  4Q5R A;  2KHP A;  2IFQ A;  2MMO A;  3GTU B;  2KOK A;  4NMU A;  1T1V A;  2VO4 A;  1XIY A;  2R2J A;  4TN8 A;  5J5N A;  2FUG 2;  3CRT A;  1WRY A;  3GUS A;  2FLS A;  1XWK A;  3IC8 A;  1X5E A;  3QD9 A;  1EV4 A;  2GQK A;  1K0B A;  3FHK A;  4L0U A;  3FZ5 A;  2C3T A;  1WP0 A;  1TU7 A;  1NM3 A;  3GX8 A;  1QK8 A;  3DWV A;  1OC9 A;  4AJ8 A;  3G7J A;  22GS A;  5C04 A;  3GIX A;  4EE0 A;  3TB2 A;  4PQ1 A;  2E7P A;  4L5L A;  2H0I A;  4FQU A;  5ID2 B;  3GTU A;  3A2V A;  1A2J A;  5HQP A;  3ZVJ A;  3CSJ A;  2R5G A;  1YEP A;  3BCI A;  4Q5F A;  2VL2 C;  3BCK A;  5H5S A;  2CZ3 A;  4IBP A;  4IS0 A;  3ERF A;  2IIY A;  1XCC A;  3U6V A;  2DML A;  2H0G A;  4BA7 A;  3DVX A;  3HY2 A;  5GZZ B;  1HD2 A;  2E0Q A;  3O6T A;  1E2Y A;  2JAC A;  4F82 A;  4WR5 A;  3DEX A;  3HDC A;  4KE3 A;  1A2L A;  3RPP A;  3A2X A;  1AQV A;  1XWA A;  2MMN A;  5ECK B;  3TKP A;  3TKS E;  1EOH A;  1ZYE A;  2G2Q A;  2HZE A;  3HD5 A;  5B6M A;  8GSS A;  2YWN A;  2XBQ A;  2GSQ A;  5ID2 A;  4ILF A;  3WT1 A;  1AUC A;  3M1G A;  5D96 A;  2C0E A;  4K2D A;  3ZZX A;  4ZB6 A;  5GAN D;  4ZIL A;  20GS A;  2OE3 A;  3D22 A;  2PPT A;  4MJB A;  1MDJ A;  5F06 A;  1URM A;  4GCI A;  4BWS A;  4GTU A;  1PRX A;  2OE1 A;  1N2A A;  3E9J B;  1G6W A;  3E3E A;  2O8V B;  5DAL B;  3FEU A;  3FZ4 A;  5FWG A;  4K9Z A;  1HNC A;  1ERU A;  5D73 A;  5ECO B;  1WPI A;  1V57 A;  3I43 A;  1GSF A;  2AV4 A;  2OA7 A;  3DRN A;  1PSQ A;  2GGT A;  4G19 A;  2QSI A;  3FR3 A;  3C1R A;  1A2M A;  2H72 A;  1HYU A;  2J23 A;  5DAK B;  2BMX A;  4WEY A;  1AQX A;  3QPM A;  5IMV A;  3KZQ A;  1GTB A;  1O73 A;  1XWC A;  3ZLP A;  2TRX A;  2VCT A;  2PMT A;  2GQM A;  3FZ9 A;  3LFL A;  1XXU A;  2HFD A;  2FNO A;  4RI6 A;  4PUR A;  2HSH A;  4X0X A;  4ID0 A;  2PWJ A;  6GSU A;  3ERG A;  2WGR A;  1LBK A;  1WJK A;  3GN3 A;  4O32 A;  2DJ2 A;  2XPD A;  1SL0 B;  1SKR B;  2H19 A;  1OC3 A;  2CX4 A;  4XTS A;  1FVJ A;  3QCP A;  1TU8 A;  1U3I A;  2B7K A;  5E4W A;  2R4V A;  3ZMK A;  1XWG A;  5DAL A;  4EXJ A;  2YP6 A;  3P7X A;  3CSI A;  1RW1 A;  2LV3 A;  4XRA A;  4GRF A;  4N11 A;  5G5E A;  3EUR A;  3DGQ A;  4OCF A;  5DAK A;  2RII A;  3TRQ A;  2VLT A;  12GS A;  4OCE A;  1Z7P A;  3F8U A;  3UBK A;  6GST A;  2RM5 A;  1SKS B;  3WGD A;  3MAK A;  3RAZ A;  1A23 A;  3IXR A;  2D2Z A;  3GX0 A;  3IAS 2;  2VCX A;  2EIR A;  1U87 A;  2YCD A;  4L8E A;  1G7E A;  1TP9 A;  2YV7 A;  1ZCP A;  3H8Q A;  1GTU A;  4LL1 B;  1PX6 A;  2IWT A;  4QL7 A;  1GSD A;  3L9V A;  4KUN A;  1LU4 A;  1QMV A;  2C0G A;  1AQW A;  1GUL A;  4HZ4 A;  4LLR A;  13GS A;  2VL2 A;  2PN8 A;  4ULX A;  3QAV A;  4KW6 A;  4WKW A;  3KMN A;  4TXV A;  3F9U A;  4EKZ A;  4EDZ A;  1M7T A;  1Z9H A;  5FHI A;  1KBN A;  4G0K A;  3TJB A;  5DBQ A;  2HSY A;  4IKH A;  4F0B A;  3J7Y k;  3MDK A;  2HRN A;  3VWW A;  3VWX A;  1EEJ A;  2CVD A;  3JCM L;  4MCU A;  1HNB A;  4TR4 A;  2TRC P;  5KN1 A;  5IQY A;  2F3M A;  1DE1 A;  1XZO A;  1EV9 A;  3L9U A;  3CMI A;  3LQ7 A;  4E8E A;  1G0T A;  2A2S A;  2CT6 A;  5IO2 A;  1HQO A;  4OFM A;  2ZCT A;  5CYY A;  3EE2 A;  5CRE A;  2FWF A;  3FZA A;  2RUF A;  2K8V A;  2YJH A;  3KJY A;  2ALB A;  2VUP A;  4I2U A;  1SL2 B;  1GSS A;  1EWX A;  2LJA A;  3TUE A;  3EU4 A;  2FWH A;  2M46 A;  1OKT A;  1JLV A;  1FO5 A;  5HFI A;  1VF4 A;  1XOA A;  3TJG A;  4YQM A;  4KSM A;  1F9M A;  3H79 A;  5ECL B;  2WRT A;  4HU7 A;  1Y25 A;  5JWQ B;  2VCQ A;  5KN3 A;  3G7Y A;  3PH9 A;  3EVI A;  1VF1 A;  2B6M A;  4F9Z A;  4N30 A;  1S3C A;  1R7H A;  3C7M A;  2GTU A;  4NV5 A;  1K0N A;  3HXS A;  4I2T A;  1GUH A;  1H75 A;  1NHO A;  3KXO A;  5C00 A;  5H5Q A;  3UAR A;  1OAZ A;  1QFN A;  5ELG A;  3DVW A;  2MMA A;  1Q4J A;  2YWM A;  4MJC A;  3F4T A;  3J7Y b;  3N5O A;  5F0G A;  4POL A;  4FO5 A;  3QDN A;  4HU9 A;  3Q6O A;  3FW2 A;  4MZB A;  1OVN A;  3TJJ A;  1SEN A;  3QR6 A;  1A0R P;  2LNS A;  1WE0 A;  1T8E B;  4KND A;  2VM2 A;  5ENU A;  3VWU A;  4IGJ A;  4BL7 B;  4FIW A;  4HUA A;  2CA8 A;  4IJ3 A;  3ZIJ A;  2GSS A;  4FH8 A;  1GNW A;  7GSS A;  1S3A A;  1BG5 A;  4ZXG A;  3ZIT A;  1BJX A;  5J9B A;  2LS5 A;  2IN3 A;  3LEF A;  3VK9 A;  2M80 A;  2IPA A;  4MZC A;  4Q5N A;  5AGY A;  4OO4 A;  1AIU A;  2AAW A;  1J9B A;  2LQQ A;  1R5P A;  2IMI A;  4J56 E;  5HR0 A;  3QAG A;  1MDK A;  4HEA 2;  17GS A;  5JWO B;  3GUR A;  5IMC A;  1Z6N A;  2REM A;  1X9W B;  2CQ9 A;  3UL3 A;  4QL9 A;  1TRW A;  4BL7 A;  2GVP A;  1V2A A;  2E2G A;  1OE7 A;  3L78 A;  4AGS A;  3Q19 A;  3RHC A;  3UEM A;  3FR6 A;  2VL9 A;  1KTE A;  3IC4 A;  1QQ2 A;  2YPM A;  4TR0 A;  19GS A;  1XBS A;  2LEG A;  3GRX A;  1WIK A;  2F8A A;  4ECC A;  4I97 A;  1ABA A;  2VLU A;  3VWV A;  2C8U A;  3FY7 A;  4ZIJ A;  2V41 A;  2KP1 A;  1M99 A;  2MYG A;  3I69 A;  2VD1 A;  3KM6 A;  1SD8 A;  5DCG A;  4MF6 A;  5HFG A;  2LST A;  1H4O A;  5B6N A;  4X1U A;  2N5A A;  4DSS B;  4J2F A;  4ZBA A;  4BVX B;  2VD0 A;  1PQN A;  4NHZ A;  4EDY A;  4RUV A;  5A5K A;  2EIQ A;  4K7O A;  1KEB A;  1K0D A;  1ZYQ B;  4LL4 B;  3RDW A;  2XC2 A;  1PA3 A;  2GST A;  4GF0 A;  2MMZ A;  4PNF A;  2P5Q A;  4XIH A;  1C72 A;  5EVO A;  3F4S A;  3ME7 A;  4EO3 A;  2LTK A;  1TK8 B;  6GSV A;  5GAP D;  2J9H A;  1VGL A;  4KCA A;  3CBU A;  1K3Y A;  2HZF A;  3KD0 A;  3W8S A;  2HZE B;  1ERT A;  3KTB A;  4DSS A;  4BVX A;  2DJ3 A;  3GL3 A;  3G7I A;  3QMX A;  3ZRD A;  4PGT A;  2GT5 A;  3TOU A;  5CRD A;  3HJO A;  2C1Y A;  4ML6 A;  4MAB A;  2N5F A;  1Z5Y E;  4KDY A;  1JZD A;  2K6V A;  3TKS C;  4G9H A;  2HNL A;  3GFK A;  4HQZ A;  2X8H A;  3Q74 A;  1T4Z A;  4G2E A;  2G0F A;  4EL1 A;  1VF3 A;  2EIO A;  3KH7 A;  1OE8 A;  2L5O A;  1GLQ A;  4MH2 A;  2HRF A;  1XW5 A;  2B5Y A;  5IM9 A;  1ZGN A;  1B48 A;  3LJR A;  3ISO A;  3H93 A;  5F8B A;  4D73 B;  1BAY A;  2X64 A;  3N9J A;  5LD0 A;  3KP9 A;  2H8L A;  1RQM A;  1X9S B;  2O87 A;  1PGT A;  2DSA A;  1YDK A;  1TI1 A;  2YWO A;  2GT6 A;  3M8N A;  5D9X A;  4JED A;  5CAX A;  3IK9 A;  3QOU A;  1EGO A;  2OJL A;  2WB9 A;  5A4U A;  9GSS A;  4P3Y B;  4L0W A;  1KNG A;  1MTC A;  1F6M C;  2L59 A;  2DBC A;  2CZ2 A;  2YN1 A;  2RM6 A;  4D73 A;  2QC7 A;  3VI7 A;  2RLI A;  1TRU A;  4ECJ A;  2AB6 A;  2FA4 A;  4ECI A;  5LCZ A;  2R6K A;  3ZIV A;  3WT2 A;  4MF7 A;  4G0L A;  2AUV A;  4GXZ A;  1U88 A;  5IMF A;  4PQI A;  2OAD A;  5DJM A;  1SK0 A;  3HVV A;  1YY7 A;  18GS A;  3PIN A;  2L4Q A;  2YNX A;  1WOU A;  4I5Q A;  5DJL A;  1ZOF A;  5G1L A;  4KA0 A;  5D9V A;  2AYT A;  4J57 E;  5CRW A;  3DXB A;  2R37 A;  3GKM A;  2P31 A;  4F2I A;  3DKS A;  5AIV A;  4O5R A;  3LG6 A;  3GA4 A;  4TW5 A;  2I9H A;  3NZN A;  2P0G A;  3KP8 A;  3GSS A;  2H75 A;  2C0D A;  5DQS A;  2ZNM A;  2OKA A;  2O85 A;  1PL1 A;  4OO5 A;  5ECI B;  5CNW A;  1QGV A;  5AIS A;  4E8H A;  5J4U A;  1ACV A;  4DSR A;  2XHF A;  1W89 A;  2CVB A;  4ZBD A;  1SJI A;  4MZW A;  1YZX A;  1TW9 A;  2WZ9 A;  1SKW B;  5ECM B;  4YQU A;  3FRC A;  5H5R A;  4PX1 A;  1EZK A;  2LJR A;  1A24 A;  2HE3 A;  2I4A A;  3LOR A;  6GSW A;  1VRS D;  3C8E A;  5HR1 A;  1B4P A;  1PKZ A;  2WFC A;  4MLY A;  4OD7 A;  2AHE A;  3C1S A;  1QUW A;  3LXZ A;  2V6O A;  4K0G A;  2NTO A;  4N0Z A;  1VF2 A;  5IMD A;  2FWG A;  3BBY A;  5DCH A;  3VPT A;  4PXO A;  1GP1 A;  4MK3 A;  3M3M A;  1EEM A;  2JL4 A;  3O76 A;  5IOW A;  1XOB A;  2DLX A;  2CX3 A;  2IME A;  4KAE A;  3TKS A;  4V2L A;  4DEJ A;  3R2Q A;  4IJI A;  3ZFL A;  4MJE A;  1O8W A;  1GTI A;  1PL2 A;  2A4V A;  2F51 A;  1OKD A;  4V1A p;  4WXT A;  2GSR A;  2GZZ A;  3HVX A;  4N0V A;  2OE0 A;  2HSM A;  5L71 A;  4POK A;  3LYK A;  2FY6 A;  4TR1 B;  2EC4 A;  4I8B A;  1GRX A;  1UA5 A;  1UN2 A;  3L0H A;  2H1D A;  1T00 A;  3QFB C;  2VCW A;  5ELA A;  3W8J A;  1TDI A;  4KSO A;  4ZB9 A;  4JZQ A;  1NW2 A;  4Q5Q A;  2IMK A;  1ST9 A;  5A4W A; 
#chains in the Genus database with same CATH topology
 2HXK A;  5HR2 A;  1RK4 A;  3RBT A;  3P8W A;  4GLT A;  2DJK A;  3D4T A;  3LGC A;  4TVE A;  2JZT A;  3ZTL A;  3C71 A;  4IP1 A;  4POM A;  3PPU A;  2ZUP A;  4N3Z A;  3GYK A;  3F3Q A;  1M9A A;  1SYX A;  2OAC A;  3UVT A;  2IMF A;  2A2R A;  2ON7 A;  3FYG A;  1GUM A;  1B9Y C;  1SVO A;  1TKD B;  2L6D A;  4TR1 A;  3D21 A;  2F9S A;  5G30 A;  5CO3 A;  2O89 A;  3GST A;  1SD9 A;  4G10 A;  4PI0 C;  4IVF A;  2H1B A;  5EL8 A;  3EWL A;  1TI3 A;  4K7N A;  4HJ2 A;  1U3A A;  3QFA C;  10GS A;  4IEL A;  2CV4 A;  5KEJ A;  1PN0 A;  2VCZ A;  1X0R A;  3IK7 A;  4MPG A;  1GSE A;  6GSX A;  2JU5 A;  4MF5 A;  3H1N A;  4MH3 A;  1ML6 A;  1S4B P;  2FCH A;  5GSS A;  4CY8 A;  3NIV A;  1XW9 A;  1A8Y A;  1ZL9 A;  1F37 A;  5D8I A;  1K0M A;  4NAX A;  4QQ7 A;  2FD3 A;  5J3R A;  1PKW A;  5IMA A;  4OMV A;  5JCW A;  2NPB A;  4E68 A;  3KEB A;  1TTZ A;  1YJ6 A;  4EUY A;  4NHW A;  2KP2 A;  2HSN B;  4LMW A;  4JU5 A;  3KIJ A;  4OFT A;  5INY A;  4KH7 A;  2VKZ G;  3QAW A;  4PNG A;  1J0F A;  5ECH B;  1Z3E A;  3M0F A;  2DIZ A;  2WVX B;  2JSY A;  1T3B A;  4HS1 A;  3UAP A;  3TKQ A;  1TXX A;  2JZS A;  3L4N A;  3TU3 B;  2WUL A;  4LMV A;  1JFU A;  3C73 A;  1F3B A;  2LQO A;  3KTL A;  1AAZ A;  1M2B A;  2VL3 A;  2NDO A;  3HJP A;  4IN0 A;  2H71 A;  3BOA A;  4PTS A;  1XVQ A;  3P90 A;  3GH6 A;  1T7P B;  4TRX A;  6GSS A;  2H6Y A;  1SJ6 A;  3I9V 2;  3GHA A;  11GS A;  2OT3 A;  2H01 A;  2X99 A;  2VIM A;  2HYX A;  2PU9 C;  2M72 A;  4TR3 A;  2NBS A;  3TDG A;  2WVZ A;  2H74 A;  3F0I A;  3A5W A;  1IYH A;  3WD6 A;  2WVX A;  3VUR A;  3NOF A;  1FVK A;  2CAI A;  1YF0 A;  4Z7X A;  5A4V A;  14GS A;  2I3Y A;  5F05 A;  3M9K A;  3IA1 A;  2WJU A;  4PUF C;  1DUG A;  5J9C A;  2R0P A;  4GQC A;  2RUE A;  3ZL5 A;  4FYB A;  4ZL9 A;  2LRT A;  2DJ1 A;  3EIN A;  3VLN A;  3TKR A;  4USS A;  2GLR A;  1PMT A;  2JAD A;  3ED3 A;  1ZMA A;  1K0A A;  1MEK A;  3HCZ A;  1SK2 A;  1EGR A;  2C80 A;  1M2A A;  1FAA A;  3IHG A;  3CTF A;  5B7C A;  4HZ2 A;  2B1K A;  3AY8 A;  1M9B A;  5FT3 A;  1XFL A;  1HNA A;  1M0U A;  1I1I P;  1O81 A;  3LWA A;  3IRA A;  1G7O A;  1SU9 A;  5ABR A;  1GUK A;  2CAQ A;  1ON4 A;  4HOJ A;  2HI7 A;  4GQF A;  1SK1 A;  2GDR A;  3MSZ A;  4JR4 A;  3GNJ A;  2WS2 A;  2DJ0 A;  5AN1 A;  2I1U A;  3UVH A;  1CQH A;  2BJX A;  1TRS A;  4GSS A;  4L5O A;  4V2M A;  3H4K A;  4F0C A;  1YQ1 A;  2YJ7 A;  1EP8 A;  2H6X A;  5ECS A;  2WDU A;  1USB A;  4AF2 A;  5E59 A;  2L57 A;  3GKK A;  1MD3 A;  2HT9 A;  3TJK A;  4WBJ A;  4ZBB A;  1GSU A;  4V1A g;  3TGZ A;  2H1A A;  3S9F A;  3D5J A;  1JHB A;  2PBJ A;  4K7I A;  4EC0 A;  1U6T A;  1G6Y A;  2GZP A;  3EU3 A;  1GNE A;  2YV9 A;  2DMM A;  1PFO A;  2OBI A;  3BD2 A;  3RPN A;  2X8C A;  4RI7 A;  1GLP A;  1A8L A;  4WF4 A;  2LJK A;  4XS4 A;  1SYR A;  4IHU A;  3CSH A;  3ZFB A;  1Z6M A;  2JZR A;  3UBL A;  2IMD A;  5J47 A;  2C0F A;  2WW1 A;  2LRN A;  3HJM A;  2H70 A;  4MA9 A;  3GH9 A;  1Q98 A;  5IPH A;  4BPY A;  3CHX C;  3I6A A;  3EPT A;  1X5D A;  1AW9 A;  1TXU A;  3FKF A;  3IOS A;  1DSB A;  3WYW A;  4ML1 A;  2QKE A;  3A2W A;  5D93 A;  4XCS A;  1AC1 A;  5J41 A;  3K8N A;  3WGE A;  4AJ7 A;  1CQG A;  1PX7 A;  4HSC X;  4XS1 A;  4DSQ A;  2HRA A;  1T4Y A;  2R0G A;  5JCG A;  1FB6 A;  2Z9S A;  3IHQ A;  3EC3 A;  3GKN A;  3A3T A;  1EOG A;  2WCI A;  3MWH A;  1XW6 A;  1W4V A;  4BVY B;  1Z7R A;  2VOC A;  4IQ1 A;  5DDL A;  1JZO A;  5JWR B;  3LYP A;  4WET A;  4EVM A;  5IPG A;  4EF0 A;  3V1W A;  1UC7 A;  4XRD A;  2WVY A;  2H66 A;  2VLV A;  2GZY A;  1UVZ A;  1BF5 A;  4ISD A;  4XHM A;  3PR8 A;  4YQV A;  3GL5 A;  1R4W A;  4G0I A;  2MZC A;  3OR5 A;  4IQA A;  2H1G A;  1YF1 A;  1O8X A;  4TKY A;  2NVL A;  3F6D A;  1AXD A;  1S3R A;  3Q18 A;  4JBB A;  3ZML A;  1FB0 A;  3FR9 A;  3A5I A;  3CRU A;  4O7H A;  3HVS A;  3HKR A;  3RHB A;  4EIQ A;  4CY6 A;  2ES7 A;  5IIZ A;  2BTO T;  3HZ8 A;  5ECP B;  2TIR A;  3P2A A;  1OC8 A;  3GV1 A;  1TJD A;  4DVC A;  3UJ1 A;  4BVY A;  4PQH A;  2FWE A;  4FXY P;  3KCM A;  1B8X A;  4OFN A;  3MNG A;  4KGI A;  5CRG A;  2FHE A;  5F07 A;  4N10 A;  1SVM A;  4KB3 A;  4K8M A;  2YZU A;  1R5A A;  4GSN A;  1TRV A;  1PN9 A;  5KOW A;  2X49 A;  2QGV A;  4PI2 C;  5IOX A;  5HFK A;  5G5F A;  1LJR A;  1TOF A;  2MBS A;  3U5R E;  3CWG A;  3R3E A;  2YOI A;  1J08 A;  1O6J A;  2YZH A;  2H73 A;  1FG4 A;  4TXO B;  3APS A;  1K3L A;  4RQX A;  2HSM B;  2X8G A;  1ZYP A;  3TJF A;  1O7U A;  4ECB A;  2PUK C;  2MBT A;  4JR6 A;  1ILO A;  3HYP A;  1YKC A;  4JE1 A;  3CTG A;  5G1K A;  4TOP A;  4WR4 A;  3TOT A;  5KOX A;  3KH9 A;  1OYJ A;  1R26 A;  3WGX A;  4K1F A;  3TRX A;  1SL1 B;  2XPE A;  2N5B A;  4V2N A;  5GST A;  2L6C A;  4MJA A;  3VFI A;  2PER A;  4NWY A;  2HQT A;  2C3N A;  4YH2 A;  1F3A A;  4TXO A;  4YAP A;  3SBC A;  2B7J A;  3F3R A;  4OWY A;  1M3I A;  3SWL A;  4FYC A;  1QXH A;  2F8F A;  4CHS A;  4HJM A;  3L9S A;  4H86 A;  1EP7 A;  3UOM A;  2PGT A;  4KDU A;  1THX A;  2XBI A;  4MPF A;  3D0Z A;  4F03 A;  4JRR A;  3CYN A;  4NPB A;  1ZZY A;  4BWQ A;  5BRT A;  1MDI A;  1FW1 A;  5AIX A;  4XS6 A;  1V98 A;  4YAV A;  5DVB A;  1WMJ A;  2WZS A;  1V40 A;  2V2G A;  1GWC A;  1BQ7 A;  3ERW A;  5CP1 A;  2H30 A;  4ZB7 A;  1SJZ A;  4WF5 A;  1BYE A;  3G9B A;  4NV2 A;  5G2Z A;  4NXI A;  1DE2 A;  1XPV A;  4G01 A;  2LUS A;  5JCU A;  3ME8 A;  3DYR A;  5EPF A;  5ECN B;  1BED A;  2UV8 G;  1I9D A;  1DBY A;  4CW9 A;  3VI5 A;  2R3X A;  2P5R A;  3APO A;  5A5H B;  2LRC A;  5COH A;  4AJ6 A;  3E0U A;  3DD3 A;  5B8B A;  2C4J A;  1V58 A;  5ECQ B;  1A0F A;  5B8A A;  4LA1 A;  1V9W A;  1YEX A;  3ZYW A;  5ECR B;  4RQR A;  3MIX A;  2FA8 A;  4O92 A;  1X5C A;  2L5L A;  1B4Q A;  3IAM 2;  2IL3 A;  4KCE A;  2OBK A;  3W6G A;  4MMM A;  5D9T A;  2L4C A;  2A2P A;  1ERV A;  1WWJ A;  3F4R A;  4KX4 A;  2PVQ A;  5IMZ A;  2B3S A;  3GMF A;  5BMU B;  2H76 A;  16GS A;  2V1M A;  2I81 A;  3HZ4 A;  3DML A;  5A5H A;  3UMA A;  2O36 A;  5KN2 A;  1IYI A;  3US3 A;  2K18 A;  2K8S A;  4YKF A;  1BX9 A;  3LSZ A;  1Y6E A;  4FYU A;  3EYT A;  4MNN A;  2O7K A;  2V32 A;  3KGK A;  3IDV A;  1FOH A;  1GTA A;  3D6I A;  4MDC A;  2HLS A;  4IW9 A;  3FK8 A;  3TRP A;  2JSZ A;  1ERW A;  3DIE A;  5KN0 A;  3F6F A;  1O85 A;  1NHY A;  3PGT A;  3ZVJ D;  1N8J A;  1X9M B;  2AJQ B;  2QA2 A;  4KF9 A;  2KLX A;  1F2E A;  4GST A;  2ON5 A;  1K3O A;  2UZ8 A;  1XVW A;  5BMU A;  2DJJ A;  1THO A;  1TK0 B;  2GQL A;  3F63 A;  3VPQ A;  2B1L A;  4I6X A;  1S3D A;  4ZB8 A;  1I5G A;  1GSY A;  5D9W A;  2H6Z A;  5HR3 A;  3O3T A;  2C3Q A;  2IJY A;  4AKG A;  4WBR D;  3IBH A;  4POB A;  5LNK e;  3HHV A;  4K0N A;  1K0C A;  1PD2 1;  1B9X C;  3APQ A;  1GH2 A;  4IP6 A;  5G31 A;  4HI7 A;  4KDX A;  1TK5 B;  3EMX A;  2HRK B;  5CRH A;  5A4W A;  3CQF A;  4GDF A;  5J4Y A;  3IPZ A;  1K0O A;  3M9J A;  4MP4 A;  4ZL7 A;  2EFD A;  4ACS A;  2FGX A;  2DIY A;  1GSQ A;  3IR4 A;  4ICY A;  2KUC A;  2CVK A;  2H0H A;  1NSW A;  4O5Q A;  2LNT A;  2IFQ B;  4PUA A;  2YAN A;  2E2M A;  3IE3 A;  4ZL8 A;  3KMO A;  1M2D A;  3TCO A;  4AKH A;  5A1N B;  3LXT A;  6GSY A;  3EMP A;  3IV4 A;  2V6K A;  2K9F A;  2VAF A;  2B5X A;  1GL8 A;  4K6X A;  4GWR A;  3HA9 A;  2YWI A;  1JLW A;  2H1L A;  3LW9 A;  3UIW A;  3GKX A;  2LKU A;  2GS3 A;  2PVO C;  4X43 A;  1E6B A;  1FHE A;  2HRK A;  1OC9 B;  1JZR A;  2VCV A;  3D4M A;  1FOV A;  1JZW A;  3BJ5 A;  2B5E A;  2VM1 A;  5DQY A;  5IO0 A;  5EY6 A;  4HQS A;  4XS4 B;  1XWB A;  4HDE A;  2DC5 A;  3CXG A;  1MD4 A;  4CDO A;  1YKA A;  3ZRE A;  4Q5R A;  2KHP A;  2IFQ A;  2MMO A;  3GTU B;  2KOK A;  4NMU A;  1T1V A;  2VO4 A;  5A1N A;  1XIY A;  2R2J A;  4TN8 A;  5J5N A;  2FUG 2;  3CRT A;  1WRY A;  3GUS A;  2FLS A;  1XWK A;  3IC8 A;  1X5E A;  3QD9 A;  1EV4 A;  2GQK A;  1K0B A;  5A34 B;  3FHK A;  4L0U A;  3FZ5 A;  2C3T A;  1WP0 A;  1TU7 A;  1NM3 A;  3GX8 A;  1QK8 A;  3DWV A;  1OC9 A;  4AJ8 A;  3G7J A;  22GS A;  5C04 A;  3GIX A;  4EE0 A;  3TB2 A;  4PQ1 A;  2E7P A;  4L5L A;  2H0I A;  4FQU A;  4QMK A;  5ID2 B;  3GTU A;  3A2V A;  1A2J A;  5HQP A;  3ZVJ A;  3CSJ A;  2R5G A;  1YEP A;  3BCI A;  4Q5F A;  2VL2 C;  3BCK A;  5H5S A;  2CZ3 A;  4IBP A;  4IS0 A;  3ERF A;  2IIY A;  1XCC A;  3U6V A;  2DML A;  2H0G A;  4BA7 A;  3DVX A;  3HY2 A;  5A34 A;  5GZZ B;  1HD2 A;  2E0Q A;  3O6T A;  3RGB C;  1E2Y A;  2JAC A;  4F82 A;  4WR5 A;  4Z2U A;  3DEX A;  3HDC A;  4KE3 A;  1A2L A;  3RPP A;  3A2X A;  1AQV A;  1XWA A;  2MMN A;  5ECK B;  2X4A A;  3TKP A;  3TKS E;  1EOH A;  1ZYE A;  2G2Q A;  2HZE A;  3HD5 A;  5B6M A;  4PHZ C;  8GSS A;  2YWN A;  2XBQ A;  2GSQ A;  5ID2 A;  4ILF A;  3WT1 A;  1AUC A;  3M1G A;  5D96 A;  2C0E A;  4K2D A;  3ZZX A;  4ZB6 A;  5GAN D;  4ZIL A;  20GS A;  2OE3 A;  3D22 A;  2PPT A;  4MJB A;  1MDJ A;  5F06 A;  1URM A;  4GCI A;  4BWS A;  4GTU A;  1PRX A;  2OE1 A;  1N2A A;  3E9J B;  1G6W A;  3E3E A;  2O8V B;  5DAL B;  3FEU A;  3FZ4 A;  5FWG A;  4K9Z A;  1HNC A;  1ERU A;  5D73 A;  5ECO B;  1WPI A;  1V57 A;  3I43 A;  1GSF A;  2AV4 A;  2OA7 A;  1ZYN A;  3DRN A;  1PSQ A;  2GGT A;  4G19 A;  2QSI A;  3FR3 A;  3C1R A;  1A2M A;  2H72 A;  1HYU A;  2J23 A;  5DAK B;  2BMX A;  4WEY A;  1AQX A;  3QPM A;  5IMV A;  3KZQ A;  1GTB A;  1O73 A;  1XWC A;  3ZLP A;  2TRX A;  2VCT A;  2PMT A;  2GQM A;  3FZ9 A;  3LFL A;  1XXU A;  2HFD A;  2FNO A;  4RI6 A;  4PUR A;  2HSH A;  4X0X A;  4ID0 A;  2PWJ A;  6GSU A;  3ERG A;  2WGR A;  1LBK A;  1WJK A;  3GN3 A;  4O32 A;  2DJ2 A;  2XPD A;  1SL0 B;  1SKR B;  2H19 A;  1OC3 A;  2CX4 A;  4XTS A;  4AKI A;  1FVJ A;  3QCP A;  1TU8 A;  1U3I A;  2B7K A;  5E4W A;  2R4V A;  3ZMK A;  1XWG A;  5DAL A;  4EXJ A;  2YP6 A;  3P7X A;  3HVN A;  3CSI A;  1RW1 A;  2LV3 A;  4XRA A;  4GRF A;  4N11 A;  5G5E A;  3EUR A;  3DGQ A;  4OCF A;  1BG1 A;  5DAK A;  2RII A;  3TRQ A;  2VLT A;  12GS A;  4A5P A;  4OCE A;  1Z7P A;  3F8U A;  3UBK A;  6GST A;  2RM5 A;  1SKS B;  2DKI A;  3WGD A;  3MAK A;  4K5R A;  3RAZ A;  2O5V A;  1A23 A;  3IXR A;  2D2Z A;  3GX0 A;  3IAS 2;  2VCX A;  2EIR A;  1U87 A;  2R0C A;  2YCD A;  4L8E A;  1G7E A;  1TP9 A;  2YV7 A;  1ZCP A;  3H8Q A;  1GTU A;  4LL1 B;  1PX6 A;  2IWT A;  4QL7 A;  1GSD A;  3L9V A;  4KUN A;  1LU4 A;  1QMV A;  2C0G A;  1AQW A;  1GUL A;  4HZ4 A;  4LLR A;  4EIP A;  13GS A;  2VL2 A;  2PN8 A;  4ULX A;  3QAV A;  4KW6 A;  4WKW A;  3KMN A;  4TXV A;  3F9U A;  4EKZ A;  4EDZ A;  1M7T A;  1Z9H A;  5FHI A;  1KBN A;  4G0K A;  5J40 A;  3TJB A;  5DBQ A;  2HSY A;  4IKH A;  4K2X A;  4F0B A;  3J7Y k;  3MDK A;  2HRN A;  3VWW A;  3VWX A;  1EEJ A;  2CVD A;  3JCM L;  4MCU A;  4O5U A;  1HNB A;  4TR4 A;  2TRC P;  5KN1 A;  5IQY A;  2F3M A;  1DE1 A;  1XZO A;  1EV9 A;  3L9U A;  3CMI A;  3LQ7 A;  4E8E A;  1G0T A;  2A2S A;  2CT6 A;  5IO2 A;  1HQO A;  4OFM A;  2ZCT A;  5CYY A;  3EE2 A;  5CRE A;  2FWF A;  3FZA A;  2RUF A;  2K8V A;  2YJH A;  3KJY A;  2ALB A;  2VUP A;  4I2U A;  1SL2 B;  1GSS A;  1EWX A;  2LJA A;  3TUE A;  3EU4 A;  2FWH A;  2M46 A;  1OKT A;  1JLV A;  1M3J A;  1FO5 A;  5HFI A;  1VF4 A;  1XOA A;  3TJG A;  4YQM A;  4KSM A;  1F9M A;  3H79 A;  5ECL B;  2WRT A;  4YKG A;  4HU7 A;  1Y25 A;  5JWQ B;  2VCQ A;  5KN3 A;  3G7Y A;  3PH9 A;  3EVI A;  1VF1 A;  2B6M A;  4BIK A;  4F9Z A;  4N30 A;  1S3C A;  1R7H A;  3C7M A;  2GTU A;  4NV5 A;  1K0N A;  3HXS A;  4I2T A;  1GUH A;  1H75 A;  1NHO A;  3KXO A;  5C00 A;  5H5Q A;  3UAR A;  1OAZ A;  1QFN A;  5ELG A;  3DVW A;  2MMA A;  1Q4J A;  2YWM A;  2EFC A;  4MJC A;  3F4T A;  3J7Y b;  3N5O A;  5F0G A;  4POL A;  4FO5 A;  3QDN A;  4HU9 A;  3Q6O A;  3FW2 A;  4MZB A;  1OVN A;  3TJJ A;  1SEN A;  3QR6 A;  1A0R P;  2LNS A;  1WE0 A;  1T8E B;  4KND A;  2VM2 A;  5ENU A;  3VWU A;  4IGJ A;  4BL7 B;  4FIW A;  4HUA A;  2CA8 A;  4IJ3 A;  3ZIJ A;  2GSS A;  4FH8 A;  1GNW A;  7GSS A;  1S3A A;  1BG5 A;  4ZXG A;  3ZIT A;  1BJX A;  5J9B A;  2LS5 A;  2IN3 A;  3VK9 A;  3LEF A;  2M80 A;  2IPA A;  4MZC A;  4Q5N A;  5AGY A;  4OO4 A;  1AIU A;  3RFR C;  2AAW A;  1J9B A;  2LQQ A;  2HSN A;  1R5P A;  2IMI A;  4J56 E;  5HR0 A;  3QAG A;  1MDK A;  4HEA 2;  17GS A;  5JWO B;  3GUR A;  5IMC A;  1Z6N A;  2REM A;  1X9W B;  2CQ9 A;  3UL3 A;  4QL9 A;  1TRW A;  4BL7 A;  2GVP A;  1V2A A;  2E2G A;  1OE7 A;  3L78 A;  4AGS A;  3Q19 A;  3RHC A;  3UEM A;  3FR6 A;  2VL9 A;  1KTE A;  2EFH A;  3IC4 A;  1QQ2 A;  2YPM A;  4TR0 A;  19GS A;  1XBS A;  2LEG A;  3GRX A;  1WIK A;  2F8A A;  4ECC A;  4I97 A;  1ABA A;  2VLU A;  3VWV A;  2C8U A;  3FY7 A;  4ZIJ A;  2V41 A;  2KP1 A;  1M99 A;  2MYG A;  3I69 A;  2VD1 A;  3KM6 A;  2WW3 A;  5DCG A;  1SD8 A;  4MF6 A;  5HFG A;  2LST A;  1H4O A;  5B6N A;  4X1U A;  2N5A A;  4DSS B;  4J2F A;  4ZBA A;  4BVX B;  2VD0 A;  1PQN A;  4NHZ A;  4EDY A;  4RUV A;  5A5K A;  2EIQ A;  4K7O A;  1KEB A;  1K0D A;  1ZYQ B;  4LL4 B;  3RDW A;  2XC2 A;  1PA3 A;  2GST A;  4GF0 A;  2MMZ A;  4PNF A;  2P5Q A;  4XIH A;  1C72 A;  5EVO A;  3F4S A;  3ME7 A;  4EO3 A;  1XG8 A;  2LTK A;  1TK8 B;  6GSV A;  5GAP D;  2J9H A;  1VGL A;  4KCA A;  3CBU A;  3HMJ G;  1K3Y A;  2HZF A;  3KD0 A;  3W8S A;  2HZE B;  1ERT A;  3KTB A;  4DSS A;  4BVX A;  2DJ3 A;  3GL3 A;  3G7I A;  3QMX A;  3ZRD A;  4PGT A;  2GT5 A;  3TOU A;  5CRD A;  3HJO A;  4AKX B;  2C1Y A;  4ML6 A;  4MAB A;  2N5F A;  1Z5Y E;  4KDY A;  1JZD A;  2WW2 A;  2K6V A;  3TKS C;  3MYD A;  4G9H A;  2HNL A;  3GFK A;  4HQZ A;  2X8H A;  3Q74 A;  1T4Z A;  2WW0 A;  4G2E A;  4AI6 A;  2G0F A;  4EL1 A;  1VF3 A;  2EIO A;  3KH7 A;  1OE8 A;  2L5O A;  1GLQ A;  4MH2 A;  2HRF A;  1XW5 A;  2B5Y A;  5IM9 A;  1ZGN A;  1B48 A;  3LJR A;  3ISO A;  3H93 A;  5F8B A;  4D73 B;  1BAY A;  2X64 A;  3N9J A;  5LD0 A;  3KP9 A;  2H8L A;  1RQM A;  1X9S B;  2O87 A;  1PGT A;  2DSA A;  1YDK A;  1TI1 A;  2YWO A;  2GT6 A;  3M8N A;  5D9X A;  4JED A;  5CAX A;  3IK9 A;  3QOU A;  4Z2T A;  1EGO A;  2OJL A;  2WB9 A;  1Y1U A;  5A4U A;  2EFE A;  9GSS A;  4P3Y B;  4L0W A;  1KNG A;  1MTC A;  1F6M C;  2L59 A;  4K5S A;  2DBC A;  2CZ2 A;  2YN1 A;  2RM6 A;  4D73 A;  2QC7 A;  3VI7 A;  2RLI A;  1TRU A;  4ECJ A;  2AB6 A;  2FA4 A;  4ECI A;  5LCZ A;  2R6K A;  3ZIV A;  3WT2 A;  4MF7 A;  4G0L A;  2AUV A;  4GXZ A;  1U88 A;  5IMF A;  4PQI A;  2OAD A;  5DJM A;  1SK0 A;  3HVV A;  1YY7 A;  18GS A;  3PIN A;  2L4Q A;  2YNX A;  1WOU A;  4I5Q A;  5DJL A;  1ZOF A;  5G1L A;  4KA0 A;  5D9V A;  2AYT A;  4J57 E;  5CRW A;  3DXB A;  2R37 A;  3GKM A;  2P31 A;  4F2I A;  3DKS A;  5AIV A;  4O5R A;  4W66 A;  3FMW A;  3LG6 A;  3GA4 A;  4TW5 A;  2I9H A;  3NZN A;  2P0G A;  3KP8 A;  3GSS A;  2H75 A;  2C0D A;  5DQS A;  4Z2R A;  2ZNM A;  2OKA A;  2O85 A;  1PL1 A;  4OO5 A;  5ECI B;  5CNW A;  1QGV A;  5AIS A;  4E8H A;  5J4U A;  1ACV A;  4DSR A;  2XHF A;  1W89 A;  2CVB A;  4ZBD A;  1SJI A;  4MZW A;  1YZX A;  1TW9 A;  2WZ9 A;  1SKW B;  5ECM B;  4YQU A;  3FRC A;  5H5R A;  4PX1 A;  1EZK A;  2LJR A;  1A24 A;  2HE3 A;  2I4A A;  3LOR A;  1N25 A;  6GSW A;  1VRS D;  3C8E A;  5HR1 A;  1B4P A;  1PKZ A;  2WFC A;  4MLY A;  4OD7 A;  2AHE A;  3C1S A;  1QUW A;  3LXZ A;  2V6O A;  4K0G A;  2NTO A;  4N0Z A;  1VF2 A;  5IMD A;  2FWG A;  3BBY A;  5DCH A;  3VPT A;  4PXO A;  1GP1 A;  4MK3 A;  3M3M A;  1EEM A;  1SVL A;  2JL4 A;  3O76 A;  5IOW A;  1XOB A;  2DLX A;  2O3E A;  2CX3 A;  2IME A;  4KAE A;  3TKS A;  4V2L A;  4DEJ A;  3R2Q A;  4IJI A;  3ZFL A;  4MJE A;  1O8W A;  2DKH A;  1GTI A;  1PL2 A;  2A4V A;  2F51 A;  1OKD A;  4V1A p;  4WXT A;  2GSR A;  2GZZ A;  3HVX A;  4N0V A;  2OE0 A;  1YEW C;  2HSM A;  5L71 A;  4POK A;  3LYK A;  2FY6 A;  4TR1 B;  2EC4 A;  4I8B A;  1GRX A;  1UA5 A;  1UN2 A;  3L0H A;  2H1D A;  1T00 A;  3QFB C;  2VCW A;  1YVL A;  5ELA A;  3W8J A;  1TDI A;  4KSO A;  4ZB9 A;  4JZQ A;  2A4H A;  1NW2 A;  5J4V A;  4Q5Q A;  4X4J A;  2IMK A;  1ST9 A;  2QA1 A; 
#chains in the Genus database with same CATH homology
 2HXK A;  5HR2 A;  1RK4 A;  3RBT A;  3P8W A;  4GLT A;  2DJK A;  3D4T A;  3LGC A;  4TVE A;  2JZT A;  3ZTL A;  3C71 A;  4IP1 A;  4POM A;  3PPU A;  2ZUP A;  4N3Z A;  3GYK A;  3F3Q A;  1M9A A;  1SYX A;  2OAC A;  3UVT A;  2IMF A;  2A2R A;  2ON7 A;  3FYG A;  1GUM A;  1B9Y C;  1SVO A;  1TKD B;  2L6D A;  4TR1 A;  3D21 A;  2F9S A;  5G30 A;  5CO3 A;  2O89 A;  3GST A;  1SD9 A;  4G10 A;  4IVF A;  2H1B A;  5EL8 A;  3EWL A;  1TI3 A;  4K7N A;  4HJ2 A;  1U3A A;  3QFA C;  10GS A;  4IEL A;  2CV4 A;  5KEJ A;  1PN0 A;  2VCZ A;  1X0R A;  3IK7 A;  4MPG A;  1GSE A;  6GSX A;  2JU5 A;  4MF5 A;  3H1N A;  4MH3 A;  1ML6 A;  2FCH A;  5GSS A;  4CY8 A;  3NIV A;  1XW9 A;  1A8Y A;  1ZL9 A;  1F37 A;  5D8I A;  1K0M A;  4NAX A;  4QQ7 A;  2FD3 A;  5J3R A;  1PKW A;  5IMA A;  4OMV A;  5JCW A;  2NPB A;  4E68 A;  3KEB A;  1TTZ A;  1YJ6 A;  4EUY A;  4NHW A;  2KP2 A;  2HSN B;  4LMW A;  4JU5 A;  3KIJ A;  4OFT A;  5INY A;  4KH7 A;  2VKZ G;  3QAW A;  4PNG A;  1J0F A;  5ECH B;  1Z3E A;  3M0F A;  2DIZ A;  2JSY A;  1T3B A;  4HS1 A;  3UAP A;  3TKQ A;  1TXX A;  2JZS A;  3L4N A;  3TU3 B;  2WUL A;  4LMV A;  1JFU A;  3C73 A;  1F3B A;  2LQO A;  3KTL A;  1AAZ A;  1M2B A;  2VL3 A;  2NDO A;  3HJP A;  4IN0 A;  2H71 A;  3BOA A;  4PTS A;  1XVQ A;  3P90 A;  3GH6 A;  1T7P B;  4TRX A;  6GSS A;  2H6Y A;  1SJ6 A;  3I9V 2;  3GHA A;  11GS A;  2OT3 A;  2H01 A;  2X99 A;  2VIM A;  2HYX A;  2PU9 C;  2M72 A;  4TR3 A;  2NBS A;  3TDG A;  2H74 A;  3F0I A;  3A5W A;  1IYH A;  3WD6 A;  3VUR A;  3NOF A;  1FVK A;  2CAI A;  1YF0 A;  4Z7X A;  5A4V A;  14GS A;  2I3Y A;  5F05 A;  3M9K A;  3IA1 A;  2WJU A;  4PUF C;  1DUG A;  5J9C A;  2R0P A;  4GQC A;  2RUE A;  3ZL5 A;  4FYB A;  4ZL9 A;  2LRT A;  2DJ1 A;  3EIN A;  3VLN A;  3TKR A;  4USS A;  2GLR A;  1PMT A;  2JAD A;  3ED3 A;  1ZMA A;  1K0A A;  1MEK A;  3HCZ A;  1SK2 A;  1EGR A;  2C80 A;  1M2A A;  1FAA A;  3IHG A;  3CTF A;  5B7C A;  4HZ2 A;  2B1K A;  3AY8 A;  1M9B A;  5FT3 A;  1XFL A;  1HNA A;  1M0U A;  1O81 A;  3LWA A;  3IRA A;  1G7O A;  1SU9 A;  5ABR A;  1GUK A;  2CAQ A;  1ON4 A;  4HOJ A;  2HI7 A;  4GQF A;  1SK1 A;  2GDR A;  3MSZ A;  4JR4 A;  3GNJ A;  2WS2 A;  2DJ0 A;  5AN1 A;  2I1U A;  3UVH A;  1CQH A;  2BJX A;  1TRS A;  4GSS A;  4L5O A;  4V2M A;  3H4K A;  4F0C A;  1YQ1 A;  2YJ7 A;  1EP8 A;  2H6X A;  5ECS A;  2WDU A;  1USB A;  4AF2 A;  5E59 A;  2L57 A;  3GKK A;  1MD3 A;  2HT9 A;  3TJK A;  4WBJ A;  4ZBB A;  1GSU A;  4V1A g;  3TGZ A;  2H1A A;  3S9F A;  3D5J A;  1JHB A;  2PBJ A;  4K7I A;  4EC0 A;  1U6T A;  1G6Y A;  2GZP A;  3EU3 A;  1GNE A;  2YV9 A;  2DMM A;  2OBI A;  3BD2 A;  3RPN A;  2X8C A;  4RI7 A;  1GLP A;  1A8L A;  4WF4 A;  2LJK A;  4XS4 A;  1SYR A;  4IHU A;  3CSH A;  3ZFB A;  1Z6M A;  2JZR A;  3UBL A;  2IMD A;  5J47 A;  2C0F A;  2LRN A;  3HJM A;  2H70 A;  4MA9 A;  3GH9 A;  1Q98 A;  5IPH A;  4BPY A;  3I6A A;  3EPT A;  1X5D A;  1AW9 A;  1TXU A;  3FKF A;  3IOS A;  1DSB A;  3WYW A;  4ML1 A;  2QKE A;  3A2W A;  5D93 A;  4XCS A;  1AC1 A;  5J41 A;  3K8N A;  3WGE A;  4AJ7 A;  1CQG A;  1PX7 A;  4XS1 A;  4DSQ A;  2HRA A;  1T4Y A;  2R0G A;  5JCG A;  1FB6 A;  2Z9S A;  3IHQ A;  3EC3 A;  3GKN A;  3A3T A;  1EOG A;  2WCI A;  3MWH A;  1XW6 A;  1W4V A;  4BVY B;  1Z7R A;  2VOC A;  4IQ1 A;  5DDL A;  1JZO A;  5JWR B;  3LYP A;  4WET A;  4EVM A;  5IPG A;  4EF0 A;  3V1W A;  1UC7 A;  4XRD A;  2H66 A;  2VLV A;  2GZY A;  1UVZ A;  1BF5 A;  4ISD A;  4XHM A;  3PR8 A;  4YQV A;  3GL5 A;  1R4W A;  4G0I A;  2MZC A;  3OR5 A;  4IQA A;  2H1G A;  1YF1 A;  1O8X A;  4TKY A;  2NVL A;  3F6D A;  1AXD A;  3Q18 A;  4JBB A;  3ZML A;  1FB0 A;  3FR9 A;  3A5I A;  3CRU A;  4O7H A;  3HVS A;  3HKR A;  3RHB A;  4EIQ A;  4CY6 A;  2ES7 A;  5IIZ A;  2BTO T;  3HZ8 A;  5ECP B;  2TIR A;  3P2A A;  1OC8 A;  3GV1 A;  1TJD A;  4DVC A;  3UJ1 A;  4BVY A;  4PQH A;  2FWE A;  3KCM A;  1B8X A;  4OFN A;  3MNG A;  4KGI A;  5CRG A;  2FHE A;  5F07 A;  4N10 A;  1SVM A;  4KB3 A;  4K8M A;  2YZU A;  1R5A A;  4GSN A;  1TRV A;  1PN9 A;  5KOW A;  2X49 A;  2QGV A;  5IOX A;  5HFK A;  5G5F A;  1LJR A;  1TOF A;  2MBS A;  3U5R E;  3CWG A;  3R3E A;  2YOI A;  1J08 A;  1O6J A;  2YZH A;  2H73 A;  1FG4 A;  4TXO B;  3APS A;  1K3L A;  4RQX A;  2HSM B;  2X8G A;  1ZYP A;  3TJF A;  1O7U A;  4ECB A;  2PUK C;  2MBT A;  4JR6 A;  1ILO A;  3HYP A;  1YKC A;  4JE1 A;  3CTG A;  5G1K A;  4TOP A;  4WR4 A;  3TOT A;  5KOX A;  3KH9 A;  1OYJ A;  1R26 A;  3WGX A;  4K1F A;  3TRX A;  1SL1 B;  2XPE A;  2N5B A;  4V2N A;  5GST A;  2L6C A;  4MJA A;  3VFI A;  2PER A;  4NWY A;  2HQT A;  2C3N A;  4YH2 A;  1F3A A;  4TXO A;  4YAP A;  3SBC A;  2B7J A;  3F3R A;  4OWY A;  3SWL A;  4FYC A;  1QXH A;  2F8F A;  4CHS A;  4HJM A;  3L9S A;  4H86 A;  1EP7 A;  3UOM A;  2PGT A;  4KDU A;  1THX A;  2XBI A;  4MPF A;  3D0Z A;  4F03 A;  4JRR A;  3CYN A;  4NPB A;  1ZZY A;  4BWQ A;  5BRT A;  1MDI A;  1FW1 A;  5AIX A;  4XS6 A;  1V98 A;  4YAV A;  5DVB A;  1WMJ A;  1V40 A;  2V2G A;  1GWC A;  1BQ7 A;  3ERW A;  5CP1 A;  2H30 A;  4ZB7 A;  1SJZ A;  4WF5 A;  1BYE A;  3G9B A;  4NV2 A;  5G2Z A;  4NXI A;  1DE2 A;  1XPV A;  4G01 A;  2LUS A;  5JCU A;  3ME8 A;  3DYR A;  5EPF A;  5ECN B;  1BED A;  2UV8 G;  1I9D A;  1DBY A;  4CW9 A;  3VI5 A;  2R3X A;  2P5R A;  3APO A;  5A5H B;  2LRC A;  5COH A;  4AJ6 A;  3E0U A;  3DD3 A;  5B8B A;  2C4J A;  1V58 A;  5ECQ B;  1A0F A;  5B8A A;  4LA1 A;  1V9W A;  1YEX A;  3ZYW A;  5ECR B;  4RQR A;  3MIX A;  2FA8 A;  4O92 A;  1X5C A;  2L5L A;  1B4Q A;  3IAM 2;  2IL3 A;  4KCE A;  2OBK A;  3W6G A;  4MMM A;  5D9T A;  2L4C A;  2A2P A;  1ERV A;  1WWJ A;  3F4R A;  4KX4 A;  2PVQ A;  5IMZ A;  2B3S A;  3GMF A;  5BMU B;  2H76 A;  16GS A;  2V1M A;  2I81 A;  3HZ4 A;  3DML A;  5A5H A;  3UMA A;  5KN2 A;  1IYI A;  3US3 A;  2K18 A;  2K8S A;  4YKF A;  1BX9 A;  3LSZ A;  1Y6E A;  4FYU A;  3EYT A;  4MNN A;  2O7K A;  2V32 A;  3KGK A;  3IDV A;  1FOH A;  1GTA A;  3D6I A;  4MDC A;  2HLS A;  4IW9 A;  3FK8 A;  3TRP A;  2JSZ A;  1ERW A;  3DIE A;  5KN0 A;  3F6F A;  1O85 A;  1NHY A;  3PGT A;  3ZVJ D;  1N8J A;  1X9M B;  2AJQ B;  2QA2 A;  4KF9 A;  2KLX A;  1F2E A;  4GST A;  2ON5 A;  1K3O A;  2UZ8 A;  1XVW A;  5BMU A;  2DJJ A;  1THO A;  1TK0 B;  2GQL A;  3F63 A;  3VPQ A;  2B1L A;  4I6X A;  1S3D A;  4ZB8 A;  1I5G A;  1GSY A;  5D9W A;  2H6Z A;  5HR3 A;  3O3T A;  2C3Q A;  2IJY A;  4AKG A;  4WBR D;  3IBH A;  4POB A;  5LNK e;  3HHV A;  4K0N A;  1K0C A;  1PD2 1;  1B9X C;  3APQ A;  1GH2 A;  4IP6 A;  5G31 A;  4HI7 A;  4KDX A;  1TK5 B;  3EMX A;  2HRK B;  5CRH A;  5A4W A;  4GDF A;  5J4Y A;  3IPZ A;  1K0O A;  3M9J A;  4MP4 A;  4ZL7 A;  2EFD A;  4ACS A;  2FGX A;  2DIY A;  1GSQ A;  3IR4 A;  4ICY A;  2KUC A;  2CVK A;  2H0H A;  1NSW A;  4O5Q A;  2LNT A;  2IFQ B;  4PUA A;  2YAN A;  2E2M A;  3IE3 A;  4ZL8 A;  3KMO A;  1M2D A;  3TCO A;  4AKH A;  5A1N B;  3LXT A;  6GSY A;  3EMP A;  3IV4 A;  2V6K A;  2K9F A;  2VAF A;  2B5X A;  1GL8 A;  4K6X A;  4GWR A;  3HA9 A;  2YWI A;  1JLW A;  2H1L A;  3LW9 A;  3UIW A;  3GKX A;  2LKU A;  2GS3 A;  2PVO C;  4X43 A;  1E6B A;  1FHE A;  2HRK A;  1OC9 B;  1JZR A;  2VCV A;  3D4M A;  1FOV A;  1JZW A;  3BJ5 A;  2B5E A;  2VM1 A;  5DQY A;  5IO0 A;  5EY6 A;  4HQS A;  4XS4 B;  1XWB A;  4HDE A;  2DC5 A;  3CXG A;  1MD4 A;  4CDO A;  1YKA A;  3ZRE A;  4Q5R A;  2KHP A;  2IFQ A;  2MMO A;  3GTU B;  2KOK A;  4NMU A;  1T1V A;  2VO4 A;  5A1N A;  1XIY A;  2R2J A;  4TN8 A;  5J5N A;  2FUG 2;  3CRT A;  1WRY A;  3GUS A;  2FLS A;  1XWK A;  3IC8 A;  1X5E A;  3QD9 A;  1EV4 A;  2GQK A;  1K0B A;  5A34 B;  3FHK A;  4L0U A;  3FZ5 A;  2C3T A;  1WP0 A;  1TU7 A;  1NM3 A;  3GX8 A;  1QK8 A;  3DWV A;  1OC9 A;  4AJ8 A;  3G7J A;  22GS A;  5C04 A;  3GIX A;  4EE0 A;  3TB2 A;  4PQ1 A;  2E7P A;  4L5L A;  2H0I A;  4FQU A;  4QMK A;  5ID2 B;  3GTU A;  3A2V A;  1A2J A;  5HQP A;  3ZVJ A;  3CSJ A;  2R5G A;  1YEP A;  3BCI A;  4Q5F A;  2VL2 C;  3BCK A;  5H5S A;  2CZ3 A;  4IBP A;  4IS0 A;  3ERF A;  2IIY A;  1XCC A;  3U6V A;  2DML A;  2H0G A;  4BA7 A;  3DVX A;  3HY2 A;  5A34 A;  5GZZ B;  1HD2 A;  2E0Q A;  3O6T A;  1E2Y A;  2JAC A;  4F82 A;  4WR5 A;  4Z2U A;  3DEX A;  3HDC A;  4KE3 A;  1A2L A;  3RPP A;  3A2X A;  1AQV A;  1XWA A;  2MMN A;  5ECK B;  2X4A A;  3TKP A;  3TKS E;  1EOH A;  1ZYE A;  2G2Q A;  2HZE A;  3HD5 A;  5B6M A;  8GSS A;  2YWN A;  2XBQ A;  2GSQ A;  5ID2 A;  4ILF A;  3WT1 A;  1AUC A;  3M1G A;  5D96 A;  2C0E A;  4K2D A;  3ZZX A;  4ZB6 A;  5GAN D;  4ZIL A;  20GS A;  2OE3 A;  3D22 A;  2PPT A;  4MJB A;  1MDJ A;  5F06 A;  1URM A;  4GCI A;  4BWS A;  4GTU A;  1PRX A;  2OE1 A;  1N2A A;  3E9J B;  1G6W A;  3E3E A;  2O8V B;  5DAL B;  3FEU A;  3FZ4 A;  5FWG A;  4K9Z A;  1HNC A;  1ERU A;  5D73 A;  5ECO B;  1WPI A;  1V57 A;  3I43 A;  1GSF A;  2AV4 A;  2OA7 A;  1ZYN A;  3DRN A;  1PSQ A;  2GGT A;  4G19 A;  2QSI A;  3FR3 A;  3C1R A;  1A2M A;  2H72 A;  1HYU A;  2J23 A;  5DAK B;  2BMX A;  4WEY A;  1AQX A;  3QPM A;  5IMV A;  3KZQ A;  1GTB A;  1O73 A;  1XWC A;  3ZLP A;  2TRX A;  2VCT A;  2PMT A;  2GQM A;  3FZ9 A;  3LFL A;  1XXU A;  2HFD A;  2FNO A;  4RI6 A;  4PUR A;  2HSH A;  4X0X A;  4ID0 A;  2PWJ A;  6GSU A;  3ERG A;  2WGR A;  1LBK A;  1WJK A;  3GN3 A;  4O32 A;  2DJ2 A;  2XPD A;  1SL0 B;  1SKR B;  2H19 A;  1OC3 A;  2CX4 A;  4XTS A;  4AKI A;  1FVJ A;  3QCP A;  1TU8 A;  1U3I A;  2B7K A;  5E4W A;  2R4V A;  3ZMK A;  1XWG A;  5DAL A;  4EXJ A;  2YP6 A;  3P7X A;  3CSI A;  1RW1 A;  2LV3 A;  4XRA A;  4GRF A;  4N11 A;  5G5E A;  3EUR A;  3DGQ A;  4OCF A;  1BG1 A;  5DAK A;  2RII A;  3TRQ A;  2VLT A;  12GS A;  4A5P A;  4OCE A;  1Z7P A;  3F8U A;  3UBK A;  6GST A;  2RM5 A;  1SKS B;  2DKI A;  3WGD A;  3MAK A;  4K5R A;  3RAZ A;  2O5V A;  1A23 A;  3IXR A;  2D2Z A;  3GX0 A;  3IAS 2;  2VCX A;  2EIR A;  1U87 A;  2R0C A;  2YCD A;  4L8E A;  1G7E A;  1TP9 A;  2YV7 A;  1ZCP A;  3H8Q A;  1GTU A;  4LL1 B;  1PX6 A;  2IWT A;  4QL7 A;  1GSD A;  3L9V A;  4KUN A;  1LU4 A;  1QMV A;  2C0G A;  1AQW A;  1GUL A;  4HZ4 A;  4LLR A;  4EIP A;  13GS A;  2VL2 A;  2PN8 A;  4ULX A;  3QAV A;  4KW6 A;  4WKW A;  3KMN A;  4TXV A;  3F9U A;  4EKZ A;  4EDZ A;  1M7T A;  1Z9H A;  5FHI A;  1KBN A;  4G0K A;  5J40 A;  3TJB A;  5DBQ A;  2HSY A;  4IKH A;  4K2X A;  4F0B A;  3J7Y k;  3MDK A;  2HRN A;  3VWW A;  3VWX A;  1EEJ A;  2CVD A;  3JCM L;  4MCU A;  4O5U A;  1HNB A;  4TR4 A;  2TRC P;  5KN1 A;  5IQY A;  2F3M A;  1DE1 A;  1XZO A;  1EV9 A;  3L9U A;  3CMI A;  3LQ7 A;  4E8E A;  1G0T A;  2A2S A;  2CT6 A;  5IO2 A;  1HQO A;  4OFM A;  2ZCT A;  5CYY A;  3EE2 A;  5CRE A;  2FWF A;  3FZA A;  2RUF A;  2K8V A;  2YJH A;  3KJY A;  2ALB A;  2VUP A;  4I2U A;  1SL2 B;  1GSS A;  1EWX A;  2LJA A;  3TUE A;  3EU4 A;  2FWH A;  2M46 A;  1OKT A;  1JLV A;  1FO5 A;  5HFI A;  1VF4 A;  1XOA A;  3TJG A;  4YQM A;  4KSM A;  1F9M A;  3H79 A;  5ECL B;  2WRT A;  4YKG A;  4HU7 A;  1Y25 A;  5JWQ B;  2VCQ A;  5KN3 A;  3G7Y A;  3PH9 A;  3EVI A;  1VF1 A;  2B6M A;  4F9Z A;  4N30 A;  1S3C A;  1R7H A;  3C7M A;  2GTU A;  4NV5 A;  1K0N A;  3HXS A;  4I2T A;  1GUH A;  1H75 A;  1NHO A;  3KXO A;  5C00 A;  5H5Q A;  3UAR A;  1OAZ A;  1QFN A;  5ELG A;  3DVW A;  2MMA A;  1Q4J A;  2YWM A;  2EFC A;  4MJC A;  3F4T A;  3J7Y b;  3N5O A;  5F0G A;  4POL A;  4FO5 A;  3QDN A;  4HU9 A;  3Q6O A;  3FW2 A;  4MZB A;  1OVN A;  3TJJ A;  1SEN A;  3QR6 A;  1A0R P;  2LNS A;  1WE0 A;  1T8E B;  4KND A;  2VM2 A;  5ENU A;  3VWU A;  4IGJ A;  4BL7 B;  4FIW A;  4HUA A;  2CA8 A;  4IJ3 A;  3ZIJ A;  2GSS A;  4FH8 A;  1GNW A;  7GSS A;  1S3A A;  1BG5 A;  4ZXG A;  3ZIT A;  1BJX A;  5J9B A;  2LS5 A;  2IN3 A;  3LEF A;  3VK9 A;  2M80 A;  2IPA A;  4MZC A;  4Q5N A;  5AGY A;  4OO4 A;  1AIU A;  2AAW A;  1J9B A;  2LQQ A;  2HSN A;  1R5P A;  2IMI A;  4J56 E;  5HR0 A;  3QAG A;  1MDK A;  4HEA 2;  17GS A;  5JWO B;  3GUR A;  5IMC A;  1Z6N A;  2REM A;  1X9W B;  2CQ9 A;  3UL3 A;  4QL9 A;  1TRW A;  4BL7 A;  2GVP A;  1V2A A;  2E2G A;  1OE7 A;  3L78 A;  4AGS A;  3Q19 A;  3RHC A;  3UEM A;  3FR6 A;  2VL9 A;  1KTE A;  2EFH A;  3IC4 A;  1QQ2 A;  2YPM A;  4TR0 A;  19GS A;  1XBS A;  2LEG A;  3GRX A;  1WIK A;  2F8A A;  4ECC A;  4I97 A;  1ABA A;  2VLU A;  3VWV A;  2C8U A;  3FY7 A;  4ZIJ A;  2V41 A;  2KP1 A;  1M99 A;  2MYG A;  3I69 A;  2VD1 A;  3KM6 A;  1SD8 A;  5DCG A;  4MF6 A;  5HFG A;  2LST A;  1H4O A;  5B6N A;  4X1U A;  2N5A A;  4DSS B;  4J2F A;  4ZBA A;  4BVX B;  2VD0 A;  1PQN A;  4NHZ A;  4EDY A;  4RUV A;  5A5K A;  2EIQ A;  4K7O A;  1KEB A;  1K0D A;  1ZYQ B;  4LL4 B;  3RDW A;  2XC2 A;  1PA3 A;  2GST A;  4GF0 A;  2MMZ A;  4PNF A;  2P5Q A;  4XIH A;  1C72 A;  5EVO A;  3F4S A;  3ME7 A;  4EO3 A;  2LTK A;  1TK8 B;  6GSV A;  5GAP D;  2J9H A;  1VGL A;  4KCA A;  3CBU A;  3HMJ G;  1K3Y A;  2HZF A;  3KD0 A;  3W8S A;  2HZE B;  1ERT A;  3KTB A;  4DSS A;  4BVX A;  2DJ3 A;  3GL3 A;  3G7I A;  3QMX A;  3ZRD A;  4PGT A;  2GT5 A;  3TOU A;  5CRD A;  3HJO A;  4AKX B;  2C1Y A;  4ML6 A;  4MAB A;  2N5F A;  1Z5Y E;  4KDY A;  1JZD A;  2K6V A;  3TKS C;  3MYD A;  4G9H A;  2HNL A;  3GFK A;  4HQZ A;  2X8H A;  3Q74 A;  1T4Z A;  4G2E A;  4AI6 A;  2G0F A;  4EL1 A;  1VF3 A;  2EIO A;  3KH7 A;  1OE8 A;  2L5O A;  1GLQ A;  4MH2 A;  2HRF A;  1XW5 A;  2B5Y A;  5IM9 A;  1ZGN A;  1B48 A;  3LJR A;  3ISO A;  3H93 A;  5F8B A;  4D73 B;  1BAY A;  2X64 A;  3N9J A;  5LD0 A;  3KP9 A;  2H8L A;  1RQM A;  1X9S B;  2O87 A;  1PGT A;  2DSA A;  1YDK A;  1TI1 A;  2YWO A;  2GT6 A;  3M8N A;  5D9X A;  4JED A;  5CAX A;  3IK9 A;  3QOU A;  4Z2T A;  1EGO A;  2OJL A;  2WB9 A;  1Y1U A;  5A4U A;  2EFE A;  9GSS A;  4P3Y B;  4L0W A;  1KNG A;  1MTC A;  1F6M C;  2L59 A;  4K5S A;  2DBC A;  2CZ2 A;  2YN1 A;  2RM6 A;  4D73 A;  2QC7 A;  3VI7 A;  2RLI A;  1TRU A;  4ECJ A;  2AB6 A;  2FA4 A;  4ECI A;  5LCZ A;  2R6K A;  3ZIV A;  3WT2 A;  4MF7 A;  4G0L A;  2AUV A;  4GXZ A;  1U88 A;  5IMF A;  4PQI A;  2OAD A;  5DJM A;  1SK0 A;  3HVV A;  1YY7 A;  18GS A;  3PIN A;  2L4Q A;  2YNX A;  1WOU A;  4I5Q A;  5DJL A;  1ZOF A;  5G1L A;  4KA0 A;  5D9V A;  2AYT A;  4J57 E;  5CRW A;  3DXB A;  2R37 A;  3GKM A;  2P31 A;  4F2I A;  3DKS A;  5AIV A;  4O5R A;  4W66 A;  3FMW A;  3LG6 A;  3GA4 A;  4TW5 A;  2I9H A;  3NZN A;  2P0G A;  3KP8 A;  3GSS A;  2H75 A;  2C0D A;  5DQS A;  4Z2R A;  2ZNM A;  2OKA A;  2O85 A;  1PL1 A;  4OO5 A;  5ECI B;  5CNW A;  1QGV A;  5AIS A;  4E8H A;  5J4U A;  1ACV A;  4DSR A;  2XHF A;  1W89 A;  2CVB A;  4ZBD A;  1SJI A;  4MZW A;  1YZX A;  1TW9 A;  2WZ9 A;  1SKW B;  5ECM B;  4YQU A;  3FRC A;  5H5R A;  4PX1 A;  1EZK A;  2LJR A;  1A24 A;  2HE3 A;  2I4A A;  3LOR A;  1N25 A;  6GSW A;  1VRS D;  3C8E A;  5HR1 A;  1B4P A;  1PKZ A;  2WFC A;  4MLY A;  4OD7 A;  2AHE A;  3C1S A;  1QUW A;  3LXZ A;  2V6O A;  4K0G A;  2NTO A;  4N0Z A;  1VF2 A;  5IMD A;  2FWG A;  3BBY A;  5DCH A;  3VPT A;  4PXO A;  1GP1 A;  4MK3 A;  3M3M A;  1EEM A;  1SVL A;  2JL4 A;  3O76 A;  5IOW A;  1XOB A;  2DLX A;  2CX3 A;  2IME A;  4KAE A;  3TKS A;  4V2L A;  4DEJ A;  3R2Q A;  4IJI A;  3ZFL A;  4MJE A;  1O8W A;  2DKH A;  1GTI A;  1PL2 A;  2A4V A;  2F51 A;  1OKD A;  4V1A p;  4WXT A;  2GSR A;  2GZZ A;  3HVX A;  4N0V A;  2OE0 A;  2HSM A;  5L71 A;  4POK A;  3LYK A;  2FY6 A;  4TR1 B;  2EC4 A;  4I8B A;  1GRX A;  1UA5 A;  1UN2 A;  3L0H A;  2H1D A;  1T00 A;  3QFB C;  2VCW A;  1YVL A;  5ELA A;  3W8J A;  1TDI A;  4KSO A;  4ZB9 A;  4JZQ A;  2A4H A;  1NW2 A;  5J4V A;  4Q5Q A;  4X4J A;  2IMK A;  1ST9 A;  2QA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...