4L5QA

Crystal structure of p202 hin1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
199
structure length
199
Chain Sequence
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
molecule keywords Interferon-activable protein 202
molecule tags Dna binding protein
source organism Mus musculus
total genus 42
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA01
4O2DA 1X65A 4GNXC 3JAMi 1VQLA 4JI2Q 2KHIA 1A63A 1E3PA 1B70B 1JJCB 1DGSA 4UP8A 3CC4A 4JI8Q 5GAGC 4DUYL 2ALYB 4YHHL 4PZ6A 1WYDA 4JBKA 4LF9L 3HOVH 1CUKA 5HY6A 2AWOA 2K5VA 2JA9A 3E0EA 4LWCA 3TS2A 2F3IA 3AFPA 1VQ6A 1N32L 3CF5A 5HGQA 1I6HH 2Y0SG 5C0XG 2IT1A 3CMEA 1PHJA 1Y1WG 2PI2E 3T1YQ 1YIJA 4A3FH 1UEBA 1CSQA 3H0GG 3ICEA 4DR7Q 4X65L 4HIMA 5DLQE 3PGZA 4C3IH 4WJ4A 3I2ZA 2GVBA 3KJPA 3HOXH 2I5HA 3D0FA 1YNXA 3BJUA 4DR5L 2EIFA 3S2DH 4DUZL 5IT9c 4A3LH 1E1OA 1VQAA 4YCVA 4LF7L 1N9WA 3GD7A 4JBWA 3W1GA 4IJHA 1GVPA 4OONA 3J81c 4A3CG 4A93H 4A3IG 1XNQQ 4DR4L 2YTVA 4GKJQ 3FKIG 4A3DG 2KENA 4JG2A 4YWLA 4DV2L 5GADC 2UXBQ 3A5ZB 2HHHL 4YY3L 5M5YH 4LF4Q 1NY4A 1UE6A 4R4OA 4X62L 1QZGA 1W2BA 3I4NH 3CCEA 1Q82C 4OX9L 1S3OA 2VZAA 1VQCA 4LF5L 4A3BG 4JI3Q 3GTOH 2JA8H 1MKHA 5IYCH 3J80c 1SE8A 3L7ZC 4P72A 2R7ZG 5ELNA 1IL2A 1CKOA 3H3VH 5IYBH 2F4VQ 1V1QA 1HZBA 3OW2A 3PUXA 2YTYA 3OTOQ 4JI7L 4UP7A 2V1CC 4HIOA 2UUAL 4IFDG 1ASYA 2K4KA 1SFOH 2AMCB 1CSPA 1OXTA 3S15H 1AE3A 5IE8A 4A3EH 3GTPH 3AFQA 1V43A 2E5LL 1Y14B 1VQIA 4P75A 3KJOA 1KD1C 1EYGA 2Q2UA 3S1QH 2ZM6L 2VUMG 1YHAA 1N33L 5M3MG 1PH1A 1XNRQ 2UUBL 1X6OA 2KBNA 3F2DA 4NPSA 1VQEA 4APVA 5LMUQ 4LFBQ 4GKKQ 3JC66 5K36G 1Z9FA 4GN3B 1W3SA 1JE5A 4JI5L 3CCJA 2AHOB 1YZ6A 4UP9A 4IJLA 2Y0SE 3Q8DA 2D0PA 4DV0L 4DV2Q 1YHBA 5IWAQ 1I94L 4JI4Q 5AJ3Q 3MXNB 1CKNA 1PFSA 2I5LX 5C4XH 4X62Q 1Y1VH 1U0LA 2XGTA 3UDIA 4JI0L 1SN8A 3J7A5 3H15A 2RHSB 1KAWA 1PH7A 4AQYL 3PIOA 1HR0Q 4IOCA 3PUYA 2JQOA 4LUVA 1HZCA 1MJCA 1PA6A 4DR1L 4DV6Q 1NBWA 1IBLL 3M7NA 4JI6L 4JYAQ 4DR2L 5BR8L 2VS1A 4A3KG 1OXUA 3U4ZA 4B3RL 4L5SA 1L2FA 2K75A 3GTMH 4DV3L 5M3FG 1VQOA 3OYYA 4LFCQ 3MEFA 1NE3A 1P16A 3E9IA 3WWVA 4A3MG 4IO9A 4GLVB 1IBML 3HKSA 5GROA 1PV4A 3TRZA 2R92H 4DV4Q 1I50H 4B3MQ 2JA6H 1X3FA 4AIMA 3A74A 1N33Q 1S72A 1J5EL 2CQOA 3W1BA 2UXCQ 2FXQA 3M4PA 4BXXG 2VY3A 3K7AH 3G71A 1AH9A 2WAQG 4NXML 1SR3A 1HNXQ 4NXNL 1QVFA 1VCIA 1Q7YC 3I4MH 1PYBA 4DV0Q 4MNOA 4DKAC 2VW9A 1NMFA 1Q86C 3T1HL 3M4QA 1QZHA 1N8RC 1SROA 4IPDA 4A75A 4LF8Q 3CCUA 1UE5A 4A76A 3ZJYC 2WB1G 3J81j 4DR6L 5GAEC 3CAMA 3W5OA 2K5NA 4B3SQ 2ES2A 1HNWQ 1R9TH 2N49A 5FLXc 1UE7A 3ER0A 4QY7A 4BY1G 1MIUA 2B29A 4IPCA 1BBWA 4AYBG 3STBD 1XMQL 2BA0A 3KF6B 4R4IA 4DR3L 1EFWA 4HJ7A 1PH3A 3JAMc 1VQ9A 2D0OA 2A8VA 2JJQA 3S1RH 3TEHB 1WCMG 3HOZH 3BZKA 4POGA 1YVCA 3CCMA 1XMOL 3GTKH 4LNQA 4IPGA 4DV5Q 5FJ8H 4LFAL 1HNZQ 1FJGL 1RIPA 3RZOH 2ZTCA 3D31A 4JI1L 3HFZB 2UXDQ 2LSSA 3I4OA 1HZ9A 3HKZG 3KYHC 4X64Q 4GOPB 3HOUG 3PO3H 2WFWA 1E1TA 5IP7G 3U58A 5JEAG 4R1JA 3TQYA 1LTLA 3PO2G 2ID0A 1NJIC 3HOWH 1J6QA 2VQEQ 1YI2A 4DV1Q 3DLLA 1N36Q 1M90C 4HJ5A 4O0AA 4BBRH 1X55A 3GTLH 1CKMA 3PCOB 4RMFA 1PVOA 1YJ9A 3IRBA 4YWMA 2VQFQ 1OXSC 4QGUA 2YTXA 2R93H 2ZJQA 3VDYA 3E9HA 2QGQA 4A3JH 2UU9Q 5C0XI 4K0KL 1HJPA 4ME3A 2HT1A 5IYDH 1KXLA 1OXXK 2BH2A 2A19A 5JJLA 3HOYG 1LUZA 1TWGH 2WAQE 1XMQQ 2HQLA 3CC7A 3CMAA 1VQNA 2JA7G 3G6EA 4R4TA 1BVSA 4BBSG 1T9HA 4DUYQ 1ASZA 3M3YH 4YHHQ 4LF9Q 2JA5G 1VQ5A 2MO1A 4JOIC 2NVYH 4OO1G 5IP9G 3S16H 2KHJA 3PV0A 1N34L 1N32Q 2NN6G 2N8NA 2YV5A 3EN2A 4X66L 2JK8A 2WB1E 5C3EH 1YEZA 2PMZE 2LXKA 3L0OA 4GS3A 3UDGA 4LF6L 3KLWA 2OTJA 3UE0A 4OWWB 4IOAA 4X65Q 1L1OB 5C44H 3U4VA 4XIGS 2D62A 1XPOA 4DR5Q 4AYBE 3CXCA 1YHQA 4GNXB 4JV5L 4DUZQ 4KHPL 2XTIA 4LF7Q 2R7DA 2AKWB 3NELA 3S2HH 4A3GH 4DR4Q 3PF5A 2B63H 2RF4A 1FL0A 1C9OA 1JJGA 1QUQA 2IY5B 2UUCL 4BY7H 4EQ5A 1B7YB 4PG3A 2MNAA 2HHHQ 4JCVE 4YY3Q 1GKHA 3HOVG 3S17H 3PUZA 3CC2A 3HKZE 4OX9Q 4IFDI 3FHWA 4LF5Q 5J3BA 1EIFA 1TWAH 4KHZA 1OTCA 3S14H 1AE2A 3FP9A 3RN5A 4A3FG 4WJ3M 3RN2A 1VQFA 4LUZA 1K9MC 1K0RA 1IBKL 3HOXG 1VQHA 3F1ZA 4B3TQ 1YBYA 3GTGH 5JJIA 4OWTB 2YU9H 3CD6A 3PIPA 4A3LG 1XJVA 5LMNL 1EQQA 4JI7Q 1Y1WH 2UUAQ 1WI5A 1XTDA 4NB3A 2Z6KC 4A93G 3H0GH 4QL5A 1X54A 1EQRA 3CW2C 2E5LQ 4B3TL 1H95A 2ZM6Q 2VNUD 1VQBA 4JOIA 3CPWA 3AYHB 2UUBQ 1K3RA 4J15A 1KIXA 2EQSA 3I4NG 2CWAA 1WJJA 5FLMH 4GKKL 1IYJB 4A3CH 2I0QA 2OWOA 4KI0A 4A3IH 1C7YA 4JI2L 1PH6A 4JI5Q 3J7ZC 1K8AC 4C2MH 3FKIH 2JA8G 4A3DH 5IYCG 2A1AA 1I94Q 3K81C 2NVTH 4JI8L 4JI0Q 4QJFA 5EAYA 1C0AA 3UDXA 1G291 4YWKA 2PQAB 2R7FA 4AQYQ 1PH8A 1VQ8A 2LXJA 4OWXB 3RNUA 5IYBG 5M5WH 4A3BH 2CCZA 2DUDA 3M9BA 1QVCA 4DR1Q 1X3GA 1X3EA 3T1YL 3KDFB 3GO5A 3NENA 1NMGA 1IBLQ 4JI6Q 4DR2Q 5BR8Q 4DR7L 1VQJA 1IBKQ 1YITA 2R7ZH 4A3EG 3CP0A 2B3GA 2VL6A 1VQMA 1K8GA 4B3RQ 4GLXA 2N78A 2QEXA 1GD7A 4DV3Q 1WOCA 4MZ9A 4X6AH 3GTJH 1A62A 2ZJRA 1EWIA 4YCUA 1IBMQ 1NTGA 2CWPA 5M5XH 3EIVA 1X9NA 1XNQL 4GKJL 4R4CA 4POFA 5LMNW 1YJWA 4L5TA 2L15A 3NEMA 3KF6A 2UXBL 1J5EQ 2VUMH 1Y1VG 3PSIA 5M3MH 1VQ4A 4LF4L 2N3SA 5C4XG 1L0WA 1X56A 4NXMQ 1QVGA 1PH9A 2JE6I 3U50C 4NXNQ 2WP8J 4KLKA 4JI3L 2Z6KA 2C35B 2BH8A 4JBMA 2PNHA 3RLNA 1EOVA 1LYLA 1VQGA 3T1HQ 2E8GA 3TREA 4GN4B 1EUJA 4GOPA 2PI2A 2Q2TA 1FGUA 2MQHA 4IPHA 1KHIA 4TQUS 4ALPA 4DR6Q 3I55A 2ZTEA 3I56A 3ERSX 3K7UC 3TS0A 2F4VL 2NVQH 2K52A 3OTOL 2HIVA 1V9PA 4LW1A 3SGIA 2E2JH 3RR5A 1VQ7A 4JC0A 2E2IH 2R92G 4GLAC 2DGYA 3ULJA 3KFUA 3J81i 4A3KH 3S1MH 2JA6G 1FVIA 1PYSB 1G6PA 1U5KA 3CQZH 4DR3Q 4QIWE 4QQBX 1VS0A 1I3QH 1P8LA 2IHEA 3F8TA 2F52A 5M3FH 1PH2A 1O7IA 5FLMG 1XNRL 4A3MH 1Q1BA 4HIDA 5LMUL 2K50A 1XMOQ 4LFBL 1Q12A 4TVAB 3B6YA 3RLOA 4LFAQ 1D7QA 2KCMA 1PH4A 1FJGQ 3I4MG 2CFMA 3PUVA 4R4QA 4OXPA 3CCVA 4JI4L 4JI1Q 3CCQA 5IWAL 4DNIA 5AJ3L 4DK3C 3A5UA 1GM5A 1JMCA 3EBEA 1G51A 1YJNA 1A0IA 2YYZA 3J80i 3G4SA 2K14A 4BXXH 4LUOA 1HR0L 2MO0A 4RG1A 3AQQA 3PF4A 3UE1A 3KF8B 4L5QA 4HJAA 2KCTA 1M1KC 2JEAI 1WFQA 1K83H 4L5RC 3M4OH 4DV6L 3RZDH 2ATWA 4JYAL 1I5FA 1L1OA 1HH2P 2BA1A 2NVXH 4OO1I 2QA4A 2IHFA 1TWHH 3K80C 1KRSA 2NN6I 1JT8A 4XTCS 1KRTA 4Y7NH 4Y52H 4GNXA 3HOZG 4LFCL 4K0KQ 4P73A 1SLJA 5C0XJ 1Q81C 1TWCH 1XPUA 3AEVA 1VQDA 5C4JH 4BY1H 4YCWA 3CCSA 5FJ8G 2GN5A 5GAHC 2IX0A 1QUQB 2GVAA 3GDEA 1E24A 4DV4L 1S40A 3LGJA 4B3ML 3CCRA 1UWVA 4AH6A 1CKNB 1JB7A 4DPGA 2OQ0A 5JEAJ 3F2CA 3BU2A 4C3HH 3S1NH 1WCMH 3PO3G 1E7ZA 1EIYB 1N34Q 3K0XA 2UXCL 4DAMA 1A8VA 1K73C 1OXVA 1XPRA 1HZAA 4X66Q 1HNXL 3HOWG 4LF6Q 3KOJA 4HIKA 4BA1I 1UE1A 2AWNA 4BBRG 3UDFA 1JJ2A 1Q1EA 2HIXA 1BKBA 4DV7L 4LF8L 2CKZB 3HOUH 1RL2A 1IXRA 5IP7H 2R93G 1D8LA 4PZ8A 4GOPC 4A3JG 1GO3E 5E7NA 1Q8KA 1PH5A 4B3SL 3PO2H 2I5MX 4JV5Q 1B8AA 2H5XA 4KHPQ 1E22A 5IYDG 1HNWL 4MTNA 3G48A 4BA2I 2K5HA 1SMXA 4DK6C 2Q2IA 1HR0W 1Q46A 3STBC 4H02A 4DAYB 4HJ9A 4P74A 1MJEA 1LM0A 3K8AA 2UUCQ 1IZ6A 1TXYA 4JBJA 4UPAA 3ULLA 3S24A 5IY0A 4FDBA 1SRUA 2OQKA 4HJ8A 2Z0SA 2ZTDA 2JEBI 4P71A 3RLFA 2RCNA 3A0JA 5C3EG 4DV5L 3I7FA 1KL9A 2OCEA 4UY8C 1HNZL 3CCLA 3HOYH 4IFDJ 2R6GA 2JA7H 5JJKA 3CPFA 4PMWA 4BBSH 3M85A 2OTLA 3DM3A 5C44G 1VQKA 5GQOA 2UXDL 2JA5H 2NZOA 4EX5A 4X64L 1KC8C 5IP9H 2PQAA 5ELOA 5LMNQ 3PUWA 2ASBA 2NZHA 2VQEL 4DV1L 3BZCA 1BBUA 1N36L 3L2PA 3KDFA 2EXDA 4A3GG 4DV7Q 2IX1A 4A4IA 2RHQB 2B63G 2MFIA 5H1SE 3ULPA 3GTQH 4GN5A 1TWFH 2VQFL 3NBHB 4BY7G 4PZ7A 1L1OC 2ZJPA 2E2HH 3H3VI 4C3JH 1KQSA 3F2BA 2UU9L 2Q2HA 1Z47A 1VQPA
chains in the Genus database with same CATH superfamily
4O2DA 2EDGA 2KHIA 1B70B 1UEAB 2F0QA 3HOXB 3WOFA 1QG7A 3EROA 1CUKA 1XXGA 2JA9A 1A6XA 1MSHA 1BCPC 1STHA 2Q8TA 1CHQD 2Y0SG 1F77A 4XYQA 4A93B 4KD4A 4A3FH 4DR7Q 3PGZA 1RF2D 2J0TD 1B9NA 3DEPA 2I5HA 4DR5L 4KHVA 1AZQA 2EIFA 1KABA 4A3LH 2EYOA 5IOCA 3J81c 2F0EA 4OONA 2F0TA 4A3IG 2L0CA 4EQOA 2PQEA 4JK1C 3L9AX 2EYFA 1H9KA 1LTSD 4YY3L 1NY4A 1PLFA 4R4OA 5K5PA 5M5YH 3I4NH 1Q82C 4OX9L 1S3OA 1JICA 4ZRZA 4KN4C 1SE8A 3SK5A 5ELNA 2DY8A 5BN5A 2C5CA 1CKOA 5C4ZA 1AEXA 1B2TA 5KYIA 4IUVA 1GUOA 3PUXA 5IODA 1NNXA 2V1CC 1EY5A 2UUAL 3GV6A 2F1MA 2AMCB 5I2YA 4A3EH 1V43A 1DYQA 1HTLD 4ABNA 1S5ED 1RODA 4LFBQ 1TS5A 2H4OA 5K36G 2F0NA 3CRLC 3LX0A 4NMZA 1ENAA 2EYJA 2QKIC 4RGTA 4UP9A 4JI5L 3Q8DA 1O80A 4DV2Q 5IWAQ 1I94L 2GA4B 3MXNB 3VYTA 1FR3A 1Y1VH 2XGTA 1TY2A 3GTMB 4AQYL 3MWYW 3PIOA 3LWUA 4RGOS 2JQOA 1EWCA 1T5XD 1SYBA 1NBWA 2F3WA 1IBLL 3M7NA 4JYAQ 2BOSA 1ZEQX 4A3KG 2X6LA 4NW2A 3SHLA 3U4ZA 4B3RL 1L2FA 5M3FG 1VQOA 3OYYA 3WWVA 1NE3A 5DM73 2JYOA 1SNOA 1II3A 3TN2A 2X69A 2O5JC 1WTHA 2G9HD 1L0XB 3TRZA 1I50H 2JA6H 2KEDA 1X3FA 4AIMA 1HUNA 4FP5D 4B9WA 2VY3A 3G71A 1R9TB 1SR3A 2BDNA 4NXNL 1HNXQ 1BQQT 3I4MH 4DNTB 1N8RC 4A75A 1EEFD 3NTHA 1UE5A 3ZJYC 2WB1G 3QIAA 5GAEC 3W5OA 2K5NA 2K32A 4R9WA 3R2TA 5FLXc 4QY7A 4L63B 2B29A 4IPCA 5EBCA 1QNKA 4AYBG 1JC7A 1XMQL 3MC0B 2A8VA 2JJQA 4C3HG 4ULLA 1IKLA 2XWJB 4F87A 3BZKA 4POGA 3CCMA 3GTKH 2HUGA 2VB3X 1S5FD 1CQVA 4HMIA 3RZOH 4BWGB 2RSNA 2WIIB 4JI1L 3HFZB 2UXDQ 2LSSA 2MPMA 1HZ9A 2K7VA 3KYHC 4HTHA 1E1TA 3TQYA 3PO2G 2MUYA 2E2JB 1NJIC 4HR7B 4A3KB 4HJ5A 4LK1C 1NR4A 1X55A 1PTOD 3IRBA 4YWMA 5M3FB 4DK0A 3HEJA 2YTXA 3TZUA 5BN3A 3E9HA 5NUCA 3SXHA 4ME3A 3J7AV 4DGZA 5IYDH 1KXLA 2BH2A 2A19A 4K5WA 1H9MA 3HOYG 3Q0AA 1SNDA 2XSCA 3G6EA 4BBSG 4DUYQ 4YHHQ 4IN3A 3MAQA 2YV5A 1U4MA 2JK8A 1YEZA 2DY7A 2LXKA 5AFWA 2OTJA 4IOAA 2F03A 3TZDA 4XIGS 1JOOA 1TWCB 1VF7A 3CXCA 2B2TA 1SYGA 2R7DA 1TWAB 4DF7A 3PF5A 2RF4A 1C9OA 4C3HB 1QUQA 1ZKOA 4EQ5A 2HHHQ 3TP8A 1VF5C 4N8FA 2BCOA 3HKZE 1I4PA 1SEBD 4IFDI 3DWQA 4LF5Q 1OTCA 4ZUJA 4KHZA 4WFN3 2IWHA 1TS3A 2RKSA 3MXUA 1K0RA 3NE5B 1VQHA 3J7AF 3GTGH 4XT3B 3PIPA 2RDFA 1SJED 1F9RA 2E2DC 1WI5A 1C4QA 1A3UA 3FKIB 4QL5A 1EQRA 2BE5D 1H95A 2ZM6Q 3AU7A 4XYOA 3AYHB 4XT1B 3BG3A 1KIXA 2EQSA 1IYJB 3ND8A 2G5DA 3I4LA 4XQNA 1JB3A 4A3IH 1WTPA 1PH6A 4F8MA 1DJRD 2JA8G 3K81C 5CBEE 1SBBB 2NVTH 1ENCA 1RKNA 2WKDA 4LJZC 1IYVA 1CI3M 2QCPX 4FXGC 2WKCA 3DWAA 2LXJA 4FF3A 5IYBG 2CCZA 3M9BA 3A56A 1X3GA 3D3RA 3QO2A 1YITA 3CP0A 2VL6A 5M3MB 1K8GA 3V96A 4DV3Q 4FYDA 2B2TC 2ZJRA 1EWIA 1STNA 2D9UA 1X3QA 3UI2A 1XNQL 1YJWA 4KTAA 2UXBL 1J5EQ 3MVVA 3PSIA 4LF4L 1TR5A 4NXMQ 1QVGA 4U68A 5K36H 2C35B 1BF4A 2B8FA 2MHVA 1LYLA 3T1HQ 2EYHA 3QG1A 3CQZB 1E2WA 3TREA 4GN4B 3S2DB 2PI2A 1IL8A 2M9VA 2MQHA 1KHIA 2KQ3A 1YNNC 3I56A 1SNPA 3OTOL 1D2BA 3N6RA 3SGIA 2E2JH 4GLAC 1K28A 1WTWA 5LHY1 3S1MH 1LTID 4A3KH 1NUCA 3T4AC 1U5KA 4DR3Q 4QIWE 5IGEA 5M3FH 2WAQB 3F8TA 5LMUL 3B6YA 4LFAQ 3I70A 4JI4L 4DK3C 1TVXA 5CORA 1JMCA 2XWBB 4CDCC 3EA6A 5EJWA 1HUMA 3OWEB 4RG1A 4RH6A 1STBA 1A15A 3UE1A 4FO2A 4L5QA 2B2UA 4I7AA 2JEAI 3A7AB 1K83H 3NQIA 4L5RC 3C2PA 2CVRA 3OIQA 1H9JA 3K80C 2NN6I 2B2YC 2B2VA 1KRTA 1YNND 4EGVA 2F0JA 4Y52H 2RSOA 3HOZG 4K0KQ 4P73A 1SLJA 3VR5A 1TWCH 2GN5A 3GDEA 4XXEA 4DV4L 1S40A 3LGJA 5CR3A 1BO0A 4EQNA 4AH6A 1CKNB 1IKMA 3F2CA 3BU2A 4C3HH 2K03A 2UXCL 1ICFB 1A8VA 1HZAA 4X3SA 1X3PA 4IZ8A 2LMCB 3KOJA 1UE1A 4BBRG 1TS4A 3C1EA 2CKZB 2FFKB 3OOCA 5EPKA 5ELBA 1Y69U 1PH5A 3PO2H 1GO3E 1RTOA 4KHPQ 1HNWL 2SOBA 4HSPA 2K5HA 1SMXA 4MN3A 2VXWA 3STBC 3QWNA 4DAYB 4P74A 1MJEA 2UUCQ 2PNRC 4JBJA 4UPAA 2HCIA 1B3AA 4HJ8A 1R4QB 1EFID 2A6ED 2F0KA 2JEBI 4M1UB 4P71A 5C3EG 2N55A 1KL9A 4UY8C 4RGMA 1HNZL 3CCLA 3HOYH 3BVMA 3S9WA 4DK1A 4BBSH 3M85A 3NWTA 5C44G 1VQKA 1SDFA 2E2HB 1EZ8A 5EGTA 5GQOA 4ZKBB 2O2LD 4C3JB 3ND9A 1JOKA 5ELOA 4KY5A 4X3UA 4DV1L 3BZCA 1N36L 3C46A 4A3GG 4DV7Q 2EZVA 2IX1A 1B50A 3Q24A 4GN5A 2ICIA 2E75C 2ZJPA 3H3VI 1HHVA 2B2VC 1U9RA 4JI2Q 3E3XA 1PZID 4OELB 1DGSA 1EEID 3CC4A 4K6LA 4LF9L 2J4XA 5HY6A 2AWOA 4LWCA 3E0EA 3AFPA 1VQ6A 1N32L 1PTOF 1SYEA 2IW3A 1DZ1A 4BBRB 3CF5A 2IT1A 2RA4A 3CMEA 1PHJA 1YIJA 2VB2X 3K57A 4X65L 1CTMA 2EVBA 2GVBA 5M5YB 4DU9A 1LT4D 4H13C 3S2DH 4DUZL 1PXUA 1VQAA 1TWGB 4YCVA 3TP7A 3W1GA 4LF7L 3IFTA 2R61A 1Y8OB 1I6VC 3PIP3 3I73A 4JG2A 4YWLA 5ISRA 4OIJA 4J8QA 4K5XA 3A5ZB 4RGNA 4X62L 2CW0C 1QZGA 2NTTA 1W2BA 3ITPA 2KJXA 2JA8H 1KDAA 2F0LA 2AUKA 1TT2A 1B1ZA 5CV6A 4CKCA 3K6OA 2LKVA 4ZQ3A 5IYBH 2F4VQ 2F0GA 4JI7L 4UP7A 3MFYA 4IFDG 1ASYA 2K4KA 2M2LA 4FXDA 2TMPA 1AE3A 3GTPH 3AFQA 4KKSA 1I4XA 1Y14B 1VQIA 2LY7A 4P75A 3W3AA 3VYUA 3OIPA 3RUZA 1KD1C 2FJ2A 1N33L 1XNRQ 2UUBL 1X6OA 4H44C 4NPSA 5A35A 5TSSA 3D8GA 3JC66 4GN3B 1JE5A 4KMUC 2AHOB 4IJLA 2D0PA 1MBYA 1YHBA 5AJ3Q 4JW0A 1CKNA 1PFSA 1U0LA 3UDIA 3J7A5 3H15A 4ZAIA 1PH7A 2RQXA 3PUYA 4KKUA 1HZCA 1PA6A 3DM1A 2N88A 4DNRB 2JA6B 4JI6L 2Z1CA 5BR8L 1G8ZD 4G4KA 2L55A 2EJMA 2K75A 5C5MA 3E9IA 3SK4A 4A3MG 5IGBA 3I4MB 4GLVB 4PQXA 5JOBA 4C2MB 1IBML 3HKSA 2KVMA 4DAYA 2EYPA 4B3MQ 2CQOA 5M5WB 3W1BA 4BXXG 3K7AH 2IX3A 1QVFA 2A6HD 1VCIA 5FO9B 4MNOA 4ODGA 1Q86C 3M4QA 1J8IA 1XYIA 4IPDA 4A76A 3VYSA 4CKBA 2ZXRA 4B3SQ 2ES2A 3GTKB 2N49A 3R3OA 1WD0A 3RZOB 1BBWA 3DEOA 1Q3LA 4DXFA 1GUTA 4IUQA 4HSVA 1EFWA 1VQ9A 3JAMc 1B3QA 1JWSD 2L5TA 3HOZH 1QWYA 1TS2A 1SNCA 4JVZA 3TP5A 4DV5Q 1FJGL 1G91A 1RIPA 2ZTCA 4Z9CB 1A3TA 3G6JB 3HKZG 4X64Q 4GOPB 1LTLA 2ID0A 5I9PA 1AFPA 2E2IB 3OMCA 5C5LA 2EY1A 3NWSA 2MP1A 4BBRH 3PCOB 2VQFQ 1I3QB 1O7LA 1OXSC 3NUCA 1LLRD 3KK7A 1WTVA 2QGQA 4IUUA 2UU9Q 5J1ZA 2HT1A 1OXXK 3RMHA 1D5ZC 4M8AA 4ZCKA 1TWGH 1XMQQ 2G9DA 1BVSA 1T9HA 1ASZA 1IHZA 2WACA 4JOIC 1BCPD 2NN6G 3EN2A 4X66L 5C3EH 1H9SB 2PMZE 1F9PA 4K2KA 1BDOA 5C44H 4RFBA 1GXDC 1XPOA 2F0OA 2XN9C 3T13A 2A68C 4WJWA 4JV5L 3CHBD 2MGSA 3I90A 1JR0D 5D3DA 4A3GH 4DR4Q 2NTSA 1JJGA 1FL0A 3OHXC 2IY5B 3SDZA 4BS9A 1B7YB 2MNAA 1C8CA 4JCVE 3S17H 1GKHA 2FMMA 4ZLTF 3GTGB 1ILQA 2Y0SB 1JWMD 5J3BA 1EIFA 3S14H 1AE2A 3C3LA 1VQFA 4C3IG 1IBKL 1K0SA 2NYZD 2K5DA 1CQFA 1RD9D 1YNJC 2A73B 3EFXD 1XJVA 5LMNL 5FKAC 1EQQA 4A3IB 1XTDA 4NB3A 4TSSA 4GZYC 2SNMA 3SR1A 2NVTB 3IKJA 2E5LQ 4J1MA 1I4HA 1VQBA 3CPWA 1K3RA 4Q5VA 2CWAA 1C7YA 2QDBA 4C2MH 1O7YA 2AQ3B 1QE6A 4OIKA 4QB4A 4JI0Q 4QJFA 3D6WA 3UDXA 2R7FA 5DNFA 3BYTB 4CKEA 4ZK9B 2KHSA 4OWXB 3RNUA 5M5WH 2IPKD 4CJ1B 1QVCA 4DR1Q 5EKLA 1X3EA 4MIUA 2PO4A 3KDFB 4X3KA 2K5QA 3URYA 1LTBD 4JPBW 4DR2Q 4DR7L 2FINB 2A5HA 4OEMB 1F2MA 2B3GA 4G7ZC 1PRTF 2N78A 3FPUB 4RHRA 2R3ZA 3GTJH 3LNNA 1A62A 4IFDH 5M5XH 1X9NA 1KDCA 4L5TA 5C4XG 1VQ4A 4C56C 1L0WA 1E2VA 1G6ZA 1PH9A 3U50C 4QUCA 2IL8A 2WP8J 3M4YA 2KCNA 3S1MB 2PNHA 1VQGA 3WOEA 1MI2A 2E8GA 1QOHA 2KA7A 4GOPA 4DR6Q 1FGUA 1CM9A 2ZTEA 2QDLA 2EJGC 3TS0A 2K01A 3FRPB 4LW1A 1QCBD 5I2XA 1VQ7A 2E2IH 3KFUA 3R8BA 3J81i 4DXGA 2NZ1D 1FVIA 3BYYB 3J81L 1G6PA 1I3QH 5FLMG 4A3MH 1Q1BA 4QIWB 1XMOQ 4LFBL 1Q12A 4TKOB 1K83B 3VR2A 1PH4A 5IWAL 4DNIA 2WB1B 3EBEA 1G51A 1YJNA 3K5OA 1FNUA 4IUPA 4BXXH 3H91A 4LUOA 4G7HC 3DHQA 1OO9B 3E5SA 1LACA 1LTTD 3TMEA 1H9SA 3DMUA 3KF8B 3PF4A 4AYBB 2MJ8A 5ELEA 2ATWA 4JYAL 1EZ6A 2BA1A 4KK7A 1SXTA 2QA4A 1KRSA 5CV4A 1EY6A 1JT8A 4Y7NH 4YIJA 3E6ZX 3HS0C 3MXPA 3N52A 5C0XJ 1GUNA 3P7JA 5M9OA 4CGYB 3J81E 3CCSA 5FJ8G 5GAHC 5KEEA 1Y8NB 5C4XB 5E4WC 1ML0D 1EY4A 4CHTB 2Z4IA 4DPGA 4EVOA 3MXNA 3PO2B 1E7ZA 1N34Q 4DAMA 1HNXL 3HOWG 4LF6Q 2JXMB 1ET6A 2AWNA 3A55A 3OWFA 1XWEA 1BKBA 1LTGD 1IYUA 2A69C 1RL2A 3K5NA 1IXRA 1WTRA 5CBAE 4GOPC 5E7NA 1Q8KA 5I6YA 1B8AA 2H5XA 1E22A 1JE4A 3KLRA 3HOYB 4BA2I 4ILWA 4DK6C 1HR0W 4BBSB 2RVLA 4H02A 5BN4A 1EOTA 3K8AA 3NTIA 4OL7A 1G2SA 4IALA 3S24A 4FDBA 1SRUA 3CU7A 1DXMA 4FF4A 2D2CC 2RCNA 1SJHD 3QOJA 5CV7A 4PMWA 1STGA 1KNAA 1JOQA 3X3MA 2UXDL 3T16A 1SSOA 4EX5A 1KC8C 4KJOA 4CDEC 2B2YA 2NN6H 2NUCA 3NQTA 2B39A 3PUWA 3A54A 2ASBA 2L4NA 3L2PA 3KDFA 1EQVA 2EXDA 2B2WA 2RHQB 2MFIA 3OW7A 4CJ2C 2B63G 3NBIA 2CH4W 3NBHB 1STAA 3P20A 4BY7G 4PZ7A 3V05A 5FLXL 1LO5D 4DN4M 1PZKD 4GKKQ 1X65A 2DNEA 4KJNA 1VQLA 3BS1A 1PMRA 4K8JA 5CC4A 1JJCB 3TSSA 4UP8A 2IJ0A 4TRDA 1CFMA 4JI8Q 5I6WA 2ALYB 4DUYL 4YHHL 2HCCA 4PZ6A 4JBKA 1A3VA 2K5VA 1I6HH 5HGQA 1SMYC 1Y1WG 2PI2E 3RD4A 3T1YQ 1KDBA 1CSQA 3H0GG 3ICEA 4HIMA 5DLQE 4C3IH 2BDOA 1CZWA 5FK9C 3KJPA 2K6AA 1YNXA 2XNAC 3BJUA 1MSGA 1E1OA 1UUPA 1N9WA 3GD7A 5E3FA 4A3CG 4IJHA 2JA8B 5FLXE 2XRSD 3BDLA 1KLGD 4P2CB 2P5ZX 4GKJQ 1BCPF 4A3DG 2KENA 2NVYB 3S16B 2HHHL 1TU2B 3CCEA 1DOLA 4LF5L 4A3BG 1EYCA 4JI3Q 4K5VA 4G7OC 3PQIA 3GTOH 1MKHA 3J80c 3GTPB 4RKBA 4QCLA 2K04A 3MFGA 4IUTA 4HN7A 4P72A 2R7ZG 2H1EA 5C3XA 3H3VH 1SMYD 1V1QA 1HZBA 3OW2A 2B63B 2YTYA 2OT2A 3OPOA 4BY7B 1CSPA 1OXTA 3S15H 2B2WC 1SYCA 3KJOA 2Q2UA 3S1QH 2ZM6L 2NWGA 3P75A 5E4XA 3F2DA 1M4VA 2A74C 3KLSX 4APVA 1D6EC 3T53B 1Z9FA 1W3SA 3SVMA 1Y8PB 4DV0L 3Q23A 4X62Q 2I5LX 5C4XH 2YU9B 1SN8A 1V1PB 1ICWA 1KAWA 2HDLA 1K8MA 1HR0Q 3H0GB 1MJCA 1QJOA 4QMGA 3A8JE 3SK6A 1Q90A 4K8IA 4DV6Q 1NCVA 5KNCA 2I07B 2VS1A 5JVG3 1OXUA 2KEEA 2EY2A 3A8KE 1DOMA 3K7AB 4DV3L 4DFAA 4LFCQ 4XQQA 4IO9A 3HG9A 2HD3A 1PV4A 2LFNA 5IIFA 1J9OA 4K6DA 2PW7A 1N33Q 2Z4HA 1S72A 1J5EL 2XRQD 4U673 5EPJA 4LAAA 1AH9A 4NXML 4RHSA 5KNBA 2QEJC 1SNMA 1Q7YC 1PYBA 5CYUA 2R7ZB 1S5BD 4O1NA 2VW9A 1NMFA 3T1HL 1QZHA 1IW7C 3D4DA 5L37A 4LF8Q 1LT3D 3CCUA 4DAPA 3J81j 3HOZB 1ESFA 3CAMA 4UHVA 1EY7A 1LABA 5EPLA 2RDHA 4BY1G 3MTSA 2TSSA 4IURA 1ONLA 2F0SA 3STBD 3NBHA 2BA0A 3KF6B 4R4IA 4KY7A 4DR3L 1PH3A 2D0OA 3S1RH 3TEHB 1YVCA 3C1FA 4LNQA 4IPGA 5FJ8H 4LFAL 5JPMC 3DXJC 4IQZA 3D31A 1G2TA 4PV1C 3I4OA 3IFDA 3HOUG 4RA8A 2WFWA 1RHPA 1CHPD 5JEAG 2NVQB 2F4IA 1AN8A 3HOWH 1J6QA 2VQEQ 1YI2A 5JAVA 2ZXPA 4O0AA 1CKMA 1FNWA 1D5MC 3QOLA 4KN7C 4EQPA 4XQJA 3P1HA 5A2QL 5ELFA 3VDYA 3R2IA 2ZJQA 2L12A 3V2TA 5C0XI 4K0KL 3BVGA 1HJPA 5C3EB 1SAPA 1K8OA 2DNCA 5JJLA 5G3LD 1LUZA 3H6MA 2WAQE 5C44B 1VQNA 2JA7G 1EIGA 2L9HA 2CHBD 2JA5G 1VQ5A 2MO1A 3TBIB 2NVYH 5IP9G 3S16H 3PV0A 2QILA 2WINB 3M4OB 2RCFA 4B3TL 4XDXA 1FYCA 2K5WA 4GS3A 1PTOB 4A3GB 4K2LA 2NVXB 1TWHB 4I65A 3R93A 5EKIA 3KBXA 3U4VA 3S17B 2Q8IB 3T56B 4DR5Q 2XIWA 5C4JB 1YHQA 4GNXB 4BY1B 4KHPL 4RCOA 3NELA 2B8GA 1B4OA 5FOBB 1PYWD 3S14B 3S2HH 5A2QE 2B63H 1MGSA 3MEHA 1HA6A 4I7ZC 2UUCL 4BY7H 1HXYD 4PG3A 5C6AA 4YY3Q 3HOVG 3PUZA 2CW0D 1D1IA 1QNUA 3M7GA 3CC2A 4OX9Q 2C9OA 3DWPA 2EOTA 2L11A 3FP9A 3RN5A 3RN2A 2AQ2B 2PZTA 1BBXC 4LMQD 1K9MC 4ZYSA 4H0LC 3HOXG 1AZPA 1V1PA 1YBYA 2YU9H 2OEOA 3AB9A 1Y1WH 3K5LA 1F2ZA 3EQLC 1UAPA 5LL6X 2UUAQ 2Z6KC 4A93G 3H0GH 2ZXOA 5C3WA 5CMDA 2M00A 1DOKA 3CW2C 2VNUD 4JOIA 1BOSA 1WJJA 3NPPA 1GUWA 4A3CH 2JA7B 2I0QA 3NSWA 4KI0A 4JI2L 4JI5Q 3J7ZC 2JA5B 1S5DD 4A3DH 5IYCG 1I94Q 3MHBA 4FNFA 3Q22A 2K1BA 5EAYA 1C0AA 1G291 4YWKA 2NB0A 1PH8A 4AQYQ 1PDQA 3GTJB 4DA2A 4CDDC 4J6HA 4A3BH 1V1OA 2DUDA 5IGFA 2EYLA 3GTQB 2EPBA 5M5XB 4IUNA 1GUGA 1TWFB 3CKIB 3H09A 4F88A 3NENA 1V8QA 1W6KA 1IBLQ 1IBKQ 2R7ZH 1L0YB 1GJXA 4B3RQ 1K3BC 4GLXA 3FPPA 1WOCA 4X6AH 4PNYA 1FGBD 3HRZC 3U9SA 4YCUA 1NTGA 1S4ZA 2CWPA 3EIVA 5D14A 4POFA 2L15A 3NEMA 3KF6A 1UNSA 4OGQC 2F0MA 1X56A 4NXNQ 1PFBA 3WDNA 2BH8A 1EQTA 1F9SA 2I46A 4ZKCB 2F0FA 2Q2TA 4ALPA 4A3MB 3BDOA 1GHJA 4FVMA 2F4VL 1D1KA 2NVQH 2K52A 2Z6BA 2DJFC 2R92G 2DGYA 3ULJA 1CK1A 1VS0A 4FXKC 1XNRL 2IHEA 2F52A 1WTOA 4HIDA 3MXGA 2KCMA 2KOLA 3SK8A 2KUMA 2E76C 4DAVA 3VR4A 3CCVA 4OXPA 5IGCA 4JI1Q 3CCQA 2EY5A 2AQ1B 5AJ3L 3A5UA 1GM5A 1A0IA 4Y7NB 2Q8RE 3K59A 3TP6A 1EIHA 1TKWB 3VA5A 1VDZA 1SE3A 1TY0A 2MO0A 3SEBA 3D4RA 1SFOB 1CA6A 1M1KC 4HJAA 3M4OH 1DONA 5KNDA 3RZDH 1PTOH 5FO7B 2NVXH 4OO1I 1TWHH 5E1FA 4XTCS 3KBGA 4GNXA 5HURA 4Q0FA 1Q81C 3AEVA 1EU4A 5C4JH 2E74C 4YCWA 4BY1H 1QUQB 2GVAA 3HKZB 3CCRA 4B3ML 4X3TA 1JB7A 1HCZA 3S1NH 3PO3G 1SYDA 1K73C 1OXVA 4RAUC 3VR3A 3L3OC 4UDUC 4BA1I 3MA2B 1B9MA 1LV9A 3FEWX 3SE0A 1Q1EA 4B9XA 3VYRA 1PFNA 2HIXA 2OXPA 3HOUH 3H94A 1CT1D 2R93G 5JEAH 2A68D 4PZ8A 4A3JG 4B3SL 1PFMA 2R92B 3G48A 1RTNA 4G57A 4L8JA 3K0YA 2PW5A 3MZ5A 1LM0A 1IZ6A 3I91A 2F0DA 3ULLA 1DM0B 5IY0A 2OQKA 5KIXA 2ZTDA 2HDMA 3RLFA 1VMPA 4DV5L 3QB3A 3I7FA 1EY8A 1RCVD 2JA7H 5JJKA 3CPFA 1HFNA 2OTLA 2K05A 2JA5H 2NZOA 4X64L 1HFGA 2JP1A 5IP9H 1YNJD 1S5CD 3PMFA 2NZHA 4PMCA 4S3SA 1PTOC 3GTQH 3ULPA 1TWFH 2VQFL 3E0JA 5J39A 5CV5A 1KQSA 3QR8A 2UU9L 2Q2HA 1I6HB 1VQDA 1VQPA 1Z6HA 2K33A 4GNXC 3JAMi 5T1GA 3JAML 1E3PA 1EY9A 1A63A 2J7ZA 4C3IB 3PO3B 4C1NK 5GAGC 5J22A 1WYDA 3HOVH 1BR9A 3TS2A 2F3IA 3IL8A 3GTLB 1EWHA 5C0XG 4WORA 4N8X1 1UEBA 2R93B 2PZUA 4WJ4A 3I2ZA 4A3JB 2HQEA 3HOXH 3D0FA 1ET9A 1GUSA 5G3LF 4ME5A 1PRTB 4RCNA 1U4LA 5IT9c 3D4WA 4JBWA 1GVPA 3GTOB 4A93H 1KAAA 3M3YB 1XNQQ 4DR4L 2YTVA 1E2ZA 3FKIG 1LT5D 4DV2L 2F0UA 4MTKA 5CV9A 5GADC 2UXBQ 1HRJA 4NKLA 4LF4Q 1UE6A 3JAME 5DAUA 2VZAA 1VQCA 5IGDA 5KYLA 1I4GA 3G7LA 1X32A 5IYCH 3S15B 2ENBA 1R4PB 2D5DA 3L7ZC 3S1QB 1Z7TA 1FD7D 3GQBA 1IL2A 2PYKA 3VA7A 3OTOQ 4HIOA 3KUPA 2PCFB 1SFOH 5IE8A 3TDQA 1I4RA 2BE5C 3BZDB 1I4QA 1EYGA 2E5LL 1BUVT 2VUMG 1YHAA 2KECA 5M3MG 1PH1A 2ZT9C 2KBNA 5LMUQ 1VQEA 2EE1A 5CGKA 1ZYRC 3EVQA 3CCJA 3AMUA 1YZ6A 3I3CA 2Y0SE 4JI4Q 1HQRD 4K14A 4JI0L 4CBVA 1LT6D 2RHSB 2Z8LA 4IOCA 4LUVA 4OHJA 2F0PA 4DR1L 1TIID 4H7BA 1CA5A 1T5EA 4DR2L 1FNVA 1MD2D 1ILPA 4RKLA 4L5SA 1D5XC 3GTMH 1STEA 3MEFA 1P16A 1BNZA 2SDFA 5I9OA 3A8IE 5GROA 2R92H 4DV4Q 4CDFC 1HA5A 3A74A 1WVLA 1KNEA 2UXCQ 2FXQA 2JSOA 3M4PA 2WAQG 1ZYRD 4RWSC 4DV0Q 3W2DA 4DKAC 1SROA 2FMCA 2FHTA 2A69D 1O7ZA 3S1RB 1GHKA 4DR6L 1HNWQ 1R9TH 1UE7A 3ER0A 3CRKC 1E0BA 1MIUA 1A2UA 1ENFA 2VUMB 5LL6S 3ZYYX 1U4RA 2LS01 4HJ7A 1WCMG 1Q8IA 3HOWB 1XMOL 1F2LA 3O13A 1HNZQ 1WTQA 2SEBD 1EYDA 1NR2A 3GV3A 1QB5D 1W6JA 3PO3H 5ELCA 5IP7G 3U58A 4R1JA 4WRDA 5D3IB 1ZXTA 5F2DA 4DV1Q 3DLLA 1N36Q 1M90C 3GTLH 4RMFA 1PVOA 1YJ9A 4QGUA 1BXTA 2R93H 1RJTA 4A3JH 3NK9A 4R8NA 3PIO3 4C1NI 5IT9L 2HQLA 3CC7A 3CMAA 3ERQA 4R4TA 1JORA 1MHWC 4LF9Q 3M3YH 3I8ZA 1WTXA 4OO1G 3VR6A 2KHJA 1N34L 1N32Q 2N8NA 1VMCA 2WB1E 2X6GA 2CQAA 3L0OA 3UDGA 3S2HB 4LF6L 3KLWA 1HTPA 3KF8A 3UE0A 4OWWB 3EJIA 4X65Q 1L1OB 4KKTA 2D62A 2XVSA 4AYBE 4C3JG 4DUZQ 2XTIA 1B44D 1NAPA 4LF7Q 2AKWB 2QF7A 3X3NA 3KLSA 1KLUD 1WCMB 1XTCD 4HEDA 5CV8A 4L6TB 1QILA 1BCPB 1LTAD 3ONAB 5I4DA 1KTKA 5IT9E 2A6EC 1Y1WB 3FHWA 5JVH3 1RDPD 1TWAH 4WJ3M 4A3FG 4LUZA 4O42A 3F2UA 1F2YA 2JN4A 3F1ZA 4B3TQ 5JJIA 4OWTB 3CD6A 5ELDA 4QUFA 1EL0A 4A3LG 5C0XH 4JI7Q 3HP3A 2ICEC 4A3DB 1DD2A 4KV6A 3K5MA 3U9OA 1X54A 2SNSA 3NTKA 1SYFA 3HZXA 2F0WA 5KRUA 2UUBQ 5DM63 4J15A 4NDXA 4A3BB 3I4NG 4GKKL 5FLMH 1JCKB 1U4PA 4E6IA 1PRTC 2OWOA 3LWEA 1K8AC 3FKIH 3Q6SA 2A1AA 2F0HA 3GP7A 4JI8L 4ID6A 2PQAB 3FDTA 1VQ8A 1A2TA 3H3VC 1C48A 2DJGC 4MHEA 5HGTA 3T1YL 1WD1A 4N9TA 3GO5A 3BVZA 1NMGA 2F3VA 4JI6Q 4FF2A 5BR8Q 1VQJA 4A3EG 3NHHA 5T1IA 1VQMA 1HPCA 1GD7A 2QEXA 1AW7A 4MZ9A 2PZWA 2EXZA 3FVQA 1IBMQ 2B2UC 4ZUIA 4GKJL 4R4CA 5LMNW 2L1BA 2VUMH 1Y1VG 5M3MH 3FMCA 2N3SA 5EKKA 1PRTD 2JE6I 2EJFC 4A3FB 5D65A 4KLKA 4JI3L 4HCSA 2Z6KA 5COYA 4JBMA 1HQMC 3RLNA 1EOVA 3OMGA 1GOZA 1IW7D 4FF1A 3BDCA 1EUJA 4NP5A 3A7LA 4IPHA 4TQUS 4V190 3I55A 3NP8A 3ERSX 3K7UC 5KGUA 1H9RA 2HIVA 1V9PA 1AP0A 3RR5A 4JC0A 1LTRD 4B08A 2JA6G 1PYSB 3CQZH 4QQBX 3I4NB 5JJZA 1P8LA 1PH2A 1EU3A 4PMBA 5FO8B 1O7IA 3J7YW 2K50A 4HMJA 4TVAB 3RLOA 4F7XA 1D7QA 3I4MG 1FJGQ 3RZDB 2CFMA 3PUVA 1SNQA 1NSNS 1JWUD 1CZGA 4R4QA 4CJ0B 4N9PA 1JQYD 2OF1A 2V4DA 2PMZB 2YYZA 3J80i 3G4SA 2K14A 3NXWA 3J80L 1HR0L 3AQQA 4V0BA 2KCTA 4A3EB 1WFQA 1EY0A 4DV6L 2Z9HA 4KD3A 1I5FA 1HH2P 1L1OA 3OSOA 4HAEA 1O78A 2IHFA 3S1NB 1SE2A 2RDGA 4LFCL 1XPUA 5EBDA 2IX0A 2PPBC 1E24A 1Y1VB 1UWVA 3HOUB 2OQ0A 5JEAJ 1WCMH 5EQ0A 1EIYB 4KY6A 3K0XA 1XPRA 4X66Q 2A6HC 1TQOA 2AUJD 4HCEA 1DCZA 5C4HA 2WV6D 4HIKA 4R8IA 1JJ2A 3UDFA 2F0IA 3HGBA 3J80E 2F0VA 4DV7L 4LF8L 5IP7H 1D8LA 4JV5Q 3IAYA 3QJYA 2I5MX 2O5IC 5IYDG 1I50B 4MTNA 5JPNC 2Q2IA 1Q46A 1F9QA 4HJ9A 1EYAA 1XX8A 1TXYA 4UAIA 2EYMA 1PZJD 2Z0SA 3K58A 3A0JA 1M8AA 4IFDJ 2EY6A 2OCEA 2DN8A 1B53A 2O4XA 2R6GA 2KCCA 2QW7A 2CH4A 3DM3A 4OO1H 2PQAA 4QF4A 5IGGA 3T51B 3D6CA 5LMNQ 2K28A 1ESRA 2VQEL 3DUZA 1BBUA 4A4IA 5H1SE 3I72A 1SE4A 3HOVB 2NBFA 1L1OC 1STYA 2E2HH 4C3JH 3F2BA 1Z47A 5DEHA 2RBMA
chains in the Genus database with same CATH topology
4O2DA 1X65A 4GNXC 3JAMi 1VQLA 4JI2Q 2KHIA 1A63A 1E3PA 1B70B 1JJCB 1DGSA 4UP8A 3CC4A 4JI8Q 5GAGC 4DUYL 2ALYB 4YHHL 4PZ6A 1WYDA 4JBKA 4LF9L 3HOVH 1CUKA 5HY6A 2AWOA 2K5VA 2JA9A 3E0EA 4LWCA 3TS2A 2F3IA 3AFPA 1VQ6A 1N32L 3CF5A 5HGQA 1I6HH 2Y0SG 5C0XG 2IT1A 3CMEA 1PHJA 1Y1WG 2PI2E 3T1YQ 1YIJA 4A3FH 1UEBA 1CSQA 3H0GG 3ICEA 4DR7Q 4X65L 4HIMA 5DLQE 3PGZA 4C3IH 4WJ4A 3I2ZA 2GVBA 3KJPA 3HOXH 2I5HA 3D0FA 1YNXA 3BJUA 4DR5L 2EIFA 3S2DH 4DUZL 5IT9c 4A3LH 1E1OA 1VQAA 4YCVA 4LF7L 1N9WA 3GD7A 4JBWA 3W1GA 4IJHA 1GVPA 4OONA 3J81c 4A3CG 4A93H 4A3IG 1XNQQ 4DR4L 2YTVA 4GKJQ 3FKIG 4A3DG 2KENA 4JG2A 4YWLA 4DV2L 5GADC 2UXBQ 3A5ZB 2HHHL 4YY3L 5M5YH 4LF4Q 1NY4A 1UE6A 4R4OA 4X62L 1QZGA 1W2BA 3I4NH 3CCEA 1Q82C 4OX9L 1S3OA 2VZAA 1VQCA 4LF5L 4A3BG 4JI3Q 3GTOH 2JA8H 1MKHA 5IYCH 3J80c 1SE8A 3L7ZC 4P72A 2R7ZG 5ELNA 1IL2A 1CKOA 3H3VH 5IYBH 2F4VQ 1V1QA 1HZBA 3OW2A 3PUXA 2YTYA 3OTOQ 4JI7L 4UP7A 2V1CC 4HIOA 2UUAL 4IFDG 1ASYA 2K4KA 1SFOH 2AMCB 1CSPA 1OXTA 3S15H 1AE3A 5IE8A 4A3EH 3GTPH 3AFQA 1V43A 2E5LL 1Y14B 1VQIA 4P75A 3KJOA 1KD1C 1EYGA 2Q2UA 3S1QH 2ZM6L 2VUMG 1YHAA 1N33L 5M3MG 1PH1A 1XNRQ 2UUBL 1X6OA 2KBNA 3F2DA 4NPSA 1VQEA 4APVA 5LMUQ 4LFBQ 4GKKQ 3JC66 5K36G 1Z9FA 4GN3B 1W3SA 1JE5A 4JI5L 3CCJA 2AHOB 1YZ6A 4UP9A 4IJLA 2Y0SE 3Q8DA 2D0PA 4DV0L 4DV2Q 1YHBA 5IWAQ 1I94L 4JI4Q 5AJ3Q 3MXNB 1CKNA 1PFSA 2I5LX 5C4XH 4X62Q 1Y1VH 1U0LA 2XGTA 3UDIA 4JI0L 1SN8A 3J7A5 3H15A 2RHSB 1KAWA 1PH7A 4AQYL 3PIOA 1HR0Q 4IOCA 3PUYA 2JQOA 4LUVA 1HZCA 1MJCA 1PA6A 4DR1L 4DV6Q 1NBWA 1IBLL 3M7NA 4JI6L 4JYAQ 4DR2L 5BR8L 2VS1A 4A3KG 1OXUA 3U4ZA 4B3RL 4L5SA 1L2FA 2K75A 3GTMH 4DV3L 5M3FG 1VQOA 3OYYA 4LFCQ 3MEFA 1NE3A 1P16A 3E9IA 3WWVA 4A3MG 4IO9A 4GLVB 1IBML 3HKSA 5GROA 1PV4A 3TRZA 2R92H 4DV4Q 1I50H 4B3MQ 2JA6H 1X3FA 4AIMA 3A74A 1N33Q 1S72A 1J5EL 2CQOA 3W1BA 2UXCQ 2FXQA 3M4PA 4BXXG 2VY3A 3K7AH 3G71A 1AH9A 2WAQG 4NXML 1SR3A 1HNXQ 4NXNL 1QVFA 1VCIA 1Q7YC 3I4MH 1PYBA 4DV0Q 4MNOA 4DKAC 2VW9A 1NMFA 1Q86C 3T1HL 3M4QA 1QZHA 1N8RC 1SROA 4IPDA 4A75A 4LF8Q 3CCUA 1UE5A 4A76A 3ZJYC 2WB1G 3J81j 4DR6L 5GAEC 3CAMA 3W5OA 2K5NA 4B3SQ 2ES2A 1HNWQ 1R9TH 2N49A 5FLXc 1UE7A 3ER0A 4QY7A 4BY1G 1MIUA 2B29A 4IPCA 1BBWA 4AYBG 3STBD 1XMQL 2BA0A 3KF6B 4R4IA 4DR3L 1EFWA 4HJ7A 1PH3A 3JAMc 1VQ9A 2D0OA 2A8VA 2JJQA 3S1RH 3TEHB 1WCMG 3HOZH 3BZKA 4POGA 1YVCA 3CCMA 1XMOL 3GTKH 4LNQA 4IPGA 4DV5Q 5FJ8H 4LFAL 1HNZQ 1FJGL 1RIPA 3RZOH 2ZTCA 3D31A 4JI1L 3HFZB 2UXDQ 2LSSA 3I4OA 1HZ9A 3HKZG 3KYHC 4X64Q 4GOPB 3HOUG 3PO3H 2WFWA 1E1TA 5IP7G 3U58A 5JEAG 4R1JA 3TQYA 1LTLA 3PO2G 2ID0A 1NJIC 3HOWH 1J6QA 2VQEQ 1YI2A 4DV1Q 3DLLA 1N36Q 1M90C 4HJ5A 4O0AA 4BBRH 1X55A 3GTLH 1CKMA 3PCOB 4RMFA 1PVOA 1YJ9A 3IRBA 4YWMA 2VQFQ 1OXSC 4QGUA 2YTXA 2R93H 2ZJQA 3VDYA 3E9HA 2QGQA 4A3JH 2UU9Q 5C0XI 4K0KL 1HJPA 4ME3A 2HT1A 5IYDH 1KXLA 1OXXK 2BH2A 2A19A 5JJLA 3HOYG 1LUZA 1TWGH 2WAQE 1XMQQ 2HQLA 3CC7A 3CMAA 1VQNA 2JA7G 3G6EA 4R4TA 1BVSA 4BBSG 1T9HA 4DUYQ 1ASZA 3M3YH 4YHHQ 4LF9Q 2JA5G 1VQ5A 2MO1A 4JOIC 2NVYH 4OO1G 5IP9G 3S16H 2KHJA 3PV0A 1N34L 1N32Q 2NN6G 2N8NA 2YV5A 3EN2A 4X66L 2JK8A 2WB1E 5C3EH 1YEZA 2PMZE 2LXKA 3L0OA 4GS3A 3UDGA 4LF6L 3KLWA 2OTJA 3UE0A 4OWWB 4IOAA 4X65Q 1L1OB 5C44H 3U4VA 4XIGS 2D62A 1XPOA 4DR5Q 4AYBE 3CXCA 1YHQA 4GNXB 4JV5L 4DUZQ 4KHPL 2XTIA 4LF7Q 2R7DA 2AKWB 3NELA 3S2HH 4A3GH 4DR4Q 3PF5A 2B63H 2RF4A 1FL0A 1C9OA 1JJGA 1QUQA 2IY5B 2UUCL 4BY7H 4EQ5A 1B7YB 4PG3A 2MNAA 2HHHQ 4JCVE 4YY3Q 1GKHA 3HOVG 3S17H 3PUZA 3CC2A 3HKZE 4OX9Q 4IFDI 3FHWA 4LF5Q 5J3BA 1EIFA 1TWAH 4KHZA 1OTCA 3S14H 1AE2A 3FP9A 3RN5A 4A3FG 4WJ3M 3RN2A 1VQFA 4LUZA 1K9MC 1K0RA 1IBKL 3HOXG 1VQHA 3F1ZA 4B3TQ 1YBYA 3GTGH 5JJIA 4OWTB 2YU9H 3CD6A 3PIPA 4A3LG 1XJVA 5LMNL 1EQQA 4JI7Q 1Y1WH 2UUAQ 1WI5A 1XTDA 4NB3A 2Z6KC 4A93G 3H0GH 4QL5A 1X54A 1EQRA 3CW2C 2E5LQ 4B3TL 1H95A 2ZM6Q 2VNUD 1VQBA 4JOIA 3CPWA 3AYHB 2UUBQ 1K3RA 4J15A 1KIXA 2EQSA 3I4NG 2CWAA 1WJJA 5FLMH 4GKKL 1IYJB 4A3CH 2I0QA 2OWOA 4KI0A 4A3IH 1C7YA 4JI2L 1PH6A 4JI5Q 3J7ZC 1K8AC 4C2MH 3FKIH 2JA8G 4A3DH 5IYCG 2A1AA 1I94Q 3K81C 2NVTH 4JI8L 4JI0Q 4QJFA 5EAYA 1C0AA 3UDXA 1G291 4YWKA 2PQAB 2R7FA 4AQYQ 1PH8A 1VQ8A 2LXJA 4OWXB 3RNUA 5IYBG 5M5WH 4A3BH 2CCZA 2DUDA 3M9BA 1QVCA 4DR1Q 1X3GA 1X3EA 3T1YL 3KDFB 3GO5A 3NENA 1NMGA 1IBLQ 4JI6Q 4DR2Q 5BR8Q 4DR7L 1VQJA 1IBKQ 1YITA 2R7ZH 4A3EG 3CP0A 2B3GA 2VL6A 1VQMA 1K8GA 4B3RQ 4GLXA 2N78A 2QEXA 1GD7A 4DV3Q 1WOCA 4MZ9A 4X6AH 3GTJH 1A62A 2ZJRA 1EWIA 4YCUA 1IBMQ 1NTGA 2CWPA 5M5XH 3EIVA 1X9NA 1XNQL 4GKJL 4R4CA 4POFA 5LMNW 1YJWA 4L5TA 2L15A 3NEMA 3KF6A 2UXBL 1J5EQ 2VUMH 1Y1VG 3PSIA 5M3MH 1VQ4A 4LF4L 2N3SA 5C4XG 1L0WA 1X56A 4NXMQ 1QVGA 1PH9A 2JE6I 3U50C 4NXNQ 2WP8J 4KLKA 4JI3L 2Z6KA 2C35B 2BH8A 4JBMA 2PNHA 3RLNA 1EOVA 1LYLA 1VQGA 3T1HQ 2E8GA 3TREA 4GN4B 1EUJA 4GOPA 2PI2A 2Q2TA 1FGUA 2MQHA 4IPHA 1KHIA 4TQUS 4ALPA 4DR6Q 3I55A 2ZTEA 3I56A 3ERSX 3K7UC 3TS0A 2F4VL 2NVQH 2K52A 3OTOL 2HIVA 1V9PA 4LW1A 3SGIA 2E2JH 3RR5A 1VQ7A 4JC0A 2E2IH 2R92G 4GLAC 2DGYA 3ULJA 3KFUA 3J81i 4A3KH 3S1MH 2JA6G 1FVIA 1PYSB 1G6PA 1U5KA 3CQZH 4DR3Q 4QIWE 4QQBX 1VS0A 1I3QH 1P8LA 2IHEA 3F8TA 2F52A 5M3FH 1PH2A 1O7IA 5FLMG 1XNRL 4A3MH 1Q1BA 4HIDA 5LMUL 2K50A 1XMOQ 4LFBL 1Q12A 4TVAB 3B6YA 3RLOA 4LFAQ 1D7QA 2KCMA 1PH4A 1FJGQ 3I4MG 2CFMA 3PUVA 4R4QA 4OXPA 3CCVA 4JI4L 4JI1Q 3CCQA 5IWAL 4DNIA 5AJ3L 4DK3C 3A5UA 1GM5A 1JMCA 3EBEA 1G51A 1YJNA 1A0IA 2YYZA 3J80i 3G4SA 2K14A 4BXXH 4LUOA 1HR0L 2MO0A 4RG1A 3AQQA 3PF4A 3UE1A 3KF8B 4L5QA 4HJAA 2KCTA 1M1KC 2JEAI 1WFQA 1K83H 4L5RC 3M4OH 4DV6L 3RZDH 2ATWA 4JYAL 1I5FA 1L1OA 1HH2P 2BA1A 2NVXH 4OO1I 2QA4A 2IHFA 1TWHH 3K80C 1KRSA 2NN6I 1JT8A 4XTCS 1KRTA 4Y7NH 4Y52H 4GNXA 3HOZG 4LFCL 4K0KQ 4P73A 1SLJA 5C0XJ 1Q81C 1TWCH 1XPUA 3AEVA 1VQDA 5C4JH 4BY1H 4YCWA 3CCSA 5FJ8G 2GN5A 5GAHC 2IX0A 1QUQB 2GVAA 3GDEA 1E24A 4DV4L 1S40A 3LGJA 4B3ML 3CCRA 1UWVA 4AH6A 1CKNB 1JB7A 4DPGA 2OQ0A 5JEAJ 3F2CA 3BU2A 4C3HH 3S1NH 1WCMH 3PO3G 1E7ZA 1EIYB 1N34Q 3K0XA 2UXCL 4DAMA 1A8VA 1K73C 1OXVA 1XPRA 1HZAA 4X66Q 1HNXL 3HOWG 4LF6Q 3KOJA 4HIKA 4BA1I 1UE1A 2AWNA 4BBRG 3UDFA 1JJ2A 1Q1EA 2HIXA 1BKBA 4DV7L 4LF8L 2CKZB 3HOUH 1RL2A 1IXRA 5IP7H 2R93G 1D8LA 4PZ8A 4GOPC 4A3JG 1GO3E 5E7NA 1Q8KA 1PH5A 4B3SL 3PO2H 2I5MX 4JV5Q 1B8AA 2H5XA 4KHPQ 1E22A 5IYDG 1HNWL 4MTNA 3G48A 4BA2I 2K5HA 1SMXA 4DK6C 2Q2IA 1HR0W 1Q46A 3STBC 4H02A 4DAYB 4HJ9A 4P74A 1MJEA 1LM0A 3K8AA 2UUCQ 1IZ6A 1TXYA 4JBJA 4UPAA 3ULLA 3S24A 5IY0A 4FDBA 1SRUA 2OQKA 4HJ8A 2Z0SA 2ZTDA 2JEBI 4P71A 3RLFA 2RCNA 3A0JA 5C3EG 4DV5L 3I7FA 1KL9A 2OCEA 4UY8C 1HNZL 3CCLA 3HOYH 4IFDJ 2R6GA 2JA7H 5JJKA 3CPFA 4PMWA 4BBSH 3M85A 2OTLA 3DM3A 5C44G 1VQKA 5GQOA 2UXDL 2JA5H 2NZOA 4EX5A 4X64L 1KC8C 5IP9H 2PQAA 5ELOA 5LMNQ 3PUWA 2ASBA 2NZHA 2VQEL 4DV1L 3BZCA 1BBUA 1N36L 3L2PA 3KDFA 2EXDA 4A3GG 4DV7Q 2IX1A 4A4IA 2RHQB 2B63G 2MFIA 5H1SE 3ULPA 3GTQH 4GN5A 1TWFH 2VQFL 3NBHB 4BY7G 4PZ7A 1L1OC 2ZJPA 2E2HH 3H3VI 4C3JH 1KQSA 3F2BA 2UU9L 2Q2HA 1Z47A 1VQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2D A;  1X65 A;  4GNX C;  3JAM i;  1VQL A;  4JI2 Q;  2KHI A;  1A63 A;  1E3P A;  1B70 B;  1JJC B;  1DGS A;  4UP8 A;  3CC4 A;  4JI8 Q;  5GAG C;  4DUY L;  2ALY B;  4YHH L;  4PZ6 A;  1WYD A;  4JBK A;  4LF9 L;  3HOV H;  1CUK A;  5HY6 A;  2AWO A;  2K5V A;  2JA9 A;  3E0E A;  4LWC A;  3TS2 A;  2F3I A;  3AFP A;  1VQ6 A;  1N32 L;  3CF5 A;  5HGQ A;  1I6H H;  2Y0S G;  5C0X G;  2IT1 A;  3CME A;  1PHJ A;  1Y1W G;  2PI2 E;  3T1Y Q;  1YIJ A;  4A3F H;  1UEB A;  1CSQ A;  3H0G G;  3ICE A;  4DR7 Q;  4X65 L;  4HIM A;  5DLQ E;  3PGZ A;  4C3I H;  4WJ4 A;  3I2Z A;  2GVB A;  3KJP A;  3HOX H;  2I5H A;  3D0F A;  1YNX A;  3BJU A;  4DR5 L;  2EIF A;  3S2D H;  4DUZ L;  5IT9 c;  4A3L H;  1E1O A;  1VQA A;  4YCV A;  4LF7 L;  1N9W A;  3GD7 A;  4JBW A;  3W1G A;  4IJH A;  1GVP A;  4OON A;  3J81 c;  4A3C G;  4A93 H;  4A3I G;  1XNQ Q;  4DR4 L;  2YTV A;  4GKJ Q;  3FKI G;  4A3D G;  2KEN A;  4JG2 A;  4YWL A;  4DV2 L;  5GAD C;  2UXB Q;  3A5Z B;  2HHH L;  4YY3 L;  5M5Y H;  4LF4 Q;  1NY4 A;  1UE6 A;  4R4O A;  4X62 L;  1QZG A;  1W2B A;  3I4N H;  3CCE A;  1Q82 C;  4OX9 L;  1S3O A;  2VZA A;  1VQC A;  4LF5 L;  4A3B G;  4JI3 Q;  3GTO H;  2JA8 H;  1MKH A;  5IYC H;  3J80 c;  1SE8 A;  3L7Z C;  4P72 A;  2R7Z G;  5ELN A;  1IL2 A;  1CKO A;  3H3V H;  5IYB H;  2F4V Q;  1V1Q A;  1HZB A;  3OW2 A;  3PUX A;  2YTY A;  3OTO Q;  4JI7 L;  4UP7 A;  2V1C C;  4HIO A;  2UUA L;  4IFD G;  1ASY A;  2K4K A;  1SFO H;  2AMC B;  1CSP A;  1OXT A;  3S15 H;  1AE3 A;  5IE8 A;  4A3E H;  3GTP H;  3AFQ A;  1V43 A;  2E5L L;  1Y14 B;  1VQI A;  4P75 A;  3KJO A;  1KD1 C;  1EYG A;  2Q2U A;  3S1Q H;  2ZM6 L;  2VUM G;  1YHA A;  1N33 L;  5M3M G;  1PH1 A;  1XNR Q;  2UUB L;  1X6O A;  2KBN A;  3F2D A;  4NPS A;  1VQE A;  4APV A;  5LMU Q;  4LFB Q;  4GKK Q;  3JC6 6;  5K36 G;  1Z9F A;  4GN3 B;  1W3S A;  1JE5 A;  4JI5 L;  3CCJ A;  2AHO B;  1YZ6 A;  4UP9 A;  4IJL A;  2Y0S E;  3Q8D A;  2D0P A;  4DV0 L;  4DV2 Q;  1YHB A;  5IWA Q;  1I94 L;  4JI4 Q;  5AJ3 Q;  3MXN B;  1CKN A;  1PFS A;  2I5L X;  5C4X H;  4X62 Q;  1Y1V H;  1U0L A;  2XGT A;  3UDI A;  4JI0 L;  1SN8 A;  3J7A 5;  3H15 A;  2RHS B;  1KAW A;  1PH7 A;  4AQY L;  3PIO A;  1HR0 Q;  4IOC A;  3PUY A;  2JQO A;  4LUV A;  1HZC A;  1MJC A;  1PA6 A;  4DR1 L;  4DV6 Q;  1NBW A;  1IBL L;  3M7N A;  4JI6 L;  4JYA Q;  4DR2 L;  5BR8 L;  2VS1 A;  4A3K G;  1OXU A;  3U4Z A;  4B3R L;  4L5S A;  1L2F A;  2K75 A;  3GTM H;  4DV3 L;  5M3F G;  1VQO A;  3OYY A;  4LFC Q;  3MEF A;  1NE3 A;  1P16 A;  3E9I A;  3WWV A;  4A3M G;  4IO9 A;  4GLV B;  1IBM L;  3HKS A;  5GRO A;  1PV4 A;  3TRZ A;  2R92 H;  4DV4 Q;  1I50 H;  4B3M Q;  2JA6 H;  1X3F A;  4AIM A;  3A74 A;  1N33 Q;  1S72 A;  1J5E L;  2CQO A;  3W1B A;  2UXC Q;  2FXQ A;  3M4P A;  4BXX G;  2VY3 A;  3K7A H;  3G71 A;  1AH9 A;  2WAQ G;  4NXM L;  1SR3 A;  1HNX Q;  4NXN L;  1QVF A;  1VCI A;  1Q7Y C;  3I4M H;  1PYB A;  4DV0 Q;  4MNO A;  4DKA C;  2VW9 A;  1NMF A;  1Q86 C;  3T1H L;  3M4Q A;  1QZH A;  1N8R C;  1SRO A;  4IPD A;  4A75 A;  4LF8 Q;  3CCU A;  1UE5 A;  4A76 A;  3ZJY C;  2WB1 G;  3J81 j;  4DR6 L;  5GAE C;  3CAM A;  3W5O A;  2K5N A;  4B3S Q;  2ES2 A;  1HNW Q;  1R9T H;  2N49 A;  5FLX c;  1UE7 A;  3ER0 A;  4QY7 A;  4BY1 G;  1MIU A;  2B29 A;  4IPC A;  1BBW A;  4AYB G;  3STB D;  1XMQ L;  2BA0 A;  3KF6 B;  4R4I A;  4DR3 L;  1EFW A;  4HJ7 A;  1PH3 A;  3JAM c;  1VQ9 A;  2D0O A;  2A8V A;  2JJQ A;  3S1R H;  3TEH B;  1WCM G;  3HOZ H;  3BZK A;  4POG A;  1YVC A;  3CCM A;  1XMO L;  3GTK H;  4LNQ A;  4IPG A;  4DV5 Q;  5FJ8 H;  4LFA L;  1HNZ Q;  1FJG L;  1RIP A;  3RZO H;  2ZTC A;  3D31 A;  4JI1 L;  3HFZ B;  2UXD Q;  2LSS A;  3I4O A;  1HZ9 A;  3HKZ G;  3KYH C;  4X64 Q;  4GOP B;  3HOU G;  3PO3 H;  2WFW A;  1E1T A;  5IP7 G;  3U58 A;  5JEA G;  4R1J A;  3TQY A;  1LTL A;  3PO2 G;  2ID0 A;  1NJI C;  3HOW H;  1J6Q A;  2VQE Q;  1YI2 A;  4DV1 Q;  3DLL A;  1N36 Q;  1M90 C;  4HJ5 A;  4O0A A;  4BBR H;  1X55 A;  3GTL H;  1CKM A;  3PCO B;  4RMF A;  1PVO A;  1YJ9 A;  3IRB A;  4YWM A;  2VQF Q;  1OXS C;  4QGU A;  2YTX A;  2R93 H;  2ZJQ A;  3VDY A;  3E9H A;  2QGQ A;  4A3J H;  2UU9 Q;  5C0X I;  4K0K L;  1HJP A;  4ME3 A;  2HT1 A;  5IYD H;  1KXL A;  1OXX K;  2BH2 A;  2A19 A;  5JJL A;  3HOY G;  1LUZ A;  1TWG H;  2WAQ E;  1XMQ Q;  2HQL A;  3CC7 A;  3CMA A;  1VQN A;  2JA7 G;  3G6E A;  4R4T A;  1BVS A;  4BBS G;  1T9H A;  4DUY Q;  1ASZ A;  3M3Y H;  4YHH Q;  4LF9 Q;  2JA5 G;  1VQ5 A;  2MO1 A;  4JOI C;  2NVY H;  4OO1 G;  5IP9 G;  3S16 H;  2KHJ A;  3PV0 A;  1N34 L;  1N32 Q;  2NN6 G;  2N8N A;  2YV5 A;  3EN2 A;  4X66 L;  2JK8 A;  2WB1 E;  5C3E H;  1YEZ A;  2PMZ E;  2LXK A;  3L0O A;  4GS3 A;  3UDG A;  4LF6 L;  3KLW A;  2OTJ A;  3UE0 A;  4OWW B;  4IOA A;  4X65 Q;  1L1O B;  5C44 H;  3U4V A;  4XIG S;  2D62 A;  1XPO A;  4DR5 Q;  4AYB E;  3CXC A;  1YHQ A;  4GNX B;  4JV5 L;  4DUZ Q;  4KHP L;  2XTI A;  4LF7 Q;  2R7D A;  2AKW B;  3NEL A;  3S2H H;  4A3G H;  4DR4 Q;  3PF5 A;  2B63 H;  2RF4 A;  1FL0 A;  1C9O A;  1JJG A;  1QUQ A;  2IY5 B;  2UUC L;  4BY7 H;  4EQ5 A;  1B7Y B;  4PG3 A;  2MNA A;  2HHH Q;  4JCV E;  4YY3 Q;  1GKH A;  3HOV G;  3S17 H;  3PUZ A;  3CC2 A;  3HKZ E;  4OX9 Q;  4IFD I;  3FHW A;  4LF5 Q;  5J3B A;  1EIF A;  1TWA H;  4KHZ A;  1OTC A;  3S14 H;  1AE2 A;  3FP9 A;  3RN5 A;  4A3F G;  4WJ3 M;  3RN2 A;  1VQF A;  4LUZ A;  1K9M C;  1K0R A;  1IBK L;  3HOX G;  1VQH A;  3F1Z A;  4B3T Q;  1YBY A;  3GTG H;  5JJI A;  4OWT B;  2YU9 H;  3CD6 A;  3PIP A;  4A3L G;  1XJV A;  5LMN L;  1EQQ A;  4JI7 Q;  1Y1W H;  2UUA Q;  1WI5 A;  1XTD A;  4NB3 A;  2Z6K C;  4A93 G;  3H0G H;  4QL5 A;  1X54 A;  1EQR A;  3CW2 C;  2E5L Q;  4B3T L;  1H95 A;  2ZM6 Q;  2VNU D;  1VQB A;  4JOI A;  3CPW A;  3AYH B;  2UUB Q;  1K3R A;  4J15 A;  1KIX A;  2EQS A;  3I4N G;  2CWA A;  1WJJ A;  5FLM H;  4GKK L;  1IYJ B;  4A3C H;  2I0Q A;  2OWO A;  4KI0 A;  4A3I H;  1C7Y A;  4JI2 L;  1PH6 A;  4JI5 Q;  3J7Z C;  1K8A C;  4C2M H;  3FKI H;  2JA8 G;  4A3D H;  5IYC G;  2A1A A;  1I94 Q;  3K81 C;  2NVT H;  4JI8 L;  4JI0 Q;  4QJF A;  5EAY A;  1C0A A;  3UDX A;  1G29 1;  4YWK A;  2PQA B;  2R7F A;  4AQY Q;  1PH8 A;  1VQ8 A;  2LXJ A;  4OWX B;  3RNU A;  5IYB G;  5M5W H;  4A3B H;  2CCZ A;  2DUD A;  3M9B A;  1QVC A;  4DR1 Q;  1X3G A;  1X3E A;  3T1Y L;  3KDF B;  3GO5 A;  3NEN A;  1NMG A;  1IBL Q;  4JI6 Q;  4DR2 Q;  5BR8 Q;  4DR7 L;  1VQJ A;  1IBK Q;  1YIT A;  2R7Z H;  4A3E G;  3CP0 A;  2B3G A;  2VL6 A;  1VQM A;  1K8G A;  4B3R Q;  4GLX A;  2N78 A;  2QEX A;  1GD7 A;  4DV3 Q;  1WOC A;  4MZ9 A;  4X6A H;  3GTJ H;  1A62 A;  2ZJR A;  1EWI A;  4YCU A;  1IBM Q;  1NTG A;  2CWP A;  5M5X H;  3EIV A;  1X9N A;  1XNQ L;  4GKJ L;  4R4C A;  4POF A;  5LMN W;  1YJW A;  4L5T A;  2L15 A;  3NEM A;  3KF6 A;  2UXB L;  1J5E Q;  2VUM H;  1Y1V G;  3PSI A;  5M3M H;  1VQ4 A;  4LF4 L;  2N3S A;  5C4X G;  1L0W A;  1X56 A;  4NXM Q;  1QVG A;  1PH9 A;  2JE6 I;  3U50 C;  4NXN Q;  2WP8 J;  4KLK A;  4JI3 L;  2Z6K A;  2C35 B;  2BH8 A;  4JBM A;  2PNH A;  3RLN A;  1EOV A;  1LYL A;  1VQG A;  3T1H Q;  2E8G A;  3TRE A;  4GN4 B;  1EUJ A;  4GOP A;  2PI2 A;  2Q2T A;  1FGU A;  2MQH A;  4IPH A;  1KHI A;  4TQU S;  4ALP A;  4DR6 Q;  3I55 A;  2ZTE A;  3I56 A;  3ERS X;  3K7U C;  3TS0 A;  2F4V L;  2NVQ H;  2K52 A;  3OTO L;  2HIV A;  1V9P A;  4LW1 A;  3SGI A;  2E2J H;  3RR5 A;  1VQ7 A;  4JC0 A;  2E2I H;  2R92 G;  4GLA C;  2DGY A;  3ULJ A;  3KFU A;  3J81 i;  4A3K H;  3S1M H;  2JA6 G;  1FVI A;  1PYS B;  1G6P A;  1U5K A;  3CQZ H;  4DR3 Q;  4QIW E;  4QQB X;  1VS0 A;  1I3Q H;  1P8L A;  2IHE A;  3F8T A;  2F52 A;  5M3F H;  1PH2 A;  1O7I A;  5FLM G;  1XNR L;  4A3M H;  1Q1B A;  4HID A;  5LMU L;  2K50 A;  1XMO Q;  4LFB L;  1Q12 A;  4TVA B;  3B6Y A;  3RLO A;  4LFA Q;  1D7Q A;  2KCM A;  1PH4 A;  1FJG Q;  3I4M G;  2CFM A;  3PUV A;  4R4Q A;  4OXP A;  3CCV A;  4JI4 L;  4JI1 Q;  3CCQ A;  5IWA L;  4DNI A;  5AJ3 L;  4DK3 C;  3A5U A;  1GM5 A;  1JMC A;  3EBE A;  1G51 A;  1YJN A;  1A0I A;  2YYZ A;  3J80 i;  3G4S A;  2K14 A;  4BXX H;  4LUO A;  1HR0 L;  2MO0 A;  4RG1 A;  3AQQ A;  3PF4 A;  3UE1 A;  3KF8 B;  4L5Q A;  4HJA A;  2KCT A;  1M1K C;  2JEA I;  1WFQ A;  1K83 H;  4L5R C;  3M4O H;  4DV6 L;  3RZD H;  2ATW A;  4JYA L;  1I5F A;  1L1O A;  1HH2 P;  2BA1 A;  2NVX H;  4OO1 I;  2QA4 A;  2IHF A;  1TWH H;  3K80 C;  1KRS A;  2NN6 I;  1JT8 A;  4XTC S;  1KRT A;  4Y7N H;  4Y52 H;  4GNX A;  3HOZ G;  4LFC L;  4K0K Q;  4P73 A;  1SLJ A;  5C0X J;  1Q81 C;  1TWC H;  1XPU A;  3AEV A;  1VQD A;  5C4J H;  4BY1 H;  4YCW A;  3CCS A;  5FJ8 G;  2GN5 A;  5GAH C;  2IX0 A;  1QUQ B;  2GVA A;  3GDE A;  1E24 A;  4DV4 L;  1S40 A;  3LGJ A;  4B3M L;  3CCR A;  1UWV A;  4AH6 A;  1CKN B;  1JB7 A;  4DPG A;  2OQ0 A;  5JEA J;  3F2C A;  3BU2 A;  4C3H H;  3S1N H;  1WCM H;  3PO3 G;  1E7Z A;  1EIY B;  1N34 Q;  3K0X A;  2UXC L;  4DAM A;  1A8V A;  1K73 C;  1OXV A;  1XPR A;  1HZA A;  4X66 Q;  1HNX L;  3HOW G;  4LF6 Q;  3KOJ A;  4HIK A;  4BA1 I;  1UE1 A;  2AWN A;  4BBR G;  3UDF A;  1JJ2 A;  1Q1E A;  2HIX A;  1BKB A;  4DV7 L;  4LF8 L;  2CKZ B;  3HOU H;  1RL2 A;  1IXR A;  5IP7 H;  2R93 G;  1D8L A;  4PZ8 A;  4GOP C;  4A3J G;  1GO3 E;  5E7N A;  1Q8K A;  1PH5 A;  4B3S L;  3PO2 H;  2I5M X;  4JV5 Q;  1B8A A;  2H5X A;  4KHP Q;  1E22 A;  5IYD G;  1HNW L;  4MTN A;  3G48 A;  4BA2 I;  2K5H A;  1SMX A;  4DK6 C;  2Q2I A;  1HR0 W;  1Q46 A;  3STB C;  4H02 A;  4DAY B;  4HJ9 A;  4P74 A;  1MJE A;  1LM0 A;  3K8A A;  2UUC Q;  1IZ6 A;  1TXY A;  4JBJ A;  4UPA A;  3ULL A;  3S24 A;  5IY0 A;  4FDB A;  1SRU A;  2OQK A;  4HJ8 A;  2Z0S A;  2ZTD A;  2JEB I;  4P71 A;  3RLF A;  2RCN A;  3A0J A;  5C3E G;  4DV5 L;  3I7F A;  1KL9 A;  2OCE A;  4UY8 C;  1HNZ L;  3CCL A;  3HOY H;  4IFD J;  2R6G A;  2JA7 H;  5JJK A;  3CPF A;  4PMW A;  4BBS H;  3M85 A;  2OTL A;  3DM3 A;  5C44 G;  1VQK A;  5GQO A;  2UXD L;  2JA5 H;  2NZO A;  4EX5 A;  4X64 L;  1KC8 C;  5IP9 H;  2PQA A;  5ELO A;  5LMN Q;  3PUW A;  2ASB A;  2NZH A;  2VQE L;  4DV1 L;  3BZC A;  1BBU A;  1N36 L;  3L2P A;  3KDF A;  2EXD A;  4A3G G;  4DV7 Q;  2IX1 A;  4A4I A;  2RHQ B;  2B63 G;  2MFI A;  5H1S E;  3ULP A;  3GTQ H;  4GN5 A;  1TWF H;  2VQF L;  3NBH B;  4BY7 G;  4PZ7 A;  1L1O C;  2ZJP A;  2E2H H;  3H3V I;  4C3J H;  1KQS A;  3F2B A;  2UU9 L;  2Q2H A;  1Z47 A;  1VQP A; 
#chains in the Genus database with same CATH topology
 4O2D A;  2EDG A;  2KHI A;  1B70 B;  1UEA B;  2F0Q A;  3HOX B;  3WOF A;  1QG7 A;  3ERO A;  1CUK A;  1XXG A;  2JA9 A;  1A6X A;  1MSH A;  1BCP C;  1STH A;  2Q8T A;  1CHQ D;  2Y0S G;  1F77 A;  4XYQ A;  4A93 B;  4KD4 A;  4A3F H;  4DR7 Q;  3PGZ A;  1RF2 D;  2J0T D;  1B9N A;  3DEP A;  2I5H A;  4DR5 L;  4KHV A;  1AZQ A;  2EIF A;  1KAB A;  4A3L H;  2EYO A;  5IOC A;  3J81 c;  2F0E A;  4OON A;  2F0T A;  4A3I G;  2L0C A;  4EQO A;  2PQE A;  4JK1 C;  3L9A X;  2EYF A;  1H9K A;  1LTS D;  4YY3 L;  1NY4 A;  1PLF A;  4R4O A;  5K5P A;  5M5Y H;  3I4N H;  1Q82 C;  4OX9 L;  1S3O A;  1JIC A;  4ZRZ A;  4KN4 C;  1SE8 A;  3SK5 A;  5ELN A;  2DY8 A;  5BN5 A;  2C5C A;  1CKO A;  5C4Z A;  1AEX A;  1B2T A;  5KYI A;  4IUV A;  1GUO A;  3PUX A;  5IOD A;  1NNX A;  2V1C C;  1EY5 A;  2UUA L;  3GV6 A;  2F1M A;  2AMC B;  5I2Y A;  4A3E H;  1V43 A;  1DYQ A;  1HTL D;  4ABN A;  1S5E D;  1ROD A;  4LFB Q;  1TS5 A;  2H4O A;  5K36 G;  2F0N A;  3CRL C;  3LX0 A;  4NMZ A;  1ENA A;  2EYJ A;  2QKI C;  4RGT A;  4UP9 A;  4JI5 L;  3Q8D A;  1O80 A;  4DV2 Q;  5IWA Q;  1I94 L;  2GA4 B;  3MXN B;  3VYT A;  1FR3 A;  1Y1V H;  2XGT A;  1TY2 A;  3GTM B;  4AQY L;  3MWY W;  3PIO A;  3LWU A;  4RGO S;  2JQO A;  1EWC A;  1T5X D;  1SYB A;  1NBW A;  2F3W A;  1IBL L;  3M7N A;  4JYA Q;  2BOS A;  1ZEQ X;  4A3K G;  2X6L A;  4NW2 A;  3SHL A;  3U4Z A;  4B3R L;  1L2F A;  5M3F G;  1VQO A;  3OYY A;  3WWV A;  1NE3 A;  5DM7 3;  2JYO A;  1SNO A;  1II3 A;  3TN2 A;  2X69 A;  2O5J C;  1WTH A;  2G9H D;  1L0X B;  3TRZ A;  1I50 H;  2JA6 H;  2KED A;  1X3F A;  4AIM A;  1HUN A;  4FP5 D;  4B9W A;  2VY3 A;  3G71 A;  1R9T B;  1SR3 A;  2BDN A;  4NXN L;  1HNX Q;  1BQQ T;  3I4M H;  4DNT B;  1N8R C;  4A75 A;  1EEF D;  3NTH A;  1UE5 A;  3ZJY C;  2WB1 G;  3QIA A;  5GAE C;  3W5O A;  2K5N A;  2K32 A;  4R9W A;  3R2T A;  5FLX c;  4QY7 A;  4L63 B;  2B29 A;  4IPC A;  5EBC A;  1QNK A;  4AYB G;  1JC7 A;  1XMQ L;  3MC0 B;  2A8V A;  2JJQ A;  4C3H G;  4ULL A;  1IKL A;  2XWJ B;  4F87 A;  3BZK A;  4POG A;  3CCM A;  3GTK H;  2HUG A;  2VB3 X;  1S5F D;  1CQV A;  4HMI A;  3RZO H;  4BWG B;  2RSN A;  2WII B;  4JI1 L;  3HFZ B;  2UXD Q;  2LSS A;  2MPM A;  1HZ9 A;  2K7V A;  3KYH C;  4HTH A;  1E1T A;  3TQY A;  3PO2 G;  2MUY A;  2E2J B;  1NJI C;  4HR7 B;  4A3K B;  4HJ5 A;  4LK1 C;  1NR4 A;  1X55 A;  1PTO D;  3IRB A;  4YWM A;  5M3F B;  4DK0 A;  3HEJ A;  2YTX A;  3TZU A;  5BN3 A;  3E9H A;  5NUC A;  3SXH A;  4ME3 A;  3J7A V;  4DGZ A;  5IYD H;  1KXL A;  2BH2 A;  2A19 A;  4K5W A;  1H9M A;  3HOY G;  3Q0A A;  1SND A;  2XSC A;  3G6E A;  4BBS G;  4DUY Q;  4YHH Q;  4IN3 A;  3MAQ A;  2YV5 A;  1U4M A;  2JK8 A;  1YEZ A;  2DY7 A;  2LXK A;  5AFW A;  2OTJ A;  4IOA A;  2F03 A;  3TZD A;  4XIG S;  1JOO A;  1TWC B;  1VF7 A;  3CXC A;  2B2T A;  1SYG A;  2R7D A;  1TWA B;  4DF7 A;  3PF5 A;  2RF4 A;  1C9O A;  4C3H B;  1QUQ A;  1ZKO A;  4EQ5 A;  2HHH Q;  3TP8 A;  1VF5 C;  4N8F A;  2BCO A;  3HKZ E;  1I4P A;  1SEB D;  4IFD I;  3DWQ A;  4LF5 Q;  1OTC A;  4ZUJ A;  4KHZ A;  4WFN 3;  2IWH A;  1TS3 A;  2RKS A;  3MXU A;  1K0R A;  3NE5 B;  1VQH A;  3J7A F;  3GTG H;  4XT3 B;  3PIP A;  2RDF A;  1SJE D;  1F9R A;  2E2D C;  1WI5 A;  1C4Q A;  1A3U A;  3FKI B;  4QL5 A;  1EQR A;  2BE5 D;  1H95 A;  2ZM6 Q;  3AU7 A;  4XYO A;  3AYH B;  4XT1 B;  3BG3 A;  1KIX A;  2EQS A;  1IYJ B;  3ND8 A;  2G5D A;  3I4L A;  4XQN A;  1JB3 A;  4A3I H;  1WTP A;  1PH6 A;  4F8M A;  1DJR D;  2JA8 G;  3K81 C;  5CBE E;  1SBB B;  2NVT H;  1ENC A;  1RKN A;  2WKD A;  4LJZ C;  1IYV A;  1CI3 M;  2QCP X;  4FXG C;  2WKC A;  3DWA A;  2LXJ A;  4FF3 A;  5IYB G;  2CCZ A;  3M9B A;  3A56 A;  1X3G A;  3D3R A;  3QO2 A;  1YIT A;  3CP0 A;  2VL6 A;  5M3M B;  1K8G A;  3V96 A;  4DV3 Q;  4FYD A;  2B2T C;  2ZJR A;  1EWI A;  1STN A;  2D9U A;  1X3Q A;  3UI2 A;  1XNQ L;  1YJW A;  4KTA A;  2UXB L;  1J5E Q;  3MVV A;  3PSI A;  4LF4 L;  1TR5 A;  4NXM Q;  1QVG A;  4U68 A;  5K36 H;  2C35 B;  1BF4 A;  2B8F A;  2MHV A;  1LYL A;  3T1H Q;  2EYH A;  3QG1 A;  3CQZ B;  1E2W A;  3TRE A;  4GN4 B;  3S2D B;  2PI2 A;  1IL8 A;  2M9V A;  2MQH A;  1KHI A;  2KQ3 A;  1YNN C;  3I56 A;  1SNP A;  3OTO L;  1D2B A;  3N6R A;  3SGI A;  2E2J H;  4GLA C;  1K28 A;  1WTW A;  5LHY 1;  3S1M H;  1LTI D;  4A3K H;  1NUC A;  3T4A C;  1U5K A;  4DR3 Q;  4QIW E;  5IGE A;  5M3F H;  2WAQ B;  3F8T A;  5LMU L;  3B6Y A;  4LFA Q;  3I70 A;  4JI4 L;  4DK3 C;  1TVX A;  5COR A;  1JMC A;  2XWB B;  4CDC C;  3EA6 A;  5EJW A;  1HUM A;  3OWE B;  4RG1 A;  4RH6 A;  1STB A;  1A15 A;  3UE1 A;  4FO2 A;  4L5Q A;  2B2U A;  4I7A A;  2JEA I;  3A7A B;  1K83 H;  3NQI A;  4L5R C;  3C2P A;  2CVR A;  3OIQ A;  1H9J A;  3K80 C;  2NN6 I;  2B2Y C;  2B2V A;  1KRT A;  1YNN D;  4EGV A;  2F0J A;  4Y52 H;  2RSO A;  3HOZ G;  4K0K Q;  4P73 A;  1SLJ A;  3VR5 A;  1TWC H;  2GN5 A;  3GDE A;  4XXE A;  4DV4 L;  1S40 A;  3LGJ A;  5CR3 A;  1BO0 A;  4EQN A;  4AH6 A;  1CKN B;  1IKM A;  3F2C A;  3BU2 A;  4C3H H;  2K03 A;  2UXC L;  1ICF B;  1A8V A;  1HZA A;  4X3S A;  1X3P A;  4IZ8 A;  2LMC B;  3KOJ A;  1UE1 A;  4BBR G;  1TS4 A;  3C1E A;  2CKZ B;  2FFK B;  3OOC A;  5EPK A;  5ELB A;  1Y69 U;  1PH5 A;  3PO2 H;  1GO3 E;  1RTO A;  4KHP Q;  1HNW L;  2SOB A;  4HSP A;  2K5H A;  1SMX A;  4MN3 A;  2VXW A;  3STB C;  3QWN A;  4DAY B;  4P74 A;  1MJE A;  2UUC Q;  2PNR C;  4JBJ A;  4UPA A;  2HCI A;  1B3A A;  4HJ8 A;  1R4Q B;  1EFI D;  2A6E D;  2F0K A;  2JEB I;  4M1U B;  4P71 A;  5C3E G;  2N55 A;  1KL9 A;  4UY8 C;  4RGM A;  1HNZ L;  3CCL A;  3HOY H;  3BVM A;  3S9W A;  4DK1 A;  4BBS H;  3M85 A;  3NWT A;  5C44 G;  1VQK A;  1SDF A;  2E2H B;  1EZ8 A;  5EGT A;  5GQO A;  4ZKB B;  2O2L D;  4C3J B;  3ND9 A;  1JOK A;  5ELO A;  4KY5 A;  4X3U A;  4DV1 L;  3BZC A;  1N36 L;  3C46 A;  4A3G G;  4DV7 Q;  2EZV A;  2IX1 A;  1B50 A;  3Q24 A;  4GN5 A;  2ICI A;  2E75 C;  2ZJP A;  3H3V I;  1HHV A;  2B2V C;  1U9R A;  4JI2 Q;  3E3X A;  1PZI D;  4OEL B;  1DGS A;  1EEI D;  3CC4 A;  4K6L A;  4LF9 L;  2J4X A;  5HY6 A;  2AWO A;  4LWC A;  3E0E A;  3AFP A;  1VQ6 A;  1N32 L;  1PTO F;  1SYE A;  2IW3 A;  1DZ1 A;  4BBR B;  3CF5 A;  2IT1 A;  2RA4 A;  3CME A;  1PHJ A;  1YIJ A;  2VB2 X;  3K57 A;  4X65 L;  1CTM A;  2EVB A;  2GVB A;  5M5Y B;  4DU9 A;  1LT4 D;  4H13 C;  3S2D H;  4DUZ L;  1PXU A;  1VQA A;  1TWG B;  4YCV A;  3TP7 A;  3W1G A;  4LF7 L;  3IFT A;  2R61 A;  1Y8O B;  1I6V C;  3PIP 3;  3I73 A;  4JG2 A;  4YWL A;  5ISR A;  4OIJ A;  4J8Q A;  4K5X A;  3A5Z B;  4RGN A;  4X62 L;  2CW0 C;  1QZG A;  2NTT A;  1W2B A;  3ITP A;  2KJX A;  2JA8 H;  1KDA A;  2F0L A;  2AUK A;  1TT2 A;  1B1Z A;  5CV6 A;  4CKC A;  3K6O A;  2LKV A;  4ZQ3 A;  5IYB H;  2F4V Q;  2F0G A;  4JI7 L;  4UP7 A;  3MFY A;  4IFD G;  1ASY A;  2K4K A;  2M2L A;  4FXD A;  2TMP A;  1AE3 A;  3GTP H;  3AFQ A;  4KKS A;  1I4X A;  1Y14 B;  1VQI A;  2LY7 A;  4P75 A;  3W3A A;  3VYU A;  3OIP A;  3RUZ A;  1KD1 C;  2FJ2 A;  1N33 L;  1XNR Q;  2UUB L;  1X6O A;  4H44 C;  4NPS A;  5A35 A;  5TSS A;  3D8G A;  3JC6 6;  4GN3 B;  1JE5 A;  4KMU C;  2AHO B;  4IJL A;  2D0P A;  1MBY A;  1YHB A;  5AJ3 Q;  4JW0 A;  1CKN A;  1PFS A;  1U0L A;  3UDI A;  3J7A 5;  3H15 A;  4ZAI A;  1PH7 A;  2RQX A;  3PUY A;  4KKU A;  1HZC A;  1PA6 A;  3DM1 A;  2N88 A;  4DNR B;  2JA6 B;  4JI6 L;  2Z1C A;  5BR8 L;  1G8Z D;  4G4K A;  2L55 A;  2EJM A;  2K75 A;  5C5M A;  3E9I A;  3SK4 A;  4A3M G;  5IGB A;  3I4M B;  4GLV B;  4PQX A;  5JOB A;  4C2M B;  1IBM L;  3HKS A;  2KVM A;  4DAY A;  2EYP A;  4B3M Q;  2CQO A;  5M5W B;  3W1B A;  4BXX G;  3K7A H;  2IX3 A;  1QVF A;  2A6H D;  1VCI A;  5FO9 B;  4MNO A;  4ODG A;  1Q86 C;  3M4Q A;  1J8I A;  1XYI A;  4IPD A;  4A76 A;  3VYS A;  4CKB A;  2ZXR A;  4B3S Q;  2ES2 A;  3GTK B;  2N49 A;  3R3O A;  1WD0 A;  3RZO B;  1BBW A;  3DEO A;  1Q3L A;  4DXF A;  1GUT A;  4IUQ A;  4HSV A;  1EFW A;  1VQ9 A;  3JAM c;  1B3Q A;  1JWS D;  2L5T A;  3HOZ H;  1QWY A;  1TS2 A;  1SNC A;  4JVZ A;  3TP5 A;  4DV5 Q;  1FJG L;  1G91 A;  1RIP A;  2ZTC A;  4Z9C B;  1A3T A;  3G6J B;  3HKZ G;  4X64 Q;  4GOP B;  1LTL A;  2ID0 A;  5I9P A;  1AFP A;  2E2I B;  3OMC A;  5C5L A;  2EY1 A;  3NWS A;  2MP1 A;  4BBR H;  3PCO B;  2VQF Q;  1I3Q B;  1O7L A;  1OXS C;  3NUC A;  1LLR D;  3KK7 A;  1WTV A;  2QGQ A;  4IUU A;  2UU9 Q;  5J1Z A;  2HT1 A;  1OXX K;  3RMH A;  1D5Z C;  4M8A A;  4ZCK A;  1TWG H;  1XMQ Q;  2G9D A;  1BVS A;  1T9H A;  1ASZ A;  1IHZ A;  2WAC A;  4JOI C;  1BCP D;  2NN6 G;  3EN2 A;  4X66 L;  5C3E H;  1H9S B;  2PMZ E;  1F9P A;  4K2K A;  1BDO A;  5C44 H;  4RFB A;  1GXD C;  1XPO A;  2F0O A;  2XN9 C;  3T13 A;  2A68 C;  4WJW A;  4JV5 L;  3CHB D;  2MGS A;  3I90 A;  1JR0 D;  5D3D A;  4A3G H;  4DR4 Q;  2NTS A;  1JJG A;  1FL0 A;  3OHX C;  2IY5 B;  3SDZ A;  4BS9 A;  1B7Y B;  2MNA A;  1C8C A;  4JCV E;  3S17 H;  1GKH A;  2FMM A;  4ZLT F;  3GTG B;  1ILQ A;  2Y0S B;  1JWM D;  5J3B A;  1EIF A;  3S14 H;  1AE2 A;  3C3L A;  1VQF A;  4C3I G;  1IBK L;  1K0S A;  2NYZ D;  2K5D A;  1CQF A;  1RD9 D;  1YNJ C;  2A73 B;  3EFX D;  1XJV A;  5LMN L;  5FKA C;  1EQQ A;  4A3I B;  1XTD A;  4NB3 A;  4TSS A;  4GZY C;  2SNM A;  3SR1 A;  2NVT B;  3IKJ A;  2E5L Q;  4J1M A;  1I4H A;  1VQB A;  3CPW A;  1K3R A;  4Q5V A;  2CWA A;  1C7Y A;  2QDB A;  4C2M H;  1O7Y A;  2AQ3 B;  1QE6 A;  4OIK A;  4QB4 A;  4JI0 Q;  4QJF A;  3D6W A;  3UDX A;  2R7F A;  5DNF A;  3BYT B;  4CKE A;  4ZK9 B;  2KHS A;  4OWX B;  3RNU A;  5M5W H;  2IPK D;  4CJ1 B;  1QVC A;  4DR1 Q;  5EKL A;  1X3E A;  4MIU A;  2PO4 A;  3KDF B;  4X3K A;  2K5Q A;  3URY A;  1LTB D;  4JPB W;  4DR2 Q;  4DR7 L;  2FIN B;  2A5H A;  4OEM B;  1F2M A;  2B3G A;  4G7Z C;  1PRT F;  2N78 A;  3FPU B;  4RHR A;  2R3Z A;  3GTJ H;  3LNN A;  1A62 A;  4IFD H;  5M5X H;  1X9N A;  1KDC A;  4L5T A;  5C4X G;  1VQ4 A;  4C56 C;  1L0W A;  1E2V A;  1G6Z A;  1PH9 A;  3U50 C;  4QUC A;  2IL8 A;  2WP8 J;  3M4Y A;  2KCN A;  3S1M B;  2PNH A;  1VQG A;  3WOE A;  1MI2 A;  2E8G A;  1QOH A;  2KA7 A;  4GOP A;  4DR6 Q;  1FGU A;  1CM9 A;  2ZTE A;  2QDL A;  2EJG C;  3TS0 A;  2K01 A;  3FRP B;  4LW1 A;  1QCB D;  5I2X A;  1VQ7 A;  2E2I H;  3KFU A;  3R8B A;  3J81 i;  4DXG A;  2NZ1 D;  1FVI A;  3BYY B;  3J81 L;  1G6P A;  1I3Q H;  5FLM G;  4A3M H;  1Q1B A;  4QIW B;  1XMO Q;  4LFB L;  1Q12 A;  4TKO B;  1K83 B;  3VR2 A;  1PH4 A;  5IWA L;  4DNI A;  2WB1 B;  3EBE A;  1G51 A;  1YJN A;  3K5O A;  1FNU A;  4IUP A;  4BXX H;  3H91 A;  4LUO A;  4G7H C;  3DHQ A;  1OO9 B;  3E5S A;  1LAC A;  1LTT D;  3TME A;  1H9S A;  3DMU A;  3KF8 B;  3PF4 A;  4AYB B;  2MJ8 A;  5ELE A;  2ATW A;  4JYA L;  1EZ6 A;  2BA1 A;  4KK7 A;  1SXT A;  2QA4 A;  1KRS A;  5CV4 A;  1EY6 A;  1JT8 A;  4Y7N H;  4YIJ A;  3E6Z X;  3HS0 C;  3MXP A;  3N52 A;  5C0X J;  1GUN A;  3P7J A;  5M9O A;  4CGY B;  3J81 E;  3CCS A;  5FJ8 G;  5GAH C;  5KEE A;  1Y8N B;  5C4X B;  5E4W C;  1ML0 D;  1EY4 A;  4CHT B;  2Z4I A;  4DPG A;  4EVO A;  3MXN A;  3PO2 B;  1E7Z A;  1N34 Q;  4DAM A;  1HNX L;  3HOW G;  4LF6 Q;  2JXM B;  1ET6 A;  2AWN A;  3A55 A;  3OWF A;  1XWE A;  1BKB A;  1LTG D;  1IYU A;  2A69 C;  1RL2 A;  3K5N A;  1IXR A;  1WTR A;  5CBA E;  4GOP C;  5E7N A;  1Q8K A;  5I6Y A;  1B8A A;  2H5X A;  1E22 A;  1JE4 A;  3KLR A;  3HOY B;  4BA2 I;  4ILW A;  4DK6 C;  1HR0 W;  4BBS B;  2RVL A;  4H02 A;  5BN4 A;  1EOT A;  3K8A A;  3NTI A;  4OL7 A;  1G2S A;  4IAL A;  3S24 A;  4FDB A;  1SRU A;  3CU7 A;  1DXM A;  4FF4 A;  2D2C C;  2RCN A;  1SJH D;  3QOJ A;  5CV7 A;  4PMW A;  1STG A;  1KNA A;  1JOQ A;  3X3M A;  2UXD L;  3T16 A;  1SSO A;  4EX5 A;  1KC8 C;  4KJO A;  4CDE C;  2B2Y A;  2NN6 H;  2NUC A;  3NQT A;  2B39 A;  3PUW A;  3A54 A;  2ASB A;  2L4N A;  3L2P A;  3KDF A;  1EQV A;  2EXD A;  2B2W A;  2RHQ B;  2MFI A;  3OW7 A;  4CJ2 C;  2B63 G;  3NBI A;  2CH4 W;  3NBH B;  1STA A;  3P20 A;  4BY7 G;  4PZ7 A;  3V05 A;  5FLX L;  1LO5 D;  4DN4 M;  1PZK D;  4GKK Q;  1X65 A;  2DNE A;  4KJN A;  1VQL A;  3BS1 A;  1PMR A;  4K8J A;  5CC4 A;  1JJC B;  3TSS A;  4UP8 A;  2IJ0 A;  4TRD A;  1CFM A;  4JI8 Q;  5I6W A;  2ALY B;  4DUY L;  4YHH L;  2HCC A;  4PZ6 A;  4JBK A;  1A3V A;  2K5V A;  1I6H H;  5HGQ A;  1SMY C;  1Y1W G;  2PI2 E;  3RD4 A;  3T1Y Q;  1KDB A;  1CSQ A;  3H0G G;  3ICE A;  4HIM A;  5DLQ E;  4C3I H;  2BDO A;  1CZW A;  5FK9 C;  3KJP A;  2K6A A;  1YNX A;  2XNA C;  3BJU A;  1MSG A;  1E1O A;  1UUP A;  1N9W A;  3GD7 A;  5E3F A;  4A3C G;  4IJH A;  2JA8 B;  5FLX E;  2XRS D;  3BDL A;  1KLG D;  4P2C B;  2P5Z X;  4GKJ Q;  1BCP F;  4A3D G;  2KEN A;  2NVY B;  3S16 B;  2HHH L;  1TU2 B;  3CCE A;  1DOL A;  4LF5 L;  4A3B G;  1EYC A;  4JI3 Q;  4K5V A;  4G7O C;  3PQI A;  3GTO H;  1MKH A;  3J80 c;  3GTP B;  4RKB A;  4QCL A;  2K04 A;  3MFG A;  4IUT A;  4HN7 A;  4P72 A;  2R7Z G;  2H1E A;  5C3X A;  3H3V H;  1SMY D;  1V1Q A;  1HZB A;  3OW2 A;  2B63 B;  2YTY A;  2OT2 A;  3OPO A;  4BY7 B;  1CSP A;  1OXT A;  3S15 H;  2B2W C;  1SYC A;  3KJO A;  2Q2U A;  3S1Q H;  2ZM6 L;  2NWG A;  3P75 A;  5E4X A;  3F2D A;  1M4V A;  2A74 C;  3KLS X;  4APV A;  1D6E C;  3T53 B;  1Z9F A;  1W3S A;  3SVM A;  1Y8P B;  4DV0 L;  3Q23 A;  4X62 Q;  2I5L X;  5C4X H;  2YU9 B;  1SN8 A;  1V1P B;  1ICW A;  1KAW A;  2HDL A;  1K8M A;  1HR0 Q;  3H0G B;  1MJC A;  1QJO A;  4QMG A;  3A8J E;  3SK6 A;  1Q90 A;  4K8I A;  4DV6 Q;  1NCV A;  5KNC A;  2I07 B;  2VS1 A;  5JVG 3;  1OXU A;  2KEE A;  2EY2 A;  3A8K E;  1DOM A;  3K7A B;  4DV3 L;  4DFA A;  4LFC Q;  4XQQ A;  4IO9 A;  3HG9 A;  2HD3 A;  1PV4 A;  2LFN A;  5IIF A;  1J9O A;  4K6D A;  2PW7 A;  1N33 Q;  2Z4H A;  1S72 A;  1J5E L;  2XRQ D;  4U67 3;  5EPJ A;  4LAA A;  1AH9 A;  4NXM L;  4RHS A;  5KNB A;  2QEJ C;  1SNM A;  1Q7Y C;  1PYB A;  5CYU A;  2R7Z B;  1S5B D;  4O1N A;  2VW9 A;  1NMF A;  3T1H L;  1QZH A;  1IW7 C;  3D4D A;  5L37 A;  4LF8 Q;  1LT3 D;  3CCU A;  4DAP A;  3J81 j;  3HOZ B;  1ESF A;  3CAM A;  4UHV A;  1EY7 A;  1LAB A;  5EPL A;  2RDH A;  4BY1 G;  3MTS A;  2TSS A;  4IUR A;  1ONL A;  2F0S A;  3STB D;  3NBH A;  2BA0 A;  3KF6 B;  4R4I A;  4KY7 A;  4DR3 L;  1PH3 A;  2D0O A;  3S1R H;  3TEH B;  1YVC A;  3C1F A;  4LNQ A;  4IPG A;  5FJ8 H;  4LFA L;  5JPM C;  3DXJ C;  4IQZ A;  3D31 A;  1G2T A;  4PV1 C;  3I4O A;  3IFD A;  3HOU G;  4RA8 A;  2WFW A;  1RHP A;  1CHP D;  5JEA G;  2NVQ B;  2F4I A;  1AN8 A;  3HOW H;  1J6Q A;  2VQE Q;  1YI2 A;  5JAV A;  2ZXP A;  4O0A A;  1CKM A;  1FNW A;  1D5M C;  3QOL A;  4KN7 C;  4EQP A;  4XQJ A;  3P1H A;  5A2Q L;  5ELF A;  3VDY A;  3R2I A;  2ZJQ A;  2L12 A;  3V2T A;  5C0X I;  4K0K L;  3BVG A;  1HJP A;  5C3E B;  1SAP A;  1K8O A;  2DNC A;  5JJL A;  5G3L D;  1LUZ A;  3H6M A;  2WAQ E;  5C44 B;  1VQN A;  2JA7 G;  1EIG A;  2L9H A;  2CHB D;  2JA5 G;  1VQ5 A;  2MO1 A;  3TBI B;  2NVY H;  5IP9 G;  3S16 H;  3PV0 A;  2QIL A;  2WIN B;  3M4O B;  2RCF A;  4B3T L;  4XDX A;  1FYC A;  2K5W A;  4GS3 A;  1PTO B;  4A3G B;  4K2L A;  2NVX B;  1TWH B;  4I65 A;  3R93 A;  5EKI A;  3KBX A;  3U4V A;  3S17 B;  2Q8I B;  3T56 B;  4DR5 Q;  2XIW A;  5C4J B;  1YHQ A;  4GNX B;  4BY1 B;  4KHP L;  4RCO A;  3NEL A;  2B8G A;  1B4O A;  5FOB B;  1PYW D;  3S14 B;  3S2H H;  5A2Q E;  2B63 H;  1MGS A;  3MEH A;  1HA6 A;  4I7Z C;  2UUC L;  4BY7 H;  1HXY D;  4PG3 A;  5C6A A;  4YY3 Q;  3HOV G;  3PUZ A;  2CW0 D;  1D1I A;  1QNU A;  3M7G A;  3CC2 A;  4OX9 Q;  2C9O A;  3DWP A;  2EOT A;  2L11 A;  3FP9 A;  3RN5 A;  3RN2 A;  2AQ2 B;  2PZT A;  1BBX C;  4LMQ D;  1K9M C;  4ZYS A;  4H0L C;  3HOX G;  1AZP A;  1V1P A;  1YBY A;  2YU9 H;  2OEO A;  3AB9 A;  1Y1W H;  3K5L A;  1F2Z A;  3EQL C;  1UAP A;  5LL6 X;  2UUA Q;  2Z6K C;  4A93 G;  3H0G H;  2ZXO A;  5C3W A;  5CMD A;  2M00 A;  1DOK A;  3CW2 C;  2VNU D;  4JOI A;  1BOS A;  1WJJ A;  3NPP A;  1GUW A;  4A3C H;  2JA7 B;  2I0Q A;  3NSW A;  4KI0 A;  4JI2 L;  4JI5 Q;  3J7Z C;  2JA5 B;  1S5D D;  4A3D H;  5IYC G;  1I94 Q;  3MHB A;  4FNF A;  3Q22 A;  2K1B A;  5EAY A;  1C0A A;  1G29 1;  4YWK A;  2NB0 A;  1PH8 A;  4AQY Q;  1PDQ A;  3GTJ B;  4DA2 A;  4CDD C;  4J6H A;  4A3B H;  1V1O A;  2DUD A;  5IGF A;  2EYL A;  3GTQ B;  2EPB A;  5M5X B;  4IUN A;  1GUG A;  1TWF B;  3CKI B;  3H09 A;  4F88 A;  3NEN A;  1V8Q A;  1W6K A;  1IBL Q;  1IBK Q;  2R7Z H;  1L0Y B;  1GJX A;  4B3R Q;  1K3B C;  4GLX A;  3FPP A;  1WOC A;  4X6A H;  4PNY A;  1FGB D;  3HRZ C;  3U9S A;  4YCU A;  1NTG A;  1S4Z A;  2CWP A;  3EIV A;  5D14 A;  4POF A;  2L15 A;  3NEM A;  3KF6 A;  1UNS A;  4OGQ C;  2F0M A;  1X56 A;  4NXN Q;  1PFB A;  3WDN A;  2BH8 A;  1EQT A;  1F9S A;  2I46 A;  4ZKC B;  2F0F A;  2Q2T A;  4ALP A;  4A3M B;  3BDO A;  1GHJ A;  4FVM A;  2F4V L;  1D1K A;  2NVQ H;  2K52 A;  2Z6B A;  2DJF C;  2R92 G;  2DGY A;  3ULJ A;  1CK1 A;  1VS0 A;  4FXK C;  1XNR L;  2IHE A;  2F52 A;  1WTO A;  4HID A;  3MXG A;  2KCM A;  2KOL A;  3SK8 A;  2KUM A;  2E76 C;  4DAV A;  3VR4 A;  3CCV A;  4OXP A;  5IGC A;  4JI1 Q;  3CCQ A;  2EY5 A;  2AQ1 B;  5AJ3 L;  3A5U A;  1GM5 A;  1A0I A;  4Y7N B;  2Q8R E;  3K59 A;  3TP6 A;  1EIH A;  1TKW B;  3VA5 A;  1VDZ A;  1SE3 A;  1TY0 A;  2MO0 A;  3SEB A;  3D4R A;  1SFO B;  1CA6 A;  1M1K C;  4HJA A;  3M4O H;  1DON A;  5KND A;  3RZD H;  1PTO H;  5FO7 B;  2NVX H;  4OO1 I;  1TWH H;  5E1F A;  4XTC S;  3KBG A;  4GNX A;  5HUR A;  4Q0F A;  1Q81 C;  3AEV A;  1EU4 A;  5C4J H;  2E74 C;  4YCW A;  4BY1 H;  1QUQ B;  2GVA A;  3HKZ B;  3CCR A;  4B3M L;  4X3T A;  1JB7 A;  1HCZ A;  3S1N H;  3PO3 G;  1SYD A;  1K73 C;  1OXV A;  4RAU C;  3VR3 A;  3L3O C;  4UDU C;  4BA1 I;  3MA2 B;  1B9M A;  1LV9 A;  3FEW X;  3SE0 A;  1Q1E A;  4B9X A;  3VYR A;  1PFN A;  2HIX A;  2OXP A;  3HOU H;  3H94 A;  1CT1 D;  2R93 G;  5JEA H;  2A68 D;  4PZ8 A;  4A3J G;  4B3S L;  1PFM A;  2R92 B;  3G48 A;  1RTN A;  4G57 A;  4L8J A;  3K0Y A;  2PW5 A;  3MZ5 A;  1LM0 A;  1IZ6 A;  3I91 A;  2F0D A;  3ULL A;  1DM0 B;  5IY0 A;  2OQK A;  5KIX A;  2ZTD A;  2HDM A;  3RLF A;  1VMP A;  4DV5 L;  3QB3 A;  3I7F A;  1EY8 A;  1RCV D;  2JA7 H;  5JJK A;  3CPF A;  1HFN A;  2OTL A;  2K05 A;  2JA5 H;  2NZO A;  4X64 L;  1HFG A;  2JP1 A;  5IP9 H;  1YNJ D;  1S5C D;  3PMF A;  2NZH A;  4PMC A;  4S3S A;  1PTO C;  3GTQ H;  3ULP A;  1TWF H;  2VQF L;  3E0J A;  5J39 A;  5CV5 A;  1KQS A;  3QR8 A;  2UU9 L;  2Q2H A;  1I6H B;  1VQD A;  1VQP A;  1Z6H A;  2K33 A;  4GNX C;  3JAM i;  5T1G A;  3JAM L;  1E3P A;  1EY9 A;  1A63 A;  2J7Z A;  4C3I B;  3PO3 B;  4C1N K;  5GAG C;  5J22 A;  1WYD A;  3HOV H;  1BR9 A;  3TS2 A;  2F3I A;  3IL8 A;  3GTL B;  1EWH A;  5C0X G;  4WOR A;  4N8X 1;  1UEB A;  2R93 B;  2PZU A;  4WJ4 A;  3I2Z A;  4A3J B;  2HQE A;  3HOX H;  3D0F A;  1ET9 A;  1GUS A;  5G3L F;  4ME5 A;  1PRT B;  4RCN A;  1U4L A;  5IT9 c;  3D4W A;  4JBW A;  1GVP A;  3GTO B;  4A93 H;  1KAA A;  3M3Y B;  1XNQ Q;  4DR4 L;  2YTV A;  1E2Z A;  3FKI G;  1LT5 D;  4DV2 L;  2F0U A;  4MTK A;  5CV9 A;  5GAD C;  2UXB Q;  1HRJ A;  4NKL A;  4LF4 Q;  1UE6 A;  3JAM E;  5DAU A;  2VZA A;  1VQC A;  5IGD A;  5KYL A;  1I4G A;  3G7L A;  1X32 A;  5IYC H;  3S15 B;  2ENB A;  1R4P B;  2D5D A;  3L7Z C;  3S1Q B;  1Z7T A;  1FD7 D;  3GQB A;  1IL2 A;  2PYK A;  3VA7 A;  3OTO Q;  4HIO A;  3KUP A;  2PCF B;  1SFO H;  5IE8 A;  3TDQ A;  1I4R A;  2BE5 C;  3BZD B;  1I4Q A;  1EYG A;  2E5L L;  1BUV T;  2VUM G;  1YHA A;  2KEC A;  5M3M G;  1PH1 A;  2ZT9 C;  2KBN A;  5LMU Q;  1VQE A;  2EE1 A;  5CGK A;  1ZYR C;  3EVQ A;  3CCJ A;  3AMU A;  1YZ6 A;  3I3C A;  2Y0S E;  4JI4 Q;  1HQR D;  4K14 A;  4JI0 L;  4CBV A;  1LT6 D;  2RHS B;  2Z8L A;  4IOC A;  4LUV A;  4OHJ A;  2F0P A;  4DR1 L;  1TII D;  4H7B A;  1CA5 A;  1T5E A;  4DR2 L;  1FNV A;  1MD2 D;  1ILP A;  4RKL A;  4L5S A;  1D5X C;  3GTM H;  1STE A;  3MEF A;  1P16 A;  1BNZ A;  2SDF A;  5I9O A;  3A8I E;  5GRO A;  2R92 H;  4DV4 Q;  4CDF C;  1HA5 A;  3A74 A;  1WVL A;  1KNE A;  2UXC Q;  2FXQ A;  2JSO A;  3M4P A;  2WAQ G;  1ZYR D;  4RWS C;  4DV0 Q;  3W2D A;  4DKA C;  1SRO A;  2FMC A;  2FHT A;  2A69 D;  1O7Z A;  3S1R B;  1GHK A;  4DR6 L;  1HNW Q;  1R9T H;  1UE7 A;  3ER0 A;  3CRK C;  1E0B A;  1MIU A;  1A2U A;  1ENF A;  2VUM B;  5LL6 S;  3ZYY X;  1U4R A;  2LS0 1;  4HJ7 A;  1WCM G;  1Q8I A;  3HOW B;  1XMO L;  1F2L A;  3O13 A;  1HNZ Q;  1WTQ A;  2SEB D;  1EYD A;  1NR2 A;  3GV3 A;  1QB5 D;  1W6J A;  3PO3 H;  5ELC A;  5IP7 G;  3U58 A;  4R1J A;  4WRD A;  5D3I B;  1ZXT A;  5F2D A;  4DV1 Q;  3DLL A;  1N36 Q;  1M90 C;  3GTL H;  4RMF A;  1PVO A;  1YJ9 A;  4QGU A;  1BXT A;  2R93 H;  1RJT A;  4A3J H;  3NK9 A;  4R8N A;  3PIO 3;  4C1N I;  5IT9 L;  2HQL A;  3CC7 A;  3CMA A;  3ERQ A;  4R4T A;  1JOR A;  1MHW C;  4LF9 Q;  3M3Y H;  3I8Z A;  1WTX A;  4OO1 G;  3VR6 A;  2KHJ A;  1N34 L;  1N32 Q;  2N8N A;  1VMC A;  2WB1 E;  2X6G A;  2CQA A;  3L0O A;  3UDG A;  3S2H B;  4LF6 L;  3KLW A;  1HTP A;  3KF8 A;  3UE0 A;  4OWW B;  3EJI A;  4X65 Q;  1L1O B;  4KKT A;  2D62 A;  2XVS A;  4AYB E;  4C3J G;  4DUZ Q;  2XTI A;  1B44 D;  1NAP A;  4LF7 Q;  2AKW B;  2QF7 A;  3X3N A;  3KLS A;  1KLU D;  1WCM B;  1XTC D;  4HED A;  5CV8 A;  4L6T B;  1QIL A;  1BCP B;  1LTA D;  3ONA B;  5I4D A;  1KTK A;  5IT9 E;  2A6E C;  1Y1W B;  3FHW A;  5JVH 3;  1RDP D;  1TWA H;  4WJ3 M;  4A3F G;  4LUZ A;  4O42 A;  3F2U A;  1F2Y A;  2JN4 A;  3F1Z A;  4B3T Q;  5JJI A;  4OWT B;  3CD6 A;  5ELD A;  4QUF A;  1EL0 A;  4A3L G;  5C0X H;  4JI7 Q;  3HP3 A;  2ICE C;  4A3D B;  1DD2 A;  4KV6 A;  3K5M A;  3U9O A;  1X54 A;  2SNS A;  3NTK A;  1SYF A;  3HZX A;  2F0W A;  5KRU A;  2UUB Q;  5DM6 3;  4J15 A;  4NDX A;  4A3B B;  3I4N G;  4GKK L;  5FLM H;  1JCK B;  1U4P A;  4E6I A;  1PRT C;  2OWO A;  3LWE A;  1K8A C;  3FKI H;  3Q6S A;  2A1A A;  2F0H A;  3GP7 A;  4JI8 L;  4ID6 A;  2PQA B;  3FDT A;  1VQ8 A;  1A2T A;  3H3V C;  1C48 A;  2DJG C;  4MHE A;  5HGT A;  3T1Y L;  1WD1 A;  4N9T A;  3GO5 A;  3BVZ A;  1NMG A;  2F3V A;  4JI6 Q;  4FF2 A;  5BR8 Q;  1VQJ A;  4A3E G;  3NHH A;  5T1I A;  1VQM A;  1HPC A;  1GD7 A;  2QEX A;  1AW7 A;  4MZ9 A;  2PZW A;  2EXZ A;  3FVQ A;  1IBM Q;  2B2U C;  4ZUI A;  4GKJ L;  4R4C A;  5LMN W;  2L1B A;  2VUM H;  1Y1V G;  5M3M H;  3FMC A;  2N3S A;  5EKK A;  1PRT D;  2JE6 I;  2EJF C;  4A3F B;  5D65 A;  4KLK A;  4JI3 L;  4HCS A;  2Z6K A;  5COY A;  4JBM A;  1HQM C;  3RLN A;  1EOV A;  3OMG A;  1GOZ A;  1IW7 D;  4FF1 A;  3BDC A;  1EUJ A;  4NP5 A;  3A7L A;  4IPH A;  4TQU S;  4V19 0;  3I55 A;  3NP8 A;  3ERS X;  3K7U C;  5KGU A;  1H9R A;  2HIV A;  1V9P A;  1AP0 A;  3RR5 A;  4JC0 A;  1LTR D;  4B08 A;  2JA6 G;  1PYS B;  3CQZ H;  4QQB X;  3I4N B;  5JJZ A;  1P8L A;  1PH2 A;  1EU3 A;  4PMB A;  5FO8 B;  1O7I A;  3J7Y W;  2K50 A;  4HMJ A;  4TVA B;  3RLO A;  4F7X A;  1D7Q A;  3I4M G;  1FJG Q;  3RZD B;  2CFM A;  3PUV A;  1SNQ A;  1NSN S;  1JWU D;  1CZG A;  4R4Q A;  4CJ0 B;  4N9P A;  1JQY D;  2OF1 A;  2V4D A;  2PMZ B;  2YYZ A;  3J80 i;  3G4S A;  2K14 A;  3NXW A;  3J80 L;  1HR0 L;  3AQQ A;  4V0B A;  2KCT A;  4A3E B;  1WFQ A;  1EY0 A;  4DV6 L;  2Z9H A;  4KD3 A;  1I5F A;  1HH2 P;  1L1O A;  3OSO A;  4HAE A;  1O78 A;  2IHF A;  3S1N B;  1SE2 A;  2RDG A;  4LFC L;  1XPU A;  5EBD A;  2IX0 A;  2PPB C;  1E24 A;  1Y1V B;  1UWV A;  3HOU B;  2OQ0 A;  5JEA J;  1WCM H;  5EQ0 A;  1EIY B;  4KY6 A;  3K0X A;  1XPR A;  4X66 Q;  2A6H C;  1TQO A;  2AUJ D;  4HCE A;  1DCZ A;  5C4H A;  2WV6 D;  4HIK A;  4R8I A;  1JJ2 A;  3UDF A;  2F0I A;  3HGB A;  3J80 E;  2F0V A;  4DV7 L;  4LF8 L;  5IP7 H;  1D8L A;  4JV5 Q;  3IAY A;  3QJY A;  2I5M X;  2O5I C;  5IYD G;  1I50 B;  4MTN A;  5JPN C;  2Q2I A;  1Q46 A;  1F9Q A;  4HJ9 A;  1EYA A;  1XX8 A;  1TXY A;  4UAI A;  2EYM A;  1PZJ D;  2Z0S A;  3K58 A;  3A0J A;  1M8A A;  4IFD J;  2EY6 A;  2OCE A;  2DN8 A;  1B53 A;  2O4X A;  2R6G A;  2KCC A;  2QW7 A;  2CH4 A;  3DM3 A;  4OO1 H;  2PQA A;  4QF4 A;  5IGG A;  3T51 B;  3D6C A;  5LMN Q;  2K28 A;  1ESR A;  2VQE L;  3DUZ A;  1BBU A;  4A4I A;  5H1S E;  3I72 A;  1SE4 A;  3HOV B;  2NBF A;  1L1O C;  1STY A;  2E2H H;  4C3J H;  3F2B A;  1Z47 A;  5DEH A;  2RBM A; 
#chains in the Genus database with same CATH homology
 4O2D A;  1X65 A;  4GNX C;  3JAM i;  1VQL A;  4JI2 Q;  2KHI A;  1A63 A;  1E3P A;  1B70 B;  1JJC B;  1DGS A;  4UP8 A;  3CC4 A;  4JI8 Q;  5GAG C;  4DUY L;  2ALY B;  4YHH L;  4PZ6 A;  1WYD A;  4JBK A;  4LF9 L;  3HOV H;  1CUK A;  5HY6 A;  2AWO A;  2K5V A;  2JA9 A;  3E0E A;  4LWC A;  3TS2 A;  2F3I A;  3AFP A;  1VQ6 A;  1N32 L;  3CF5 A;  5HGQ A;  1I6H H;  2Y0S G;  5C0X G;  2IT1 A;  3CME A;  1PHJ A;  1Y1W G;  2PI2 E;  3T1Y Q;  1YIJ A;  4A3F H;  1UEB A;  1CSQ A;  3H0G G;  3ICE A;  4DR7 Q;  4X65 L;  4HIM A;  5DLQ E;  3PGZ A;  4C3I H;  4WJ4 A;  3I2Z A;  2GVB A;  3KJP A;  3HOX H;  2I5H A;  3D0F A;  1YNX A;  3BJU A;  4DR5 L;  2EIF A;  3S2D H;  4DUZ L;  5IT9 c;  4A3L H;  1E1O A;  1VQA A;  4YCV A;  4LF7 L;  1N9W A;  3GD7 A;  4JBW A;  3W1G A;  4IJH A;  1GVP A;  4OON A;  3J81 c;  4A3C G;  4A93 H;  4A3I G;  1XNQ Q;  4DR4 L;  2YTV A;  4GKJ Q;  3FKI G;  4A3D G;  2KEN A;  4JG2 A;  4YWL A;  4DV2 L;  5GAD C;  2UXB Q;  3A5Z B;  2HHH L;  4YY3 L;  5M5Y H;  4LF4 Q;  1NY4 A;  1UE6 A;  4R4O A;  4X62 L;  1QZG A;  1W2B A;  3I4N H;  3CCE A;  1Q82 C;  4OX9 L;  1S3O A;  2VZA A;  1VQC A;  4LF5 L;  4A3B G;  4JI3 Q;  3GTO H;  2JA8 H;  1MKH A;  5IYC H;  3J80 c;  1SE8 A;  3L7Z C;  4P72 A;  2R7Z G;  5ELN A;  1IL2 A;  1CKO A;  3H3V H;  5IYB H;  2F4V Q;  1V1Q A;  1HZB A;  3OW2 A;  3PUX A;  2YTY A;  3OTO Q;  4JI7 L;  4UP7 A;  2V1C C;  4HIO A;  2UUA L;  4IFD G;  1ASY A;  2K4K A;  1SFO H;  2AMC B;  1CSP A;  1OXT A;  3S15 H;  1AE3 A;  5IE8 A;  4A3E H;  3GTP H;  3AFQ A;  1V43 A;  2E5L L;  1Y14 B;  1VQI A;  4P75 A;  3KJO A;  1KD1 C;  1EYG A;  2Q2U A;  3S1Q H;  2ZM6 L;  2VUM G;  1YHA A;  1N33 L;  5M3M G;  1PH1 A;  1XNR Q;  2UUB L;  1X6O A;  2KBN A;  3F2D A;  4NPS A;  1VQE A;  4APV A;  5LMU Q;  4LFB Q;  4GKK Q;  3JC6 6;  5K36 G;  1Z9F A;  4GN3 B;  1W3S A;  1JE5 A;  4JI5 L;  3CCJ A;  2AHO B;  1YZ6 A;  4UP9 A;  4IJL A;  2Y0S E;  3Q8D A;  2D0P A;  4DV0 L;  4DV2 Q;  1YHB A;  5IWA Q;  1I94 L;  4JI4 Q;  5AJ3 Q;  3MXN B;  1CKN A;  1PFS A;  2I5L X;  5C4X H;  4X62 Q;  1Y1V H;  1U0L A;  2XGT A;  3UDI A;  4JI0 L;  1SN8 A;  3J7A 5;  3H15 A;  2RHS B;  1KAW A;  1PH7 A;  4AQY L;  3PIO A;  1HR0 Q;  4IOC A;  3PUY A;  2JQO A;  4LUV A;  1HZC A;  1MJC A;  1PA6 A;  4DR1 L;  4DV6 Q;  1NBW A;  1IBL L;  3M7N A;  4JI6 L;  4JYA Q;  4DR2 L;  5BR8 L;  2VS1 A;  4A3K G;  1OXU A;  3U4Z A;  4B3R L;  4L5S A;  1L2F A;  2K75 A;  3GTM H;  4DV3 L;  5M3F G;  1VQO A;  3OYY A;  4LFC Q;  3MEF A;  1NE3 A;  1P16 A;  3E9I A;  3WWV A;  4A3M G;  4IO9 A;  4GLV B;  1IBM L;  3HKS A;  5GRO A;  1PV4 A;  3TRZ A;  2R92 H;  4DV4 Q;  1I50 H;  4B3M Q;  2JA6 H;  1X3F A;  4AIM A;  3A74 A;  1N33 Q;  1S72 A;  1J5E L;  2CQO A;  3W1B A;  2UXC Q;  2FXQ A;  3M4P A;  4BXX G;  2VY3 A;  3K7A H;  3G71 A;  1AH9 A;  2WAQ G;  4NXM L;  1SR3 A;  1HNX Q;  4NXN L;  1QVF A;  1VCI A;  1Q7Y C;  3I4M H;  1PYB A;  4DV0 Q;  4MNO A;  4DKA C;  2VW9 A;  1NMF A;  1Q86 C;  3T1H L;  3M4Q A;  1QZH A;  1N8R C;  1SRO A;  4IPD A;  4A75 A;  4LF8 Q;  3CCU A;  1UE5 A;  4A76 A;  3ZJY C;  2WB1 G;  3J81 j;  4DR6 L;  5GAE C;  3CAM A;  3W5O A;  2K5N A;  4B3S Q;  2ES2 A;  1HNW Q;  1R9T H;  2N49 A;  5FLX c;  1UE7 A;  3ER0 A;  4QY7 A;  4BY1 G;  1MIU A;  2B29 A;  4IPC A;  1BBW A;  4AYB G;  3STB D;  1XMQ L;  2BA0 A;  3KF6 B;  4R4I A;  4DR3 L;  1EFW A;  4HJ7 A;  1PH3 A;  3JAM c;  1VQ9 A;  2D0O A;  2A8V A;  2JJQ A;  3S1R H;  3TEH B;  1WCM G;  3HOZ H;  3BZK A;  4POG A;  1YVC A;  3CCM A;  1XMO L;  3GTK H;  4LNQ A;  4IPG A;  4DV5 Q;  5FJ8 H;  4LFA L;  1HNZ Q;  1FJG L;  1RIP A;  3RZO H;  2ZTC A;  3D31 A;  4JI1 L;  3HFZ B;  2UXD Q;  2LSS A;  3I4O A;  1HZ9 A;  3HKZ G;  3KYH C;  4X64 Q;  4GOP B;  3HOU G;  3PO3 H;  2WFW A;  1E1T A;  5IP7 G;  3U58 A;  5JEA G;  4R1J A;  3TQY A;  1LTL A;  3PO2 G;  2ID0 A;  1NJI C;  3HOW H;  1J6Q A;  2VQE Q;  1YI2 A;  4DV1 Q;  3DLL A;  1N36 Q;  1M90 C;  4HJ5 A;  4O0A A;  4BBR H;  1X55 A;  3GTL H;  1CKM A;  3PCO B;  4RMF A;  1PVO A;  1YJ9 A;  3IRB A;  4YWM A;  2VQF Q;  1OXS C;  4QGU A;  2YTX A;  2R93 H;  2ZJQ A;  3VDY A;  3E9H A;  2QGQ A;  4A3J H;  2UU9 Q;  5C0X I;  4K0K L;  1HJP A;  4ME3 A;  2HT1 A;  5IYD H;  1KXL A;  1OXX K;  2BH2 A;  2A19 A;  5JJL A;  3HOY G;  1LUZ A;  1TWG H;  2WAQ E;  1XMQ Q;  2HQL A;  3CC7 A;  3CMA A;  1VQN A;  2JA7 G;  3G6E A;  4R4T A;  1BVS A;  4BBS G;  1T9H A;  4DUY Q;  1ASZ A;  3M3Y H;  4YHH Q;  4LF9 Q;  2JA5 G;  1VQ5 A;  2MO1 A;  4JOI C;  2NVY H;  4OO1 G;  5IP9 G;  3S16 H;  2KHJ A;  3PV0 A;  1N34 L;  1N32 Q;  2NN6 G;  2N8N A;  2YV5 A;  3EN2 A;  4X66 L;  2JK8 A;  2WB1 E;  5C3E H;  1YEZ A;  2PMZ E;  2LXK A;  3L0O A;  4GS3 A;  3UDG A;  4LF6 L;  3KLW A;  2OTJ A;  3UE0 A;  4OWW B;  4IOA A;  4X65 Q;  1L1O B;  5C44 H;  3U4V A;  4XIG S;  2D62 A;  1XPO A;  4DR5 Q;  4AYB E;  3CXC A;  1YHQ A;  4GNX B;  4JV5 L;  4DUZ Q;  4KHP L;  2XTI A;  4LF7 Q;  2R7D A;  2AKW B;  3NEL A;  3S2H H;  4A3G H;  4DR4 Q;  3PF5 A;  2B63 H;  2RF4 A;  1FL0 A;  1C9O A;  1JJG A;  1QUQ A;  2IY5 B;  2UUC L;  4BY7 H;  4EQ5 A;  1B7Y B;  4PG3 A;  2MNA A;  2HHH Q;  4JCV E;  4YY3 Q;  1GKH A;  3HOV G;  3S17 H;  3PUZ A;  3CC2 A;  3HKZ E;  4OX9 Q;  4IFD I;  3FHW A;  4LF5 Q;  5J3B A;  1EIF A;  1TWA H;  4KHZ A;  1OTC A;  3S14 H;  1AE2 A;  3FP9 A;  3RN5 A;  4A3F G;  4WJ3 M;  3RN2 A;  1VQF A;  4LUZ A;  1K9M C;  1K0R A;  1IBK L;  3HOX G;  1VQH A;  3F1Z A;  4B3T Q;  1YBY A;  3GTG H;  5JJI A;  4OWT B;  2YU9 H;  3CD6 A;  3PIP A;  4A3L G;  1XJV A;  5LMN L;  1EQQ A;  4JI7 Q;  1Y1W H;  2UUA Q;  1WI5 A;  1XTD A;  4NB3 A;  2Z6K C;  4A93 G;  3H0G H;  4QL5 A;  1X54 A;  1EQR A;  3CW2 C;  2E5L Q;  4B3T L;  1H95 A;  2ZM6 Q;  2VNU D;  1VQB A;  4JOI A;  3CPW A;  3AYH B;  2UUB Q;  1K3R A;  4J15 A;  1KIX A;  2EQS A;  3I4N G;  2CWA A;  1WJJ A;  5FLM H;  4GKK L;  1IYJ B;  4A3C H;  2I0Q A;  2OWO A;  4KI0 A;  4A3I H;  1C7Y A;  4JI2 L;  1PH6 A;  4JI5 Q;  3J7Z C;  1K8A C;  4C2M H;  3FKI H;  2JA8 G;  4A3D H;  5IYC G;  2A1A A;  1I94 Q;  3K81 C;  2NVT H;  4JI8 L;  4JI0 Q;  4QJF A;  5EAY A;  1C0A A;  3UDX A;  1G29 1;  4YWK A;  2PQA B;  2R7F A;  4AQY Q;  1PH8 A;  1VQ8 A;  2LXJ A;  4OWX B;  3RNU A;  5IYB G;  5M5W H;  4A3B H;  2CCZ A;  2DUD A;  3M9B A;  1QVC A;  4DR1 Q;  1X3G A;  1X3E A;  3T1Y L;  3KDF B;  3GO5 A;  3NEN A;  1NMG A;  1IBL Q;  4JI6 Q;  4DR2 Q;  5BR8 Q;  4DR7 L;  1VQJ A;  1IBK Q;  1YIT A;  2R7Z H;  4A3E G;  3CP0 A;  2B3G A;  2VL6 A;  1VQM A;  1K8G A;  4B3R Q;  4GLX A;  2N78 A;  2QEX A;  1GD7 A;  4DV3 Q;  1WOC A;  4MZ9 A;  4X6A H;  3GTJ H;  1A62 A;  2ZJR A;  1EWI A;  4YCU A;  1IBM Q;  1NTG A;  2CWP A;  5M5X H;  3EIV A;  1X9N A;  1XNQ L;  4GKJ L;  4R4C A;  4POF A;  5LMN W;  1YJW A;  4L5T A;  2L15 A;  3NEM A;  3KF6 A;  2UXB L;  1J5E Q;  2VUM H;  1Y1V G;  3PSI A;  5M3M H;  1VQ4 A;  4LF4 L;  2N3S A;  5C4X G;  1L0W A;  1X56 A;  4NXM Q;  1QVG A;  1PH9 A;  2JE6 I;  3U50 C;  4NXN Q;  2WP8 J;  4KLK A;  4JI3 L;  2Z6K A;  2C35 B;  2BH8 A;  4JBM A;  2PNH A;  3RLN A;  1EOV A;  1LYL A;  1VQG A;  3T1H Q;  2E8G A;  3TRE A;  4GN4 B;  1EUJ A;  4GOP A;  2PI2 A;  2Q2T A;  1FGU A;  2MQH A;  4IPH A;  1KHI A;  4TQU S;  4ALP A;  4DR6 Q;  3I55 A;  2ZTE A;  3I56 A;  3ERS X;  3K7U C;  3TS0 A;  2F4V L;  2NVQ H;  2K52 A;  3OTO L;  2HIV A;  1V9P A;  4LW1 A;  3SGI A;  2E2J H;  3RR5 A;  1VQ7 A;  4JC0 A;  2E2I H;  2R92 G;  4GLA C;  2DGY A;  3ULJ A;  3KFU A;  3J81 i;  4A3K H;  3S1M H;  2JA6 G;  1FVI A;  1PYS B;  1G6P A;  1U5K A;  3CQZ H;  4DR3 Q;  4QIW E;  4QQB X;  1VS0 A;  1I3Q H;  1P8L A;  2IHE A;  3F8T A;  2F52 A;  5M3F H;  1PH2 A;  1O7I A;  5FLM G;  1XNR L;  4A3M H;  1Q1B A;  4HID A;  5LMU L;  2K50 A;  1XMO Q;  4LFB L;  1Q12 A;  4TVA B;  3B6Y A;  3RLO A;  4LFA Q;  1D7Q A;  2KCM A;  1PH4 A;  1FJG Q;  3I4M G;  2CFM A;  3PUV A;  4R4Q A;  4OXP A;  3CCV A;  4JI4 L;  4JI1 Q;  3CCQ A;  5IWA L;  4DNI A;  5AJ3 L;  4DK3 C;  3A5U A;  1GM5 A;  1JMC A;  3EBE A;  1G51 A;  1YJN A;  1A0I A;  2YYZ A;  3J80 i;  3G4S A;  2K14 A;  4BXX H;  4LUO A;  1HR0 L;  2MO0 A;  4RG1 A;  3AQQ A;  3PF4 A;  3UE1 A;  3KF8 B;  4L5Q A;  4HJA A;  2KCT A;  1M1K C;  2JEA I;  1WFQ A;  1K83 H;  4L5R C;  3M4O H;  4DV6 L;  3RZD H;  2ATW A;  4JYA L;  1I5F A;  1L1O A;  1HH2 P;  2BA1 A;  2NVX H;  4OO1 I;  2QA4 A;  2IHF A;  1TWH H;  3K80 C;  1KRS A;  2NN6 I;  1JT8 A;  4XTC S;  1KRT A;  4Y7N H;  4Y52 H;  4GNX A;  3HOZ G;  4LFC L;  4K0K Q;  4P73 A;  1SLJ A;  5C0X J;  1Q81 C;  1TWC H;  1XPU A;  3AEV A;  1VQD A;  5C4J H;  4BY1 H;  4YCW A;  3CCS A;  5FJ8 G;  2GN5 A;  5GAH C;  2IX0 A;  1QUQ B;  2GVA A;  3GDE A;  1E24 A;  4DV4 L;  1S40 A;  3LGJ A;  4B3M L;  3CCR A;  1UWV A;  4AH6 A;  1CKN B;  1JB7 A;  4DPG A;  2OQ0 A;  5JEA J;  3F2C A;  3BU2 A;  4C3H H;  3S1N H;  1WCM H;  3PO3 G;  1E7Z A;  1EIY B;  1N34 Q;  3K0X A;  2UXC L;  4DAM A;  1A8V A;  1K73 C;  1OXV A;  1XPR A;  1HZA A;  4X66 Q;  1HNX L;  3HOW G;  4LF6 Q;  3KOJ A;  4HIK A;  4BA1 I;  1UE1 A;  2AWN A;  4BBR G;  3UDF A;  1JJ2 A;  1Q1E A;  2HIX A;  1BKB A;  4DV7 L;  4LF8 L;  2CKZ B;  3HOU H;  1RL2 A;  1IXR A;  5IP7 H;  2R93 G;  1D8L A;  4PZ8 A;  4GOP C;  4A3J G;  1GO3 E;  5E7N A;  1Q8K A;  1PH5 A;  4B3S L;  3PO2 H;  2I5M X;  4JV5 Q;  1B8A A;  2H5X A;  4KHP Q;  1E22 A;  5IYD G;  1HNW L;  4MTN A;  3G48 A;  4BA2 I;  2K5H A;  1SMX A;  4DK6 C;  2Q2I A;  1HR0 W;  1Q46 A;  3STB C;  4H02 A;  4DAY B;  4HJ9 A;  4P74 A;  1MJE A;  1LM0 A;  3K8A A;  2UUC Q;  1IZ6 A;  1TXY A;  4JBJ A;  4UPA A;  3ULL A;  3S24 A;  5IY0 A;  4FDB A;  1SRU A;  2OQK A;  4HJ8 A;  2Z0S A;  2ZTD A;  2JEB I;  4P71 A;  3RLF A;  2RCN A;  3A0J A;  5C3E G;  4DV5 L;  3I7F A;  1KL9 A;  2OCE A;  4UY8 C;  1HNZ L;  3CCL A;  3HOY H;  4IFD J;  2R6G A;  2JA7 H;  5JJK A;  3CPF A;  4PMW A;  4BBS H;  3M85 A;  2OTL A;  3DM3 A;  5C44 G;  1VQK A;  5GQO A;  2UXD L;  2JA5 H;  2NZO A;  4EX5 A;  4X64 L;  1KC8 C;  5IP9 H;  2PQA A;  5ELO A;  5LMN Q;  3PUW A;  2ASB A;  2NZH A;  2VQE L;  4DV1 L;  3BZC A;  1BBU A;  1N36 L;  3L2P A;  3KDF A;  2EXD A;  4A3G G;  4DV7 Q;  2IX1 A;  4A4I A;  2RHQ B;  2B63 G;  2MFI A;  5H1S E;  3ULP A;  3GTQ H;  4GN5 A;  1TWF H;  2VQF L;  3NBH B;  4BY7 G;  4PZ7 A;  1L1O C;  2ZJP A;  2E2H H;  3H3V I;  4C3J H;  1KQS A;  3F2B A;  2UU9 L;  2Q2H A;  1Z47 A;  1VQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...