4L5QA

Crystal structure of p202 hin1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
199
structure length
199
Chain Sequence
b'STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 42
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA01
2VQEQ 4LF7Q 1CSPA 3K81C 4X6AH 4GKJL 1VQDA 1Q81C 4DR6Q 2KCMA 2K52A 4IPDA 4A3CG 3BU2A 4JBMA 4KHPL 5C3EG 4NXNL 2UUCQ 1G291 1HH2P 1VQBA 1VQ6A 1V1QA 3GTLH 4PG3A 3PGZA 3HOVG 4DR2L 2UUBQ 3DLLA 4UY8C 2R92G 4GKKQ 5HY6A 4X64L 1CKNA 1Y1VH 2ZJPA 1YVCA 2B29A 1VQ7A 4JI4L 4JV5L 1X9NA 4JI6L 2VNUD 2IX0A 3JC66 5C0XG 4DR7Q 2Z6KA 4HIMA 1QZHA 4RG1A 3ERSX 1QUQB 1IYJB 4A3JH 2ZM6Q 3PO3G 3ZJYC 1VQKA 2OWOA 5C4XH 1VCIA 2LXJA 3PF4A 4JBKA 2HT1A 2VZAA 1V43A 4LF9L 4LF5L 3S2HH 4LF8L 2A19A 2KCTA 1EIYB 4KHPQ 4NXNQ 3HKZE 3M4PA 1TWGH 2Y0SE 3JAMi 3CMAA 2AKWB 1OXXK 2VQFQ 2R6GA 2VUMG 1K83H 1CKOA 2N8NA 1I94L 1I5FA 4JYAL 5DLQE 2MFIA 3I4OA 3TS0A 1PH5A 4JI4Q 2JA6G 1KHIA 3GD7A 3K8AA 2KHIA 4LUZA 4A3FH 5FLMH 1VQMA 4JI6Q 4DPGA 1PH7A 1XNRQ 1YJNA 1DGSA 2RCNA 2IHFA 5K36G 5FLXc 1YZ6A 1QVCA 4BY1H 1Y1WG 1XPOA 3HKZG 1PHJA 2YTVA 1BKBA 2Y0SG 3CC2A 3OW2A 3FKIG 2OQ0A 1VQ5A 4IJLA 4R4OA 3KF8B 2E2IH 1TWCH 4LF9Q 3UE1A 4X62Q 3S1MH 1N32L 2ES2A 3GTKH 4GOPC 1Q82C 1GM5A 1OXVA 3EN2A 4A3EH 1I3QH 1HZAA 3PIOA 4PZ8A 3FHWA 1Q8KA 2D62A 2JQOA 2LSSA 3F1ZA 3IRBA 1IBLL 1WOCA 4GNXA 4LWCA 1HR0L 5C44G 3I7FA 1I94Q 4YCUA 2ZJQA 4BBRG 1WFQA 4JYAQ 1VQ4A 1PYSB 4A3MH 1JJCB 1D7QA 4LFBQ 4R1JA 3U4VA 3CC4A 2I5MX 3G48A 4AYBE 4QIWE 1CSQA 3WWVA 5IP9G 3CCEA 2JE6I 4A3IG 3PO2G 4A3DH 4BY7H 1HNWL 1HNZL 3K80C 5C0XJ 1N34L 2GN5A 3RN2A 4LF6Q 3HOZH 1JJ2A 2UXBL 1GO3E 1L1OA 4YWKA 4A3KH 3PUYA 3RZOH 1SFOH 1XNQQ 1N32Q 5LMUL 3H3VH 2CQOA 5IP7G 4AYBG 1KXLA 4DV3Q 1IL2A 5IYCG 1VQAA 4JI2L 4L5RC 1KL9A 4EX5A 1EQQA 2ASBA 1HR0Q 4JOIC 3F2DA 2GVBA 1X3FA 2BH8A 2UUAL 3CCLA 1K3RA 1YI2A 3GTQH 2F3IA 4R4IA 4DNIA 4AQYL 4DV7L 1FJGL 2B63H 5C3EH 4A3LG 4LF4L 4JC0A 3KF6A 4IPGA 4IFDG 5M5XH 5GAGC 2E2JH 2I0QA 1FGUA 1XJVA 4A75A 1PH2A 1P16A 1HNZQ 4MZ9A 4RMFA 4GLVB 1N34Q 4JI5Q 1X54A 2HQLA 3EIVA 4YHHL 3F2CA 3CF5A 4BXXH 1BVSA 2R7FA 4P73A 3DM3A 1MJCA 4LFAL 1KQSA 4IJHA 3UDIA 4GS3A 1YNXA 1PYBA 4LFCL 4DR5L 1MJEA 3UDXA 4DK6C 1KIXA 3J81i 2ALYB 4X65L 1WCMH 2L15A 3Q8DA 3CXCA 3GTMH 1K9MC 2R93G 1L0WA 2NN6I 4GNXB 1X65A 3HKSA 3H0GG 4TQUS 3ULPA 1XMOQ 2NZHA 1VQPA 3HFZB 5C4JH 5FJ8G 2C35B 1TWHH 2UXCQ 1E24A 1E1OA 5M5YH 1N8RC 2IT1A 1OXSC 4DV6L 1SN8A 2Q2UA 4A3GG 4DR1L 4DUZQ 1IXRA 5ELOA 4AIMA 1VQNA 3G4SA 2NVYH 5GAEC 3A5UA 2D0PA 4R4TA 3KJPA 1D8LA 1XMQL 4HJAA 2PI2A 2Q2HA 1L1OB 3PSIA 3HOXG 1OTCA 1B8AA 1OXUA 1Y1VG 3H3VI 1EQRA 1HZCA 2BA0A 4DV4Q 2A1AA 2MO0A 4JI7L 4A3BH 4JBJA 2ATWA 2PQAB 4A3JG 2WB1E 2XTIA 5AJ3Q 1EUJA 2YTYA 4DV2L 3T1YQ 1YJ9A 3D0FA 3S1QH 2OTLA 1EYGA 4BBSG 2KENA 1YJWA 3I4MH 4DV5L 4HJ5A 4O0AA 5IE8A 5BR8Q 1YHQA 3GDEA 5IYBH 4OWTB 1W2BA 1FL0A 4IFDJ 3AFQA 3T1HQ 1V9PA 4JI1Q 4A4IA 1B7YB 1U0LA 4GN5A 1TWAH 2WB1G 2Z6KC 4YWLA 5IWAL 5LMNW 3BJUA 2K50A 4HIDA 1XMQQ 4GKJQ 1G6PA 4LUOA 2VY3A 4JI0L 1KD1C 5J3BA 3UDGA 4POGA 4X66L 1K0RA 1PH8A 2K75A 4OO1I 3NEMA 1YHAA 3L0OA 1YITA 4BY1G 4DR2Q 1X3GA 2HHHL 4B3ML 4A3CH 1J5EL 1M90C 4GLAC 4LUVA 3GTJH 4OXPA 1UE7A 3J80i 4X64Q 3S16H 1Q46A 5JEAG 1Q1EA 1WJJA 3HOVH 1LYLA 2R92H 1U5KA 1X6OA 5GAHC 2CKZB 3AYHB 3I56A 2AWNA 3PUWA 3HOUH 4H02A 2JA8H 3KFUA 3ULJA 2K5VA 3KOJA 1GD7A 3K7AH 4JI3L 1FJGQ 3GTGH 1K8GA 4LF5Q 2NN6G 5LMNL 3HOYG 5M3FG 4UP9A 4LF8Q 3CCMA 2R7DA 3E9HA 1VQLA 2BA1A 2JEBI 3A5ZB 2JK8A 4HIOA 1PH9A 1UE5A 2UXDL 3L7ZC 2IY5B 4A3DG 1PH3A 3I55A 5IY0A 1VQCA 4B3MQ 2HHHQ 3KJOA 1UEBA 3TREA 3OTOL 3HOZG 4DR4L 4DAYB 3U58A 2EQSA 1EOVA 1Y14B 1TWFH 2E5LL 1N33L 1CKNB 2JA7G 3PUXA 4DV1L 4GNXC 1CKMA 3E0EA 4YY3L 3RZDH 3CCRA 2JA6H 1C7YA 2KHJA 1EFWA 3RN5A 1PH1A 1A63A 1I6HH 4A76A 1UWVA 2RHQB 4JI3Q 4OX9L 2HIXA 1Y1WH 4KI0A 4JI8L 2YTXA 1RIPA 2H5XA 1KC8C 2JA5H 2JA9A 1B70B 2AWOA 2K14A 1VQEA 3FKIH 4O2DA 4P75A 3D31A 1KAWA 3RLOA 4C2MH 1VQIA 4TVAB 3CPWA 2R7ZH 1E3PA 2UXDQ 5IYDG 1L1OC 1FVIA 1IBLQ 2I5HA 2N78A 4MTNA 3CP0A 1M1KC 4DR3L 1IBML 1RL2A 1C9OA 1N36L 4J15A 3UDFA 4DKAC 2I5LX 4BXXG 3STBC 2GVAA 3AQQA 2DUDA 4BBRH 1LUZA 5JEAJ 4APVA 1HNWQ 3CPFA 1IZ6A 2KBNA 4QY7A 3CCSA 1PH6A 1EWIA 4OWXB 1HNXL 4B3TL 2IX1A 2UXBQ 1S72A 1PV4A 4OX9Q 5JJIA 1CUKA 1E7ZA 4ALPA 4A93H 3AEVA 2VS1A 4DK3C 3PUVA 4DV0L 1EIFA 2LXKA 3TQYA 5LMUQ 4HIKA 1Z47A 2DGYA 2IHEA 1S40A 2CCZA 1X3EA 4JBWA 1NBWA 1Q12A 4JI2Q 3JAMc 3I4NH 4PZ7A 3B6YA 4DUYL 1R9TH 3UE0A 4KLKA 1VQ8A 2E2HH 2UUAQ 2N3SA 1IBMQ 2RF4A 1VQJA 4AQYQ 1QUQA 4DV7Q 1N36Q 4LF4Q 4AH6A 4R4CA 4K0KQ 2PI2E 3G71A 1L2FA 2CWPA 2FXQA 1I50H 3TS2A 4UP8A 4HJ7A 4A3LH 2VQEL 1Q1BA 4LF7L 3TEHB 3U50C 1IBKL 3L2PA 4A3BG 1O7IA 1A8VA 3ER0A 2EXDA 4DR6L 4JCVE 4YHHQ 3CMEA 4OONA 1E22A 3CW2C 4LFAQ 2MNAA 3W1GA 4L5QA 1LTLA 5ELNA 4Y7NH 4DR5Q 4LFCQ 2JEAI 3I4MG 2VL6A 4X65Q 1HJPA 1JJGA 2UUBL 4GN3B 3CQZH 2B3GA 3MXNB 5FJ8H 3RNUA 1LM0A 3I2ZA 4EQ5A 4GKKL 1A0IA 1S3OA 3HOWH 1BBWA 5C4XG 3F8TA 3KYHC 4XTCS 1WYDA 4NPSA 4DR7L 4FDBA 1MIUA 2R93H 2ZM6L 4JG2A 4IPHA 4NB3A 4JV5Q 4B3RL 3KF6B 3E9IA 1VQFA 4P74A 4UP7A 4POFA 4UPAA 4DV6Q 4DR1Q 1PA6A 3S15H 2ZTCA 3STBD 1IBKQ 4B3SL 1ASYA 2NVXH 4A3GH 4YWMA 3M9BA 3W1BA 3FP9A 4PZ6A 5M3MH 2A8VA 3SGIA 3EBEA 3CCQA 2N49A 2MQHA 1K73C 1K8AC 4JI7Q 5M5WH 2VQFL 1VS0A 4XIGS 5FLMG 4A3FG 4C3HH 3M85A 1VQ9A 3HOXH 1PVOA 1AH9A 4YCWA 4GN4B 1P8LA 1YIJA 1N9WA 3BZKA 2NVTH 1C0AA 4C3IH 2PMZE 3PIPA 3S1RH 1UE6A 4DV2Q 1XNRL 2K4KA 2RHSB 2JA8G 3HOUG 2Q2TA 4BA2I 1VQOA 1SMXA 4DV5Q 3M4QA 4B3RQ 4IOAA 2AHOB 4GLXA 1QVGA 1AE3A 4BBSH 1JT8A 3RLFA 4A3EG 4IPCA 3PF5A 3S14H 4IFDI 1TXYA 2BH2A 2OCEA 1VQHA 4X62L 3CCJA 4B3SQ 5IWAQ 3NBHB 4JI0Q 1HR0W 2YU9H 4L5TA 2CFMA 4A3MG 1XPRA 1SROA 3J81c 4HJ8A 4X66Q 4L5SA 1GVPA 3W5OA 1NJIC 2ZTEA 3K0XA 2YYZA 1J5EQ 4BY7G 1PFSA 4K0KL 3M4OH 2E8GA 1WI5A 1Q86C 3G6EA 2CWAA 2NZOA 4GOPA 2VUMH 4ME3A 3CAMA 4A3KG 2JA5G 3BZCA 4LF6L 3GTPH 2NVQH 5JJKA 1A62A 2QA4A 3A74A 2R7ZG 2JJQA 1SLJA 3CCUA 4C3JH 4NXML 1UE1A 1XNQL 1T9HA 3KLWA 1VQGA 1BBUA 3TRZA 2QGQA 5LMNQ 4DV3L 4OWWB 1MKHA 1X56A 2B63G 3NENA 4WJ4A 2D0OA 3VDYA 2EIFA 1Q7YC 4LFBL 4LNQA 3S17H 3U4ZA 4YCVA 3HOYH 5M3FH 1QZGA 3PV0A 2WAQE 3KDFA 4IO9A 1XTDA 3OTOQ 1J6QA 4MNOA 4DR4Q 1NE3A 3LGJA 1SE8A 5E7NA 5GROA 1X55A 2E5LQ 1N33Q 3NELA 5GADC 3ICEA 3ULLA 5C44H 4A93G 3MEFA 4DV1Q 1NMGA 4JI5L 4YY3Q 3A0JA 1NTGA 2ZTDA 1HZ9A 1OXTA 3GO5A 5C0XI 1WCMG 2JA7H 4OO1G 4A3IH 3PO2H 2OTJA 4JOIA 5IP9H 3I4NG 2Z0SA 4NXMQ 2V1CC 2XGTA 2WAQG 2VW9A 1PH4A 2K5HA 4IOCA 4JI8Q 4QGUA 1KRSA 3S24A 2UU9L 2PQAA 3J81j 2F4VL 1W3SA 3RR5A 5HGQA 3CC7A 1H95A 3PCOB 1HZBA 5IT9c 1XMOL 3CCVA 1YBYA 3J7A5 3H15A 5IP7H 3J80c 4DR3Q 4Y52H 2K5NA 1SR3A 5IYCH 2UXCL 5IYDH 1NMFA 1Z9FA 1KRTA 2WFWA 4PMWA 3M7NA 4DUZL 3K7UC 4P72A 3CD6A 3AFPA 4QJFA 1JB7A 3S2DH 1JE5A 4GOPB 3PUZA 4DAMA 5GQOA 1AE2A 5H1SE 1JMCA 1YEZA 4BA1I 3J7ZC 1NY4A 1HNXQ 4B3TQ 4LW1A 5JJLA 3GTOH 4QL5A 3HOWG 3OYYA 4DV4L 1GKHA 2UUCL 2UU9Q 2WP8J 2ZJRA 1ASZA 4DV0Q 1QVFA 2ID0A 4R4QA 2F4VQ 5AJ3L 3T1YL 2QEXA 4P71A 2HIVA 5IYBG 4DUYQ 3S1NH 3PO3H 2PNHA 3KDFB 4HJ9A 2Q2IA 3F2BA 3RLNA 2OQKA 4KHZA 5BR8L 4WJ3M 2AMCB 2MO1A 4QQBX 5M3MG 1G51A 3T1HL 1E1TA 1SRUA 3H0GH 5EAYA 1XPUA 3M3YH 2YV5A 4JI1L 2F52A 1YHBA
chains in the Genus database with same CATH superfamily
2VQEQ 2G5DA 1RHPA 4DGZA 3K81C 1HQMC 3N52A 3ZYYX 4DR6Q 3R8BA 4IPDA 3BU2A 3OMCA 4ID6A 4NXNL 2K01A 1HH2P 1SBBB 4KHVA 5E1FA 3HOVG 3SE0A 4GKKQ 4X64L 1Y1VH 1G2TA 2ZJPA 1YVCA 3NP8A 4JI4L 1X9NA 2IX0A 2G9HD 1D1KA 3MEHA 3H94A 2ZM6Q 4A3JH 2BE5D 2OWOA 1VCIA 2LXJA 1HA5A 3PF4A 1Y8NB 1U4LA 4LF5L 3S1NB 4RGOS 2Q8IB 3S2HH 2KCTA 2B2YA 3HKZE 2R93B 5KYLA 3JAMi 1TKWB 1OXXK 2AKWB 2VQFQ 3NBIA 1B9MA 2AQ2B 2DNEA 4LUZA 5A35A 2EY1A 4J1MA 1LABA 1SSOA 5FLXc 1Y1WG 3TDQA 3CRKC 1EY6A 1D1IA 2Y0SG 1AP0A 5CV4A 5JEAH 3FKIG 1LT4D 1VQ5A 4IJLA 4WJWA 3HOXB 2XWJB 1Y1VB 2CW0D 1N32L 1OXVA 4A3EH 1I3QH 3FHWA 4A3JB 1DOKA 1Z6HA 1YNND 2D62A 3F1ZA 4KY5A 4RCOA 4R8IA 4BBSB 2ZJQA 2IWHA 1Z7TA 1WVLA 4K0KQ 4A3IG 3PO2G 1DYQA 3WWVA 1WTQA 2JE6I 1GHKA 1FNVA 5J1ZA 1S5BD 1HNWL 2R61A 5C0XJ 2GN5A 4LF6Q 2WB1B 4K6LA 5C5MA 1L1OA 4A3KH 3RZOH 3H3VH 5IP7G 2OT2A 4L5RC 1BQQT 3C46A 1Y8OB 2DNCA 2NVQB 1X3FA 5IODA 4HSVA 3CCLA 3GTQH 1YI2A 4AQYL 4R4IA 1EFID 4LF4L 3SK5A 3KF6A 1XJVA 1I3QB 3EJIA 1P16A 2M00A 4F8MA 5KRUA 1HNZQ 1HFNA 2TSSA 2L12A 4JI5Q 2PNRC 1BCPD 4KMUC 1JWMD 2HCCA 3F2CA 1HQRD 4YHHL 1YNJD 3CF5A 5M3FB 3S17B 1BVSA 4P73A 4OEMB 3Q22A 3UDIA 4GZYC 4X65L 3BZDB 4PQXA 3NXWA 4JPBW 1WTWA 4K2LA 4HCEA 5TSSA 3H0GG 3O13A 1XMOQ 3HFZB 3DWPA 1TWHH 2VB2X 1N8RC 2ICIA 2IT1A 1OXSC 4KKTA 1HRJA 3FEWX 3MVVA 1B50A 4HMIA 2C9OA 1D8LA 1GUWA 2PI2A 2Q2HA 1L1OB 4C3HG 3PSIA 5G3LF 4R8NA 1CI3M 1U4PA 2FJ2A 4DV4Q 4A3BH 4EQPA 1E2WA 2PQAB 4DAYA 3D8GA 3T1YQ 2YTYA 3S1QH 1ZYRC 3D0FA 3EA6A 2OTLA 2XRSD 2L0CA 4HJ5A 5BR8Q 1YHQA 2M2LA 3GDEA 3NTHA 1STNA 1VF7A 4IFDJ 1V9PA 1H9JA 1BXTA 5HGTA 2IJ0A 5IWAL 4GN5A 4LAAA 1TWAH 5LMNW 4HIDA 4B9XA 2K50A 1KD1C 2MUYA 1WTPA 1TY2A 5FK9C 1D5XC 1J9OA 1K0RA 1SE3A 4RGNA 1YHAA 3L0OA 2D5DA 3V2TA 1YITA 4B3ML 4GLAC 4OXPA 4X64Q 3S16H 4G7ZC 1WJJA 4OGQC 1JORA 3F2UA 3C1FA 3HOVH 2JXMB 5EBDA 2FMCA 1EU4A 5JPNC 4HSPA 4A3BB 2BOSA 3K6OA 3KFUA 1X32A 3J7AV 2RKSA 1GD7A 3K7AH 4LF5Q 2NN6G 5I6YA 5L37A 1STGA 4UP9A 2K33A 3R2TA 1UEAB 4J6HA 2L1BA 2IY5B 1F2LA 4KY7A 1UE5A 4HIOA 3L7ZC 2UXDL 1PH3A 3I55A 2SNMA 4HN7A 2HHHQ 3KJOA 3OTOL 4DAYB 1Y14B 2NTTA 2JA7G 2I46A 1I4PA 4GNXC 1CKMA 3RZDH 3CCRA 1C7YA 2NB0A 1EFWA 1HXYD 1A63A 1UWVA 1QE6A 1ICWA 1JOOA 1DM0B 2HIXA 2MHVA 3I91A 4C56C 4CJ2C 1Y1WH 5CBEE 1RIPA 2BCOA 2F0LA 1KC8C 4P75A 1VQEA 2F3WA 3FKIH 3CPWA 1KAWA 5EJWA 2RCFA 1E3PA 2N78A 3CP0A 4XXEA 5DNFA 1S5DD 2G9DA 1I6VC 1IBML 1C9OA 4G7HC 3VR3A 1TWCB 4BXXG 2K32A 2JSOA 3AQQA 3HGBA 2DUDA 3S16B 1PZKD 1HNWQ 1II3A 1PH6A 1HNXL 1B9NA 2B2TA 1ONLA 2PW7A 4A3MB 2A69C 4A93H 1DXMA 4DK3C 4DV0L 3TQYA 5DEHA 4HIKA 1Z47A 2F0DA 2IHEA 2PW5A 3A8KE 4JBWA 1NBWA 4FXDA 4ILWA 4DUYL 3HOZB 3UE0A 3D4WA 2BE5C 2N3SA 2K6AA 2RF4A 4AQYQ 1QUQA 1N36Q 1IYUA 4LF4Q 2FFKB 2LKVA 1L2FA 2EYOA 3HRZC 1I50H 1RCVD 4HJ7A 2EY5A 1Q1BA 1EEFD 3TEHB 1IBKL 1A8VA 3ER0A 4JCVE 4YHHQ 1AZPA 1S5ED 1T5EA 5C3EB 3I4MG 1EU3A 1QNKA 4X65Q 5C3WA 1EY5A 1LTSD 5FLXL 1LM0A 4DK1A 1A0IA 1WTVA 4QCLA 5CGKA 3F8TA 1MIUA 4A93B 4IPHA 4Q0FA 5ELCA 2GA4B 2CW0C 1PA6A 4POFA 4UPAA 5BN4A 2WAQB 2K5WA 4B3SL 1JWSD 2L4NA 1YNNC 2NVXH 4HCSA 2O2LD 3M9BA 3W1BA 3FP9A 4RGMA 2A8VA 3SGIA 1K73C 3SK4A 2KEDA 1VS0A 1VQ9A 4C3HH 1AH9A 3CU7A 1TS2A 4E6IA 1NR2A 4GN4B 1P8LA 1Q3LA 2PMZE 5FO7B 4C3IH 1SXTA 4IUQA 1LLRD 1FYCA 3M4QA 4B3RQ 2QCPX 2JN4A 1JT8A 3S14H 5JVG3 2BH2A 3WOEA 5IWAQ 1RF2D 3IL8A 3K0YA 3LWEA 4IUPA 4C1NI 2YU9H 4L5TA 3J81c 4I7ZC 3W5OA 1WTHA 5JVH3 4H13C 2HDMA 1K3BC 1ENAA 1NAPA 2KOLA 5C6AA 1WI5A 1BCPC 3UI2A 4RHSA 3MZ5A 3AMUA 4P2CB 3GTPH 3TMEA 2R7ZG 2EJFC 2EYFA 2K5DA 1SLJA 4L6TB 4C3IB 1T9HA 3KLWA 1BBUA 4DV3L 4OWWB 4LMQD 1MKHA 2B63G 3VDYA 2EIFA 2AUKA 4XT3B 4K5VA 4ZCKA 5F2DA 5I2YA 3HOUB 3EQLC 1XTDA 1S5FD 2HUGA 3OTOQ 1SE8A 5GROA 1PYWD 5KNBA 5GADC 2YU9B 5C44H 1WTRA 1NMGA 3A0JA 1CM9A 2QF7A 1OXTA 1Q8IA 4FXKC 1WCMG 2JA7H 5IP9H 1Q90A 1FD7D 2XGTA 2Z0SA 1PH4A 1KRSA 3S24A 4DF7A 1MGSA 1B3QA 3NTKA 3RR5A 3OPOA 3GTPB 5CMDA 2JA6B 3CCVA 2WINB 2C5CA 3J80c 1NMFA 1QWYA 1Z9FA 2FINB 1KRTA 4PMWA 1LTBD 3S2DH 3ITPA 1JE5A 1K8OA 2O5JC 2HDLA 1EY8A 1YEZA 1PFMA 5A2QE 1HNXQ 1B53A 4LW1A 5E4WC 4UDUC 2F0PA 5IT9E 4FF4A 3BDCA 4DV0Q 2ID0A 4R4QA 1ESFA 3AU7A 4BBRB 5AJ3L 2HCIA 1UUPA 5C3XA 4P71A 4DUYQ 3PO3H 1HPCA 2EYLA 2PNHA 2RQXA 1HFGA 4U673 4OL7A 4WJ3M 3HS0C 2MO1A 3LX0A 4L63B 2RSOA 1YHBA 5FJ8H 4XDXA 4GKJL 1VQDA 1R9TB 1IYVA 3FRPB 4AYBB 4QIWB 1EL0A 2K52A 2Z4HA 3WOFA 2UUCQ 3BS1A 5ELFA 4KKUA 3H09A 1PTOH 3PGZA 4PG3A 3U9SA 2R92G 4NMZA 1CKNA 4V190 2IL8A 2SEBD 5C0XG 4HIMA 1PXUA 5JPMC 1DOMA 1LACA 1SNDA 1V8QA 1IW7D 1M8AA 3PO3B 4XQNA 3M4PA 1JR0D 1W6JA 2R3ZA 2VUMG 1GUNA 1K83H 1CKOA 1EQVA 1I5FA 1PTOD 4NW2A 5DLQE 4JV5Q 3VR6A 4JI6Q 3GD7A 1VQMA 2KHIA 4A3GB 2ICEC 1PH7A 4RA8A 1YJNA 1DGSA 2RCNA 5K36G 1YZ6A 1XPOA 3HKZG 4CDEC 1PHJA 1BKBA 3NK9A 3OW2A 4ME5A 1K8MA 1W6KA 5M5WB 4XQQA 1K0SA 3KF8B 3SR1A 4LF9Q 3BDLA 3S1MH 1D5ZC 1F9RA 1I4RA 1Q82C 2PZWA 1HZAA 5CR3A 2VXWA 2X6GA 1IBLL 4RKBA 1WOCA 4GNXA 4LWCA 4K8IA 1I94Q 4JYAQ 1GUOA 4LFBQ 3U4VA 2I5MX 3CCEA 2WKDA 4A3DH 1HNZL 3RN2A 1EZ6A 1QCBD 3PUYA 3T16A 4CJ0B 3M4OB 4DK0A 1CK1A 4DV3Q 5IYCG 1O7ZA 2F0QA 2K1BA 4EX5A 2ASBA 2NYZD 3OIQA 3F2DA 1VMCA 2GVBA 4U68A 2Q8TA 4DV7L 2B63H 4JC0A 4C3JB 3D3RA 5GAGC 5M5XH 2E2JH 4CHTB 4IFDG 1JQYD 2DY8A 4RMFA 4BS9A 1N34Q 3BYYB 1AW7A 2R7FA 3L3OC 3T51B 2L11A 4LFAL 1SJHD 2QEJC 4A3DB 1DOLA 1WCMH 2F0KA 3Q8DA 3CXCA 3GTMH 3FPPA 1K9MC 4FVMA 4OHJA 2V4DA 4GNXB 1X65A 2DJFC 3TP5A 2NZHA 1VQPA 1I4HA 1SYBA 1LT3D 4DR1L 1A3VA 3I90A 1VQNA 3PQIA 3J81L 5GAEC 4HMJA 5KNCA 4DNTB 2OEOA 4R4TA 1KNEA 4F88A 2B2UA 5CV7A 3H3VI 1HZCA 1KLUD 3VYSA 3HG9A 2WB1E 5AJ3Q 4KK7A 4DV2L 4N8FA 1CQVA 1X3PA 1EYGA 2KENA 4WORA 5IE8A 5I9OA 4OWTB 1FL0A 4MHEA 3GTMB 3QG1A 4G57A 2D2CC 4CJ1B 1B7YB 1EY4A 1U0LA 4ZK9B 4GKJQ 1WTOA 2LS01 1PFNA 4KTAA 2VY3A 3K5LA 3OWEB 5J3BA 3UDGA 4POGA 4X66L 1JCKB 4BY1G 2HHHL 1J5EL 4LUVA 3GTJH 2AQ1B 1UE7A 5BN3A 4KN4C 5CV5A 1R4QB 3DWAA 2R92H 1U5KA 1X6OA 1BF4A 5GAHC 2F0VA 1D2BA 3AYHB 2AWNA 3TP8A 4DNRB 2JA8H 2E75C 3KOJA 1I4QA 1FJGQ 3GTGH 4QF4A 1K8GA 2CVRA 3MXPA 3HOYG 5IIFA 3J80L 3CCMA 1QILA 1HTPA 3E9HA 2BA1A 3A5ZB 4M8AA 2JK8A 1PH9A 3MTSA 1EIHA 2A73B 3HOZG 4DR4L 1AEXA 3U58A 3WDNA 1TWFH 3QR8A 3S2HB 4DV1L 3VR5A 4V0BA 2FHTA 2KHJA 2NWGA 4TKOB 3RN5A 1PH1A 4PMBA 4A76A 2RHQB 4FO2A 3GTJB 1C48A 1HA6A 2JA5H 2JA9A 1B70B 1SNPA 2QDLA 2AWOA 2K14A 4O2DA 2B2WC 2EDGA 3D31A 3RLOA 4CGYB 1VQIA 4TVAB 5IYDG 4FP5D 1IBLQ 4MTNA 4DR3L 1PRTC 1N36L 4J15A 3UDFA 3QOLA 4DXFA 3STBC 4A3EB 2A68D 5JEAJ 2F0WA 3I72A 1IZ6A 3KUPA 3NPPA 4QY7A 3CCSA 4B3TL 1S72A 1PV4A 1E7ZA 1X3EA 4M1UB 1BCPB 3I4NH 5CORA 4PZ7A 3B6YA 5D3DA 3FMCA 3L9AX 4KLKA 5D65A 4DV7Q 2EYPA 4A3KB 3RZOB 2JA5B 2PI2E 2CWPA 4K8JA 2FXQA 3TS2A 4UP8A 2NTSA 4NDXA 4LF7L 5LL6X 4IFDH 1ZXTA 1O7IA 4FF3A 2EXDA 3GTQB 2L9HA 1E22A 3JAME 4LFAQ 4L5QA 1PTOC 5ELNA 3P20A 1HJPA 4CDDC 2UUBL 3CQZH 5IGEA 3I2ZA 1S3OA 1BBWA 4QUCA 5C4XG 4XTCS 4FDBA 2EOTA 4JG2A 5EPKA 1FR3A 4B3RL 3KF6B 1EY0A 4UP7A 4DR1Q 2ZTCA 5CYUA 3I4NB 3TZUA 5J22A 5CV9A 1GHJA 1BO0A 3MC0B 4PZ6A 4CDCC 3VYRA 1TWHB 1H9SA 1O78A 5FLMG 4A3FG 3M85A 5K5PA 1PVOA 2NVTH 3NTIA 3S1RH 3HOUG 4DV2Q 1XNRL 4B9WA 2Q2TA 1IKLA 4KKSA 2KEEA 3QB3A 3D4DA 5EPJA 5BN5A 4KD4A 2AHOB 2SNSA 1AE3A 1LO5D 3PF5A 2XNAC 1TXYA 2ZXRA 2PPBC 2O5IC 3S1QB 2ZT9C 4IN3A 1EOTA 4X66Q 2KUMA 4LJZC 1NJIC 5KYIA 4IUVA 1J8IA 3DWQA 4KJOA 2ZTEA 4BY7G 1J5EQ 1TWAB 2E8GA 1HUMA 3KLSX 2E76C 4RFBA 4X3UA 5G3LD 2E74C 3MXGA 1B2TA 2KQ3A 3E0JA 1XNQL 4WRDA 3K58A 1VQGA 4K14A 4CKCA 3HOVB 1X56A 1RKNA 4WJ4A 1Q7YC 3KK7A 1CA5A 3HOYH 1WD0A 3PV0A 2WAQE 5EKKA 1J6QA 4DR4Q 3K7AB 1NE3A 1SNQA 3LGJA 4X3KA 1EYCA 5IGFA 1X55A 3I4LA 3CRLC 2OF1A 4DV1Q 1EQTA 3EFXD 1NTGA 3N6RA 2X6LA 4OO1G 4A3IH 3PO2H 1KTKA 3M7GA 4QUFA 4IOCA 4QGUA 1LT5D 5IOCA 3J81j 1MSGA 5CC4A 3RZDB 1H95A 5IT9c 1YBYA 3E6ZX 3H15A 5IP7H 4DR3Q 1ILPA 4CKEA 2K5NA 1SR3A 2PZTA 3A54A 3GP7A 5IYDH 1Y1WB 1DJRD 1BOSA 1EWCA 2QDBA 3K7UC 4P72A 2Y0SB 4QJFA 3FKIB 1ICFB 2BDOA 5GQOA 1AE2A 2IPKD 3J7ZC 3D6CA 1NY4A 4B3TQ 5KGUA 3HOWG 3OYYA 1LT6D 2UUCL 2WP8J 1H9RA 2QEXA 1U9RA 2B2UC 2RDGA 1T5XD 4A3IB 3F2BA 1O7LA 4KHZA 3GQBA 4QQBX 1STEA 5M3MG 4F7XA 3T1HL 3M3YH 1SRUA 3H0GH 1G6ZA 1SYDA 4LF7Q 1CSPA 4X6AH 1Q81C 4KY6A 2KCMA 4A3CG 5C3EG 5IGBA 1G291 1VQ6A 3GTLH 1I50B 4DR2L 2UUBQ 3DLLA 2KVMA 3D6WA 1C8CA 4JV5L 4JI6L 3JC66 4RG1A 1QUQB 3ZJYC 1XX8A 3P7JA 1VQKA 5C4XH 2F0TA 3SHLA 4EGVA 3MAQA 4JBKA 2HT1A 1V43A 4LF9L 3NUCA 1MD2D 3TP6A 4IALA 4KHPQ 4RH6A 1TWGH 1KDAA 1TVXA 5KIXA 3CMAA 3M3YB 1TR5A 2A6HD 1I94L 4JYAL 2MFIA 2A68C 3KBGA 1KDBA 3I4OA 5JAVA 2DN8A 2K5QA 2RA4A 3TS0A 4RAUC 4A3FH 5FLMH 1XNRQ 4LFBL 4DPGA 2NVXB 2NZ1D 2IHFA 5E4XA 1YNJC 2YTVA 3CC2A 3RD4A 4HAEA 4C3HB 4R4OA 5AFWA 3UE1A 1CZWA 2ES2A 4GOPC 2J4XA 4X3SA 3EN2A 5I4DA 1Q8KA 2JQOA 3IRBA 5C4HA 2L55A 2NN6H 5IGGA 3S14B 1WFQA 3K57A 1D7QA 2PQEA 3NHHA 4ZYSA 1A6XA 3G48A 4AYBE 4QIWE 4RKLA 1F9QA 4BY7H 3K80C 3MA2B 1LTTD 1N34L 3Q23A 2B2WA 5COYA 1JJ2A 2UXBL 5DM73 1GO3E 3I8ZA 4YWKA 2JYOA 1PRTF 1SFOH 1XNQQ 4LK1C 2CQOA 3AB9A 1IL2A 1XTCD 1BUVT 1STAA 3LNNA 4K2KA 1HR0Q 2BH8A 1K3RA 3NQIA 4ZKCB 2F3IA 2WIIB 3QWNA 4KV6A 1EY9A 4A3LG 1AN8A 2I0QA 1FGUA 3E3XA 1PH2A 3K5OA 4GLVB 2EE1A 4L8JA 1X54A 4BXXH 4N9PA 4ZAIA 2KJXA 2EYJA 4NKLA 1MJCA 4I65A 5JJZA 4IJHA 4JBMA 1KIXA 2EXZA 1PYBA 4G4KA 4DK6C 3DEPA 3J81i 2F1MA 4OO1H 3TSSA 4KD3A 5C44B 2R93G 1L0WA 3Q0AA 3HKSA 4TQUS 3U9OA 5C4JH 1S4ZA 2JA7B 1O80A 2C35B 5ELBA 1E1OA 2XN9C 1PTOF 4DV6L 1SN8A 1IXRA 4AIMA 3A5UA 1TY0A 1PFBA 3KBXA 4HJAA 5T1GA 3HOXG 1OXUA 1Y1VG 3DEOA 1EQRA 4RCNA 2A1AA 4JI7L 1SMYD 5E3FA 1PRTB 3S2DB 4A3JG 3V96A 1RJTA 5FO8B 1EUJA 1YJ9A 3M4YA 4BBSG 5JOBA 1YJWA 3I4MH 4DV5L 4O0AA 2ENBA 1SNOA 1W2BA 5CV6A 3T1HQ 2PO4A 3VA5A 2VB3X 4B08A 3Q6SA 3R2IA 2KA7A 4A4IA 1FJGL 2Z6KC 2WB1G 4YWLA 1XMQQ 1ZKOA 4N9TA 4LUOA 3C1EA 2EPBA 2AUJD 5EGTA 1G91A 2LMCB 4DR2Q 4A3CH 5C5LA 2LY7A 3J80i 2ZXOA 1Q46A 1DZ1A 5JEAG 1Q1EA 1SYFA 3FVQA 5A2QL 1PTOB 3ULJA 2K5VA 2F0HA 3A56A 5IT9L 5M3FG 2EYMA 2P5ZX 3J7AF 2EY2A 1TQOA 5LHY1 2F0FA 1LTRD 2NBFA 1G8ZD 1UEBA 1EOVA 3IKJA 1CKNB 1B1ZA 2B8FA 4UAIA 4S3SA 3PUXA 2MJ8A 1KAAA 3D4RA 5CV8A 1SAPA 1X3QA 1I6HH 1IL8A 1K83B 4JI3Q 1F2YA 1LTID 2YTXA 3TP7A 5ISRA 3CKIB 2EY6A 2PCFB 3MXNA 2R7ZH 3C2PA 3VR4A 4QMGA 2I5HA 4UHVA 1JC7A 3P1HA 1VMPA 3KLSA 2K7VA 3A7LA 2MP1A 1ZEQX 2I5LX 1GXDC 1K28A 3S1MB 3GV6A 3A8JE 1F2MA 2D9UA 1LUZA 2QKIC 2OXPA 2KBNA 2IX1A 2UXBQ 1EWIA 4JW0A 4OWXB 4OX9Q 3AEVA 3DM1A 3PUVA 2LXKA 2DGYA 2EVBA 5C4ZA 1Q12A 3JAMc 4ZQ3A 2E2HH 1I6HB 1A3UA 1NNXA 3G6JB 3QJYA 4MN3A 1CFMA 3URYA 5KNDA 2R7ZB 4A3LH 3OW7A 1D6EC 2F3VA 4A3BG 1MBYA 3NBHA 1RTOA 4FNFA 4X3TA 2A6HC 4OONA 2B63B 3CW2C 4YIJA 3W1GA 1LTLA 5M5XB 2E2JB 1B4OA 2VL6A 2KCNA 1JJGA 2HQEA 4GN3B 3MXNB 3RNUA 4EQ5A 3PIO3 4DR7L 1STHA 2R93H 2F0EA 4NB3A 1LTGD 3E9IA 4DV6Q 1UNSA 1WCMB 2RSNA 4TSSA 1JB3A 5D3IB 1XYIA 2E2HB 1Y8PB 2MPMA 3IFDA 3EBEA 3VR2A 4ABNA 2N49A 4JI7Q 2A69D 3HOXH 4YCWA 5DM63 1YIJA 1C0AA 1N9WA 3KLRA 3BVZA 1Y69U 2K4KA 2RHSB 1SMXA 4DV5Q 4IOAA 4GLXA 2F0MA 1F77A 1A2TA 1BNZA 4BBSH 3RLFA 4IPCA 4IFDI 4OELB 2DY7A 5C0XH 2OCEA 1VQHA 5EPLA 4X62L 3FPUB 3NBHB 2F0JA 4CKBA 1HR0W 1BCPF 2Z6BA 4IQZA 4A3MG 1L0XB 1SROA 1U4MA 4HJ8A 4H0LC 1CA6A 5FOBB 1GVPA 3H6MA 3GV3A 3RUZA 1ET9A 1VF5C 4DN4M 4N8X1 1A2UA 2NZOA 3G6EA 4GOPA 2VUMH 4ME3A 3A55A 3BZCA 2BDNA 2NVQH 4O42A 1SE4A 4ZUIA 2QA4A 3A74A 4DAPA 5K36H 4OIJA 1KABA 1NUCA 4F87A 3G7LA 3T13A 2D0OA 2R92B 3OOCA 2LFNA 1KDCA 2N55A 4LNQA 3S17H 4YCVA 5M3FH 2JA8B 1EWHA 4MNOA 3HP3A 3I3CA 3GTGB 5E7NA 3J7YW 2PYKA 3NELA 4IUTA 3ULLA 1F9PA 4A93G 2M9VA 1WD1A 2ZTDA 1JE4A 1HZ9A 2HD3A 3GO5A 1SMYC 5CBAE 4NXMQ 2WAQG 1TS3A 5EBCA 1TWFB 5EQ0A 2PQAA 2VUMB 1W3SA 5I6WA 2WKCA 3CC7A 3PCOB 1DONA 4FYDA 2UXCL 5IYCH 1PMRA 1EYDA 2WFWA 3HKZB 4DUZL 4NP5A 3CD6A 4XYOA 3AFPA 1IW7C 1BR9A 4GOPB 3OIPA 4DAMA 3W3AA 2RDHA 5H1SE 2IX3A 1PZJD 2O4XA 1JOKA 3GTOH 1GKHA 1CHQD 1EYAA 2UU9Q 2KHSA 1QVFA 1GUSA 1EY7A 2F4VQ 4Q5VA 2RDFA 1QJOA 1HCZA 5IYBG 3T56B 1HTLD 2Q2IA 1ILQA 3RLNA 5EAYA 1XPUA 2YV5A 4JI1L 2F52A 2B39A 4JVZA 4DA2A 4C3IG 2RVLA 4KHPL 5HURA 1S5CD 1VQBA 4K5WA 1V1QA 4K5XA 2F0SA 3K5MA 2F03A 4UY8C 5HY6A 1QG7A 1NCVA 1U4RA 2B29A 1VQ7A 4R9WA 2VNUD 1STYA 1GOZA 2WV6D 2Z6KA 3VA7A 1QZHA 3GTOB 4DR7Q 3ERSX 1IYJB 4KJNA 3P75A 4JK1C 3CQZB 4QB4A 1GUTA 2VZAA 3K5NA 2B2VC 1F9SA 4LF8L 2A19A 1EIYB 1SDFA 4NXNQ 3I70A 2Y0SE 1RTNA 2R6GA 3ND8A 1SEBD 1ENFA 4Z9CB 2N8NA 3HZXA 1CQFA 3NWTA 4JI4Q 2JA6G 1KHIA 3K8AA 1V1OA 3C3LA 1KLGD 5FKAC 3OMGA 1QVCA 3MFYA 4BY1H 2DJGC 2K04A 2OQ0A 5ELDA 2E2IH 3JAML 1B44D 1TWCH 2NVTB 4X62Q 3S1RB 3HEJA 3GTKH 1GM5A 1A3TA 3PIOA 4PZ8A 2A5HA 3V05A 1M4VA 2LSSA 3TN2A 1HR0L 5C44G 3I7FA 5IGDA 1H9SB 4YCUA 4BBRG 2KCCA 1VQ4A 5FLXE 4DFAA 1PYSB 4A3MH 1JJCB 4R1JA 3CC4A 1A15A 1CSQA 5IP9G 1G2SA 3DMUA 2SDFA 3HOZH 4ODGA 4MIUA 1HUNA 3OHXC 5DAUA 1WTXA 1N32Q 1R4PB 2J7ZA 4HTHA 5LMUL 3NE5B 4EVOA 3DUZA 3NQTA 4AYBG 1KXLA 2XWBB 3BYTB 1VQAA 4BY1B 4JI2L 4CBVA 2FMMA 1KL9A 1EQQA 2XSCA 1ESRA 4JOIC 2UUAL 3ERQA 4KN7C 4DNIA 2E2IB 5C3EH 4IPGA 2QW7A 3GTKB 2F0OA 2CHBD 4A75A 4DXGA 4MZ9A 3PIP3 2EJMA 2XVSA 4IUNA 3SVMA 1I4GA 2HQLA 3EIVA 3HOYB 3DM3A 1KQSA 1MJEA 4GS3A 1YNXA 4LFCL 4ULLA 4DR5L 1JB7A 1OO9B 3UDXA 3PO3G 2ALYB 4I7AA 2L15A 2Z1CA 3BG3A 2NN6I 3ULPA 2Z9HA 5FO9B 5FJ8G 2EZVA 3PO2B 2CH4W 2MGSA 2UXCQ 1E24A 5M5YH 1FGBD 4A3GG 2Q2UA 4DUZQ 5ELOA 1QOHA 3G4SA 2NVYH 1B3AA 2D0PA 3KJPA 1XMQL 2A6ED 1O7YA 4XQJA 4RWSC 5J39A 1OTCA 1B8AA 2F0UA 2BA0A 1ML0D 2MO0A 4IUUA 3S9WA 4JBJA 2ATWA 2XTIA 4FXGC 3MHBA 2XIWA 4J8QA 3X3MA 3FDTA 2K05A 1SYEA 5IYBH 4O1NA 4H7BA 3AFQA 4JI1Q 3LWUA 1TIID 1G6PA 3BJUA 1EZ8A 3NSWA 4JI0L 5M5YB 1PH8A 2K75A 4OO1I 3NEMA 1ENCA 4DU9A 3H0GB 1X3GA 2NVYB 1RODA 1D5MC 1M90C 2L5TA 1EIGA 2B2YC 1LYLA 2TMPA 2B8GA 2NUCA 4C3JG 2CKZB 1LTAD 3I56A 2I07B 2Z4IA 3PUWA 3HOUH 4H02A 5EKLA 4DAVA 3GTLB 3SDZA 4JI3L 2F0IA 1TS5A 4K6DA 1PH5A 5LMNL 4FF2A 1SE2A 4LF8Q 2R7DA 5KEEA 1VQLA 3EROA 2JEBI 1RD9D 3CHBD 4IZ8A 4A3DG 3T53B 5IY0A 5C4XB 1VQCA 4B3MQ 1I4XA 3TREA 1CTMA 3SEBA 3MFGA 2EQSA 5I9PA 3BVMA 3IAYA 2E5LL 5M9OA 1N33L 3R3OA 3A7AB 1PLFA 3E0EA 4YY3L 2Z8LA 2JA6H 1TWGB 3H3VC 2F0GA 3X3NA 1DD2A 4OX9L 4KI0A 4JI8L 5D14A 2H5XA 3MXUA 4A3FB 1BDOA 4C2MH 4ZLTF 4HR7B 2UXDQ 2Q8RE 1L1OC 1FVIA 3ONAB 3W2DA 3K59A 1M1KC 1RL2A 2N88A 4ZKBB 1DCZA 1XWEA 4DKAC 1H9MA 2GVAA 3IFTA 4BBRH 4APVA 3CPFA 4PNYA 2PMZB 1TS4A 1AFPA 1CZGA 1E2VA 1QNUA 5JJIA 1CUKA 4ALPA 1RDPD 2VS1A 1EIFA 2XRQD 5LMUQ 3DXJC 2CH4A 1S40A 1FNUA 2CCZA 4JI2Q 2A74C 4BY7B 4XT1B 1R9TH 1VQ8A 2UUAQ 1E0BA 1IBMQ 1CT1D 1VQJA 1TU2B 4AH6A 4R4CA 3G71A 1SFOB 4FF1A 1L0YB 4C2MB 4HEDA 4ZRZA 2VQEL 2WACA 3U50C 3L2PA 2H4OA 2F4IA 1SYCA 4DR6L 1SYGA 3CMEA 2EYHA 2MNAA 1E2ZA 3OSOA 4Y7NH 4LFCQ 4DR5Q 2JEAI 1VDZA 2B3GA 4PMCA 4GKKL 3HOWH 1JICA 3KYHC 2CQAA 1WYDA 4NPSA 3I73A 2ZM6L 2K03A 1C4QA 4PV1C 4EQOA 1PRTD 1VQFA 2H1EA 4MTKA 1SNMA 4P74A 5I2XA 3S15H 3KF8A 3STBD 2E2DC 4RHRA 1IBKQ 2SOBA 1ASYA 4A3GH 2X69A 4YWMA 5M3MH 5C4JB 1MHWC 4CDFC 3CCQA 1IKMA 2MQHA 1K8AC 5M5WH 2VQFL 4XIGS 1TT2A 4XYQA 3BZKA 3PIPA 1UE6A 2JA8G 2IW3A 3QIAA 4BA2I 1VQOA 2B2VA 3ND9A 4Y7NB 3VYTA 1QVGA 1SNCA 3SK6A 1JOQA 4A3EG 1SJED 3HOWB 4B3SQ 3CCJA 3H91A 3OWFA 3TBIB 3I4MB 4JI0Q 1XPRA 2CFMA 3DHQA 5LL6S 1STBA 4G7OC 3TZDA 4L5SA 1LV9A 3S15B 1FNWA 1MI2A 2AQ3B 1V1PA 3K0XA 2YYZA 1PFSA 4K0KL 3M4OH 1Q86C 5M3MB 2F0NA 2QILA 4TRDA 2CWAA 3BVGA 1ZYRD 3CAMA 1GUGA 4A3KG 5EKIA 3EVQA 2JA5G 4LF6L 5JJKA 1A62A 3MWYW 2JJQA 3QO2A 1IHZA 5NUCA 3CCUA 4C3JH 3J81E 1UE1A 4NXML 3TRZA 2J0TD 2QGQA 5LMNQ 3QOJA 3R93A 3NWSA 3NENA 5T1IA 1BBXC 1JWUD 2EJGC 2KECA 3U4ZA 1QZGA 4IO9A 3KDFA 4OIKA 3A8IE 2E5LQ 1N33Q 1HHVA 3SK8A 3ICEA 2PZUA 2A6EC 3MEFA 1KNAA 4JI5L 1UAPA 5IGCA 4YY3Q 1PZID 2OTJA 5C0XI 4JOIA 3I4NG 2V1CC 2VW9A 1PDQA 2K5HA 1MSHA 4JI8Q 2UU9L 2F4VL 5HGQA 1HZBA 1XMOL 2B2TC 4IURA 1H9KA 3J7A5 1NSNS 1V1PB 4WFN3 4Y52H 2ZXPA 3M7NA 4RGTA 2RBMA 3Q24A 1NR4A 3BDOA 4C1NK 3PUZA 4BWGB 1JMCA 4BA1I 1F2ZA 1QB5D 4ZUJA 5JJLA 1GJXA 4QL5A 4DV4L 2ZJRA 1ASZA 3J80E 3T1YL 3RMHA 3E5SA 3VYUA 2HIVA 2JP1A 1CHPD 5ELEA 3S1NH 3KDFB 3PMFA 2K28A 3SXHA 4HJ9A 1ET6A 1EEID 2OQKA 4H44C 5BR8L 2AMCB 4EQNA 1AZQA 3T4AC 1G51A 1E1TA 1XXGA
chains in the Genus database with same CATH topology
2VQEQ 4LF7Q 1CSPA 3K81C 4X6AH 4GKJL 1VQDA 1Q81C 4DR6Q 2KCMA 2K52A 4IPDA 4A3CG 3BU2A 4JBMA 4KHPL 5C3EG 4NXNL 2UUCQ 1G291 1HH2P 1VQBA 1VQ6A 1V1QA 3GTLH 4PG3A 3PGZA 3HOVG 4DR2L 2UUBQ 3DLLA 4UY8C 2R92G 4GKKQ 5HY6A 4X64L 1CKNA 1Y1VH 2ZJPA 1YVCA 2B29A 1VQ7A 4JI4L 4JV5L 1X9NA 4JI6L 2VNUD 2IX0A 3JC66 5C0XG 4DR7Q 2Z6KA 4HIMA 1QZHA 4RG1A 3ERSX 1QUQB 1IYJB 4A3JH 2ZM6Q 3PO3G 3ZJYC 1VQKA 2OWOA 5C4XH 1VCIA 2LXJA 3PF4A 4JBKA 2HT1A 2VZAA 1V43A 4LF9L 4LF5L 3S2HH 4LF8L 2A19A 2KCTA 1EIYB 4KHPQ 4NXNQ 3HKZE 3M4PA 1TWGH 2Y0SE 3JAMi 3CMAA 2AKWB 1OXXK 2VQFQ 2R6GA 2VUMG 1K83H 1CKOA 2N8NA 1I94L 1I5FA 4JYAL 5DLQE 2MFIA 3I4OA 3TS0A 1PH5A 4JI4Q 2JA6G 1KHIA 3GD7A 3K8AA 2KHIA 4LUZA 4A3FH 5FLMH 1VQMA 4JI6Q 4DPGA 1PH7A 1XNRQ 1YJNA 1DGSA 2RCNA 2IHFA 5K36G 5FLXc 1YZ6A 1QVCA 4BY1H 1Y1WG 1XPOA 3HKZG 1PHJA 2YTVA 1BKBA 2Y0SG 3CC2A 3OW2A 3FKIG 2OQ0A 1VQ5A 4IJLA 4R4OA 3KF8B 2E2IH 1TWCH 4LF9Q 3UE1A 4X62Q 3S1MH 1N32L 2ES2A 3GTKH 4GOPC 1Q82C 1GM5A 1OXVA 3EN2A 4A3EH 1I3QH 1HZAA 3PIOA 4PZ8A 3FHWA 1Q8KA 2D62A 2JQOA 2LSSA 3F1ZA 3IRBA 1IBLL 1WOCA 4GNXA 4LWCA 1HR0L 5C44G 3I7FA 1I94Q 4YCUA 2ZJQA 4BBRG 1WFQA 4JYAQ 1VQ4A 1PYSB 4A3MH 1JJCB 1D7QA 4LFBQ 4R1JA 3U4VA 3CC4A 2I5MX 3G48A 4AYBE 4QIWE 1CSQA 3WWVA 5IP9G 3CCEA 2JE6I 4A3IG 3PO2G 4A3DH 4BY7H 1HNWL 1HNZL 3K80C 5C0XJ 1N34L 2GN5A 3RN2A 4LF6Q 3HOZH 1JJ2A 2UXBL 1GO3E 1L1OA 4YWKA 4A3KH 3PUYA 3RZOH 1SFOH 1XNQQ 1N32Q 5LMUL 3H3VH 2CQOA 5IP7G 4AYBG 1KXLA 4DV3Q 1IL2A 5IYCG 1VQAA 4JI2L 4L5RC 1KL9A 4EX5A 1EQQA 2ASBA 1HR0Q 4JOIC 3F2DA 2GVBA 1X3FA 2BH8A 2UUAL 3CCLA 1K3RA 1YI2A 3GTQH 2F3IA 4R4IA 4DNIA 4AQYL 4DV7L 1FJGL 2B63H 5C3EH 4A3LG 4LF4L 4JC0A 3KF6A 4IPGA 4IFDG 5M5XH 5GAGC 2E2JH 2I0QA 1FGUA 1XJVA 4A75A 1PH2A 1P16A 1HNZQ 4MZ9A 4RMFA 4GLVB 1N34Q 4JI5Q 1X54A 2HQLA 3EIVA 4YHHL 3F2CA 3CF5A 4BXXH 1BVSA 2R7FA 4P73A 3DM3A 1MJCA 4LFAL 1KQSA 4IJHA 3UDIA 4GS3A 1YNXA 1PYBA 4LFCL 4DR5L 1MJEA 3UDXA 4DK6C 1KIXA 3J81i 2ALYB 4X65L 1WCMH 2L15A 3Q8DA 3CXCA 3GTMH 1K9MC 2R93G 1L0WA 2NN6I 4GNXB 1X65A 3HKSA 3H0GG 4TQUS 3ULPA 1XMOQ 2NZHA 1VQPA 3HFZB 5C4JH 5FJ8G 2C35B 1TWHH 2UXCQ 1E24A 1E1OA 5M5YH 1N8RC 2IT1A 1OXSC 4DV6L 1SN8A 2Q2UA 4A3GG 4DR1L 4DUZQ 1IXRA 5ELOA 4AIMA 1VQNA 3G4SA 2NVYH 5GAEC 3A5UA 2D0PA 4R4TA 3KJPA 1D8LA 1XMQL 4HJAA 2PI2A 2Q2HA 1L1OB 3PSIA 3HOXG 1OTCA 1B8AA 1OXUA 1Y1VG 3H3VI 1EQRA 1HZCA 2BA0A 4DV4Q 2A1AA 2MO0A 4JI7L 4A3BH 4JBJA 2ATWA 2PQAB 4A3JG 2WB1E 2XTIA 5AJ3Q 1EUJA 2YTYA 4DV2L 3T1YQ 1YJ9A 3D0FA 3S1QH 2OTLA 1EYGA 4BBSG 2KENA 1YJWA 3I4MH 4DV5L 4HJ5A 4O0AA 5IE8A 5BR8Q 1YHQA 3GDEA 5IYBH 4OWTB 1W2BA 1FL0A 4IFDJ 3AFQA 3T1HQ 1V9PA 4JI1Q 4A4IA 1B7YB 1U0LA 4GN5A 1TWAH 2WB1G 2Z6KC 4YWLA 5IWAL 5LMNW 3BJUA 2K50A 4HIDA 1XMQQ 4GKJQ 1G6PA 4LUOA 2VY3A 4JI0L 1KD1C 5J3BA 3UDGA 4POGA 4X66L 1K0RA 1PH8A 2K75A 4OO1I 3NEMA 1YHAA 3L0OA 1YITA 4BY1G 4DR2Q 1X3GA 2HHHL 4B3ML 4A3CH 1J5EL 1M90C 4GLAC 4LUVA 3GTJH 4OXPA 1UE7A 3J80i 4X64Q 3S16H 1Q46A 5JEAG 1Q1EA 1WJJA 3HOVH 1LYLA 2R92H 1U5KA 1X6OA 5GAHC 2CKZB 3AYHB 3I56A 2AWNA 3PUWA 3HOUH 4H02A 2JA8H 3KFUA 3ULJA 2K5VA 3KOJA 1GD7A 3K7AH 4JI3L 1FJGQ 3GTGH 1K8GA 4LF5Q 2NN6G 5LMNL 3HOYG 5M3FG 4UP9A 4LF8Q 3CCMA 2R7DA 3E9HA 1VQLA 2BA1A 2JEBI 3A5ZB 2JK8A 4HIOA 1PH9A 1UE5A 2UXDL 3L7ZC 2IY5B 4A3DG 1PH3A 3I55A 5IY0A 1VQCA 4B3MQ 2HHHQ 3KJOA 1UEBA 3TREA 3OTOL 3HOZG 4DR4L 4DAYB 3U58A 2EQSA 1EOVA 1Y14B 1TWFH 2E5LL 1N33L 1CKNB 2JA7G 3PUXA 4DV1L 4GNXC 1CKMA 3E0EA 4YY3L 3RZDH 3CCRA 2JA6H 1C7YA 2KHJA 1EFWA 3RN5A 1PH1A 1A63A 1I6HH 4A76A 1UWVA 2RHQB 4JI3Q 4OX9L 2HIXA 1Y1WH 4KI0A 4JI8L 2YTXA 1RIPA 2H5XA 1KC8C 2JA5H 2JA9A 1B70B 2AWOA 2K14A 1VQEA 3FKIH 4O2DA 4P75A 3D31A 1KAWA 3RLOA 4C2MH 1VQIA 4TVAB 3CPWA 2R7ZH 1E3PA 2UXDQ 5IYDG 1L1OC 1FVIA 1IBLQ 2I5HA 2N78A 4MTNA 3CP0A 1M1KC 4DR3L 1IBML 1RL2A 1C9OA 1N36L 4J15A 3UDFA 4DKAC 2I5LX 4BXXG 3STBC 2GVAA 3AQQA 2DUDA 4BBRH 1LUZA 5JEAJ 4APVA 1HNWQ 3CPFA 1IZ6A 2KBNA 4QY7A 3CCSA 1PH6A 1EWIA 4OWXB 1HNXL 4B3TL 2IX1A 2UXBQ 1S72A 1PV4A 4OX9Q 5JJIA 1CUKA 1E7ZA 4ALPA 4A93H 3AEVA 2VS1A 4DK3C 3PUVA 4DV0L 1EIFA 2LXKA 3TQYA 5LMUQ 4HIKA 1Z47A 2DGYA 2IHEA 1S40A 2CCZA 1X3EA 4JBWA 1NBWA 1Q12A 4JI2Q 3JAMc 3I4NH 4PZ7A 3B6YA 4DUYL 1R9TH 3UE0A 4KLKA 1VQ8A 2E2HH 2UUAQ 2N3SA 1IBMQ 2RF4A 1VQJA 4AQYQ 1QUQA 4DV7Q 1N36Q 4LF4Q 4AH6A 4R4CA 4K0KQ 2PI2E 3G71A 1L2FA 2CWPA 2FXQA 1I50H 3TS2A 4UP8A 4HJ7A 4A3LH 2VQEL 1Q1BA 4LF7L 3TEHB 3U50C 1IBKL 3L2PA 4A3BG 1O7IA 1A8VA 3ER0A 2EXDA 4DR6L 4JCVE 4YHHQ 3CMEA 4OONA 1E22A 3CW2C 4LFAQ 2MNAA 3W1GA 4L5QA 1LTLA 5ELNA 4Y7NH 4DR5Q 4LFCQ 2JEAI 3I4MG 2VL6A 4X65Q 1HJPA 1JJGA 2UUBL 4GN3B 3CQZH 2B3GA 3MXNB 5FJ8H 3RNUA 1LM0A 3I2ZA 4EQ5A 4GKKL 1A0IA 1S3OA 3HOWH 1BBWA 5C4XG 3F8TA 3KYHC 4XTCS 1WYDA 4NPSA 4DR7L 4FDBA 1MIUA 2R93H 2ZM6L 4JG2A 4IPHA 4NB3A 4JV5Q 4B3RL 3KF6B 3E9IA 1VQFA 4P74A 4UP7A 4POFA 4UPAA 4DV6Q 4DR1Q 1PA6A 3S15H 2ZTCA 3STBD 1IBKQ 4B3SL 1ASYA 2NVXH 4A3GH 4YWMA 3M9BA 3W1BA 3FP9A 4PZ6A 5M3MH 2A8VA 3SGIA 3EBEA 3CCQA 2N49A 2MQHA 1K73C 1K8AC 4JI7Q 5M5WH 2VQFL 1VS0A 4XIGS 5FLMG 4A3FG 4C3HH 3M85A 1VQ9A 3HOXH 1PVOA 1AH9A 4YCWA 4GN4B 1P8LA 1YIJA 1N9WA 3BZKA 2NVTH 1C0AA 4C3IH 2PMZE 3PIPA 3S1RH 1UE6A 4DV2Q 1XNRL 2K4KA 2RHSB 2JA8G 3HOUG 2Q2TA 4BA2I 1VQOA 1SMXA 4DV5Q 3M4QA 4B3RQ 4IOAA 2AHOB 4GLXA 1QVGA 1AE3A 4BBSH 1JT8A 3RLFA 4A3EG 4IPCA 3PF5A 3S14H 4IFDI 1TXYA 2BH2A 2OCEA 1VQHA 4X62L 3CCJA 4B3SQ 5IWAQ 3NBHB 4JI0Q 1HR0W 2YU9H 4L5TA 2CFMA 4A3MG 1XPRA 1SROA 3J81c 4HJ8A 4X66Q 4L5SA 1GVPA 3W5OA 1NJIC 2ZTEA 3K0XA 2YYZA 1J5EQ 4BY7G 1PFSA 4K0KL 3M4OH 2E8GA 1WI5A 1Q86C 3G6EA 2CWAA 2NZOA 4GOPA 2VUMH 4ME3A 3CAMA 4A3KG 2JA5G 3BZCA 4LF6L 3GTPH 2NVQH 5JJKA 1A62A 2QA4A 3A74A 2R7ZG 2JJQA 1SLJA 3CCUA 4C3JH 4NXML 1UE1A 1XNQL 1T9HA 3KLWA 1VQGA 1BBUA 3TRZA 2QGQA 5LMNQ 4DV3L 4OWWB 1MKHA 1X56A 2B63G 3NENA 4WJ4A 2D0OA 3VDYA 2EIFA 1Q7YC 4LFBL 4LNQA 3S17H 3U4ZA 4YCVA 3HOYH 5M3FH 1QZGA 3PV0A 2WAQE 3KDFA 4IO9A 1XTDA 3OTOQ 1J6QA 4MNOA 4DR4Q 1NE3A 3LGJA 1SE8A 5E7NA 5GROA 1X55A 2E5LQ 1N33Q 3NELA 5GADC 3ICEA 3ULLA 5C44H 4A93G 3MEFA 4DV1Q 1NMGA 4JI5L 4YY3Q 3A0JA 1NTGA 2ZTDA 1HZ9A 1OXTA 3GO5A 5C0XI 1WCMG 2JA7H 4OO1G 4A3IH 3PO2H 2OTJA 4JOIA 5IP9H 3I4NG 2Z0SA 4NXMQ 2V1CC 2XGTA 2WAQG 2VW9A 1PH4A 2K5HA 4IOCA 4JI8Q 4QGUA 1KRSA 3S24A 2UU9L 2PQAA 3J81j 2F4VL 1W3SA 3RR5A 5HGQA 3CC7A 1H95A 3PCOB 1HZBA 5IT9c 1XMOL 3CCVA 1YBYA 3J7A5 3H15A 5IP7H 3J80c 4DR3Q 4Y52H 2K5NA 1SR3A 5IYCH 2UXCL 5IYDH 1NMFA 1Z9FA 1KRTA 2WFWA 4PMWA 3M7NA 4DUZL 3K7UC 4P72A 3CD6A 3AFPA 4QJFA 1JB7A 3S2DH 1JE5A 4GOPB 3PUZA 4DAMA 5GQOA 1AE2A 5H1SE 1JMCA 1YEZA 4BA1I 3J7ZC 1NY4A 1HNXQ 4B3TQ 4LW1A 5JJLA 3GTOH 4QL5A 3HOWG 3OYYA 4DV4L 1GKHA 2UUCL 2UU9Q 2WP8J 2ZJRA 1ASZA 4DV0Q 1QVFA 2ID0A 4R4QA 2F4VQ 5AJ3L 3T1YL 2QEXA 4P71A 2HIVA 5IYBG 4DUYQ 3S1NH 3PO3H 2PNHA 3KDFB 4HJ9A 2Q2IA 3F2BA 3RLNA 2OQKA 4KHZA 5BR8L 4WJ3M 2AMCB 2MO1A 4QQBX 5M3MG 1G51A 3T1HL 1E1TA 1SRUA 3H0GH 5EAYA 1XPUA 3M3YH 2YV5A 4JI1L 2F52A 1YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE Q;  4LF7 Q;  1CSP A;  3K81 C;  4X6A H;  4GKJ L;  1VQD A;  1Q81 C;  4DR6 Q;  2KCM A;  2K52 A;  4IPD A;  4A3C G;  3BU2 A;  4JBM A;  4KHP L;  5C3E G;  4NXN L;  2UUC Q;  1G29 1;  1HH2 P;  1VQB A;  1VQ6 A;  1V1Q A;  3GTL H;  4PG3 A;  3PGZ A;  3HOV G;  4DR2 L;  2UUB Q;  3DLL A;  4UY8 C;  2R92 G;  4GKK Q;  5HY6 A;  4X64 L;  1CKN A;  1Y1V H;  2ZJP A;  1YVC A;  2B29 A;  1VQ7 A;  4JI4 L;  4JV5 L;  1X9N A;  4JI6 L;  2VNU D;  2IX0 A;  3JC6 6;  5C0X G;  4DR7 Q;  2Z6K A;  4HIM A;  1QZH A;  4RG1 A;  3ERS X;  1QUQ B;  1IYJ B;  4A3J H;  2ZM6 Q;  3PO3 G;  3ZJY C;  1VQK A;  2OWO A;  5C4X H;  1VCI A;  2LXJ A;  3PF4 A;  4JBK A;  2HT1 A;  2VZA A;  1V43 A;  4LF9 L;  4LF5 L;  3S2H H;  4LF8 L;  2A19 A;  2KCT A;  1EIY B;  4KHP Q;  4NXN Q;  3HKZ E;  3M4P A;  1TWG H;  2Y0S E;  3JAM i;  3CMA A;  2AKW B;  1OXX K;  2VQF Q;  2R6G A;  2VUM G;  1K83 H;  1CKO A;  2N8N A;  1I94 L;  1I5F A;  4JYA L;  5DLQ E;  2MFI A;  3I4O A;  3TS0 A;  1PH5 A;  4JI4 Q;  2JA6 G;  1KHI A;  3GD7 A;  3K8A A;  2KHI A;  4LUZ A;  4A3F H;  5FLM H;  1VQM A;  4JI6 Q;  4DPG A;  1PH7 A;  1XNR Q;  1YJN A;  1DGS A;  2RCN A;  2IHF A;  5K36 G;  5FLX c;  1YZ6 A;  1QVC A;  4BY1 H;  1Y1W G;  1XPO A;  3HKZ G;  1PHJ A;  2YTV A;  1BKB A;  2Y0S G;  3CC2 A;  3OW2 A;  3FKI G;  2OQ0 A;  1VQ5 A;  4IJL A;  4R4O A;  3KF8 B;  2E2I H;  1TWC H;  4LF9 Q;  3UE1 A;  4X62 Q;  3S1M H;  1N32 L;  2ES2 A;  3GTK H;  4GOP C;  1Q82 C;  1GM5 A;  1OXV A;  3EN2 A;  4A3E H;  1I3Q H;  1HZA A;  3PIO A;  4PZ8 A;  3FHW A;  1Q8K A;  2D62 A;  2JQO A;  2LSS A;  3F1Z A;  3IRB A;  1IBL L;  1WOC A;  4GNX A;  4LWC A;  1HR0 L;  5C44 G;  3I7F A;  1I94 Q;  4YCU A;  2ZJQ A;  4BBR G;  1WFQ A;  4JYA Q;  1VQ4 A;  1PYS B;  4A3M H;  1JJC B;  1D7Q A;  4LFB Q;  4R1J A;  3U4V A;  3CC4 A;  2I5M X;  3G48 A;  4AYB E;  4QIW E;  1CSQ A;  3WWV A;  5IP9 G;  3CCE A;  2JE6 I;  4A3I G;  3PO2 G;  4A3D H;  4BY7 H;  1HNW L;  1HNZ L;  3K80 C;  5C0X J;  1N34 L;  2GN5 A;  3RN2 A;  4LF6 Q;  3HOZ H;  1JJ2 A;  2UXB L;  1GO3 E;  1L1O A;  4YWK A;  4A3K H;  3PUY A;  3RZO H;  1SFO H;  1XNQ Q;  1N32 Q;  5LMU L;  3H3V H;  2CQO A;  5IP7 G;  4AYB G;  1KXL A;  4DV3 Q;  1IL2 A;  5IYC G;  1VQA A;  4JI2 L;  4L5R C;  1KL9 A;  4EX5 A;  1EQQ A;  2ASB A;  1HR0 Q;  4JOI C;  3F2D A;  2GVB A;  1X3F A;  2BH8 A;  2UUA L;  3CCL A;  1K3R A;  1YI2 A;  3GTQ H;  2F3I A;  4R4I A;  4DNI A;  4AQY L;  4DV7 L;  1FJG L;  2B63 H;  5C3E H;  4A3L G;  4LF4 L;  4JC0 A;  3KF6 A;  4IPG A;  4IFD G;  5M5X H;  5GAG C;  2E2J H;  2I0Q A;  1FGU A;  1XJV A;  4A75 A;  1PH2 A;  1P16 A;  1HNZ Q;  4MZ9 A;  4RMF A;  4GLV B;  1N34 Q;  4JI5 Q;  1X54 A;  2HQL A;  3EIV A;  4YHH L;  3F2C A;  3CF5 A;  4BXX H;  1BVS A;  2R7F A;  4P73 A;  3DM3 A;  1MJC A;  4LFA L;  1KQS A;  4IJH A;  3UDI A;  4GS3 A;  1YNX A;  1PYB A;  4LFC L;  4DR5 L;  1MJE A;  3UDX A;  4DK6 C;  1KIX A;  3J81 i;  2ALY B;  4X65 L;  1WCM H;  2L15 A;  3Q8D A;  3CXC A;  3GTM H;  1K9M C;  2R93 G;  1L0W A;  2NN6 I;  4GNX B;  1X65 A;  3HKS A;  3H0G G;  4TQU S;  3ULP A;  1XMO Q;  2NZH A;  1VQP A;  3HFZ B;  5C4J H;  5FJ8 G;  2C35 B;  1TWH H;  2UXC Q;  1E24 A;  1E1O A;  5M5Y H;  1N8R C;  2IT1 A;  1OXS C;  4DV6 L;  1SN8 A;  2Q2U A;  4A3G G;  4DR1 L;  4DUZ Q;  1IXR A;  5ELO A;  4AIM A;  1VQN A;  3G4S A;  2NVY H;  5GAE C;  3A5U A;  2D0P A;  4R4T A;  3KJP A;  1D8L A;  1XMQ L;  4HJA A;  2PI2 A;  2Q2H A;  1L1O B;  3PSI A;  3HOX G;  1OTC A;  1B8A A;  1OXU A;  1Y1V G;  3H3V I;  1EQR A;  1HZC A;  2BA0 A;  4DV4 Q;  2A1A A;  2MO0 A;  4JI7 L;  4A3B H;  4JBJ A;  2ATW A;  2PQA B;  4A3J G;  2WB1 E;  2XTI A;  5AJ3 Q;  1EUJ A;  2YTY A;  4DV2 L;  3T1Y Q;  1YJ9 A;  3D0F A;  3S1Q H;  2OTL A;  1EYG A;  4BBS G;  2KEN A;  1YJW A;  3I4M H;  4DV5 L;  4HJ5 A;  4O0A A;  5IE8 A;  5BR8 Q;  1YHQ A;  3GDE A;  5IYB H;  4OWT B;  1W2B A;  1FL0 A;  4IFD J;  3AFQ A;  3T1H Q;  1V9P A;  4JI1 Q;  4A4I A;  1B7Y B;  1U0L A;  4GN5 A;  1TWA H;  2WB1 G;  2Z6K C;  4YWL A;  5IWA L;  5LMN W;  3BJU A;  2K50 A;  4HID A;  1XMQ Q;  4GKJ Q;  1G6P A;  4LUO A;  2VY3 A;  4JI0 L;  1KD1 C;  5J3B A;  3UDG A;  4POG A;  4X66 L;  1K0R A;  1PH8 A;  2K75 A;  4OO1 I;  3NEM A;  1YHA A;  3L0O A;  1YIT A;  4BY1 G;  4DR2 Q;  1X3G A;  2HHH L;  4B3M L;  4A3C H;  1J5E L;  1M90 C;  4GLA C;  4LUV A;  3GTJ H;  4OXP A;  1UE7 A;  3J80 i;  4X64 Q;  3S16 H;  1Q46 A;  5JEA G;  1Q1E A;  1WJJ A;  3HOV H;  1LYL A;  2R92 H;  1U5K A;  1X6O A;  5GAH C;  2CKZ B;  3AYH B;  3I56 A;  2AWN A;  3PUW A;  3HOU H;  4H02 A;  2JA8 H;  3KFU A;  3ULJ A;  2K5V A;  3KOJ A;  1GD7 A;  3K7A H;  4JI3 L;  1FJG Q;  3GTG H;  1K8G A;  4LF5 Q;  2NN6 G;  5LMN L;  3HOY G;  5M3F G;  4UP9 A;  4LF8 Q;  3CCM A;  2R7D A;  3E9H A;  1VQL A;  2BA1 A;  2JEB I;  3A5Z B;  2JK8 A;  4HIO A;  1PH9 A;  1UE5 A;  2UXD L;  3L7Z C;  2IY5 B;  4A3D G;  1PH3 A;  3I55 A;  5IY0 A;  1VQC A;  4B3M Q;  2HHH Q;  3KJO A;  1UEB A;  3TRE A;  3OTO L;  3HOZ G;  4DR4 L;  4DAY B;  3U58 A;  2EQS A;  1EOV A;  1Y14 B;  1TWF H;  2E5L L;  1N33 L;  1CKN B;  2JA7 G;  3PUX A;  4DV1 L;  4GNX C;  1CKM A;  3E0E A;  4YY3 L;  3RZD H;  3CCR A;  2JA6 H;  1C7Y A;  2KHJ A;  1EFW A;  3RN5 A;  1PH1 A;  1A63 A;  1I6H H;  4A76 A;  1UWV A;  2RHQ B;  4JI3 Q;  4OX9 L;  2HIX A;  1Y1W H;  4KI0 A;  4JI8 L;  2YTX A;  1RIP A;  2H5X A;  1KC8 C;  2JA5 H;  2JA9 A;  1B70 B;  2AWO A;  2K14 A;  1VQE A;  3FKI H;  4O2D A;  4P75 A;  3D31 A;  1KAW A;  3RLO A;  4C2M H;  1VQI A;  4TVA B;  3CPW A;  2R7Z H;  1E3P A;  2UXD Q;  5IYD G;  1L1O C;  1FVI A;  1IBL Q;  2I5H A;  2N78 A;  4MTN A;  3CP0 A;  1M1K C;  4DR3 L;  1IBM L;  1RL2 A;  1C9O A;  1N36 L;  4J15 A;  3UDF A;  4DKA C;  2I5L X;  4BXX G;  3STB C;  2GVA A;  3AQQ A;  2DUD A;  4BBR H;  1LUZ A;  5JEA J;  4APV A;  1HNW Q;  3CPF A;  1IZ6 A;  2KBN A;  4QY7 A;  3CCS A;  1PH6 A;  1EWI A;  4OWX B;  1HNX L;  4B3T L;  2IX1 A;  2UXB Q;  1S72 A;  1PV4 A;  4OX9 Q;  5JJI A;  1CUK A;  1E7Z A;  4ALP A;  4A93 H;  3AEV A;  2VS1 A;  4DK3 C;  3PUV A;  4DV0 L;  1EIF A;  2LXK A;  3TQY A;  5LMU Q;  4HIK A;  1Z47 A;  2DGY A;  2IHE A;  1S40 A;  2CCZ A;  1X3E A;  4JBW A;  1NBW A;  1Q12 A;  4JI2 Q;  3JAM c;  3I4N H;  4PZ7 A;  3B6Y A;  4DUY L;  1R9T H;  3UE0 A;  4KLK A;  1VQ8 A;  2E2H H;  2UUA Q;  2N3S A;  1IBM Q;  2RF4 A;  1VQJ A;  4AQY Q;  1QUQ A;  4DV7 Q;  1N36 Q;  4LF4 Q;  4AH6 A;  4R4C A;  4K0K Q;  2PI2 E;  3G71 A;  1L2F A;  2CWP A;  2FXQ A;  1I50 H;  3TS2 A;  4UP8 A;  4HJ7 A;  4A3L H;  2VQE L;  1Q1B A;  4LF7 L;  3TEH B;  3U50 C;  1IBK L;  3L2P A;  4A3B G;  1O7I A;  1A8V A;  3ER0 A;  2EXD A;  4DR6 L;  4JCV E;  4YHH Q;  3CME A;  4OON A;  1E22 A;  3CW2 C;  4LFA Q;  2MNA A;  3W1G A;  4L5Q A;  1LTL A;  5ELN A;  4Y7N H;  4DR5 Q;  4LFC Q;  2JEA I;  3I4M G;  2VL6 A;  4X65 Q;  1HJP A;  1JJG A;  2UUB L;  4GN3 B;  3CQZ H;  2B3G A;  3MXN B;  5FJ8 H;  3RNU A;  1LM0 A;  3I2Z A;  4EQ5 A;  4GKK L;  1A0I A;  1S3O A;  3HOW H;  1BBW A;  5C4X G;  3F8T A;  3KYH C;  4XTC S;  1WYD A;  4NPS A;  4DR7 L;  4FDB A;  1MIU A;  2R93 H;  2ZM6 L;  4JG2 A;  4IPH A;  4NB3 A;  4JV5 Q;  4B3R L;  3KF6 B;  3E9I A;  1VQF A;  4P74 A;  4UP7 A;  4POF A;  4UPA A;  4DV6 Q;  4DR1 Q;  1PA6 A;  3S15 H;  2ZTC A;  3STB D;  1IBK Q;  4B3S L;  1ASY A;  2NVX H;  4A3G H;  4YWM A;  3M9B A;  3W1B A;  3FP9 A;  4PZ6 A;  5M3M H;  2A8V A;  3SGI A;  3EBE A;  3CCQ A;  2N49 A;  2MQH A;  1K73 C;  1K8A C;  4JI7 Q;  5M5W H;  2VQF L;  1VS0 A;  4XIG S;  5FLM G;  4A3F G;  4C3H H;  3M85 A;  1VQ9 A;  3HOX H;  1PVO A;  1AH9 A;  4YCW A;  4GN4 B;  1P8L A;  1YIJ A;  1N9W A;  3BZK A;  2NVT H;  1C0A A;  4C3I H;  2PMZ E;  3PIP A;  3S1R H;  1UE6 A;  4DV2 Q;  1XNR L;  2K4K A;  2RHS B;  2JA8 G;  3HOU G;  2Q2T A;  4BA2 I;  1VQO A;  1SMX A;  4DV5 Q;  3M4Q A;  4B3R Q;  4IOA A;  2AHO B;  4GLX A;  1QVG A;  1AE3 A;  4BBS H;  1JT8 A;  3RLF A;  4A3E G;  4IPC A;  3PF5 A;  3S14 H;  4IFD I;  1TXY A;  2BH2 A;  2OCE A;  1VQH A;  4X62 L;  3CCJ A;  4B3S Q;  5IWA Q;  3NBH B;  4JI0 Q;  1HR0 W;  2YU9 H;  4L5T A;  2CFM A;  4A3M G;  1XPR A;  1SRO A;  3J81 c;  4HJ8 A;  4X66 Q;  4L5S A;  1GVP A;  3W5O A;  1NJI C;  2ZTE A;  3K0X A;  2YYZ A;  1J5E Q;  4BY7 G;  1PFS A;  4K0K L;  3M4O H;  2E8G A;  1WI5 A;  1Q86 C;  3G6E A;  2CWA A;  2NZO A;  4GOP A;  2VUM H;  4ME3 A;  3CAM A;  4A3K G;  2JA5 G;  3BZC A;  4LF6 L;  3GTP H;  2NVQ H;  5JJK A;  1A62 A;  2QA4 A;  3A74 A;  2R7Z G;  2JJQ A;  1SLJ A;  3CCU A;  4C3J H;  4NXM L;  1UE1 A;  1XNQ L;  1T9H A;  3KLW A;  1VQG A;  1BBU A;  3TRZ A;  2QGQ A;  5LMN Q;  4DV3 L;  4OWW B;  1MKH A;  1X56 A;  2B63 G;  3NEN A;  4WJ4 A;  2D0O A;  3VDY A;  2EIF A;  1Q7Y C;  4LFB L;  4LNQ A;  3S17 H;  3U4Z A;  4YCV A;  3HOY H;  5M3F H;  1QZG A;  3PV0 A;  2WAQ E;  3KDF A;  4IO9 A;  1XTD A;  3OTO Q;  1J6Q A;  4MNO A;  4DR4 Q;  1NE3 A;  3LGJ A;  1SE8 A;  5E7N A;  5GRO A;  1X55 A;  2E5L Q;  1N33 Q;  3NEL A;  5GAD C;  3ICE A;  3ULL A;  5C44 H;  4A93 G;  3MEF A;  4DV1 Q;  1NMG A;  4JI5 L;  4YY3 Q;  3A0J A;  1NTG A;  2ZTD A;  1HZ9 A;  1OXT A;  3GO5 A;  5C0X I;  1WCM G;  2JA7 H;  4OO1 G;  4A3I H;  3PO2 H;  2OTJ A;  4JOI A;  5IP9 H;  3I4N G;  2Z0S A;  4NXM Q;  2V1C C;  2XGT A;  2WAQ G;  2VW9 A;  1PH4 A;  2K5H A;  4IOC A;  4JI8 Q;  4QGU A;  1KRS A;  3S24 A;  2UU9 L;  2PQA A;  3J81 j;  2F4V L;  1W3S A;  3RR5 A;  5HGQ A;  3CC7 A;  1H95 A;  3PCO B;  1HZB A;  5IT9 c;  1XMO L;  3CCV A;  1YBY A;  3J7A 5;  3H15 A;  5IP7 H;  3J80 c;  4DR3 Q;  4Y52 H;  2K5N A;  1SR3 A;  5IYC H;  2UXC L;  5IYD H;  1NMF A;  1Z9F A;  1KRT A;  2WFW A;  4PMW A;  3M7N A;  4DUZ L;  3K7U C;  4P72 A;  3CD6 A;  3AFP A;  4QJF A;  1JB7 A;  3S2D H;  1JE5 A;  4GOP B;  3PUZ A;  4DAM A;  5GQO A;  1AE2 A;  5H1S E;  1JMC A;  1YEZ A;  4BA1 I;  3J7Z C;  1NY4 A;  1HNX Q;  4B3T Q;  4LW1 A;  5JJL A;  3GTO H;  4QL5 A;  3HOW G;  3OYY A;  4DV4 L;  1GKH A;  2UUC L;  2UU9 Q;  2WP8 J;  2ZJR A;  1ASZ A;  4DV0 Q;  1QVF A;  2ID0 A;  4R4Q A;  2F4V Q;  5AJ3 L;  3T1Y L;  2QEX A;  4P71 A;  2HIV A;  5IYB G;  4DUY Q;  3S1N H;  3PO3 H;  2PNH A;  3KDF B;  4HJ9 A;  2Q2I A;  3F2B A;  3RLN A;  2OQK A;  4KHZ A;  5BR8 L;  4WJ3 M;  2AMC B;  2MO1 A;  4QQB X;  5M3M G;  1G51 A;  3T1H L;  1E1T A;  1SRU A;  3H0G H;  5EAY A;  1XPU A;  3M3Y H;  2YV5 A;  4JI1 L;  2F52 A;  1YHB A; 
#chains in the Genus database with same CATH topology
 2VQE Q;  2G5D A;  1RHP A;  4DGZ A;  3K81 C;  1HQM C;  3N52 A;  3ZYY X;  4DR6 Q;  3R8B A;  4IPD A;  3BU2 A;  3OMC A;  4ID6 A;  4NXN L;  2K01 A;  1HH2 P;  1SBB B;  4KHV A;  5E1F A;  3HOV G;  3SE0 A;  4GKK Q;  4X64 L;  1Y1V H;  1G2T A;  2ZJP A;  1YVC A;  3NP8 A;  4JI4 L;  1X9N A;  2IX0 A;  2G9H D;  1D1K A;  3MEH A;  3H94 A;  2ZM6 Q;  4A3J H;  2BE5 D;  2OWO A;  1VCI A;  2LXJ A;  1HA5 A;  3PF4 A;  1Y8N B;  1U4L A;  4LF5 L;  3S1N B;  4RGO S;  2Q8I B;  3S2H H;  2KCT A;  2B2Y A;  3HKZ E;  2R93 B;  5KYL A;  3JAM i;  1TKW B;  1OXX K;  2AKW B;  2VQF Q;  3NBI A;  1B9M A;  2AQ2 B;  2DNE A;  4LUZ A;  5A35 A;  2EY1 A;  4J1M A;  1LAB A;  1SSO A;  5FLX c;  1Y1W G;  3TDQ A;  3CRK C;  1EY6 A;  1D1I A;  2Y0S G;  1AP0 A;  5CV4 A;  5JEA H;  3FKI G;  1LT4 D;  1VQ5 A;  4IJL A;  4WJW A;  3HOX B;  2XWJ B;  1Y1V B;  2CW0 D;  1N32 L;  1OXV A;  4A3E H;  1I3Q H;  3FHW A;  4A3J B;  1DOK A;  1Z6H A;  1YNN D;  2D62 A;  3F1Z A;  4KY5 A;  4RCO A;  4R8I A;  4BBS B;  2ZJQ A;  2IWH A;  1Z7T A;  1WVL A;  4K0K Q;  4A3I G;  3PO2 G;  1DYQ A;  3WWV A;  1WTQ A;  2JE6 I;  1GHK A;  1FNV A;  5J1Z A;  1S5B D;  1HNW L;  2R61 A;  5C0X J;  2GN5 A;  4LF6 Q;  2WB1 B;  4K6L A;  5C5M A;  1L1O A;  4A3K H;  3RZO H;  3H3V H;  5IP7 G;  2OT2 A;  4L5R C;  1BQQ T;  3C46 A;  1Y8O B;  2DNC A;  2NVQ B;  1X3F A;  5IOD A;  4HSV A;  3CCL A;  3GTQ H;  1YI2 A;  4AQY L;  4R4I A;  1EFI D;  4LF4 L;  3SK5 A;  3KF6 A;  1XJV A;  1I3Q B;  3EJI A;  1P16 A;  2M00 A;  4F8M A;  5KRU A;  1HNZ Q;  1HFN A;  2TSS A;  2L12 A;  4JI5 Q;  2PNR C;  1BCP D;  4KMU C;  1JWM D;  2HCC A;  3F2C A;  1HQR D;  4YHH L;  1YNJ D;  3CF5 A;  5M3F B;  3S17 B;  1BVS A;  4P73 A;  4OEM B;  3Q22 A;  3UDI A;  4GZY C;  4X65 L;  3BZD B;  4PQX A;  3NXW A;  4JPB W;  1WTW A;  4K2L A;  4HCE A;  5TSS A;  3H0G G;  3O13 A;  1XMO Q;  3HFZ B;  3DWP A;  1TWH H;  2VB2 X;  1N8R C;  2ICI A;  2IT1 A;  1OXS C;  4KKT A;  1HRJ A;  3FEW X;  3MVV A;  1B50 A;  4HMI A;  2C9O A;  1D8L A;  1GUW A;  2PI2 A;  2Q2H A;  1L1O B;  4C3H G;  3PSI A;  5G3L F;  4R8N A;  1CI3 M;  1U4P A;  2FJ2 A;  4DV4 Q;  4A3B H;  4EQP A;  1E2W A;  2PQA B;  4DAY A;  3D8G A;  3T1Y Q;  2YTY A;  3S1Q H;  1ZYR C;  3D0F A;  3EA6 A;  2OTL A;  2XRS D;  2L0C A;  4HJ5 A;  5BR8 Q;  1YHQ A;  2M2L A;  3GDE A;  3NTH A;  1STN A;  1VF7 A;  4IFD J;  1V9P A;  1H9J A;  1BXT A;  5HGT A;  2IJ0 A;  5IWA L;  4GN5 A;  4LAA A;  1TWA H;  5LMN W;  4HID A;  4B9X A;  2K50 A;  1KD1 C;  2MUY A;  1WTP A;  1TY2 A;  5FK9 C;  1D5X C;  1J9O A;  1K0R A;  1SE3 A;  4RGN A;  1YHA A;  3L0O A;  2D5D A;  3V2T A;  1YIT A;  4B3M L;  4GLA C;  4OXP A;  4X64 Q;  3S16 H;  4G7Z C;  1WJJ A;  4OGQ C;  1JOR A;  3F2U A;  3C1F A;  3HOV H;  2JXM B;  5EBD A;  2FMC A;  1EU4 A;  5JPN C;  4HSP A;  4A3B B;  2BOS A;  3K6O A;  3KFU A;  1X32 A;  3J7A V;  2RKS A;  1GD7 A;  3K7A H;  4LF5 Q;  2NN6 G;  5I6Y A;  5L37 A;  1STG A;  4UP9 A;  2K33 A;  3R2T A;  1UEA B;  4J6H A;  2L1B A;  2IY5 B;  1F2L A;  4KY7 A;  1UE5 A;  4HIO A;  3L7Z C;  2UXD L;  1PH3 A;  3I55 A;  2SNM A;  4HN7 A;  2HHH Q;  3KJO A;  3OTO L;  4DAY B;  1Y14 B;  2NTT A;  2JA7 G;  2I46 A;  1I4P A;  4GNX C;  1CKM A;  3RZD H;  3CCR A;  1C7Y A;  2NB0 A;  1EFW A;  1HXY D;  1A63 A;  1UWV A;  1QE6 A;  1ICW A;  1JOO A;  1DM0 B;  2HIX A;  2MHV A;  3I91 A;  4C56 C;  4CJ2 C;  1Y1W H;  5CBE E;  1RIP A;  2BCO A;  2F0L A;  1KC8 C;  4P75 A;  1VQE A;  2F3W A;  3FKI H;  3CPW A;  1KAW A;  5EJW A;  2RCF A;  1E3P A;  2N78 A;  3CP0 A;  4XXE A;  5DNF A;  1S5D D;  2G9D A;  1I6V C;  1IBM L;  1C9O A;  4G7H C;  3VR3 A;  1TWC B;  4BXX G;  2K32 A;  2JSO A;  3AQQ A;  3HGB A;  2DUD A;  3S16 B;  1PZK D;  1HNW Q;  1II3 A;  1PH6 A;  1HNX L;  1B9N A;  2B2T A;  1ONL A;  2PW7 A;  4A3M B;  2A69 C;  4A93 H;  1DXM A;  4DK3 C;  4DV0 L;  3TQY A;  5DEH A;  4HIK A;  1Z47 A;  2F0D A;  2IHE A;  2PW5 A;  3A8K E;  4JBW A;  1NBW A;  4FXD A;  4ILW A;  4DUY L;  3HOZ B;  3UE0 A;  3D4W A;  2BE5 C;  2N3S A;  2K6A A;  2RF4 A;  4AQY Q;  1QUQ A;  1N36 Q;  1IYU A;  4LF4 Q;  2FFK B;  2LKV A;  1L2F A;  2EYO A;  3HRZ C;  1I50 H;  1RCV D;  4HJ7 A;  2EY5 A;  1Q1B A;  1EEF D;  3TEH B;  1IBK L;  1A8V A;  3ER0 A;  4JCV E;  4YHH Q;  1AZP A;  1S5E D;  1T5E A;  5C3E B;  3I4M G;  1EU3 A;  1QNK A;  4X65 Q;  5C3W A;  1EY5 A;  1LTS D;  5FLX L;  1LM0 A;  4DK1 A;  1A0I A;  1WTV A;  4QCL A;  5CGK A;  3F8T A;  1MIU A;  4A93 B;  4IPH A;  4Q0F A;  5ELC A;  2GA4 B;  2CW0 C;  1PA6 A;  4POF A;  4UPA A;  5BN4 A;  2WAQ B;  2K5W A;  4B3S L;  1JWS D;  2L4N A;  1YNN C;  2NVX H;  4HCS A;  2O2L D;  3M9B A;  3W1B A;  3FP9 A;  4RGM A;  2A8V A;  3SGI A;  1K73 C;  3SK4 A;  2KED A;  1VS0 A;  1VQ9 A;  4C3H H;  1AH9 A;  3CU7 A;  1TS2 A;  4E6I A;  1NR2 A;  4GN4 B;  1P8L A;  1Q3L A;  2PMZ E;  5FO7 B;  4C3I H;  1SXT A;  4IUQ A;  1LLR D;  1FYC A;  3M4Q A;  4B3R Q;  2QCP X;  2JN4 A;  1JT8 A;  3S14 H;  5JVG 3;  2BH2 A;  3WOE A;  5IWA Q;  1RF2 D;  3IL8 A;  3K0Y A;  3LWE A;  4IUP A;  4C1N I;  2YU9 H;  4L5T A;  3J81 c;  4I7Z C;  3W5O A;  1WTH A;  5JVH 3;  4H13 C;  2HDM A;  1K3B C;  1ENA A;  1NAP A;  2KOL A;  5C6A A;  1WI5 A;  1BCP C;  3UI2 A;  4RHS A;  3MZ5 A;  3AMU A;  4P2C B;  3GTP H;  3TME A;  2R7Z G;  2EJF C;  2EYF A;  2K5D A;  1SLJ A;  4L6T B;  4C3I B;  1T9H A;  3KLW A;  1BBU A;  4DV3 L;  4OWW B;  4LMQ D;  1MKH A;  2B63 G;  3VDY A;  2EIF A;  2AUK A;  4XT3 B;  4K5V A;  4ZCK A;  5F2D A;  5I2Y A;  3HOU B;  3EQL C;  1XTD A;  1S5F D;  2HUG A;  3OTO Q;  1SE8 A;  5GRO A;  1PYW D;  5KNB A;  5GAD C;  2YU9 B;  5C44 H;  1WTR A;  1NMG A;  3A0J A;  1CM9 A;  2QF7 A;  1OXT A;  1Q8I A;  4FXK C;  1WCM G;  2JA7 H;  5IP9 H;  1Q90 A;  1FD7 D;  2XGT A;  2Z0S A;  1PH4 A;  1KRS A;  3S24 A;  4DF7 A;  1MGS A;  1B3Q A;  3NTK A;  3RR5 A;  3OPO A;  3GTP B;  5CMD A;  2JA6 B;  3CCV A;  2WIN B;  2C5C A;  3J80 c;  1NMF A;  1QWY A;  1Z9F A;  2FIN B;  1KRT A;  4PMW A;  1LTB D;  3S2D H;  3ITP A;  1JE5 A;  1K8O A;  2O5J C;  2HDL A;  1EY8 A;  1YEZ A;  1PFM A;  5A2Q E;  1HNX Q;  1B53 A;  4LW1 A;  5E4W C;  4UDU C;  2F0P A;  5IT9 E;  4FF4 A;  3BDC A;  4DV0 Q;  2ID0 A;  4R4Q A;  1ESF A;  3AU7 A;  4BBR B;  5AJ3 L;  2HCI A;  1UUP A;  5C3X A;  4P71 A;  4DUY Q;  3PO3 H;  1HPC A;  2EYL A;  2PNH A;  2RQX A;  1HFG A;  4U67 3;  4OL7 A;  4WJ3 M;  3HS0 C;  2MO1 A;  3LX0 A;  4L63 B;  2RSO A;  1YHB A;  5FJ8 H;  4XDX A;  4GKJ L;  1VQD A;  1R9T B;  1IYV A;  3FRP B;  4AYB B;  4QIW B;  1EL0 A;  2K52 A;  2Z4H A;  3WOF A;  2UUC Q;  3BS1 A;  5ELF A;  4KKU A;  3H09 A;  1PTO H;  3PGZ A;  4PG3 A;  3U9S A;  2R92 G;  4NMZ A;  1CKN A;  4V19 0;  2IL8 A;  2SEB D;  5C0X G;  4HIM A;  1PXU A;  5JPM C;  1DOM A;  1LAC A;  1SND A;  1V8Q A;  1IW7 D;  1M8A A;  3PO3 B;  4XQN A;  3M4P A;  1JR0 D;  1W6J A;  2R3Z A;  2VUM G;  1GUN A;  1K83 H;  1CKO A;  1EQV A;  1I5F A;  1PTO D;  4NW2 A;  5DLQ E;  4JV5 Q;  3VR6 A;  4JI6 Q;  3GD7 A;  1VQM A;  2KHI A;  4A3G B;  2ICE C;  1PH7 A;  4RA8 A;  1YJN A;  1DGS A;  2RCN A;  5K36 G;  1YZ6 A;  1XPO A;  3HKZ G;  4CDE C;  1PHJ A;  1BKB A;  3NK9 A;  3OW2 A;  4ME5 A;  1K8M A;  1W6K A;  5M5W B;  4XQQ A;  1K0S A;  3KF8 B;  3SR1 A;  4LF9 Q;  3BDL A;  3S1M H;  1D5Z C;  1F9R A;  1I4R A;  1Q82 C;  2PZW A;  1HZA A;  5CR3 A;  2VXW A;  2X6G A;  1IBL L;  4RKB A;  1WOC A;  4GNX A;  4LWC A;  4K8I A;  1I94 Q;  4JYA Q;  1GUO A;  4LFB Q;  3U4V A;  2I5M X;  3CCE A;  2WKD A;  4A3D H;  1HNZ L;  3RN2 A;  1EZ6 A;  1QCB D;  3PUY A;  3T16 A;  4CJ0 B;  3M4O B;  4DK0 A;  1CK1 A;  4DV3 Q;  5IYC G;  1O7Z A;  2F0Q A;  2K1B A;  4EX5 A;  2ASB A;  2NYZ D;  3OIQ A;  3F2D A;  1VMC A;  2GVB A;  4U68 A;  2Q8T A;  4DV7 L;  2B63 H;  4JC0 A;  4C3J B;  3D3R A;  5GAG C;  5M5X H;  2E2J H;  4CHT B;  4IFD G;  1JQY D;  2DY8 A;  4RMF A;  4BS9 A;  1N34 Q;  3BYY B;  1AW7 A;  2R7F A;  3L3O C;  3T51 B;  2L11 A;  4LFA L;  1SJH D;  2QEJ C;  4A3D B;  1DOL A;  1WCM H;  2F0K A;  3Q8D A;  3CXC A;  3GTM H;  3FPP A;  1K9M C;  4FVM A;  4OHJ A;  2V4D A;  4GNX B;  1X65 A;  2DJF C;  3TP5 A;  2NZH A;  1VQP A;  1I4H A;  1SYB A;  1LT3 D;  4DR1 L;  1A3V A;  3I90 A;  1VQN A;  3PQI A;  3J81 L;  5GAE C;  4HMJ A;  5KNC A;  4DNT B;  2OEO A;  4R4T A;  1KNE A;  4F88 A;  2B2U A;  5CV7 A;  3H3V I;  1HZC A;  1KLU D;  3VYS A;  3HG9 A;  2WB1 E;  5AJ3 Q;  4KK7 A;  4DV2 L;  4N8F A;  1CQV A;  1X3P A;  1EYG A;  2KEN A;  4WOR A;  5IE8 A;  5I9O A;  4OWT B;  1FL0 A;  4MHE A;  3GTM B;  3QG1 A;  4G57 A;  2D2C C;  4CJ1 B;  1B7Y B;  1EY4 A;  1U0L A;  4ZK9 B;  4GKJ Q;  1WTO A;  2LS0 1;  1PFN A;  4KTA A;  2VY3 A;  3K5L A;  3OWE B;  5J3B A;  3UDG A;  4POG A;  4X66 L;  1JCK B;  4BY1 G;  2HHH L;  1J5E L;  4LUV A;  3GTJ H;  2AQ1 B;  1UE7 A;  5BN3 A;  4KN4 C;  5CV5 A;  1R4Q B;  3DWA A;  2R92 H;  1U5K A;  1X6O A;  1BF4 A;  5GAH C;  2F0V A;  1D2B A;  3AYH B;  2AWN A;  3TP8 A;  4DNR B;  2JA8 H;  2E75 C;  3KOJ A;  1I4Q A;  1FJG Q;  3GTG H;  4QF4 A;  1K8G A;  2CVR A;  3MXP A;  3HOY G;  5IIF A;  3J80 L;  3CCM A;  1QIL A;  1HTP A;  3E9H A;  2BA1 A;  3A5Z B;  4M8A A;  2JK8 A;  1PH9 A;  3MTS A;  1EIH A;  2A73 B;  3HOZ G;  4DR4 L;  1AEX A;  3U58 A;  3WDN A;  1TWF H;  3QR8 A;  3S2H B;  4DV1 L;  3VR5 A;  4V0B A;  2FHT A;  2KHJ A;  2NWG A;  4TKO B;  3RN5 A;  1PH1 A;  4PMB A;  4A76 A;  2RHQ B;  4FO2 A;  3GTJ B;  1C48 A;  1HA6 A;  2JA5 H;  2JA9 A;  1B70 B;  1SNP A;  2QDL A;  2AWO A;  2K14 A;  4O2D A;  2B2W C;  2EDG A;  3D31 A;  3RLO A;  4CGY B;  1VQI A;  4TVA B;  5IYD G;  4FP5 D;  1IBL Q;  4MTN A;  4DR3 L;  1PRT C;  1N36 L;  4J15 A;  3UDF A;  3QOL A;  4DXF A;  3STB C;  4A3E B;  2A68 D;  5JEA J;  2F0W A;  3I72 A;  1IZ6 A;  3KUP A;  3NPP A;  4QY7 A;  3CCS A;  4B3T L;  1S72 A;  1PV4 A;  1E7Z A;  1X3E A;  4M1U B;  1BCP B;  3I4N H;  5COR A;  4PZ7 A;  3B6Y A;  5D3D A;  3FMC A;  3L9A X;  4KLK A;  5D65 A;  4DV7 Q;  2EYP A;  4A3K B;  3RZO B;  2JA5 B;  2PI2 E;  2CWP A;  4K8J A;  2FXQ A;  3TS2 A;  4UP8 A;  2NTS A;  4NDX A;  4LF7 L;  5LL6 X;  4IFD H;  1ZXT A;  1O7I A;  4FF3 A;  2EXD A;  3GTQ B;  2L9H A;  1E22 A;  3JAM E;  4LFA Q;  4L5Q A;  1PTO C;  5ELN A;  3P20 A;  1HJP A;  4CDD C;  2UUB L;  3CQZ H;  5IGE A;  3I2Z A;  1S3O A;  1BBW A;  4QUC A;  5C4X G;  4XTC S;  4FDB A;  2EOT A;  4JG2 A;  5EPK A;  1FR3 A;  4B3R L;  3KF6 B;  1EY0 A;  4UP7 A;  4DR1 Q;  2ZTC A;  5CYU A;  3I4N B;  3TZU A;  5J22 A;  5CV9 A;  1GHJ A;  1BO0 A;  3MC0 B;  4PZ6 A;  4CDC C;  3VYR A;  1TWH B;  1H9S A;  1O78 A;  5FLM G;  4A3F G;  3M85 A;  5K5P A;  1PVO A;  2NVT H;  3NTI A;  3S1R H;  3HOU G;  4DV2 Q;  1XNR L;  4B9W A;  2Q2T A;  1IKL A;  4KKS A;  2KEE A;  3QB3 A;  3D4D A;  5EPJ A;  5BN5 A;  4KD4 A;  2AHO B;  2SNS A;  1AE3 A;  1LO5 D;  3PF5 A;  2XNA C;  1TXY A;  2ZXR A;  2PPB C;  2O5I C;  3S1Q B;  2ZT9 C;  4IN3 A;  1EOT A;  4X66 Q;  2KUM A;  4LJZ C;  1NJI C;  5KYI A;  4IUV A;  1J8I A;  3DWQ A;  4KJO A;  2ZTE A;  4BY7 G;  1J5E Q;  1TWA B;  2E8G A;  1HUM A;  3KLS X;  2E76 C;  4RFB A;  4X3U A;  5G3L D;  2E74 C;  3MXG A;  1B2T A;  2KQ3 A;  3E0J A;  1XNQ L;  4WRD A;  3K58 A;  1VQG A;  4K14 A;  4CKC A;  3HOV B;  1X56 A;  1RKN A;  4WJ4 A;  1Q7Y C;  3KK7 A;  1CA5 A;  3HOY H;  1WD0 A;  3PV0 A;  2WAQ E;  5EKK A;  1J6Q A;  4DR4 Q;  3K7A B;  1NE3 A;  1SNQ A;  3LGJ A;  4X3K A;  1EYC A;  5IGF A;  1X55 A;  3I4L A;  3CRL C;  2OF1 A;  4DV1 Q;  1EQT A;  3EFX D;  1NTG A;  3N6R A;  2X6L A;  4OO1 G;  4A3I H;  3PO2 H;  1KTK A;  3M7G A;  4QUF A;  4IOC A;  4QGU A;  1LT5 D;  5IOC A;  3J81 j;  1MSG A;  5CC4 A;  3RZD B;  1H95 A;  5IT9 c;  1YBY A;  3E6Z X;  3H15 A;  5IP7 H;  4DR3 Q;  1ILP A;  4CKE A;  2K5N A;  1SR3 A;  2PZT A;  3A54 A;  3GP7 A;  5IYD H;  1Y1W B;  1DJR D;  1BOS A;  1EWC A;  2QDB A;  3K7U C;  4P72 A;  2Y0S B;  4QJF A;  3FKI B;  1ICF B;  2BDO A;  5GQO A;  1AE2 A;  2IPK D;  3J7Z C;  3D6C A;  1NY4 A;  4B3T Q;  5KGU A;  3HOW G;  3OYY A;  1LT6 D;  2UUC L;  2WP8 J;  1H9R A;  2QEX A;  1U9R A;  2B2U C;  2RDG A;  1T5X D;  4A3I B;  3F2B A;  1O7L A;  4KHZ A;  3GQB A;  4QQB X;  1STE A;  5M3M G;  4F7X A;  3T1H L;  3M3Y H;  1SRU A;  3H0G H;  1G6Z A;  1SYD A;  4LF7 Q;  1CSP A;  4X6A H;  1Q81 C;  4KY6 A;  2KCM A;  4A3C G;  5C3E G;  5IGB A;  1G29 1;  1VQ6 A;  3GTL H;  1I50 B;  4DR2 L;  2UUB Q;  3DLL A;  2KVM A;  3D6W A;  1C8C A;  4JV5 L;  4JI6 L;  3JC6 6;  4RG1 A;  1QUQ B;  3ZJY C;  1XX8 A;  3P7J A;  1VQK A;  5C4X H;  2F0T A;  3SHL A;  4EGV A;  3MAQ A;  4JBK A;  2HT1 A;  1V43 A;  4LF9 L;  3NUC A;  1MD2 D;  3TP6 A;  4IAL A;  4KHP Q;  4RH6 A;  1TWG H;  1KDA A;  1TVX A;  5KIX A;  3CMA A;  3M3Y B;  1TR5 A;  2A6H D;  1I94 L;  4JYA L;  2MFI A;  2A68 C;  3KBG A;  1KDB A;  3I4O A;  5JAV A;  2DN8 A;  2K5Q A;  2RA4 A;  3TS0 A;  4RAU C;  4A3F H;  5FLM H;  1XNR Q;  4LFB L;  4DPG A;  2NVX B;  2NZ1 D;  2IHF A;  5E4X A;  1YNJ C;  2YTV A;  3CC2 A;  3RD4 A;  4HAE A;  4C3H B;  4R4O A;  5AFW A;  3UE1 A;  1CZW A;  2ES2 A;  4GOP C;  2J4X A;  4X3S A;  3EN2 A;  5I4D A;  1Q8K A;  2JQO A;  3IRB A;  5C4H A;  2L55 A;  2NN6 H;  5IGG A;  3S14 B;  1WFQ A;  3K57 A;  1D7Q A;  2PQE A;  3NHH A;  4ZYS A;  1A6X A;  3G48 A;  4AYB E;  4QIW E;  4RKL A;  1F9Q A;  4BY7 H;  3K80 C;  3MA2 B;  1LTT D;  1N34 L;  3Q23 A;  2B2W A;  5COY A;  1JJ2 A;  2UXB L;  5DM7 3;  1GO3 E;  3I8Z A;  4YWK A;  2JYO A;  1PRT F;  1SFO H;  1XNQ Q;  4LK1 C;  2CQO A;  3AB9 A;  1IL2 A;  1XTC D;  1BUV T;  1STA A;  3LNN A;  4K2K A;  1HR0 Q;  2BH8 A;  1K3R A;  3NQI A;  4ZKC B;  2F3I A;  2WII B;  3QWN A;  4KV6 A;  1EY9 A;  4A3L G;  1AN8 A;  2I0Q A;  1FGU A;  3E3X A;  1PH2 A;  3K5O A;  4GLV B;  2EE1 A;  4L8J A;  1X54 A;  4BXX H;  4N9P A;  4ZAI A;  2KJX A;  2EYJ A;  4NKL A;  1MJC A;  4I65 A;  5JJZ A;  4IJH A;  4JBM A;  1KIX A;  2EXZ A;  1PYB A;  4G4K A;  4DK6 C;  3DEP A;  3J81 i;  2F1M A;  4OO1 H;  3TSS A;  4KD3 A;  5C44 B;  2R93 G;  1L0W A;  3Q0A A;  3HKS A;  4TQU S;  3U9O A;  5C4J H;  1S4Z A;  2JA7 B;  1O80 A;  2C35 B;  5ELB A;  1E1O A;  2XN9 C;  1PTO F;  4DV6 L;  1SN8 A;  1IXR A;  4AIM A;  3A5U A;  1TY0 A;  1PFB A;  3KBX A;  4HJA A;  5T1G A;  3HOX G;  1OXU A;  1Y1V G;  3DEO A;  1EQR A;  4RCN A;  2A1A A;  4JI7 L;  1SMY D;  5E3F A;  1PRT B;  3S2D B;  4A3J G;  3V96 A;  1RJT A;  5FO8 B;  1EUJ A;  1YJ9 A;  3M4Y A;  4BBS G;  5JOB A;  1YJW A;  3I4M H;  4DV5 L;  4O0A A;  2ENB A;  1SNO A;  1W2B A;  5CV6 A;  3T1H Q;  2PO4 A;  3VA5 A;  2VB3 X;  4B08 A;  3Q6S A;  3R2I A;  2KA7 A;  4A4I A;  1FJG L;  2Z6K C;  2WB1 G;  4YWL A;  1XMQ Q;  1ZKO A;  4N9T A;  4LUO A;  3C1E A;  2EPB A;  2AUJ D;  5EGT A;  1G91 A;  2LMC B;  4DR2 Q;  4A3C H;  5C5L A;  2LY7 A;  3J80 i;  2ZXO A;  1Q46 A;  1DZ1 A;  5JEA G;  1Q1E A;  1SYF A;  3FVQ A;  5A2Q L;  1PTO B;  3ULJ A;  2K5V A;  2F0H A;  3A56 A;  5IT9 L;  5M3F G;  2EYM A;  2P5Z X;  3J7A F;  2EY2 A;  1TQO A;  5LHY 1;  2F0F A;  1LTR D;  2NBF A;  1G8Z D;  1UEB A;  1EOV A;  3IKJ A;  1CKN B;  1B1Z A;  2B8F A;  4UAI A;  4S3S A;  3PUX A;  2MJ8 A;  1KAA A;  3D4R A;  5CV8 A;  1SAP A;  1X3Q A;  1I6H H;  1IL8 A;  1K83 B;  4JI3 Q;  1F2Y A;  1LTI D;  2YTX A;  3TP7 A;  5ISR A;  3CKI B;  2EY6 A;  2PCF B;  3MXN A;  2R7Z H;  3C2P A;  3VR4 A;  4QMG A;  2I5H A;  4UHV A;  1JC7 A;  3P1H A;  1VMP A;  3KLS A;  2K7V A;  3A7L A;  2MP1 A;  1ZEQ X;  2I5L X;  1GXD C;  1K28 A;  3S1M B;  3GV6 A;  3A8J E;  1F2M A;  2D9U A;  1LUZ A;  2QKI C;  2OXP A;  2KBN A;  2IX1 A;  2UXB Q;  1EWI A;  4JW0 A;  4OWX B;  4OX9 Q;  3AEV A;  3DM1 A;  3PUV A;  2LXK A;  2DGY A;  2EVB A;  5C4Z A;  1Q12 A;  3JAM c;  4ZQ3 A;  2E2H H;  1I6H B;  1A3U A;  1NNX A;  3G6J B;  3QJY A;  4MN3 A;  1CFM A;  3URY A;  5KND A;  2R7Z B;  4A3L H;  3OW7 A;  1D6E C;  2F3V A;  4A3B G;  1MBY A;  3NBH A;  1RTO A;  4FNF A;  4X3T A;  2A6H C;  4OON A;  2B63 B;  3CW2 C;  4YIJ A;  3W1G A;  1LTL A;  5M5X B;  2E2J B;  1B4O A;  2VL6 A;  2KCN A;  1JJG A;  2HQE A;  4GN3 B;  3MXN B;  3RNU A;  4EQ5 A;  3PIO 3;  4DR7 L;  1STH A;  2R93 H;  2F0E A;  4NB3 A;  1LTG D;  3E9I A;  4DV6 Q;  1UNS A;  1WCM B;  2RSN A;  4TSS A;  1JB3 A;  5D3I B;  1XYI A;  2E2H B;  1Y8P B;  2MPM A;  3IFD A;  3EBE A;  3VR2 A;  4ABN A;  2N49 A;  4JI7 Q;  2A69 D;  3HOX H;  4YCW A;  5DM6 3;  1YIJ A;  1C0A A;  1N9W A;  3KLR A;  3BVZ A;  1Y69 U;  2K4K A;  2RHS B;  1SMX A;  4DV5 Q;  4IOA A;  4GLX A;  2F0M A;  1F77 A;  1A2T A;  1BNZ A;  4BBS H;  3RLF A;  4IPC A;  4IFD I;  4OEL B;  2DY7 A;  5C0X H;  2OCE A;  1VQH A;  5EPL A;  4X62 L;  3FPU B;  3NBH B;  2F0J A;  4CKB A;  1HR0 W;  1BCP F;  2Z6B A;  4IQZ A;  4A3M G;  1L0X B;  1SRO A;  1U4M A;  4HJ8 A;  4H0L C;  1CA6 A;  5FOB B;  1GVP A;  3H6M A;  3GV3 A;  3RUZ A;  1ET9 A;  1VF5 C;  4DN4 M;  4N8X 1;  1A2U A;  2NZO A;  3G6E A;  4GOP A;  2VUM H;  4ME3 A;  3A55 A;  3BZC A;  2BDN A;  2NVQ H;  4O42 A;  1SE4 A;  4ZUI A;  2QA4 A;  3A74 A;  4DAP A;  5K36 H;  4OIJ A;  1KAB A;  1NUC A;  4F87 A;  3G7L A;  3T13 A;  2D0O A;  2R92 B;  3OOC A;  2LFN A;  1KDC A;  2N55 A;  4LNQ A;  3S17 H;  4YCV A;  5M3F H;  2JA8 B;  1EWH A;  4MNO A;  3HP3 A;  3I3C A;  3GTG B;  5E7N A;  3J7Y W;  2PYK A;  3NEL A;  4IUT A;  3ULL A;  1F9P A;  4A93 G;  2M9V A;  1WD1 A;  2ZTD A;  1JE4 A;  1HZ9 A;  2HD3 A;  3GO5 A;  1SMY C;  5CBA E;  4NXM Q;  2WAQ G;  1TS3 A;  5EBC A;  1TWF B;  5EQ0 A;  2PQA A;  2VUM B;  1W3S A;  5I6W A;  2WKC A;  3CC7 A;  3PCO B;  1DON A;  4FYD A;  2UXC L;  5IYC H;  1PMR A;  1EYD A;  2WFW A;  3HKZ B;  4DUZ L;  4NP5 A;  3CD6 A;  4XYO A;  3AFP A;  1IW7 C;  1BR9 A;  4GOP B;  3OIP A;  4DAM A;  3W3A A;  2RDH A;  5H1S E;  2IX3 A;  1PZJ D;  2O4X A;  1JOK A;  3GTO H;  1GKH A;  1CHQ D;  1EYA A;  2UU9 Q;  2KHS A;  1QVF A;  1GUS A;  1EY7 A;  2F4V Q;  4Q5V A;  2RDF A;  1QJO A;  1HCZ A;  5IYB G;  3T56 B;  1HTL D;  2Q2I A;  1ILQ A;  3RLN A;  5EAY A;  1XPU A;  2YV5 A;  4JI1 L;  2F52 A;  2B39 A;  4JVZ A;  4DA2 A;  4C3I G;  2RVL A;  4KHP L;  5HUR A;  1S5C D;  1VQB A;  4K5W A;  1V1Q A;  4K5X A;  2F0S A;  3K5M A;  2F03 A;  4UY8 C;  5HY6 A;  1QG7 A;  1NCV A;  1U4R A;  2B29 A;  1VQ7 A;  4R9W A;  2VNU D;  1STY A;  1GOZ A;  2WV6 D;  2Z6K A;  3VA7 A;  1QZH A;  3GTO B;  4DR7 Q;  3ERS X;  1IYJ B;  4KJN A;  3P75 A;  4JK1 C;  3CQZ B;  4QB4 A;  1GUT A;  2VZA A;  3K5N A;  2B2V C;  1F9S A;  4LF8 L;  2A19 A;  1EIY B;  1SDF A;  4NXN Q;  3I70 A;  2Y0S E;  1RTN A;  2R6G A;  3ND8 A;  1SEB D;  1ENF A;  4Z9C B;  2N8N A;  3HZX A;  1CQF A;  3NWT A;  4JI4 Q;  2JA6 G;  1KHI A;  3K8A A;  1V1O A;  3C3L A;  1KLG D;  5FKA C;  3OMG A;  1QVC A;  3MFY A;  4BY1 H;  2DJG C;  2K04 A;  2OQ0 A;  5ELD A;  2E2I H;  3JAM L;  1B44 D;  1TWC H;  2NVT B;  4X62 Q;  3S1R B;  3HEJ A;  3GTK H;  1GM5 A;  1A3T A;  3PIO A;  4PZ8 A;  2A5H A;  3V05 A;  1M4V A;  2LSS A;  3TN2 A;  1HR0 L;  5C44 G;  3I7F A;  5IGD A;  1H9S B;  4YCU A;  4BBR G;  2KCC A;  1VQ4 A;  5FLX E;  4DFA A;  1PYS B;  4A3M H;  1JJC B;  4R1J A;  3CC4 A;  1A15 A;  1CSQ A;  5IP9 G;  1G2S A;  3DMU A;  2SDF A;  3HOZ H;  4ODG A;  4MIU A;  1HUN A;  3OHX C;  5DAU A;  1WTX A;  1N32 Q;  1R4P B;  2J7Z A;  4HTH A;  5LMU L;  3NE5 B;  4EVO A;  3DUZ A;  3NQT A;  4AYB G;  1KXL A;  2XWB B;  3BYT B;  1VQA A;  4BY1 B;  4JI2 L;  4CBV A;  2FMM A;  1KL9 A;  1EQQ A;  2XSC A;  1ESR A;  4JOI C;  2UUA L;  3ERQ A;  4KN7 C;  4DNI A;  2E2I B;  5C3E H;  4IPG A;  2QW7 A;  3GTK B;  2F0O A;  2CHB D;  4A75 A;  4DXG A;  4MZ9 A;  3PIP 3;  2EJM A;  2XVS A;  4IUN A;  3SVM A;  1I4G A;  2HQL A;  3EIV A;  3HOY B;  3DM3 A;  1KQS A;  1MJE A;  4GS3 A;  1YNX A;  4LFC L;  4ULL A;  4DR5 L;  1JB7 A;  1OO9 B;  3UDX A;  3PO3 G;  2ALY B;  4I7A A;  2L15 A;  2Z1C A;  3BG3 A;  2NN6 I;  3ULP A;  2Z9H A;  5FO9 B;  5FJ8 G;  2EZV A;  3PO2 B;  2CH4 W;  2MGS A;  2UXC Q;  1E24 A;  5M5Y H;  1FGB D;  4A3G G;  2Q2U A;  4DUZ Q;  5ELO A;  1QOH A;  3G4S A;  2NVY H;  1B3A A;  2D0P A;  3KJP A;  1XMQ L;  2A6E D;  1O7Y A;  4XQJ A;  4RWS C;  5J39 A;  1OTC A;  1B8A A;  2F0U A;  2BA0 A;  1ML0 D;  2MO0 A;  4IUU A;  3S9W A;  4JBJ A;  2ATW A;  2XTI A;  4FXG C;  3MHB A;  2XIW A;  4J8Q A;  3X3M A;  3FDT A;  2K05 A;  1SYE A;  5IYB H;  4O1N A;  4H7B A;  3AFQ A;  4JI1 Q;  3LWU A;  1TII D;  1G6P A;  3BJU A;  1EZ8 A;  3NSW A;  4JI0 L;  5M5Y B;  1PH8 A;  2K75 A;  4OO1 I;  3NEM A;  1ENC A;  4DU9 A;  3H0G B;  1X3G A;  2NVY B;  1ROD A;  1D5M C;  1M90 C;  2L5T A;  1EIG A;  2B2Y C;  1LYL A;  2TMP A;  2B8G A;  2NUC A;  4C3J G;  2CKZ B;  1LTA D;  3I56 A;  2I07 B;  2Z4I A;  3PUW A;  3HOU H;  4H02 A;  5EKL A;  4DAV A;  3GTL B;  3SDZ A;  4JI3 L;  2F0I A;  1TS5 A;  4K6D A;  1PH5 A;  5LMN L;  4FF2 A;  1SE2 A;  4LF8 Q;  2R7D A;  5KEE A;  1VQL A;  3ERO A;  2JEB I;  1RD9 D;  3CHB D;  4IZ8 A;  4A3D G;  3T53 B;  5IY0 A;  5C4X B;  1VQC A;  4B3M Q;  1I4X A;  3TRE A;  1CTM A;  3SEB A;  3MFG A;  2EQS A;  5I9P A;  3BVM A;  3IAY A;  2E5L L;  5M9O A;  1N33 L;  3R3O A;  3A7A B;  1PLF A;  3E0E A;  4YY3 L;  2Z8L A;  2JA6 H;  1TWG B;  3H3V C;  2F0G A;  3X3N A;  1DD2 A;  4OX9 L;  4KI0 A;  4JI8 L;  5D14 A;  2H5X A;  3MXU A;  4A3F B;  1BDO A;  4C2M H;  4ZLT F;  4HR7 B;  2UXD Q;  2Q8R E;  1L1O C;  1FVI A;  3ONA B;  3W2D A;  3K59 A;  1M1K C;  1RL2 A;  2N88 A;  4ZKB B;  1DCZ A;  1XWE A;  4DKA C;  1H9M A;  2GVA A;  3IFT A;  4BBR H;  4APV A;  3CPF A;  4PNY A;  2PMZ B;  1TS4 A;  1AFP A;  1CZG A;  1E2V A;  1QNU A;  5JJI A;  1CUK A;  4ALP A;  1RDP D;  2VS1 A;  1EIF A;  2XRQ D;  5LMU Q;  3DXJ C;  2CH4 A;  1S40 A;  1FNU A;  2CCZ A;  4JI2 Q;  2A74 C;  4BY7 B;  4XT1 B;  1R9T H;  1VQ8 A;  2UUA Q;  1E0B A;  1IBM Q;  1CT1 D;  1VQJ A;  1TU2 B;  4AH6 A;  4R4C A;  3G71 A;  1SFO B;  4FF1 A;  1L0Y B;  4C2M B;  4HED A;  4ZRZ A;  2VQE L;  2WAC A;  3U50 C;  3L2P A;  2H4O A;  2F4I A;  1SYC A;  4DR6 L;  1SYG A;  3CME A;  2EYH A;  2MNA A;  1E2Z A;  3OSO A;  4Y7N H;  4LFC Q;  4DR5 Q;  2JEA I;  1VDZ A;  2B3G A;  4PMC A;  4GKK L;  3HOW H;  1JIC A;  3KYH C;  2CQA A;  1WYD A;  4NPS A;  3I73 A;  2ZM6 L;  2K03 A;  1C4Q A;  4PV1 C;  4EQO A;  1PRT D;  1VQF A;  2H1E A;  4MTK A;  1SNM A;  4P74 A;  5I2X A;  3S15 H;  3KF8 A;  3STB D;  2E2D C;  4RHR A;  1IBK Q;  2SOB A;  1ASY A;  4A3G H;  2X69 A;  4YWM A;  5M3M H;  5C4J B;  1MHW C;  4CDF C;  3CCQ A;  1IKM A;  2MQH A;  1K8A C;  5M5W H;  2VQF L;  4XIG S;  1TT2 A;  4XYQ A;  3BZK A;  3PIP A;  1UE6 A;  2JA8 G;  2IW3 A;  3QIA A;  4BA2 I;  1VQO A;  2B2V A;  3ND9 A;  4Y7N B;  3VYT A;  1QVG A;  1SNC A;  3SK6 A;  1JOQ A;  4A3E G;  1SJE D;  3HOW B;  4B3S Q;  3CCJ A;  3H91 A;  3OWF A;  3TBI B;  3I4M B;  4JI0 Q;  1XPR A;  2CFM A;  3DHQ A;  5LL6 S;  1STB A;  4G7O C;  3TZD A;  4L5S A;  1LV9 A;  3S15 B;  1FNW A;  1MI2 A;  2AQ3 B;  1V1P A;  3K0X A;  2YYZ A;  1PFS A;  4K0K L;  3M4O H;  1Q86 C;  5M3M B;  2F0N A;  2QIL A;  4TRD A;  2CWA A;  3BVG A;  1ZYR D;  3CAM A;  1GUG A;  4A3K G;  5EKI A;  3EVQ A;  2JA5 G;  4LF6 L;  5JJK A;  1A62 A;  3MWY W;  2JJQ A;  3QO2 A;  1IHZ A;  5NUC A;  3CCU A;  4C3J H;  3J81 E;  1UE1 A;  4NXM L;  3TRZ A;  2J0T D;  2QGQ A;  5LMN Q;  3QOJ A;  3R93 A;  3NWS A;  3NEN A;  5T1I A;  1BBX C;  1JWU D;  2EJG C;  2KEC A;  3U4Z A;  1QZG A;  4IO9 A;  3KDF A;  4OIK A;  3A8I E;  2E5L Q;  1N33 Q;  1HHV A;  3SK8 A;  3ICE A;  2PZU A;  2A6E C;  3MEF A;  1KNA A;  4JI5 L;  1UAP A;  5IGC A;  4YY3 Q;  1PZI D;  2OTJ A;  5C0X I;  4JOI A;  3I4N G;  2V1C C;  2VW9 A;  1PDQ A;  2K5H A;  1MSH A;  4JI8 Q;  2UU9 L;  2F4V L;  5HGQ A;  1HZB A;  1XMO L;  2B2T C;  4IUR A;  1H9K A;  3J7A 5;  1NSN S;  1V1P B;  4WFN 3;  4Y52 H;  2ZXP A;  3M7N A;  4RGT A;  2RBM A;  3Q24 A;  1NR4 A;  3BDO A;  4C1N K;  3PUZ A;  4BWG B;  1JMC A;  4BA1 I;  1F2Z A;  1QB5 D;  4ZUJ A;  5JJL A;  1GJX A;  4QL5 A;  4DV4 L;  2ZJR A;  1ASZ A;  3J80 E;  3T1Y L;  3RMH A;  3E5S A;  3VYU A;  2HIV A;  2JP1 A;  1CHP D;  5ELE A;  3S1N H;  3KDF B;  3PMF A;  2K28 A;  3SXH A;  4HJ9 A;  1ET6 A;  1EEI D;  2OQK A;  4H44 C;  5BR8 L;  2AMC B;  4EQN A;  1AZQ A;  3T4A C;  1G51 A;  1E1T A;  1XXG A; 
#chains in the Genus database with same CATH homology
 2VQE Q;  4LF7 Q;  1CSP A;  3K81 C;  4X6A H;  4GKJ L;  1VQD A;  1Q81 C;  4DR6 Q;  2KCM A;  2K52 A;  4IPD A;  4A3C G;  3BU2 A;  4JBM A;  4KHP L;  5C3E G;  4NXN L;  2UUC Q;  1G29 1;  1HH2 P;  1VQB A;  1VQ6 A;  1V1Q A;  3GTL H;  4PG3 A;  3PGZ A;  3HOV G;  4DR2 L;  2UUB Q;  3DLL A;  4UY8 C;  2R92 G;  4GKK Q;  5HY6 A;  4X64 L;  1CKN A;  1Y1V H;  2ZJP A;  1YVC A;  2B29 A;  1VQ7 A;  4JI4 L;  4JV5 L;  1X9N A;  4JI6 L;  2VNU D;  2IX0 A;  3JC6 6;  5C0X G;  4DR7 Q;  2Z6K A;  4HIM A;  1QZH A;  4RG1 A;  3ERS X;  1QUQ B;  1IYJ B;  4A3J H;  2ZM6 Q;  3PO3 G;  3ZJY C;  1VQK A;  2OWO A;  5C4X H;  1VCI A;  2LXJ A;  3PF4 A;  4JBK A;  2HT1 A;  2VZA A;  1V43 A;  4LF9 L;  4LF5 L;  3S2H H;  4LF8 L;  2A19 A;  2KCT A;  1EIY B;  4KHP Q;  4NXN Q;  3HKZ E;  3M4P A;  1TWG H;  2Y0S E;  3JAM i;  3CMA A;  2AKW B;  1OXX K;  2VQF Q;  2R6G A;  2VUM G;  1K83 H;  1CKO A;  2N8N A;  1I94 L;  1I5F A;  4JYA L;  5DLQ E;  2MFI A;  3I4O A;  3TS0 A;  1PH5 A;  4JI4 Q;  2JA6 G;  1KHI A;  3GD7 A;  3K8A A;  2KHI A;  4LUZ A;  4A3F H;  5FLM H;  1VQM A;  4JI6 Q;  4DPG A;  1PH7 A;  1XNR Q;  1YJN A;  1DGS A;  2RCN A;  2IHF A;  5K36 G;  5FLX c;  1YZ6 A;  1QVC A;  4BY1 H;  1Y1W G;  1XPO A;  3HKZ G;  1PHJ A;  2YTV A;  1BKB A;  2Y0S G;  3CC2 A;  3OW2 A;  3FKI G;  2OQ0 A;  1VQ5 A;  4IJL A;  4R4O A;  3KF8 B;  2E2I H;  1TWC H;  4LF9 Q;  3UE1 A;  4X62 Q;  3S1M H;  1N32 L;  2ES2 A;  3GTK H;  4GOP C;  1Q82 C;  1GM5 A;  1OXV A;  3EN2 A;  4A3E H;  1I3Q H;  1HZA A;  3PIO A;  4PZ8 A;  3FHW A;  1Q8K A;  2D62 A;  2JQO A;  2LSS A;  3F1Z A;  3IRB A;  1IBL L;  1WOC A;  4GNX A;  4LWC A;  1HR0 L;  5C44 G;  3I7F A;  1I94 Q;  4YCU A;  2ZJQ A;  4BBR G;  1WFQ A;  4JYA Q;  1VQ4 A;  1PYS B;  4A3M H;  1JJC B;  1D7Q A;  4LFB Q;  4R1J A;  3U4V A;  3CC4 A;  2I5M X;  3G48 A;  4AYB E;  4QIW E;  1CSQ A;  3WWV A;  5IP9 G;  3CCE A;  2JE6 I;  4A3I G;  3PO2 G;  4A3D H;  4BY7 H;  1HNW L;  1HNZ L;  3K80 C;  5C0X J;  1N34 L;  2GN5 A;  3RN2 A;  4LF6 Q;  3HOZ H;  1JJ2 A;  2UXB L;  1GO3 E;  1L1O A;  4YWK A;  4A3K H;  3PUY A;  3RZO H;  1SFO H;  1XNQ Q;  1N32 Q;  5LMU L;  3H3V H;  2CQO A;  5IP7 G;  4AYB G;  1KXL A;  4DV3 Q;  1IL2 A;  5IYC G;  1VQA A;  4JI2 L;  4L5R C;  1KL9 A;  4EX5 A;  1EQQ A;  2ASB A;  1HR0 Q;  4JOI C;  3F2D A;  2GVB A;  1X3F A;  2BH8 A;  2UUA L;  3CCL A;  1K3R A;  1YI2 A;  3GTQ H;  2F3I A;  4R4I A;  4DNI A;  4AQY L;  4DV7 L;  1FJG L;  2B63 H;  5C3E H;  4A3L G;  4LF4 L;  4JC0 A;  3KF6 A;  4IPG A;  4IFD G;  5M5X H;  5GAG C;  2E2J H;  2I0Q A;  1FGU A;  1XJV A;  4A75 A;  1PH2 A;  1P16 A;  1HNZ Q;  4MZ9 A;  4RMF A;  4GLV B;  1N34 Q;  4JI5 Q;  1X54 A;  2HQL A;  3EIV A;  4YHH L;  3F2C A;  3CF5 A;  4BXX H;  1BVS A;  2R7F A;  4P73 A;  3DM3 A;  1MJC A;  4LFA L;  1KQS A;  4IJH A;  3UDI A;  4GS3 A;  1YNX A;  1PYB A;  4LFC L;  4DR5 L;  1MJE A;  3UDX A;  4DK6 C;  1KIX A;  3J81 i;  2ALY B;  4X65 L;  1WCM H;  2L15 A;  3Q8D A;  3CXC A;  3GTM H;  1K9M C;  2R93 G;  1L0W A;  2NN6 I;  4GNX B;  1X65 A;  3HKS A;  3H0G G;  4TQU S;  3ULP A;  1XMO Q;  2NZH A;  1VQP A;  3HFZ B;  5C4J H;  5FJ8 G;  2C35 B;  1TWH H;  2UXC Q;  1E24 A;  1E1O A;  5M5Y H;  1N8R C;  2IT1 A;  1OXS C;  4DV6 L;  1SN8 A;  2Q2U A;  4A3G G;  4DR1 L;  4DUZ Q;  1IXR A;  5ELO A;  4AIM A;  1VQN A;  3G4S A;  2NVY H;  5GAE C;  3A5U A;  2D0P A;  4R4T A;  3KJP A;  1D8L A;  1XMQ L;  4HJA A;  2PI2 A;  2Q2H A;  1L1O B;  3PSI A;  3HOX G;  1OTC A;  1B8A A;  1OXU A;  1Y1V G;  3H3V I;  1EQR A;  1HZC A;  2BA0 A;  4DV4 Q;  2A1A A;  2MO0 A;  4JI7 L;  4A3B H;  4JBJ A;  2ATW A;  2PQA B;  4A3J G;  2WB1 E;  2XTI A;  5AJ3 Q;  1EUJ A;  2YTY A;  4DV2 L;  3T1Y Q;  1YJ9 A;  3D0F A;  3S1Q H;  2OTL A;  1EYG A;  4BBS G;  2KEN A;  1YJW A;  3I4M H;  4DV5 L;  4HJ5 A;  4O0A A;  5IE8 A;  5BR8 Q;  1YHQ A;  3GDE A;  5IYB H;  4OWT B;  1W2B A;  1FL0 A;  4IFD J;  3AFQ A;  3T1H Q;  1V9P A;  4JI1 Q;  4A4I A;  1B7Y B;  1U0L A;  4GN5 A;  1TWA H;  2WB1 G;  2Z6K C;  4YWL A;  5IWA L;  5LMN W;  3BJU A;  2K50 A;  4HID A;  1XMQ Q;  4GKJ Q;  1G6P A;  4LUO A;  2VY3 A;  4JI0 L;  1KD1 C;  5J3B A;  3UDG A;  4POG A;  4X66 L;  1K0R A;  1PH8 A;  2K75 A;  4OO1 I;  3NEM A;  1YHA A;  3L0O A;  1YIT A;  4BY1 G;  4DR2 Q;  1X3G A;  2HHH L;  4B3M L;  4A3C H;  1J5E L;  1M90 C;  4GLA C;  4LUV A;  3GTJ H;  4OXP A;  1UE7 A;  3J80 i;  4X64 Q;  3S16 H;  1Q46 A;  5JEA G;  1Q1E A;  1WJJ A;  3HOV H;  1LYL A;  2R92 H;  1U5K A;  1X6O A;  5GAH C;  2CKZ B;  3AYH B;  3I56 A;  2AWN A;  3PUW A;  3HOU H;  4H02 A;  2JA8 H;  3KFU A;  3ULJ A;  2K5V A;  3KOJ A;  1GD7 A;  3K7A H;  4JI3 L;  1FJG Q;  3GTG H;  1K8G A;  4LF5 Q;  2NN6 G;  5LMN L;  3HOY G;  5M3F G;  4UP9 A;  4LF8 Q;  3CCM A;  2R7D A;  3E9H A;  1VQL A;  2BA1 A;  2JEB I;  3A5Z B;  2JK8 A;  4HIO A;  1PH9 A;  1UE5 A;  2UXD L;  3L7Z C;  2IY5 B;  4A3D G;  1PH3 A;  3I55 A;  5IY0 A;  1VQC A;  4B3M Q;  2HHH Q;  3KJO A;  1UEB A;  3TRE A;  3OTO L;  3HOZ G;  4DR4 L;  4DAY B;  3U58 A;  2EQS A;  1EOV A;  1Y14 B;  1TWF H;  2E5L L;  1N33 L;  1CKN B;  2JA7 G;  3PUX A;  4DV1 L;  4GNX C;  1CKM A;  3E0E A;  4YY3 L;  3RZD H;  3CCR A;  2JA6 H;  1C7Y A;  2KHJ A;  1EFW A;  3RN5 A;  1PH1 A;  1A63 A;  1I6H H;  4A76 A;  1UWV A;  2RHQ B;  4JI3 Q;  4OX9 L;  2HIX A;  1Y1W H;  4KI0 A;  4JI8 L;  2YTX A;  1RIP A;  2H5X A;  1KC8 C;  2JA5 H;  2JA9 A;  1B70 B;  2AWO A;  2K14 A;  1VQE A;  3FKI H;  4O2D A;  4P75 A;  3D31 A;  1KAW A;  3RLO A;  4C2M H;  1VQI A;  4TVA B;  3CPW A;  2R7Z H;  1E3P A;  2UXD Q;  5IYD G;  1L1O C;  1FVI A;  1IBL Q;  2I5H A;  2N78 A;  4MTN A;  3CP0 A;  1M1K C;  4DR3 L;  1IBM L;  1RL2 A;  1C9O A;  1N36 L;  4J15 A;  3UDF A;  4DKA C;  2I5L X;  4BXX G;  3STB C;  2GVA A;  3AQQ A;  2DUD A;  4BBR H;  1LUZ A;  5JEA J;  4APV A;  1HNW Q;  3CPF A;  1IZ6 A;  2KBN A;  4QY7 A;  3CCS A;  1PH6 A;  1EWI A;  4OWX B;  1HNX L;  4B3T L;  2IX1 A;  2UXB Q;  1S72 A;  1PV4 A;  4OX9 Q;  5JJI A;  1CUK A;  1E7Z A;  4ALP A;  4A93 H;  3AEV A;  2VS1 A;  4DK3 C;  3PUV A;  4DV0 L;  1EIF A;  2LXK A;  3TQY A;  5LMU Q;  4HIK A;  1Z47 A;  2DGY A;  2IHE A;  1S40 A;  2CCZ A;  1X3E A;  4JBW A;  1NBW A;  1Q12 A;  4JI2 Q;  3JAM c;  3I4N H;  4PZ7 A;  3B6Y A;  4DUY L;  1R9T H;  3UE0 A;  4KLK A;  1VQ8 A;  2E2H H;  2UUA Q;  2N3S A;  1IBM Q;  2RF4 A;  1VQJ A;  4AQY Q;  1QUQ A;  4DV7 Q;  1N36 Q;  4LF4 Q;  4AH6 A;  4R4C A;  4K0K Q;  2PI2 E;  3G71 A;  1L2F A;  2CWP A;  2FXQ A;  1I50 H;  3TS2 A;  4UP8 A;  4HJ7 A;  4A3L H;  2VQE L;  1Q1B A;  4LF7 L;  3TEH B;  3U50 C;  1IBK L;  3L2P A;  4A3B G;  1O7I A;  1A8V A;  3ER0 A;  2EXD A;  4DR6 L;  4JCV E;  4YHH Q;  3CME A;  4OON A;  1E22 A;  3CW2 C;  4LFA Q;  2MNA A;  3W1G A;  4L5Q A;  1LTL A;  5ELN A;  4Y7N H;  4DR5 Q;  4LFC Q;  2JEA I;  3I4M G;  2VL6 A;  4X65 Q;  1HJP A;  1JJG A;  2UUB L;  4GN3 B;  3CQZ H;  2B3G A;  3MXN B;  5FJ8 H;  3RNU A;  1LM0 A;  3I2Z A;  4EQ5 A;  4GKK L;  1A0I A;  1S3O A;  3HOW H;  1BBW A;  5C4X G;  3F8T A;  3KYH C;  4XTC S;  1WYD A;  4NPS A;  4DR7 L;  4FDB A;  1MIU A;  2R93 H;  2ZM6 L;  4JG2 A;  4IPH A;  4NB3 A;  4JV5 Q;  4B3R L;  3KF6 B;  3E9I A;  1VQF A;  4P74 A;  4UP7 A;  4POF A;  4UPA A;  4DV6 Q;  4DR1 Q;  1PA6 A;  3S15 H;  2ZTC A;  3STB D;  1IBK Q;  4B3S L;  1ASY A;  2NVX H;  4A3G H;  4YWM A;  3M9B A;  3W1B A;  3FP9 A;  4PZ6 A;  5M3M H;  2A8V A;  3SGI A;  3EBE A;  3CCQ A;  2N49 A;  2MQH A;  1K73 C;  1K8A C;  4JI7 Q;  5M5W H;  2VQF L;  1VS0 A;  4XIG S;  5FLM G;  4A3F G;  4C3H H;  3M85 A;  1VQ9 A;  3HOX H;  1PVO A;  1AH9 A;  4YCW A;  4GN4 B;  1P8L A;  1YIJ A;  1N9W A;  3BZK A;  2NVT H;  1C0A A;  4C3I H;  2PMZ E;  3PIP A;  3S1R H;  1UE6 A;  4DV2 Q;  1XNR L;  2K4K A;  2RHS B;  2JA8 G;  3HOU G;  2Q2T A;  4BA2 I;  1VQO A;  1SMX A;  4DV5 Q;  3M4Q A;  4B3R Q;  4IOA A;  2AHO B;  4GLX A;  1QVG A;  1AE3 A;  4BBS H;  1JT8 A;  3RLF A;  4A3E G;  4IPC A;  3PF5 A;  3S14 H;  4IFD I;  1TXY A;  2BH2 A;  2OCE A;  1VQH A;  4X62 L;  3CCJ A;  4B3S Q;  5IWA Q;  3NBH B;  4JI0 Q;  1HR0 W;  2YU9 H;  4L5T A;  2CFM A;  4A3M G;  1XPR A;  1SRO A;  3J81 c;  4HJ8 A;  4X66 Q;  4L5S A;  1GVP A;  3W5O A;  1NJI C;  2ZTE A;  3K0X A;  2YYZ A;  1J5E Q;  4BY7 G;  1PFS A;  4K0K L;  3M4O H;  2E8G A;  1WI5 A;  1Q86 C;  3G6E A;  2CWA A;  2NZO A;  4GOP A;  2VUM H;  4ME3 A;  3CAM A;  4A3K G;  2JA5 G;  3BZC A;  4LF6 L;  3GTP H;  2NVQ H;  5JJK A;  1A62 A;  2QA4 A;  3A74 A;  2R7Z G;  2JJQ A;  1SLJ A;  3CCU A;  4C3J H;  4NXM L;  1UE1 A;  1XNQ L;  1T9H A;  3KLW A;  1VQG A;  1BBU A;  3TRZ A;  2QGQ A;  5LMN Q;  4DV3 L;  4OWW B;  1MKH A;  1X56 A;  2B63 G;  3NEN A;  4WJ4 A;  2D0O A;  3VDY A;  2EIF A;  1Q7Y C;  4LFB L;  4LNQ A;  3S17 H;  3U4Z A;  4YCV A;  3HOY H;  5M3F H;  1QZG A;  3PV0 A;  2WAQ E;  3KDF A;  4IO9 A;  1XTD A;  3OTO Q;  1J6Q A;  4MNO A;  4DR4 Q;  1NE3 A;  3LGJ A;  1SE8 A;  5E7N A;  5GRO A;  1X55 A;  2E5L Q;  1N33 Q;  3NEL A;  5GAD C;  3ICE A;  3ULL A;  5C44 H;  4A93 G;  3MEF A;  4DV1 Q;  1NMG A;  4JI5 L;  4YY3 Q;  3A0J A;  1NTG A;  2ZTD A;  1HZ9 A;  1OXT A;  3GO5 A;  5C0X I;  1WCM G;  2JA7 H;  4OO1 G;  4A3I H;  3PO2 H;  2OTJ A;  4JOI A;  5IP9 H;  3I4N G;  2Z0S A;  4NXM Q;  2V1C C;  2XGT A;  2WAQ G;  2VW9 A;  1PH4 A;  2K5H A;  4IOC A;  4JI8 Q;  4QGU A;  1KRS A;  3S24 A;  2UU9 L;  2PQA A;  3J81 j;  2F4V L;  1W3S A;  3RR5 A;  5HGQ A;  3CC7 A;  1H95 A;  3PCO B;  1HZB A;  5IT9 c;  1XMO L;  3CCV A;  1YBY A;  3J7A 5;  3H15 A;  5IP7 H;  3J80 c;  4DR3 Q;  4Y52 H;  2K5N A;  1SR3 A;  5IYC H;  2UXC L;  5IYD H;  1NMF A;  1Z9F A;  1KRT A;  2WFW A;  4PMW A;  3M7N A;  4DUZ L;  3K7U C;  4P72 A;  3CD6 A;  3AFP A;  4QJF A;  1JB7 A;  3S2D H;  1JE5 A;  4GOP B;  3PUZ A;  4DAM A;  5GQO A;  1AE2 A;  5H1S E;  1JMC A;  1YEZ A;  4BA1 I;  3J7Z C;  1NY4 A;  1HNX Q;  4B3T Q;  4LW1 A;  5JJL A;  3GTO H;  4QL5 A;  3HOW G;  3OYY A;  4DV4 L;  1GKH A;  2UUC L;  2UU9 Q;  2WP8 J;  2ZJR A;  1ASZ A;  4DV0 Q;  1QVF A;  2ID0 A;  4R4Q A;  2F4V Q;  5AJ3 L;  3T1Y L;  2QEX A;  4P71 A;  2HIV A;  5IYB G;  4DUY Q;  3S1N H;  3PO3 H;  2PNH A;  3KDF B;  4HJ9 A;  2Q2I A;  3F2B A;  3RLN A;  2OQK A;  4KHZ A;  5BR8 L;  4WJ3 M;  2AMC B;  2MO1 A;  4QQB X;  5M3M G;  1G51 A;  3T1H L;  1E1T A;  1SRU A;  3H0G H;  5EAY A;  1XPU A;  3M3Y H;  2YV5 A;  4JI1 L;  2F52 A;  1YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...