4L5QA

Crystal structure of p202 hin1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
199
structure length
199
Chain Sequence
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Interferon-activable protein 202
total genus 42
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5qA01
1D8LA 1L1OB 2OCEA 1I50H 4A3CG 4H02A 1JJ2A 2Z6KC 1LYLA 3J7ZC 1VQAA 4JI4Q 2AWOA 1X3GA 1A62A 4NB3A 2UUCL 1V1QA 4LUZA 1PH7A 4LFBQ 3GTLH 4JI6Q 3F2DA 1PH5A 1L0WA 1Y14B 2IX0A 1TWCH 3PO2H 1CKOA 1EUJA 3S16H 1HR0W 3FHWA 1BVSA 5M5XH 3TREA 1CUKA 2KCMA 3AQQA 4DV5L 2BH2A 3I4NG 2ID0A 4X65Q 1C0AA 4YY3Q 2VUMH 2A8VA 2R92G 2VNUD 5DLQE 2N49A 2R7ZH 4IFDJ 2PQAB 1UE6A 1Y1WH 1KC8C 1J6QA 5GAHC 2F52A 3KJPA 3TQYA 2JA7H 4P75A 3CQZH 4DR4L 3FP9A 1E1OA 1E24A 4PMWA 1OXTA 3K7UC 5IYBG 4A3FG 4YHHL 2IX1A 2RHQB 3RN2A 1CSQA 1I6HH 4IPGA 5C0XJ 2KENA 3H3VH 4OONA 3PO3G 5BR8Q 3S2HH 3NBHB 1N33Q 5FJ8G 1U0LA 1KIXA 3I56A 1N32Q 1L1OC 4A3JG 1X54A 1P8LA 1NJIC 4DV0L 4YCVA 4EX5A 2HHHL 5IP9G 5IYDG 2IY5B 4X6AH 3J80i 3F8TA 4HJ5A 4BY7G 3ICEA 2R93G 2WFWA 1IYJB 4GS3A 4BA2I 1K73C 1Q12A 1XPOA 1VCIA 3OW2A 1YJNA 4DR2Q 1N36L 3PUZA 4GNXB 3J80c 3G4SA 4DV1Q 2JA6G 4YWMA 1GO3E 5GROA 1K83H 3CCUA 1XJVA 1VQCA 1KRTA 5HGQA 1MKHA 4MNOA 1NY4A 4DV2L 1PH3A 4A3IH 4IFDI 4DV2Q 2UXBL 2UXBQ 1Z9FA 3KYHC 2Q2IA 2I5MX 4R1JA 2ZJQA 1A63A 2UU9L 3PUYA 1OTCA 3KF8B 5C4JH 4AQYQ 3GTPH 1LM0A 4UP8A 4NXNL 5GADC 2R7DA 1MJEA 4O2DA 3KOJA 4L5TA 4B3RQ 3STBC 2ZTCA 1TWGH 3PCOB 1G51A 2NZHA 4JV5Q 3HFZB 4NPSA 1PYBA 2F4VL 3L7ZC 2YTYA 1FGUA 1XNQQ 4LUVA 4FDBA 1IBML 4DV0Q 4L5RC 5M3MH 5AJ3Q 5LMNW 3RLNA 1S40A 2VY3A 2YTVA 1GVPA 2Z6KA 4IOCA 2JQOA 3CCQA 5LMUL 1N33L 2HT1A 4BBSH 1IBLQ 2WB1G 4R4OA 4HJ9A 4BY1G 2FXQA 1GKHA 3PV0A 4GOPA 1VQEA 4JI7L 2E2HH 3PUWA 4YCWA 1EYGA 1Q8KA 4QL5A 4UP7A 2IT1A 3MXNB 4JI0L 4A3DH 4DR4Q 4AIMA 3H0GH 5GAGC 4KHPQ 4B3ML 2E5LL 2KBNA 3J81i 2WAQG 2LXJA 3RLFA 3CXCA 2K4KA 2YV5A 1SN8A 1CKMA 2N3SA 4LW1A 4C3HH 3GTJH 3PO3H 3H0GG 3KDFB 1GM5A 4POGA 5C4XH 2RF4A 4HJ7A 1PYSB 4LNQA 4YWKA 1QZGA 4A3KH 4GOPC 2K75A 2UUAL 3H15A 2AKWB 3GTQH 4JI5L 4IPDA 2DUDA 3CMEA 4HIMA 2DGYA 2Q2HA 1HZBA 1K3RA 4LF8Q 3K8AA 2B63H 4AH6A 2NVXH 4DV7L 4A3MG 1BBUA 2PNHA 4POFA 5IP7H 3HOUH 4GKKL 4A3DG 1Q81C 1HZ9A 5FLXc 1X6OA 4LF5L 1G6PA 1TXYA 4LFBL 2VZAA 5IWAL 3EN2A 5IE8A 3RR5A 1QVFA 4GN3B 4KHZA 1HNZQ 1UE7A 1EIFA 4DPGA 5J3BA 1X65A 1R9TH 2WB1E 4JG2A 1WOCA 3CCRA 2A19A 3EIVA 1SR3A 2YTXA 3PSIA 1OXVA 4R4TA 1PH6A 4LF6L 5FLMH 5M5WH 3DLLA 1Q7YC 4MZ9A 3PF5A 4L5SA 1KXLA 4BA1I 5H1SE 2B3GA 3G6EA 1NE3A 2OTLA 3LGJA 3TRZA 1IBKL 5FLMG 4DR1L 2QGQA 2WAQE 5EAYA 3S24A 3KDFA 2VUMG 4K0KL 5LMUQ 4R4QA 4A3EH 3CC2A 2JJQA 3KFUA 1LTLA 5AJ3L 3CC4A 1XNQL 1JJGA 2ASBA 4A3JH 2YU9H 1ASZA 2JA6H 3PGZA 3B6YA 3I2ZA 1X3FA 3OTOQ 3HOZH 1Q86C 4BBRG 4LF7L 4X62L 1NMGA 1YHAA 2RCNA 4NXNQ 4AQYL 3K0XA 1OXXK 3F2CA 1IBMQ 4DR7L 3ER0A 3ULPA 2B63G 2E2IH 2CWPA 3GO5A 5LMNQ 1NBWA 2JEAI 3RZOH 3HKZE 2EIFA 4A3EG 1PH2A 2CWAA 2JA7G 1E7ZA 3U4VA 4GLVB 4IJHA 4DR5Q 4LF9L 1HNWQ 1AE2A 1UWVA 4DV4Q 1VQNA 1CSPA 4NXMQ 2JEBI 5IY0A 2MNAA 2ZJRA 3ULJA 4X66Q 3I55A 4B3SL 1B7YB 1XMQL 3S1NH 1S3OA 4P71A 5JEAG 1XMQQ 3D31A 3G71A 2R6GA 1DGSA 4GN5A 4X66L 2EQSA 1QVGA 1VQOA 3L0OA 1W3SA 1FL0A 3PUVA 3E9HA 4NXML 3F1ZA 4GLAC 3DM3A 4GN4B 5JEAJ 1HR0Q 3PIOA 1KD1C 4JI2L 1VQLA 4JBMA 1KAWA 1KHIA 3BJUA 1MJCA 5LMNL 1KQSA 3E9IA 5IT9c 1XNRL 3M3YH 3H3VI 3AFPA 3PIPA 3KF6B 3CPFA 1VS0A 4WJ4A 1PA6A 3OTOL 4HIOA 1UEBA 2AWNA 4B3TL 2Y0SG 1M1KC 3IRBA 2Q2TA 3W1BA 4OO1G 4X65L 4BXXH 3JAMc 3KJOA 2BH8A 3U58A 4A3FH 4K0KQ 4A4IA 1C9OA 3JC66 2JA8H 3CAMA 3I7FA 3MEFA 1IBKQ 2ZTDA 3AYHB 4RMFA 1YVCA 3CCEA 3T1HQ 4JI6L 3T1YQ 3AEVA 4LF6Q 1EQRA 4UY8C 4DK6C 2UUCQ 1RIPA 1QZHA 3UDXA 3NENA 4QY7A 1VQMA 1X9NA 1PH1A 4LFCQ 4TQUS 4JI4L 1O7IA 2GVAA 3K7AH 3ERSX 4IOAA 1HNZL 3CPWA 2V1CC 1SRUA 2YYZA 4JI8L 5IWAQ 1YI2A 5C3EG 2ZJPA 4LF5Q 3PF4A 3TEHB 2CFMA 2ATWA 4GKJL 1Q1BA 1KL9A 4GKKQ 2K5NA 4JI1Q 4DV7Q 4IO9A 3PUXA 3HOYH 2K14A 3FKIG 2Y0SE 1VQFA 4JI5Q 4OWXB 1VQIA 4KLKA 2RHSB 1VQBA 2UUAQ 2MO1A 3VDYA 4DUZQ 3U50C 1AH9A 3K81C 4AYBG 2C35B 4QJFA 4GNXC 1RL2A 2K52A 4DR3Q 1SFOH 4BY1H 1BKBA 4OX9L 2UXCL 3S1QH 1VQDA 4P72A 4LF4Q 2E5LQ 2F3IA 2NVYH 2ZM6Q 1N34L 4KHPL 3TS0A 1V43A 1Y1VH 4C3JH 1XMOL 2PMZE 1HNXL 4JI0Q 5HY6A 1FJGQ 3SGIA 4IPCA 1VQGA 3A0JA 4PZ6A 3G48A 1E22A 3HKSA 5C44G 1XNRQ 1X55A 1IBLL 5C4XG 4DAYB 2PI2E 4OWTB 4XTCS 3HOXG 4GNXA 4A76A 4A3KG 2GN5A 1Q1EA 2K50A 2PQAA 3NELA 4OO1I 1XTDA 4LWCA 5FJ8H 2MO0A 1CKNA 1Q46A 4A3BG 4JI3L 3M7NA 1T9HA 3D0FA 3J7A5 5C0XI 4HJAA 3S15H 3U4ZA 5IYBH 4B3RL 1WFQA 4IJLA 4B3SQ 4A3BH 4ME3A 3HOWG 3I4MG 3S2DH 1IL2A 2UU9Q 1W2BA 4DV3Q 1VQ8A 1QUQB 5M3MG 2VQEQ 1J5EQ 1HNWL 5JJKA 4LFAQ 4BBSG 2HIVA 3M9BA 1N8RC 5E7NA 4WJ3M 2NN6G 3CCSA 2VQEL 1I3QH 1SLJA 1U5KA 1WCMH 4DV3L 4DV6L 1Z47A 1EQQA 2D0OA 3WWVA 4DR7Q 4A93G 1MIUA 2VL6A 1C7YA 3S1MH 4UP9A 2OQKA 1PVOA 2ZTEA 2CQOA 3BZKA 3I4OA 4X62Q 3ZJYC 1PH8A 4DK3C 4LF7Q 1YEZA 4A93H 4A3LG 5IYCH 5ELNA 4IFDG 4JI3Q 1QVCA 2MQHA 3I4MH 2HHHQ 3FKIH 4JBKA 3W5OA 2JA5G 1K8GA 3GTKH 3JAMi 1EIYB 1N32L 3BU2A 1PH4A 4QGUA 1EOVA 5C0XG 2UUBQ 4PZ8A 1CKNB 2JA5H 5M5YH 1EFWA 5M3FH 2R92H 4DR1Q 1YNXA 2JA9A 5GAEC 3A74A 2H5XA 1VQ5A 4RG1A 1XMOQ 5IYCG 5JJIA 1K8AC 3UE1A 5C3EH 1E3PA 2BA1A 3Q8DA 2ZM6L 1YIJA 4BY7H 1QUQA 1NTGA 2NN6I 4DR3L 4OX9Q 4HIDA 2ALYB 3UDGA 2JA8G 2I5LX 4DUZL 4A75A 4AYBE 4GOPB 1I94Q 3GTGH 1JE5A 3CCVA 5JJLA 2N78A 2JK8A 4KI0A 2QEXA 2KCTA 3CCJA 1JT8A 4A3CH 1EWIA 1YHBA 1XPUA 2D62A 1E1TA 3M4PA 4ALPA 1TWHH 3F2BA 4LF8L 1I94L 4IPHA 1LUZA 4JI8Q 3RZDH 1SE8A 3S17H 4A3LH 1N9WA 4JBWA 4JBJA 2CKZB 4LFCL 2NVQH 2GVBA 3UDFA 1VQ6A 4A3IG 3I4NH 2XGTA 4DNIA 4B3MQ 1X56A 3M4QA 3NEMA 3J81c 1H95A 3T1YL 4A3GG 2K5VA 4DAMA 3T1HL 1IZ6A 2HIXA 3CCMA 1VQJA 5IP7G 2VQFQ 3HOUG 4Y7NH 1VQ4A 4JI7Q 1HZCA 2LSSA 4X64Q 3RNUA 4C3IH 1K0RA 1Y1VG 5IP9H 4J15A 5IYDH 1VQ7A 1Q82C 4DR6Q 1L2FA 2UUBL 1KRSA 4HIKA 1G291 4R4CA 4DKAC 5K36G 2K5HA 3PO2G 5ELOA 4UPAA 1ASYA 1SROA 3CW2C 2F4VQ 4JOIC 2IHEA 1OXUA 1B70B 1YJ9A 4B3TQ 4JV5L 3S1RH 3GD7A 3CP0A 1K9MC 4OWWB 2KHIA 2UXDQ 3K80C 2PI2A 1OXSC 4BXXG 3ULLA 3HOXH 3AFQA 2R7ZG 1PV4A 4DV6Q 2ES2A 2OWOA 1HZAA 1A0IA 3CF5A 3S14H 3HOYG 3RLOA 1AE3A 2R7FA 1Y1WG 4OXPA 1TWFH 2I0QA 4QQBX 2D0PA 4JI2Q 1JMCA 2I5HA 1FVIA 1YJWA 1HR0L 2LXKA 4JOIA 2Q2UA 3CMAA 2VS1A 1VQ9A 4LFAL 3KLWA 1J5EL 4QIWE 4DV1L 2R93H 3CD6A 1YBYA 3A5UA 1PFSA 1YZ6A 4R4IA 4DR2L 1N36Q 1WI5A 3CCLA 3HOVH 4JYAQ 4EQ5A 4DUYQ 4GLXA 1WCMG 2AMCB 3CC7A 3HOZG 2AHOB 3M4OH 1UE5A 2E8GA 5M3FG 4DUYL 2NVTH 1UE1A 1VQKA 4JYAL 2OTJA 2L15A 4YCUA 3L2PA 2KHJA 4A3GH 4LUOA 1NMFA 1L1OA 3GDEA 4DV4L 3TS2A 4LF9Q 2NZOA 4DR5L 2N8NA 4XIGS 4PZ7A 5BR8L 4P73A 4MTNA 1HJPA 3STBD 4YWLA 1S72A 1JJCB 1WJJA 3E0EA 1XPRA 4HJ8A 1PHJA 4JCVE 1VQPA 1YITA 1X3EA 3HKZG 1P16A 4JC0A 4TVAB 4PG3A 3RN5A 1JB7A 3GTMH 2WP8J 1B8AA 4YHHQ 1FJGL 3HOVG 2MFIA 2UXDL 3A5ZB 1HNXQ 1WYDA 3GTOH 1A8VA 3OYYA 4APVA 1M90C 5C44H 3EBEA 1N34Q 1TWAH 1PH9A 1HH2P 2B29A 2OQ0A 4LF4L 2QA4A 2BA0A 2UXCQ 2JE6I 1I5FA 4L5QA 2VW9A 4BBRH 4A3MH 2HQLA 2EXDA 4YY3L 4Y52H 2A1AA 5GQOA 4C2MH 3BZCA 4DV5Q 3J81j 4O0AA 3M85A 2CCZA 4DR6L 1IXRA 3KF6A 3W1GA 1BBWA 2IHFA 1YHQA 2E2JH 2Z0SA 1D7QA 3UDIA 1GD7A 4P74A 3UE0A 4X64L 4JI1L 2VQFL 3HOWH 4GKJQ 2XTIA 1V9PA 1VQHA 1SMXA
chains in the Genus database with same CATH superfamily
3PO3B 4H02A 3I73A 3J7ZC 4A3FB 4JI4Q 5DAUA 2AWOA 5I9OA 1A62A 4NB3A 4HCSA 2QW7A 1SYCA 3KLSX 2JP1A 1EUJA 4IUUA 1HR0W 1JC7A 1BVSA 3EJIA 5M5XH 4G7ZC 5EGTA 4YY3Q 2VUMH 1GHJA 2EY2A 4BWGB 2PQAB 1UE6A 1KC8C 2F52A 3S15B 3CQZH 4DR4L 1PMRA 1E24A 4A3FG 3RN2A 2J4XA 4UDUC 1FYCA 5C0XJ 3H3VH 3PO3G 1XXGA 1TS4A 2PW7A 3S2HH 1ML0D 1KIXA 3I56A 1L1OC 4ULLA 5HGTA 4EX5A 5IYDG 3Q22A 3F8TA 5CORA 1TY2A 4L63B 1LACA 2IPKD 1XPOA 2DNCA 1JWMD 1YJNA 1H9KA 4O42A 3S2HB 4DR2Q 1G6ZA 3J80c 4OEMB 1XJVA 3J7YW 5I6YA 1KRTA 1MKHA 1NY4A 4DV2L 4A3IH 4DV2Q 2E75C 1Z9FA 3GTJB 2Q2IA 4QF4A 4OL7A 1DYQA 3PUYA 1CI3M 3KF8B 4U68A 5GADC 4O2DA 1TWGH 1BNZA 4LAAA 3J81E 4HMIA 5T1GA 1PYBA 3MFGA 4CDFC 2D5DA 3R2IA 4HCEA 1PTOC 1GVPA 4IOCA 2HT1A 2JQOA 3CCQA 2H1EA 1BCPB 1GKHA 1QNKA 5ELBA 1VQEA 2RSOA 2E2HH 2QILA 4IQZA 4CDDC 1Q8KA 1EYAA 3PMFA 3MXPA 3H0GH 2E5LL 3J81i 3RLFA 3CXCA 2YV5A 2N3SA 4XYOA 3PO3H 2E2DC 4POGA 2E76C 3R2TA 3D4RA 4A3KH 1TR5A 2K75A 1VMPA 2A6HD 1CA5A 4EQPA 2RBMA 3GTQH 4IPDA 4HIMA 3CMEA 1HZBA 4ZKCB 1F2YA 2B2VA 2NVXH 2PNHA 4GKKL 1MGSA 3HOUH 1RJTA 4A3DG 1Q81C 3UI2A 4LF5L 1TXYA 3EVQA 4RCNA 4HR7B 5IE8A 3RR5A 3D4DA 1HNZQ 1EIFA 3V2TA 4DPGA 5J3BA 4JG2A 5FLXE 1S5FD 3EIVA 1SR3A 2YTXA 4S3SA 5FLMH 4L5SA 1U4RA 4MZ9A 3NTIA 2B3GA 1NE3A 2ICIA 2OTLA 3LGJA 1YNJD 1ZXTA 5EKKA 3TRZA 2QKIC 5FLMG 4DR1L 2EYLA 1F9RA 2VUMG 3S24A 4PNYA 4A3EH 3CC2A 3KFUA 4KN4C 1LTLA 3W2DA 1JICA 1JJGA 1TWAB 2LKVA 1Y69U 1B50A 2JA6H 1PFNA 1X3FA 1W6KA 4OGQC 1HA6A 3F2CA 1IBMQ 3ULPA 2CWPA 3GO5A 3IFTA 1NBWA 2EIFA 4A3EG 3U4VA 3I90A 4DR5Q 5E3FA 5M5WB 1UWVA 2JEBI 3R93A 5IY0A 2K7VA 3OPOA 5C0XH 4WJWA 1DGSA 1EY0A 4GN5A 1KABA 3L0OA 1W3SA 2CW0C 2D9UA 2JYOA 1LTBD 4FYDA 1TS5A 3PIOA 1ONLA 3VYUA 4C3IB 3BJUA 3E9IA 2EY5A 1XNRL 1I3QB 5J22A 1WTXA 1QG7A 3CPFA 3QIAA 1VS0A 2RDFA 4ZQ3A 1F2LA 2BE5C 3VR4A 1M1KC 3RMHA 5IT9E 3IRBA 1VF5C 4X65L 2P5ZX 3KJOA 2BH8A 4IUNA 4YIJA 1NSNS 2CH4A 1C9OA 3FPPA 1MBYA 2JA8H 3CAMA 1IBKQ 2Z6BA 3R8BA 4A3IB 3VR5A 3ITPA 2YU9B 3AEVA 2AUKA 2KCNA 2XRSD 4Q5VA 4LF6Q 4F87A 4UY8C 1TWCB 5JJZA 3NBIA 4KJNA 2L11A 2UUCQ 4QY7A 1VQMA 4DAYA 4FXKC 3CPWA 5KNCA 3S1QB 1SRUA 4JI8L 2NVXB 5C3EG 2ZJPA 3PF4A 2CFMA 2I07B 4IO9A 3PUXA 2KEEA 1ET6A 2A6EC 2Y0SE 4JI5Q 4OWXB 1VQIA 1XX8A 2QDLA 1D1KA 3HKZB 4GNXC 4DR3Q 4OX9L 2F0VA 4QB4A 3J7AF 2F0KA 2UXCL 1STAA 2F3IA 3TS0A 1V43A 1Y1VH 2WKCA 5CV9A 2PMZE 3SGIA 3HOXB 4PZ6A 1E22A 1PTOD 2KJXA 1XNRQ 1X55A 1IBLL 4OWTB 4GNXA 4XTCS 2IW3A 3SR1A 3BVMA 4A76A 3GTMB 5CC4A 1EEID 1U9RA 3NELA 2PQAA 3NWTA 5C4JB 1CKNA 4ZUJA 1STGA 1T9HA 3S15H 3Q23A 1TQOA 1WFQA 4IJLA 4ME3A 1AZQA 1PRTB 1K8MA 1JOQA 2MUYA 3NBHA 1VQ8A 1QUQB 2QF7A 1J5EQ 2EPBA 5JJKA 3I8ZA 1SE4A 1GXDC 1SE2A 4WJ3M 3CCSA 3M3YB 3MVVA 1SLJA 4DV3L 4CKCA 2NYZD 4DV6L 2D0OA 1C7YA 2OQKA 1XYIA 1PVOA 1WVLA 3BZKA 4A93H 4A3LG 1PH8A 1YEZA 1UEAB 5ELNA 4NW2A 4RA8A 4JI3Q 2B63B 1QVCA 2JA6B 3NQTA 3G7LA 3C1EA 4F7XA 2JA5G 1N32L 3BU2A 1PTOB 1EOVA 5M5YH 1EFWA 5M3FH 4DR1Q 1SYEA 2JA9A 4KV6A 3A74A 3JAME 1DONA 1VQ5A 5IYCG 5K36H 1E3PA 1S4ZA 2BA1A 4EVOA 1NTGA 4ZYSA 4PV1C 2K1BA 1JOOA 4HMJA 4A75A 1Y8OB 3J80L 1Q8IA 3CCVA 4F8MA 2JA8B 1GUTA 2KCTA 4ZRZA 4ZUIA 1XPUA 3M4PA 1F9PA 2JN4A 1TWHH 4LF8L 3TZDA 5D3DA 4IPHA 3E0JA 1DD2A 1N9WA 2CKZB 2GVBA 3UDFA 4A3IG 4B3MQ 1X56A 3KBGA 3J81c 1IW7C 4HN7A 4C3IG 1IZ6A 2HIXA 4DAMA 1VQJA 5KIXA 5IP7G 2DY7A 4CJ0B 1VQ4A 4JI7Q 4X64Q 2ZT9C 1K0RA 5IP9H 2VXWA 4J15A 5C5MA 2Q8IB 1VQ7A 4DR6Q 3RUZA 3GTPB 3X3NA 3I91A 5K36G 1YNNC 3SVMA 4QMGA 4EQNA 3PO2G 5ELOA 4DF7A 2FMMA 1TS2A 4RGMA 1A15A 2MJ8A 4JOIC 1YJ9A 1OXUA 2B2TC 4JV5L 3VR6A 3GD7A 1DJRD 1EIGA 2UXDQ 1OXSC 4BXXG 3HOXH 3AFQA 1JB3A 3TN2A 1A0IA 5HURA 2R3ZA 5FOBB 1AE3A 2R7FA 2XSCA 2I0QA 4QQBX 3HOUB 2I5HA 2LXKA 4JOIA 1J5EL 1EL0A 4PMBA 4DR2L 1PFSA 2PZWA 4ODGA 4R4IA 2Z9HA 2J7ZA 4A3KB 4GLXA 3M4OH 5JPMC 1DM0B 5M3FG 1EWCA 4DUYL 2NVTH 1UE1A 1VQKA 2L15A 3L2PA 1W6JA 4LUOA 2F0PA 2EJGC 1R4PB 1RHPA 3OIQA 3NHHA 1B53A 4XIGS 2H4OA 4N9PA 4PZ7A 4C3HG 1A6XA 3HKZG 1FNUA 4JC0A 5CGKA 3GTMH 2WP8J 1B8AA 3NSWA 2MFIA 3HOVG 1HNXQ 3GTOH 1STEA 3OYYA 5I9PA 2FINB 5C44H 3EBEA 4Z9CB 1K8OA 4LF4L 1MD2D 1CHPD 4B9XA 1I5FA 2VW9A 4FVMA 1WTRA 5M9OA 3J81j 5T1IA 1SNCA 2IHFA 4OIJA 3UDIA 4P74A 2JSOA 1LYLA 1JR0D 3TSSA 2OCEA 1I50H 2A6HC 2F0WA 3MEHA 4A3CG 4QUCA 2B2UA 4KMUC 2MPMA 3TBIB 2B2YA 2PPBC 1EY7A 2EYMA 2UUCL 4LUZA 3TMEA 2EY6A 2B39A 3G6JB 3HG9A 1PH5A 4BBSB 3PO2H 3IKJA 1CKOA 4O1NA 2EYOA 2B2UC 5EBDA 3FHWA 1ZKOA 2Z1CA 1CUKA 4DV5L 1DOMA 2EYPA 1JCKB 2ID0A 3IFDA 3S2DB 4ABNA 2A8VA 2R92G 2VNUD 2N49A 3CRLC 4TKOB 5FKAC 1E2VA 3Q6SA 4IFDJ 5GAHC 1CQFA 4P75A 1SMYD 2BDOA 5IYBG 1OXTA 4QIWB 3OW7A 1CSQA 4CBVA 1LTTD 5CV8A 1I6HH 1LLRD 4OONA 2XN9C 3L9AX 1I4QA 3I4LA 2F03A 3HOWB 5FJ8G 4A3JG 2WIIB 1P8LA 3NE5B 3SK4A 1NJIC 3TDQA 2K5QA 2TMPA 5IP9G 2A68D 3J80i 1I4XA 5C6AA 4JW0A 4C3JG 1IYJB 1K73C 1SAPA 4KY6A 2F0FA 3DWAA 3G4SA 1GO3E 5GROA 5HGQA 4IFDI 4R8NA 5C4JH 1R4QB 5IODA 1MJEA 2R7DA 4B3RQ 3STBC 4NKLA 2PZUA 1D1IA 3HFZB 2NVTB 3L7ZC 1KDCA 1XNQQ 4FDBA 2BCOA 5KGUA 5M3MH 5LMNW 3RLNA 4DK1A 3GTQB 5LMUL 1IW7D 1Z6HA 4OHJA 2WB1G 4R4OA 2E2JB 2FXQA 4IN3A 4FF3A 4DN4M 4YCWA 3FMCA 4JI0L 2IT1A 2RCFA 4DR4Q 4AIMA 5GAGC 4KHPQ 1SFOB 1LT4D 2WAQG 1SN8A 4P2CB 4C3HH 4WORA 3T16A 5C4XH 2KEDA 4Q0FA 2K5WA 1R9TB 2AKWB 5JVH3 1RF2D 5E4XA 1G8ZD 2DGYA 1AFPA 1K3RA 2B63H 3SXHA 4AH6A 1BBUA 4HEDA 5CYUA 1HZ9A 4K8JA 5IWAL 4Y7NB 3EN2A 1QVFA 3MTSA 1BCPF 5M3FB 1UE7A 3DMUA 4XQNA 1OXVA 1S5BD 2X6LA 3VR2A 3DLLA 3MXNA 3G6EA 5H1SE 1SNDA 1BUVT 2RQXA 5JVG3 2EJMA 1BQQT 3S14B 2K33A 2NWGA 1CT1D 3QB3A 5EAYA 2A69D 4K0KL 3H94A 5LMUQ 2JJQA 1BXTA 1LO5D 3BS1A 1NNXA 3CC4A 1HXYD 2Q8TA 1XNQL 1IL8A 1AP0A 3E5SA 2ASBA 3NPPA 2YU9H 1ASZA 1HTLD 3I2ZA 3OTOQ 1Q86C 4LF7L 5I6WA 1NMGA 1I4HA 4DR7L 4C1NK 3Q24A 3K5OA 5LMNQ 2JEAI 3HKZE 1PH2A 2JA7G 1BF4A 4RFBA 4GLVB 4IJHA 3QOJA 1AE2A 1CSPA 4NXMQ 4X3KA 2ZJRA 3AB9A 3P20A 1S3OA 4P71A 1EZ8A 3D31A 2DY8A 2R6GA 4X66L 1HUNA 1QVGA 1VQOA 3PUVA 3RZOB 3DWPA 2R7ZB 1ENCA 5JEAJ 4GN4B 4C56C 2LFNA 1HR0Q 1KD1C 5IGFA 1SDFA 4JBMA 1KAWA 1KHIA 1KQSA 1EFID 5IT9c 1JWSD 2AQ1B 3H3VI 3AFPA 4RAUC 3PIPA 1LABA 1WTPA 3KF6B 1EY9A 3O13A 2OT2A 1PA6A 2B2VC 4HIOA 1UEBA 1SYFA 2AWNA 1DCZA 5CV7A 5IGEA 2Q2TA 3H6MA 3U58A 1LT6D 4EGVA 4A3FH 4K0KQ 3MAQA 3HP3A 3JC66 2SEBD 2ZTDA 3AYHB 1FNWA 1Y8NB 4RMFA 2IWHA 1SSOA 3T1HQ 5NUCA 3SK6A 1ICFB 1SNPA 1B3AA 1QZHA 3UDXA 1X9NA 4TQUS 5EPKA 5IGBA 4JI4L 1RDPD 1PXUA 1ZEQX 2V1CC 3QWNA 2YYZA 4XXEA 4DK0A 5IWAQ 2HCIA 4BY1B 2HDMA 5EPJA 1BR9A 3D6CA 1KL9A 4DV7Q 4MIUA 4I65A 3OIPA 2JA5B 3HOYH 2K14A 3FKIG 4U673 3HOVB 4DUZQ 1D5ZC 4AYBG 2C35B 4QJFA 1RL2A 5KNBA 4BY1H 4BY7B 2M9VA 1VQDA 1BDOA 4LF4Q 2NVYH 4B08A 4KHPL 2WB1B 4JI0Q 1XMOL 1HNXL 1VQGA 3A0JA 2F1MA 3K0YA 3I72A 5C44G 3P1HA 5C4XG 3HOXG 5ISRA 4K5WA 4A3KG 2GN5A 1Q1EA 2K50A 2MHVA 4OO1I 3GP7A 4LWCA 5C3EB 5DEHA 1JE4A 3J7A5 1QNUA 1EQTA 4B3SQ 1U4MA 2F0TA 3S2DH 3OHXC 1FD7D 5M3MG 2VQEQ 4LFAQ 3S9WA 3A7LA 1N8RC 4ME5A 5E7NA 1SNOA 3EROA 3WWVA 1HFNA 2WACA 3WOEA 2F0GA 2FFKB 3ZJYC 4DU9A 5A2QE 4UAIA 2M00A 4DNTB 1PLFA 3GTKH 2KUMA 5CV5A 1HRJA 1U4PA 4QGUA 3D6WA 5D3IB 1NUCA 5JPNC 3KF8A 4ZK9B 4A3BB 1YNJC 2H5XA 1A3VA 1SYDA 4RG1A 1Y1WB 4L8JA 1K8AC 3UE1A 3KLRA 5C3EH 1YIJA 2ZM6L 5EJWA 5KEEA 2ALYB 2F0EA 2JA8G 2I5LX 2F0IA 2F0NA 4AYBE 1T5EA 1KLUD 4G7HC 3GTLB 1I4PA 3H0GB 5CV4A 3P75A 1D6EC 1EWIA 1M4VA 4X3SA 1E1TA 1I94L 3ERQA 1LUZA 1SE8A 3S17H 4RGNA 4F88A 4KTAA 5C4ZA 3S1NB 4LFCL 2K28A 1RD9D 4KN7C 1T5XD 2I46A 3M4QA 3T1YL 2EYJA 2MGSA 1RTOA 5IYDH 2ZXRA 1O7YA 2UUBL 1G291 5K5PA 2K5HA 1DOLA 4I7AA 1SROA 3QJYA 1RKNA 4C3HB 1KDAA 3OOCA 2PO4A 3CP0A 3NXWA 1K9MC 3K80C 2HUGA 4DV6Q 2ES2A 1CK1A 3MZ5A 4JI2Q 4E6IA 1JMCA 3DM1A 2XWBB 1YJWA 4IFDH 2VS1A 4QIWE 4DV1L 1AZPA 2R93H 1EWHA 1YZ6A 3CCLA 4LK1C 1WI5A 3HOVH 1ZYRC 4DUYQ 3CC7A 4ZLTF 1PZID 1UE5A 1TVXA 2E8GA 4XDXA 4A3EB 2LS01 2WAQB 4YCUA 2NVYB 1O7LA 4OO1H 2NZOA 5G3LF 1IYUA 5BR8L 4P73A 5LL6X 1S72A 3STBD 1EY4A 1WJJA 5DNFA 1XPRA 4HJ8A 3HOYG 3BDLA 1VQPA 5IGDA 3NP8A 1TIID 4YHHQ 3K59A 1F77A 1FJGL 3A5ZB 1HHVA 1WYDA 1M90C 4JVZA 1N34Q 1TWAH 5JAVA 1HH2P 2OQ0A 3U9OA 2BA0A 4HSVA 5I2XA 2UXCQ 5ELCA 2AQ3B 4BBRH 2L1BA 3EA6A 4PQXA 3A55A 5GQOA 3HRZC 4O0AA 5KNDA 1YHQA 1ICWA 1CFMA 2R92B 2Z0SA 1WTQA 1D7QA 4X64L 3UE0A 5EQ0A 4JI1L 3HOWH 4GKJQ 3PO2B 1VQHA 1ILQA 2KVMA 1L1OB 1DOKA 1JJ2A 2Z6KC 1PFMA 1GHKA 1STNA 1QCBD 3V96A 1WD1A 5E4WC 2N88A 2V4DA 4LFBQ 3GTLH 3LWEA 3T4AC 1Y14B 2IX0A 4IUVA 1TWCH 3T13A 5M3MB 1BOSA 2G9DA 3TREA 1A2TA 3VYTA 3I4NG 4X65Q 1C0AA 1HQMC 1O78A 2R7ZH 1Y1WH 1X3QA 1EY5A 2JA7H 5CR3A 3BZDB 4PMWA 1BCPC 3C2PA 4YHHL 2IX1A 2BDNA 2KCCA 2RHQB 4IPGA 2KENA 3L3OC 1SJHD 2K5DA 5BR8Q 3C46A 1X54A 2IY5B 3DXJC 4HJ5A 1GUOA 1LT5D 3HGBA 5IGCA 3ICEA 2F0SA 2R93G 2WFWA 5IGGA 4BA2I 3AMUA 3OW2A 2PNRC 1HPCA 5KYIA 1SE3A 2Y0SB 1N36L 1NCVA 4GNXB 1E0BA 2JA6G 4YWMA 4CKBA 4MNOA 1PH3A 2UXBQ 2XIWA 1A63A 2I5MX 3QO2A 4R1JA 4FF1A 1QB5D 1EQVA 1VDZA 3GTPH 4ID6A 1LM0A 4UP8A 3CU7A 3X3MA 1GJXA 3KOJA 1CM9A 2ZTCA 1E2ZA 1A2UA 2NZHA 4RH6A 4NPSA 4DGZA 3KUPA 2F4VL 3SE0A 2C9OA 4DV0Q 4L5RC 5AJ3Q 1S40A 2VY3A 1N33L 4BBSH 4HJ9A 4BY1G 2B2YC 1H9MA 3K6OA 1E2WA 1EYGA 2J0TD 4QL5A 1EYCA 4DAVA 3D3RA 1H9SB 4A3DH 4LJZC 3E3XA 1YNND 2LXJA 2K4KA 4LW1A 1CKMA 3H0GG 2RF4A 2XVSA 4LNQA 4YWKA 3PIO3 3H15A 3E6ZX 4JI5L 2DUDA 2Q2HA 3OSOA 2OEOA 4DV7L 4A3MG 4DAPA 5IP7H 4RGOS 3MA2B 4XT3B 4NP5A 1X6OA 1G6PA 4QUFA 2VZAA 1EY8A 1F9QA 3D4WA 4MHEA 1STHA 3DEOA 4GN3B 5TSSA 2EZVA 4WRDA 1HA5A 5J39A 5C5LA 4FP5D 1X65A 1WOCA 3CCRA 2A19A 4XQJA 3W3AA 3J80E 5BN5A 5M5WH 1Q7YC 1KXLA 1TWHB 1MI2A 5KRUA 3MFYA 3FEWX 2QGQA 2WAQE 3KDFA 2EJFC 3GQBA 2QCPX 1PRTD 4A3JH 1KNAA 3B6YA 1D5XC 3QR8A 1S5CD 1YHAA 2RCNA 4X62L 1D2BA 2KOLA 4AQYL 5I2YA 4K6LA 3ER0A 3U9SA 1GOZA 5CV6A 3RZOH 4N9TA 1UAPA 4RGTA 3V05A 4FF4A 2CWAA 4RKLA 4LF9L 1HNWQ 4DV4Q 2Z4HA 1VQNA 2ICEC 3S1RB 2PCFB 2MNAA 3GV3A 3ULJA 2X69A 4X66Q 3I55A 4B3SL 3S1NH 3QOLA 2BE5D 4H0LC 4J8QA 3G71A 1CHQD 3VR3A 3E9HA 4NXML 2E2IB 1Y1VB 4GLAC 3DM3A 4OIKA 5EKIA 1G91A 3J81L 2K03A 4JI2L 4K5VA 1VQLA 3RD4A 2A74C 3HOZB 5LMNL 1MJCA 3CHBD 3M4OB 4WJ4A 1MHWC 3OTOL 2NVQB 4B3TL 2F0OA 1LTID 5IOCA 2L55A 1PFBA 3CQZB 3W1BA 4K2LA 2FHTA 4OO1G 2X6GA 4TSSA 2CW0D 1L0YB 2A73B 3K7AB 2L5TA 3MEFA 2QEJC 4K6DA 4HAEA 2F0HA 4QCLA 3URYA 4JI6L 3T1YQ 4CKEA 3DUZA 2PZTA 4XQQA 4LFCQ 3EQLC 2RSNA 3K7AH 3RZDB 4IOAA 1F2ZA 2NTSA 1YI2A 4CHTB 3TEHB 2ATWA 1Q1BA 4GKKQ 1EYDA 2KA7A 3MWYW 1I50B 2IL8A 4R8IA 1C4QA 3H3VC 1VQFA 1PTOF 2RHSB 1VQBA 2WV6D 2MO1A 3VDYA 3U50C 1WTWA 3I70A 3NK9A 2K52A 4UHVA 1SFOH 5BN3A 2RDGA 4P72A 3A8IE 3KBXA 2F4IA 4CGYB 2SNSA 5HY6A 1RODA 1TU2B 3BVZA 3BYTB 4FF2A 2OF1A 3TP8A 2PI2E 2A6ED 1GUWA 3A7AB 1TWFB 4K14A 2F3VA 5FJ8H 2MO0A 3KLSA 2KQ3A 1Q46A 4A3BG 1EZ6A 3M7NA 5C0XI 2JA7B 2K01A 4M1UB 4B3RL 3HOWG 3I4MG 3NTKA 5G3LD 1II3A 1HNWL 4FNFA 1CTMA 4RHSA 3TP5A 1D5MC 5CBAE 2D2CC 2HIVA 1HCZA 3M9BA 4C3JB 2VQEL 1I3QH 1WCMH 1U5KA 2C5CA 1Z47A 1EQQA 1MIUA 2VL6A 4UP9A 2ZXOA 2ZTEA 1IHZA 1Y8PB 3I4OA 4X62Q 4LF7Q 4DK3C 4HSPA 5IYCH 2MQHA 3I4MH 1TS3A 1J8IA 4JBKA 3W5OA 1K8GA 1EIYB 2K04A 1PH4A 4RKBA 5C0XG 4PZ8A 1CKNB 2JA5H 2R92H 5CMDA 1VF7A 1YNXA 5GAEC 2HDLA 5JJIA 3QG1A 1HQRD 3C3LA 1LV9A 1UUPA 2VUMB 4BY7H 2NN6I 3ONAB 3DEPA 2K05A 4A3MB 3UDGA 1PRTC 4DUZL 1SNMA 1NR2A 4RCOA 3Q0AA 3GTGH 2WKDA 5JJLA 2R61A 4KI0A 1H9SA 2ZXPA 3J7AV 3P7JA 4KHVA 4A3CH 1B44D 1SJED 4ALPA 1STBA 4ZAIA 3F2BA 3FRPB 4A3LH 2CHBD 5M5YB 2E74C 1WTHA 4CJ2C 4RHRA 2NVQH 1KTKA 1X3PA 4R9WA 2L9HA 2XGTA 4DNIA 1H95A 4IURA 2A5HA 2K5VA 3CCMA 3FDTA 3SDZA 3HOUG 4Y7NH 2LSSA 3RNUA 1Y1VG 1TY0A 4N8FA 3M4YA 3OMGA 1KRSA 4HIKA 1PZKD 3TP7A 4IUPA 1ASYA 2F4VQ 3K5MA 2IHEA 1B70B 4B3TQ 1CZGA 2PYKA 4OWWB 2KHIA 1H9RA 1BO0A 3ULLA 1C48A 3S14H 1HZAA 3CF5A 1I4RA 1BCPD 1UNSA 3RLOA 1Y1WG 4OXPA 1TWFH 2DJGC 2D0PA 2E2HB 1B9NA 1FNVA 2Q2UA 3CMAA 5DM63 5M5XB 3CD6A 3VA7A 1YBYA 3A5UA 1N36Q 4A3JB 1WCMG 2AMCB 3HOZG 4KKTA 4XT1B 4LMQD 1RCVD 4KKUA 3R3OA 1SYBA 1NMFA 1L1OA 3GDEA 4DV4L 4LF9Q 2EYFA 4MTNA 1HJPA 4YWLA 2HQEA 1JJCB 3E0EA 1CZWA 1PHJA 2SDFA 3K58A 1JB7A 1P16A 4TVAB 5BN4A 2EDGA 2UXDL 5AFWA 1IKMA 5JOBA 1A8VA 3CRKC 1PH9A 2Q8RE 2EY1A 2QA4A 1B2TA 4L5QA 2M2LA 2EE1A 1F2MA 3HS0C 4C2MH 3BZCA 4DR6L 1FR3A 1IXRA 3KF6A 3W1GA 1BBWA 2E2JH 1EIHA 1GD7A 1LTSD 3H09A 2VQFL 4PMCA 1DZ1A 3SEBA 2XNAC 1ESFA 1V9PA 1B3QA 1SMXA 4I7ZC 1D8LA 3ND9A 3S17B 1KNEA 3FVQA 2B2WC 1VQAA 2LMCB 1PYWD 1X3GA 1V1QA 5I4DA 3MHBA 4A3GB 1PH7A 5J1ZA 4JI6Q 3F2DA 1VMCA 1L0WA 3AU7A 3S16H 2EVBA 1F9SA 2NB0A 2B2WA 3AQQA 2KCMA 1A3TA 2BH2A 4JPBW 5DLQE 3MC0B 4FO2A 3PIP3 4IUTA 1J6QA 3KJPA 3TQYA 3ZYYX 3FP9A 1E1OA 3FPUB 1K3BC 1DXMA 3K7UC 4KK7A 4KD4A 3NBHB 1N33Q 1U0LA 2Z8LA 1N32Q 1G2TA 1QWYA 2R93B 4DV0L 4YCVA 4X6AH 2HHHL 2A69C 4WFN3 4DXGA 4BY7G 4A93B 4CDCC 5LL6S 4GS3A 1Q12A 1G2SA 1VCIA 4X3UA 3PUZA 3SHLA 1SYGA 5JEAH 4DV1Q 2QDBA 3CCUA 1K83H 1VQCA 2F0UA 2UXBL 1HFGA 2NTTA 3KYHC 4TRDA 2ZJQA 2UU9L 1B1ZA 1OTCA 4AQYQ 2PMZB 4NXNL 1FGBD 4L5TA 2GA4B 1RTNA 3PCOB 1G51A 3N6RA 2F0MA 4KJOA 4JV5Q 4K2KA 5D14A 2YTYA 1FGUA 1OO9B 4LUVA 4FXDA 2L4NA 3BDCA 1O80A 2YTVA 2Z6KA 2PQEA 1IBLQ 2NZ1D 5EPLA 3PV0A 4GOPA 4JI7L 3PUWA 2G9HD 4UP7A 3MXNB 5FO7B 4CDEC 1Q90A 3C1FA 4B3ML 1NR4A 2KBNA 3SK5A 1JT8A 3GTJH 2KECA 3K5NA 5IIFA 3KDFB 1GM5A 4HJ7A 1PYSB 2MP1A 4KY5A 1QZGA 2UUAL 4GOPC 2RDHA 4X3TA 3A8KE 4LF8Q 4N8X1 3TZUA 3K8AA 4H7BA 1U4LA 1K0SA 4POFA 3VYSA 4CJ1B 5FLXc 2EXZA 4MN3A 3GV6A 4LFBL 5FLXL 4FXGC 4KHZA 1BBXC 1I4GA 1IKLA 2XRQD 1WTVA 1EOTA 1ZYRD 1R9TH 2WB1E 2DJFC 5EKLA 4V190 4LF6L 3PSIA 4R4TA 1PH6A 1WTOA 2RA4A 3PF5A 4G4KA 4BA1I 1V1OA 1IBKL 3HEJA 4C2MB 2A68C 1K28A 5ELDA 3OMCA 4R4QA 3OWEB 5AJ3L 5ELEA 4EQOA 4C1NI 2N55A 1V8QA 3IAYA 3PGZA 5COYA 1CQVA 3HOZH 4BBRG 1EU4A 3TP6A 2Z4IA 4NXNQ 3K0XA 1OXXK 4ILWA 2B63G 2E2IH 1KAAA 2XWJB 4G7OC 1A3UA 1E7ZA 2VB3X 3DWQA 1V1PA 2F0QA 3BVGA 3HOYB 4ZCKA 1B7YB 1XMQL 1NAPA 1B9MA 5JEAG 1XMQQ 1X32A 2EQSA 2NBFA 5ELFA 1FL0A 3NQIA 3F1ZA 1WD0A 4MTKA 2ENBA 4BBRB 5FO9B 3S1MB 3M3YH 2OXPA 1HTPA 5F2DA 2F3WA 3K5LA 3I4NB 3FKIB 1H9JA 2CH4W 2Y0SG 1KLGD 2F0LA 1QILA 2EYHA 1SBBB 4BXXH 3JAMc 3VA5A 3VYRA 2IJ0A 1KDBA 4A4IA 4KKSA 3I7FA 1SNQA 1IYVA 3H91A 2FMCA 1K83B 1YVCA 3CCEA 1EQRA 3ND8A 4DK6C 1RIPA 2KHSA 3NENA 1PH1A 2AQ2B 1ESRA 3NWSA 1O7IA 2GVAA 3ERSX 5EBCA 1HNZL 1S5DD 1I6VC 1AN8A 4LF5Q 5C3XA 3NTHA 4GKJL 1PTOH 2K5NA 1EY6A 4JI1Q 2WINB 1I6HB 4G57A 3GTKB 3CKIB 4DA2A 4KLKA 3NUCA 2UUAQ 3BYYB 2DN8A 1AH9A 3K81C 4A3DB 1BKBA 3S1QH 3IL8A 2E5LQ 2L0CA 3K57A 2ZM6Q 4M8AA 1N34L 4C3JH 1FJGQ 1MSGA 4IPCA 5D65A 3G48A 2O5IC 3HKSA 4DAYB 3BG3A 3MXGA 2F0DA 4ZKBB 1XTDA 3LNNA 4DNRB 4JI3L 1AEXA 3D0FA 4HJAA 3U4ZA 5IYBH 4A3BH 1O7ZA 4RWSC 1IL2A 2UU9Q 3GTGB 1LTRD 4DV3Q 1W2BA 2B8GA 3I4MB 4BBSG 4HTHA 4NMZA 5DM73 2NN6G 3S16B 2B2TA 2JXMB 2O4XA 4A93G 4DR7Q 3S1MH 1PZJD 2CVRA 2CQOA 4H13C 1LTAD 4IFDG 1SMYC 1STYA 3A56A 4IALA 3GTOB 1J9OA 5C44B 2HHHQ 3FKIH 1AW7A 1TKWB 1ENFA 1C8CA 2K6AA 3DHQA 3T51B 4J6HA 3JAMi 3M7GA 2UUBQ 1L0XB 2O5JC 3LX0A 1Z7TA 1GUGA 2IX3A 2NUCA 1XMOQ 2RVLA 4AYBB 4IZ8A 1JWUD 1JOKA 3Q8DA 3SK8A 1QUQA 4L6TB 4DR3L 4OX9Q 4HIDA 1QJOA 3I3CA 4IUQA 1EEFD 1M8AA 4GOPB 1I94Q 1JE5A 1LT3D 4K5XA 2N78A 1ENAA 2JK8A 3EFXD 2QEXA 3CCJA 1YHBA 2D62A 1HUMA 1EU3A 2TSSA 4JI8Q 3RZDH 4JBWA 1ILPA 4JBJA 4JK1C 1VQ6A 1PDQA 2HD3A 5LHY1 3I4NH 2NN6H 4KY7A 4B9WA 2SOBA 3NEMA 1LTGD 4A3GG 3T1HL 2DNEA 3T56B 4BS9A 1S5ED 2VQFQ 1JQYD 5IT9L 1HZCA 4H44C 1ET9A 4C3IH 4V0BA 1Q82C 2FJ2A 1L2FA 1XTCD 4R4CA 4DKAC 2BOSA 4UPAA 1XWEA 1Q3LA 3CW2C 2F0JA 4NDXA 3S1RH 2SNMA 4DFAA 2G5DA 5E1FA 4J1MA 1SEBD 5KYLA 2PI2A 3JAML 2R7ZG 3LWUA 1PV4A 2OWOA 3N52A 2RKSA 1FVIA 4LFAL 2CQAA 2K32A 1HR0L 3A8JE 1VQ9A 1WCMB 3KLWA 5FO8B 1CA6A 3D8GA 4JYAQ 4EQ5A 2AHOB 2LY7A 5FK9C 5C4XB 3MXUA 2B8FA 1GUNA 2OTJA 4JYAL 2KHJA 4A3GH 1TWGB 3HZXA 1MSHA 3TS2A 3KK7A 4DR5L 5A2QL 2N8NA 4KD3A 4DXFA 1V1PB 3OWFA 3PQIA 2L12A 1GUSA 2HCCA 5C3WA 1IBML 4JCVE 1YITA 1X3EA 5CBEE 3BDOA 4PG3A 3RN5A 1PRTF 4APVA 3WOFA 2B29A 4XYQA 4OELB 2JE6I 4A3MH 2HQLA 2EXDA 4YY3L 3A54A 4Y52H 2A1AA 1SXTA 2O2LD 5A35A 4DV5Q 3F2UA 3M85A 2EOTA 2PW5A 2CCZA 5C4HA 1JORA 1QOHA 1TT2A 2AUJD 2VB2X 4K8IA 3T53B 3WDNA 1B4OA 5L37A 1QE6A 2XTIA 4GZYC
chains in the Genus database with same CATH topology
1D8LA 1L1OB 2OCEA 1I50H 4A3CG 4H02A 1JJ2A 2Z6KC 1LYLA 3J7ZC 1VQAA 4JI4Q 2AWOA 1X3GA 1A62A 4NB3A 2UUCL 1V1QA 4LUZA 1PH7A 4LFBQ 3GTLH 4JI6Q 3F2DA 1PH5A 1L0WA 1Y14B 2IX0A 1TWCH 3PO2H 1CKOA 1EUJA 3S16H 1HR0W 3FHWA 1BVSA 5M5XH 3TREA 1CUKA 2KCMA 3AQQA 4DV5L 2BH2A 3I4NG 2ID0A 4X65Q 1C0AA 4YY3Q 2VUMH 2A8VA 2R92G 2VNUD 5DLQE 2N49A 2R7ZH 4IFDJ 2PQAB 1UE6A 1Y1WH 1KC8C 1J6QA 5GAHC 2F52A 3KJPA 3TQYA 2JA7H 4P75A 3CQZH 4DR4L 3FP9A 1E1OA 1E24A 4PMWA 1OXTA 3K7UC 5IYBG 4A3FG 4YHHL 2IX1A 2RHQB 3RN2A 1CSQA 1I6HH 4IPGA 5C0XJ 2KENA 3H3VH 4OONA 3PO3G 5BR8Q 3S2HH 3NBHB 1N33Q 5FJ8G 1U0LA 1KIXA 3I56A 1N32Q 1L1OC 4A3JG 1X54A 1P8LA 1NJIC 4DV0L 4YCVA 4EX5A 2HHHL 5IP9G 5IYDG 2IY5B 4X6AH 3J80i 3F8TA 4HJ5A 4BY7G 3ICEA 2R93G 2WFWA 1IYJB 4GS3A 4BA2I 1K73C 1Q12A 1XPOA 1VCIA 3OW2A 1YJNA 4DR2Q 1N36L 3PUZA 4GNXB 3J80c 3G4SA 4DV1Q 2JA6G 4YWMA 1GO3E 5GROA 1K83H 3CCUA 1XJVA 1VQCA 1KRTA 5HGQA 1MKHA 4MNOA 1NY4A 4DV2L 1PH3A 4A3IH 4IFDI 4DV2Q 2UXBL 2UXBQ 1Z9FA 3KYHC 2Q2IA 2I5MX 4R1JA 2ZJQA 1A63A 2UU9L 3PUYA 1OTCA 3KF8B 5C4JH 4AQYQ 3GTPH 1LM0A 4UP8A 4NXNL 5GADC 2R7DA 1MJEA 4O2DA 3KOJA 4L5TA 4B3RQ 3STBC 2ZTCA 1TWGH 3PCOB 1G51A 2NZHA 4JV5Q 3HFZB 4NPSA 1PYBA 2F4VL 3L7ZC 2YTYA 1FGUA 1XNQQ 4LUVA 4FDBA 1IBML 4DV0Q 4L5RC 5M3MH 5AJ3Q 5LMNW 3RLNA 1S40A 2VY3A 2YTVA 1GVPA 2Z6KA 4IOCA 2JQOA 3CCQA 5LMUL 1N33L 2HT1A 4BBSH 1IBLQ 2WB1G 4R4OA 4HJ9A 4BY1G 2FXQA 1GKHA 3PV0A 4GOPA 1VQEA 4JI7L 2E2HH 3PUWA 4YCWA 1EYGA 1Q8KA 4QL5A 4UP7A 2IT1A 3MXNB 4JI0L 4A3DH 4DR4Q 4AIMA 3H0GH 5GAGC 4KHPQ 4B3ML 2E5LL 2KBNA 3J81i 2WAQG 2LXJA 3RLFA 3CXCA 2K4KA 2YV5A 1SN8A 1CKMA 2N3SA 4LW1A 4C3HH 3GTJH 3PO3H 3H0GG 3KDFB 1GM5A 4POGA 5C4XH 2RF4A 4HJ7A 1PYSB 4LNQA 4YWKA 1QZGA 4A3KH 4GOPC 2K75A 2UUAL 3H15A 2AKWB 3GTQH 4JI5L 4IPDA 2DUDA 3CMEA 4HIMA 2DGYA 2Q2HA 1HZBA 1K3RA 4LF8Q 3K8AA 2B63H 4AH6A 2NVXH 4DV7L 4A3MG 1BBUA 2PNHA 4POFA 5IP7H 3HOUH 4GKKL 4A3DG 1Q81C 1HZ9A 5FLXc 1X6OA 4LF5L 1G6PA 1TXYA 4LFBL 2VZAA 5IWAL 3EN2A 5IE8A 3RR5A 1QVFA 4GN3B 4KHZA 1HNZQ 1UE7A 1EIFA 4DPGA 5J3BA 1X65A 1R9TH 2WB1E 4JG2A 1WOCA 3CCRA 2A19A 3EIVA 1SR3A 2YTXA 3PSIA 1OXVA 4R4TA 1PH6A 4LF6L 5FLMH 5M5WH 3DLLA 1Q7YC 4MZ9A 3PF5A 4L5SA 1KXLA 4BA1I 5H1SE 2B3GA 3G6EA 1NE3A 2OTLA 3LGJA 3TRZA 1IBKL 5FLMG 4DR1L 2QGQA 2WAQE 5EAYA 3S24A 3KDFA 2VUMG 4K0KL 5LMUQ 4R4QA 4A3EH 3CC2A 2JJQA 3KFUA 1LTLA 5AJ3L 3CC4A 1XNQL 1JJGA 2ASBA 4A3JH 2YU9H 1ASZA 2JA6H 3PGZA 3B6YA 3I2ZA 1X3FA 3OTOQ 3HOZH 1Q86C 4BBRG 4LF7L 4X62L 1NMGA 1YHAA 2RCNA 4NXNQ 4AQYL 3K0XA 1OXXK 3F2CA 1IBMQ 4DR7L 3ER0A 3ULPA 2B63G 2E2IH 2CWPA 3GO5A 5LMNQ 1NBWA 2JEAI 3RZOH 3HKZE 2EIFA 4A3EG 1PH2A 2CWAA 2JA7G 1E7ZA 3U4VA 4GLVB 4IJHA 4DR5Q 4LF9L 1HNWQ 1AE2A 1UWVA 4DV4Q 1VQNA 1CSPA 4NXMQ 2JEBI 5IY0A 2MNAA 2ZJRA 3ULJA 4X66Q 3I55A 4B3SL 1B7YB 1XMQL 3S1NH 1S3OA 4P71A 5JEAG 1XMQQ 3D31A 3G71A 2R6GA 1DGSA 4GN5A 4X66L 2EQSA 1QVGA 1VQOA 3L0OA 1W3SA 1FL0A 3PUVA 3E9HA 4NXML 3F1ZA 4GLAC 3DM3A 4GN4B 5JEAJ 1HR0Q 3PIOA 1KD1C 4JI2L 1VQLA 4JBMA 1KAWA 1KHIA 3BJUA 1MJCA 5LMNL 1KQSA 3E9IA 5IT9c 1XNRL 3M3YH 3H3VI 3AFPA 3PIPA 3KF6B 3CPFA 1VS0A 4WJ4A 1PA6A 3OTOL 4HIOA 1UEBA 2AWNA 4B3TL 2Y0SG 1M1KC 3IRBA 2Q2TA 3W1BA 4OO1G 4X65L 4BXXH 3JAMc 3KJOA 2BH8A 3U58A 4A3FH 4K0KQ 4A4IA 1C9OA 3JC66 2JA8H 3CAMA 3I7FA 3MEFA 1IBKQ 2ZTDA 3AYHB 4RMFA 1YVCA 3CCEA 3T1HQ 4JI6L 3T1YQ 3AEVA 4LF6Q 1EQRA 4UY8C 4DK6C 2UUCQ 1RIPA 1QZHA 3UDXA 3NENA 4QY7A 1VQMA 1X9NA 1PH1A 4LFCQ 4TQUS 4JI4L 1O7IA 2GVAA 3K7AH 3ERSX 4IOAA 1HNZL 3CPWA 2V1CC 1SRUA 2YYZA 4JI8L 5IWAQ 1YI2A 5C3EG 2ZJPA 4LF5Q 3PF4A 3TEHB 2CFMA 2ATWA 4GKJL 1Q1BA 1KL9A 4GKKQ 2K5NA 4JI1Q 4DV7Q 4IO9A 3PUXA 3HOYH 2K14A 3FKIG 2Y0SE 1VQFA 4JI5Q 4OWXB 1VQIA 4KLKA 2RHSB 1VQBA 2UUAQ 2MO1A 3VDYA 4DUZQ 3U50C 1AH9A 3K81C 4AYBG 2C35B 4QJFA 4GNXC 1RL2A 2K52A 4DR3Q 1SFOH 4BY1H 1BKBA 4OX9L 2UXCL 3S1QH 1VQDA 4P72A 4LF4Q 2E5LQ 2F3IA 2NVYH 2ZM6Q 1N34L 4KHPL 3TS0A 1V43A 1Y1VH 4C3JH 1XMOL 2PMZE 1HNXL 4JI0Q 5HY6A 1FJGQ 3SGIA 4IPCA 1VQGA 3A0JA 4PZ6A 3G48A 1E22A 3HKSA 5C44G 1XNRQ 1X55A 1IBLL 5C4XG 4DAYB 2PI2E 4OWTB 4XTCS 3HOXG 4GNXA 4A76A 4A3KG 2GN5A 1Q1EA 2K50A 2PQAA 3NELA 4OO1I 1XTDA 4LWCA 5FJ8H 2MO0A 1CKNA 1Q46A 4A3BG 4JI3L 3M7NA 1T9HA 3D0FA 3J7A5 5C0XI 4HJAA 3S15H 3U4ZA 5IYBH 4B3RL 1WFQA 4IJLA 4B3SQ 4A3BH 4ME3A 3HOWG 3I4MG 3S2DH 1IL2A 2UU9Q 1W2BA 4DV3Q 1VQ8A 1QUQB 5M3MG 2VQEQ 1J5EQ 1HNWL 5JJKA 4LFAQ 4BBSG 2HIVA 3M9BA 1N8RC 5E7NA 4WJ3M 2NN6G 3CCSA 2VQEL 1I3QH 1SLJA 1U5KA 1WCMH 4DV3L 4DV6L 1Z47A 1EQQA 2D0OA 3WWVA 4DR7Q 4A93G 1MIUA 2VL6A 1C7YA 3S1MH 4UP9A 2OQKA 1PVOA 2ZTEA 2CQOA 3BZKA 3I4OA 4X62Q 3ZJYC 1PH8A 4DK3C 4LF7Q 1YEZA 4A93H 4A3LG 5IYCH 5ELNA 4IFDG 4JI3Q 1QVCA 2MQHA 3I4MH 2HHHQ 3FKIH 4JBKA 3W5OA 2JA5G 1K8GA 3GTKH 3JAMi 1EIYB 1N32L 3BU2A 1PH4A 4QGUA 1EOVA 5C0XG 2UUBQ 4PZ8A 1CKNB 2JA5H 5M5YH 1EFWA 5M3FH 2R92H 4DR1Q 1YNXA 2JA9A 5GAEC 3A74A 2H5XA 1VQ5A 4RG1A 1XMOQ 5IYCG 5JJIA 1K8AC 3UE1A 5C3EH 1E3PA 2BA1A 3Q8DA 2ZM6L 1YIJA 4BY7H 1QUQA 1NTGA 2NN6I 4DR3L 4OX9Q 4HIDA 2ALYB 3UDGA 2JA8G 2I5LX 4DUZL 4A75A 4AYBE 4GOPB 1I94Q 3GTGH 1JE5A 3CCVA 5JJLA 2N78A 2JK8A 4KI0A 2QEXA 2KCTA 3CCJA 1JT8A 4A3CH 1EWIA 1YHBA 1XPUA 2D62A 1E1TA 3M4PA 4ALPA 1TWHH 3F2BA 4LF8L 1I94L 4IPHA 1LUZA 4JI8Q 3RZDH 1SE8A 3S17H 4A3LH 1N9WA 4JBWA 4JBJA 2CKZB 4LFCL 2NVQH 2GVBA 3UDFA 1VQ6A 4A3IG 3I4NH 2XGTA 4DNIA 4B3MQ 1X56A 3M4QA 3NEMA 3J81c 1H95A 3T1YL 4A3GG 2K5VA 4DAMA 3T1HL 1IZ6A 2HIXA 3CCMA 1VQJA 5IP7G 2VQFQ 3HOUG 4Y7NH 1VQ4A 4JI7Q 1HZCA 2LSSA 4X64Q 3RNUA 4C3IH 1K0RA 1Y1VG 5IP9H 4J15A 5IYDH 1VQ7A 1Q82C 4DR6Q 1L2FA 2UUBL 1KRSA 4HIKA 1G291 4R4CA 4DKAC 5K36G 2K5HA 3PO2G 5ELOA 4UPAA 1ASYA 1SROA 3CW2C 2F4VQ 4JOIC 2IHEA 1OXUA 1B70B 1YJ9A 4B3TQ 4JV5L 3S1RH 3GD7A 3CP0A 1K9MC 4OWWB 2KHIA 2UXDQ 3K80C 2PI2A 1OXSC 4BXXG 3ULLA 3HOXH 3AFQA 2R7ZG 1PV4A 4DV6Q 2ES2A 2OWOA 1HZAA 1A0IA 3CF5A 3S14H 3HOYG 3RLOA 1AE3A 2R7FA 1Y1WG 4OXPA 1TWFH 2I0QA 4QQBX 2D0PA 4JI2Q 1JMCA 2I5HA 1FVIA 1YJWA 1HR0L 2LXKA 4JOIA 2Q2UA 3CMAA 2VS1A 1VQ9A 4LFAL 3KLWA 1J5EL 4QIWE 4DV1L 2R93H 3CD6A 1YBYA 3A5UA 1PFSA 1YZ6A 4R4IA 4DR2L 1N36Q 1WI5A 3CCLA 3HOVH 4JYAQ 4EQ5A 4DUYQ 4GLXA 1WCMG 2AMCB 3CC7A 3HOZG 2AHOB 3M4OH 1UE5A 2E8GA 5M3FG 4DUYL 2NVTH 1UE1A 1VQKA 4JYAL 2OTJA 2L15A 4YCUA 3L2PA 2KHJA 4A3GH 4LUOA 1NMFA 1L1OA 3GDEA 4DV4L 3TS2A 4LF9Q 2NZOA 4DR5L 2N8NA 4XIGS 4PZ7A 5BR8L 4P73A 4MTNA 1HJPA 3STBD 4YWLA 1S72A 1JJCB 1WJJA 3E0EA 1XPRA 4HJ8A 1PHJA 4JCVE 1VQPA 1YITA 1X3EA 3HKZG 1P16A 4JC0A 4TVAB 4PG3A 3RN5A 1JB7A 3GTMH 2WP8J 1B8AA 4YHHQ 1FJGL 3HOVG 2MFIA 2UXDL 3A5ZB 1HNXQ 1WYDA 3GTOH 1A8VA 3OYYA 4APVA 1M90C 5C44H 3EBEA 1N34Q 1TWAH 1PH9A 1HH2P 2B29A 2OQ0A 4LF4L 2QA4A 2BA0A 2UXCQ 2JE6I 1I5FA 4L5QA 2VW9A 4BBRH 4A3MH 2HQLA 2EXDA 4YY3L 4Y52H 2A1AA 5GQOA 4C2MH 3BZCA 4DV5Q 3J81j 4O0AA 3M85A 2CCZA 4DR6L 1IXRA 3KF6A 3W1GA 1BBWA 2IHFA 1YHQA 2E2JH 2Z0SA 1D7QA 3UDIA 1GD7A 4P74A 3UE0A 4X64L 4JI1L 2VQFL 3HOWH 4GKJQ 2XTIA 1V9PA 1VQHA 1SMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8L A;  1L1O B;  2OCE A;  1I50 H;  4A3C G;  4H02 A;  1JJ2 A;  2Z6K C;  1LYL A;  3J7Z C;  1VQA A;  4JI4 Q;  2AWO A;  1X3G A;  1A62 A;  4NB3 A;  2UUC L;  1V1Q A;  4LUZ A;  1PH7 A;  4LFB Q;  3GTL H;  4JI6 Q;  3F2D A;  1PH5 A;  1L0W A;  1Y14 B;  2IX0 A;  1TWC H;  3PO2 H;  1CKO A;  1EUJ A;  3S16 H;  1HR0 W;  3FHW A;  1BVS A;  5M5X H;  3TRE A;  1CUK A;  2KCM A;  3AQQ A;  4DV5 L;  2BH2 A;  3I4N G;  2ID0 A;  4X65 Q;  1C0A A;  4YY3 Q;  2VUM H;  2A8V A;  2R92 G;  2VNU D;  5DLQ E;  2N49 A;  2R7Z H;  4IFD J;  2PQA B;  1UE6 A;  1Y1W H;  1KC8 C;  1J6Q A;  5GAH C;  2F52 A;  3KJP A;  3TQY A;  2JA7 H;  4P75 A;  3CQZ H;  4DR4 L;  3FP9 A;  1E1O A;  1E24 A;  4PMW A;  1OXT A;  3K7U C;  5IYB G;  4A3F G;  4YHH L;  2IX1 A;  2RHQ B;  3RN2 A;  1CSQ A;  1I6H H;  4IPG A;  5C0X J;  2KEN A;  3H3V H;  4OON A;  3PO3 G;  5BR8 Q;  3S2H H;  3NBH B;  1N33 Q;  5FJ8 G;  1U0L A;  1KIX A;  3I56 A;  1N32 Q;  1L1O C;  4A3J G;  1X54 A;  1P8L A;  1NJI C;  4DV0 L;  4YCV A;  4EX5 A;  2HHH L;  5IP9 G;  5IYD G;  2IY5 B;  4X6A H;  3J80 i;  3F8T A;  4HJ5 A;  4BY7 G;  3ICE A;  2R93 G;  2WFW A;  1IYJ B;  4GS3 A;  4BA2 I;  1K73 C;  1Q12 A;  1XPO A;  1VCI A;  3OW2 A;  1YJN A;  4DR2 Q;  1N36 L;  3PUZ A;  4GNX B;  3J80 c;  3G4S A;  4DV1 Q;  2JA6 G;  4YWM A;  1GO3 E;  5GRO A;  1K83 H;  3CCU A;  1XJV A;  1VQC A;  1KRT A;  5HGQ A;  1MKH A;  4MNO A;  1NY4 A;  4DV2 L;  1PH3 A;  4A3I H;  4IFD I;  4DV2 Q;  2UXB L;  2UXB Q;  1Z9F A;  3KYH C;  2Q2I A;  2I5M X;  4R1J A;  2ZJQ A;  1A63 A;  2UU9 L;  3PUY A;  1OTC A;  3KF8 B;  5C4J H;  4AQY Q;  3GTP H;  1LM0 A;  4UP8 A;  4NXN L;  5GAD C;  2R7D A;  1MJE A;  4O2D A;  3KOJ A;  4L5T A;  4B3R Q;  3STB C;  2ZTC A;  1TWG H;  3PCO B;  1G51 A;  2NZH A;  4JV5 Q;  3HFZ B;  4NPS A;  1PYB A;  2F4V L;  3L7Z C;  2YTY A;  1FGU A;  1XNQ Q;  4LUV A;  4FDB A;  1IBM L;  4DV0 Q;  4L5R C;  5M3M H;  5AJ3 Q;  5LMN W;  3RLN A;  1S40 A;  2VY3 A;  2YTV A;  1GVP A;  2Z6K A;  4IOC A;  2JQO A;  3CCQ A;  5LMU L;  1N33 L;  2HT1 A;  4BBS H;  1IBL Q;  2WB1 G;  4R4O A;  4HJ9 A;  4BY1 G;  2FXQ A;  1GKH A;  3PV0 A;  4GOP A;  1VQE A;  4JI7 L;  2E2H H;  3PUW A;  4YCW A;  1EYG A;  1Q8K A;  4QL5 A;  4UP7 A;  2IT1 A;  3MXN B;  4JI0 L;  4A3D H;  4DR4 Q;  4AIM A;  3H0G H;  5GAG C;  4KHP Q;  4B3M L;  2E5L L;  2KBN A;  3J81 i;  2WAQ G;  2LXJ A;  3RLF A;  3CXC A;  2K4K A;  2YV5 A;  1SN8 A;  1CKM A;  2N3S A;  4LW1 A;  4C3H H;  3GTJ H;  3PO3 H;  3H0G G;  3KDF B;  1GM5 A;  4POG A;  5C4X H;  2RF4 A;  4HJ7 A;  1PYS B;  4LNQ A;  4YWK A;  1QZG A;  4A3K H;  4GOP C;  2K75 A;  2UUA L;  3H15 A;  2AKW B;  3GTQ H;  4JI5 L;  4IPD A;  2DUD A;  3CME A;  4HIM A;  2DGY A;  2Q2H A;  1HZB A;  1K3R A;  4LF8 Q;  3K8A A;  2B63 H;  4AH6 A;  2NVX H;  4DV7 L;  4A3M G;  1BBU A;  2PNH A;  4POF A;  5IP7 H;  3HOU H;  4GKK L;  4A3D G;  1Q81 C;  1HZ9 A;  5FLX c;  1X6O A;  4LF5 L;  1G6P A;  1TXY A;  4LFB L;  2VZA A;  5IWA L;  3EN2 A;  5IE8 A;  3RR5 A;  1QVF A;  4GN3 B;  4KHZ A;  1HNZ Q;  1UE7 A;  1EIF A;  4DPG A;  5J3B A;  1X65 A;  1R9T H;  2WB1 E;  4JG2 A;  1WOC A;  3CCR A;  2A19 A;  3EIV A;  1SR3 A;  2YTX A;  3PSI A;  1OXV A;  4R4T A;  1PH6 A;  4LF6 L;  5FLM H;  5M5W H;  3DLL A;  1Q7Y C;  4MZ9 A;  3PF5 A;  4L5S A;  1KXL A;  4BA1 I;  5H1S E;  2B3G A;  3G6E A;  1NE3 A;  2OTL A;  3LGJ A;  3TRZ A;  1IBK L;  5FLM G;  4DR1 L;  2QGQ A;  2WAQ E;  5EAY A;  3S24 A;  3KDF A;  2VUM G;  4K0K L;  5LMU Q;  4R4Q A;  4A3E H;  3CC2 A;  2JJQ A;  3KFU A;  1LTL A;  5AJ3 L;  3CC4 A;  1XNQ L;  1JJG A;  2ASB A;  4A3J H;  2YU9 H;  1ASZ A;  2JA6 H;  3PGZ A;  3B6Y A;  3I2Z A;  1X3F A;  3OTO Q;  3HOZ H;  1Q86 C;  4BBR G;  4LF7 L;  4X62 L;  1NMG A;  1YHA A;  2RCN A;  4NXN Q;  4AQY L;  3K0X A;  1OXX K;  3F2C A;  1IBM Q;  4DR7 L;  3ER0 A;  3ULP A;  2B63 G;  2E2I H;  2CWP A;  3GO5 A;  5LMN Q;  1NBW A;  2JEA I;  3RZO H;  3HKZ E;  2EIF A;  4A3E G;  1PH2 A;  2CWA A;  2JA7 G;  1E7Z A;  3U4V A;  4GLV B;  4IJH A;  4DR5 Q;  4LF9 L;  1HNW Q;  1AE2 A;  1UWV A;  4DV4 Q;  1VQN A;  1CSP A;  4NXM Q;  2JEB I;  5IY0 A;  2MNA A;  2ZJR A;  3ULJ A;  4X66 Q;  3I55 A;  4B3S L;  1B7Y B;  1XMQ L;  3S1N H;  1S3O A;  4P71 A;  5JEA G;  1XMQ Q;  3D31 A;  3G71 A;  2R6G A;  1DGS A;  4GN5 A;  4X66 L;  2EQS A;  1QVG A;  1VQO A;  3L0O A;  1W3S A;  1FL0 A;  3PUV A;  3E9H A;  4NXM L;  3F1Z A;  4GLA C;  3DM3 A;  4GN4 B;  5JEA J;  1HR0 Q;  3PIO A;  1KD1 C;  4JI2 L;  1VQL A;  4JBM A;  1KAW A;  1KHI A;  3BJU A;  1MJC A;  5LMN L;  1KQS A;  3E9I A;  5IT9 c;  1XNR L;  3M3Y H;  3H3V I;  3AFP A;  3PIP A;  3KF6 B;  3CPF A;  1VS0 A;  4WJ4 A;  1PA6 A;  3OTO L;  4HIO A;  1UEB A;  2AWN A;  4B3T L;  2Y0S G;  1M1K C;  3IRB A;  2Q2T A;  3W1B A;  4OO1 G;  4X65 L;  4BXX H;  3JAM c;  3KJO A;  2BH8 A;  3U58 A;  4A3F H;  4K0K Q;  4A4I A;  1C9O A;  3JC6 6;  2JA8 H;  3CAM A;  3I7F A;  3MEF A;  1IBK Q;  2ZTD A;  3AYH B;  4RMF A;  1YVC A;  3CCE A;  3T1H Q;  4JI6 L;  3T1Y Q;  3AEV A;  4LF6 Q;  1EQR A;  4UY8 C;  4DK6 C;  2UUC Q;  1RIP A;  1QZH A;  3UDX A;  3NEN A;  4QY7 A;  1VQM A;  1X9N A;  1PH1 A;  4LFC Q;  4TQU S;  4JI4 L;  1O7I A;  2GVA A;  3K7A H;  3ERS X;  4IOA A;  1HNZ L;  3CPW A;  2V1C C;  1SRU A;  2YYZ A;  4JI8 L;  5IWA Q;  1YI2 A;  5C3E G;  2ZJP A;  4LF5 Q;  3PF4 A;  3TEH B;  2CFM A;  2ATW A;  4GKJ L;  1Q1B A;  1KL9 A;  4GKK Q;  2K5N A;  4JI1 Q;  4DV7 Q;  4IO9 A;  3PUX A;  3HOY H;  2K14 A;  3FKI G;  2Y0S E;  1VQF A;  4JI5 Q;  4OWX B;  1VQI A;  4KLK A;  2RHS B;  1VQB A;  2UUA Q;  2MO1 A;  3VDY A;  4DUZ Q;  3U50 C;  1AH9 A;  3K81 C;  4AYB G;  2C35 B;  4QJF A;  4GNX C;  1RL2 A;  2K52 A;  4DR3 Q;  1SFO H;  4BY1 H;  1BKB A;  4OX9 L;  2UXC L;  3S1Q H;  1VQD A;  4P72 A;  4LF4 Q;  2E5L Q;  2F3I A;  2NVY H;  2ZM6 Q;  1N34 L;  4KHP L;  3TS0 A;  1V43 A;  1Y1V H;  4C3J H;  1XMO L;  2PMZ E;  1HNX L;  4JI0 Q;  5HY6 A;  1FJG Q;  3SGI A;  4IPC A;  1VQG A;  3A0J A;  4PZ6 A;  3G48 A;  1E22 A;  3HKS A;  5C44 G;  1XNR Q;  1X55 A;  1IBL L;  5C4X G;  4DAY B;  2PI2 E;  4OWT B;  4XTC S;  3HOX G;  4GNX A;  4A76 A;  4A3K G;  2GN5 A;  1Q1E A;  2K50 A;  2PQA A;  3NEL A;  4OO1 I;  1XTD A;  4LWC A;  5FJ8 H;  2MO0 A;  1CKN A;  1Q46 A;  4A3B G;  4JI3 L;  3M7N A;  1T9H A;  3D0F A;  3J7A 5;  5C0X I;  4HJA A;  3S15 H;  3U4Z A;  5IYB H;  4B3R L;  1WFQ A;  4IJL A;  4B3S Q;  4A3B H;  4ME3 A;  3HOW G;  3I4M G;  3S2D H;  1IL2 A;  2UU9 Q;  1W2B A;  4DV3 Q;  1VQ8 A;  1QUQ B;  5M3M G;  2VQE Q;  1J5E Q;  1HNW L;  5JJK A;  4LFA Q;  4BBS G;  2HIV A;  3M9B A;  1N8R C;  5E7N A;  4WJ3 M;  2NN6 G;  3CCS A;  2VQE L;  1I3Q H;  1SLJ A;  1U5K A;  1WCM H;  4DV3 L;  4DV6 L;  1Z47 A;  1EQQ A;  2D0O A;  3WWV A;  4DR7 Q;  4A93 G;  1MIU A;  2VL6 A;  1C7Y A;  3S1M H;  4UP9 A;  2OQK A;  1PVO A;  2ZTE A;  2CQO A;  3BZK A;  3I4O A;  4X62 Q;  3ZJY C;  1PH8 A;  4DK3 C;  4LF7 Q;  1YEZ A;  4A93 H;  4A3L G;  5IYC H;  5ELN A;  4IFD G;  4JI3 Q;  1QVC A;  2MQH A;  3I4M H;  2HHH Q;  3FKI H;  4JBK A;  3W5O A;  2JA5 G;  1K8G A;  3GTK H;  3JAM i;  1EIY B;  1N32 L;  3BU2 A;  1PH4 A;  4QGU A;  1EOV A;  5C0X G;  2UUB Q;  4PZ8 A;  1CKN B;  2JA5 H;  5M5Y H;  1EFW A;  5M3F H;  2R92 H;  4DR1 Q;  1YNX A;  2JA9 A;  5GAE C;  3A74 A;  2H5X A;  1VQ5 A;  4RG1 A;  1XMO Q;  5IYC G;  5JJI A;  1K8A C;  3UE1 A;  5C3E H;  1E3P A;  2BA1 A;  3Q8D A;  2ZM6 L;  1YIJ A;  4BY7 H;  1QUQ A;  1NTG A;  2NN6 I;  4DR3 L;  4OX9 Q;  4HID A;  2ALY B;  3UDG A;  2JA8 G;  2I5L X;  4DUZ L;  4A75 A;  4AYB E;  4GOP B;  1I94 Q;  3GTG H;  1JE5 A;  3CCV A;  5JJL A;  2N78 A;  2JK8 A;  4KI0 A;  2QEX A;  2KCT A;  3CCJ A;  1JT8 A;  4A3C H;  1EWI A;  1YHB A;  1XPU A;  2D62 A;  1E1T A;  3M4P A;  4ALP A;  1TWH H;  3F2B A;  4LF8 L;  1I94 L;  4IPH A;  1LUZ A;  4JI8 Q;  3RZD H;  1SE8 A;  3S17 H;  4A3L H;  1N9W A;  4JBW A;  4JBJ A;  2CKZ B;  4LFC L;  2NVQ H;  2GVB A;  3UDF A;  1VQ6 A;  4A3I G;  3I4N H;  2XGT A;  4DNI A;  4B3M Q;  1X56 A;  3M4Q A;  3NEM A;  3J81 c;  1H95 A;  3T1Y L;  4A3G G;  2K5V A;  4DAM A;  3T1H L;  1IZ6 A;  2HIX A;  3CCM A;  1VQJ A;  5IP7 G;  2VQF Q;  3HOU G;  4Y7N H;  1VQ4 A;  4JI7 Q;  1HZC A;  2LSS A;  4X64 Q;  3RNU A;  4C3I H;  1K0R A;  1Y1V G;  5IP9 H;  4J15 A;  5IYD H;  1VQ7 A;  1Q82 C;  4DR6 Q;  1L2F A;  2UUB L;  1KRS A;  4HIK A;  1G29 1;  4R4C A;  4DKA C;  5K36 G;  2K5H A;  3PO2 G;  5ELO A;  4UPA A;  1ASY A;  1SRO A;  3CW2 C;  2F4V Q;  4JOI C;  2IHE A;  1OXU A;  1B70 B;  1YJ9 A;  4B3T Q;  4JV5 L;  3S1R H;  3GD7 A;  3CP0 A;  1K9M C;  4OWW B;  2KHI A;  2UXD Q;  3K80 C;  2PI2 A;  1OXS C;  4BXX G;  3ULL A;  3HOX H;  3AFQ A;  2R7Z G;  1PV4 A;  4DV6 Q;  2ES2 A;  2OWO A;  1HZA A;  1A0I A;  3CF5 A;  3S14 H;  3HOY G;  3RLO A;  1AE3 A;  2R7F A;  1Y1W G;  4OXP A;  1TWF H;  2I0Q A;  4QQB X;  2D0P A;  4JI2 Q;  1JMC A;  2I5H A;  1FVI A;  1YJW A;  1HR0 L;  2LXK A;  4JOI A;  2Q2U A;  3CMA A;  2VS1 A;  1VQ9 A;  4LFA L;  3KLW A;  1J5E L;  4QIW E;  4DV1 L;  2R93 H;  3CD6 A;  1YBY A;  3A5U A;  1PFS A;  1YZ6 A;  4R4I A;  4DR2 L;  1N36 Q;  1WI5 A;  3CCL A;  3HOV H;  4JYA Q;  4EQ5 A;  4DUY Q;  4GLX A;  1WCM G;  2AMC B;  3CC7 A;  3HOZ G;  2AHO B;  3M4O H;  1UE5 A;  2E8G A;  5M3F G;  4DUY L;  2NVT H;  1UE1 A;  1VQK A;  4JYA L;  2OTJ A;  2L15 A;  4YCU A;  3L2P A;  2KHJ A;  4A3G H;  4LUO A;  1NMF A;  1L1O A;  3GDE A;  4DV4 L;  3TS2 A;  4LF9 Q;  2NZO A;  4DR5 L;  2N8N A;  4XIG S;  4PZ7 A;  5BR8 L;  4P73 A;  4MTN A;  1HJP A;  3STB D;  4YWL A;  1S72 A;  1JJC B;  1WJJ A;  3E0E A;  1XPR A;  4HJ8 A;  1PHJ A;  4JCV E;  1VQP A;  1YIT A;  1X3E A;  3HKZ G;  1P16 A;  4JC0 A;  4TVA B;  4PG3 A;  3RN5 A;  1JB7 A;  3GTM H;  2WP8 J;  1B8A A;  4YHH Q;  1FJG L;  3HOV G;  2MFI A;  2UXD L;  3A5Z B;  1HNX Q;  1WYD A;  3GTO H;  1A8V A;  3OYY A;  4APV A;  1M90 C;  5C44 H;  3EBE A;  1N34 Q;  1TWA H;  1PH9 A;  1HH2 P;  2B29 A;  2OQ0 A;  4LF4 L;  2QA4 A;  2BA0 A;  2UXC Q;  2JE6 I;  1I5F A;  4L5Q A;  2VW9 A;  4BBR H;  4A3M H;  2HQL A;  2EXD A;  4YY3 L;  4Y52 H;  2A1A A;  5GQO A;  4C2M H;  3BZC A;  4DV5 Q;  3J81 j;  4O0A A;  3M85 A;  2CCZ A;  4DR6 L;  1IXR A;  3KF6 A;  3W1G A;  1BBW A;  2IHF A;  1YHQ A;  2E2J H;  2Z0S A;  1D7Q A;  3UDI A;  1GD7 A;  4P74 A;  3UE0 A;  4X64 L;  4JI1 L;  2VQF L;  3HOW H;  4GKJ Q;  2XTI A;  1V9P A;  1VQH A;  1SMX A; 
#chains in the Genus database with same CATH topology
 3PO3 B;  4H02 A;  3I73 A;  3J7Z C;  4A3F B;  4JI4 Q;  5DAU A;  2AWO A;  5I9O A;  1A62 A;  4NB3 A;  4HCS A;  2QW7 A;  1SYC A;  3KLS X;  2JP1 A;  1EUJ A;  4IUU A;  1HR0 W;  1JC7 A;  1BVS A;  3EJI A;  5M5X H;  4G7Z C;  5EGT A;  4YY3 Q;  2VUM H;  1GHJ A;  2EY2 A;  4BWG B;  2PQA B;  1UE6 A;  1KC8 C;  2F52 A;  3S15 B;  3CQZ H;  4DR4 L;  1PMR A;  1E24 A;  4A3F G;  3RN2 A;  2J4X A;  4UDU C;  1FYC A;  5C0X J;  3H3V H;  3PO3 G;  1XXG A;  1TS4 A;  2PW7 A;  3S2H H;  1ML0 D;  1KIX A;  3I56 A;  1L1O C;  4ULL A;  5HGT A;  4EX5 A;  5IYD G;  3Q22 A;  3F8T A;  5COR A;  1TY2 A;  4L63 B;  1LAC A;  2IPK D;  1XPO A;  2DNC A;  1JWM D;  1YJN A;  1H9K A;  4O42 A;  3S2H B;  4DR2 Q;  1G6Z A;  3J80 c;  4OEM B;  1XJV A;  3J7Y W;  5I6Y A;  1KRT A;  1MKH A;  1NY4 A;  4DV2 L;  4A3I H;  4DV2 Q;  2E75 C;  1Z9F A;  3GTJ B;  2Q2I A;  4QF4 A;  4OL7 A;  1DYQ A;  3PUY A;  1CI3 M;  3KF8 B;  4U68 A;  5GAD C;  4O2D A;  1TWG H;  1BNZ A;  4LAA A;  3J81 E;  4HMI A;  5T1G A;  1PYB A;  3MFG A;  4CDF C;  2D5D A;  3R2I A;  4HCE A;  1PTO C;  1GVP A;  4IOC A;  2HT1 A;  2JQO A;  3CCQ A;  2H1E A;  1BCP B;  1GKH A;  1QNK A;  5ELB A;  1VQE A;  2RSO A;  2E2H H;  2QIL A;  4IQZ A;  4CDD C;  1Q8K A;  1EYA A;  3PMF A;  3MXP A;  3H0G H;  2E5L L;  3J81 i;  3RLF A;  3CXC A;  2YV5 A;  2N3S A;  4XYO A;  3PO3 H;  2E2D C;  4POG A;  2E76 C;  3R2T A;  3D4R A;  4A3K H;  1TR5 A;  2K75 A;  1VMP A;  2A6H D;  1CA5 A;  4EQP A;  2RBM A;  3GTQ H;  4IPD A;  4HIM A;  3CME A;  1HZB A;  4ZKC B;  1F2Y A;  2B2V A;  2NVX H;  2PNH A;  4GKK L;  1MGS A;  3HOU H;  1RJT A;  4A3D G;  1Q81 C;  3UI2 A;  4LF5 L;  1TXY A;  3EVQ A;  4RCN A;  4HR7 B;  5IE8 A;  3RR5 A;  3D4D A;  1HNZ Q;  1EIF A;  3V2T A;  4DPG A;  5J3B A;  4JG2 A;  5FLX E;  1S5F D;  3EIV A;  1SR3 A;  2YTX A;  4S3S A;  5FLM H;  4L5S A;  1U4R A;  4MZ9 A;  3NTI A;  2B3G A;  1NE3 A;  2ICI A;  2OTL A;  3LGJ A;  1YNJ D;  1ZXT A;  5EKK A;  3TRZ A;  2QKI C;  5FLM G;  4DR1 L;  2EYL A;  1F9R A;  2VUM G;  3S24 A;  4PNY A;  4A3E H;  3CC2 A;  3KFU A;  4KN4 C;  1LTL A;  3W2D A;  1JIC A;  1JJG A;  1TWA B;  2LKV A;  1Y69 U;  1B50 A;  2JA6 H;  1PFN A;  1X3F A;  1W6K A;  4OGQ C;  1HA6 A;  3F2C A;  1IBM Q;  3ULP A;  2CWP A;  3GO5 A;  3IFT A;  1NBW A;  2EIF A;  4A3E G;  3U4V A;  3I90 A;  4DR5 Q;  5E3F A;  5M5W B;  1UWV A;  2JEB I;  3R93 A;  5IY0 A;  2K7V A;  3OPO A;  5C0X H;  4WJW A;  1DGS A;  1EY0 A;  4GN5 A;  1KAB A;  3L0O A;  1W3S A;  2CW0 C;  2D9U A;  2JYO A;  1LTB D;  4FYD A;  1TS5 A;  3PIO A;  1ONL A;  3VYU A;  4C3I B;  3BJU A;  3E9I A;  2EY5 A;  1XNR L;  1I3Q B;  5J22 A;  1WTX A;  1QG7 A;  3CPF A;  3QIA A;  1VS0 A;  2RDF A;  4ZQ3 A;  1F2L A;  2BE5 C;  3VR4 A;  1M1K C;  3RMH A;  5IT9 E;  3IRB A;  1VF5 C;  4X65 L;  2P5Z X;  3KJO A;  2BH8 A;  4IUN A;  4YIJ A;  1NSN S;  2CH4 A;  1C9O A;  3FPP A;  1MBY A;  2JA8 H;  3CAM A;  1IBK Q;  2Z6B A;  3R8B A;  4A3I B;  3VR5 A;  3ITP A;  2YU9 B;  3AEV A;  2AUK A;  2KCN A;  2XRS D;  4Q5V A;  4LF6 Q;  4F87 A;  4UY8 C;  1TWC B;  5JJZ A;  3NBI A;  4KJN A;  2L11 A;  2UUC Q;  4QY7 A;  1VQM A;  4DAY A;  4FXK C;  3CPW A;  5KNC A;  3S1Q B;  1SRU A;  4JI8 L;  2NVX B;  5C3E G;  2ZJP A;  3PF4 A;  2CFM A;  2I07 B;  4IO9 A;  3PUX A;  2KEE A;  1ET6 A;  2A6E C;  2Y0S E;  4JI5 Q;  4OWX B;  1VQI A;  1XX8 A;  2QDL A;  1D1K A;  3HKZ B;  4GNX C;  4DR3 Q;  4OX9 L;  2F0V A;  4QB4 A;  3J7A F;  2F0K A;  2UXC L;  1STA A;  2F3I A;  3TS0 A;  1V43 A;  1Y1V H;  2WKC A;  5CV9 A;  2PMZ E;  3SGI A;  3HOX B;  4PZ6 A;  1E22 A;  1PTO D;  2KJX A;  1XNR Q;  1X55 A;  1IBL L;  4OWT B;  4GNX A;  4XTC S;  2IW3 A;  3SR1 A;  3BVM A;  4A76 A;  3GTM B;  5CC4 A;  1EEI D;  1U9R A;  3NEL A;  2PQA A;  3NWT A;  5C4J B;  1CKN A;  4ZUJ A;  1STG A;  1T9H A;  3S15 H;  3Q23 A;  1TQO A;  1WFQ A;  4IJL A;  4ME3 A;  1AZQ A;  1PRT B;  1K8M A;  1JOQ A;  2MUY A;  3NBH A;  1VQ8 A;  1QUQ B;  2QF7 A;  1J5E Q;  2EPB A;  5JJK A;  3I8Z A;  1SE4 A;  1GXD C;  1SE2 A;  4WJ3 M;  3CCS A;  3M3Y B;  3MVV A;  1SLJ A;  4DV3 L;  4CKC A;  2NYZ D;  4DV6 L;  2D0O A;  1C7Y A;  2OQK A;  1XYI A;  1PVO A;  1WVL A;  3BZK A;  4A93 H;  4A3L G;  1PH8 A;  1YEZ A;  1UEA B;  5ELN A;  4NW2 A;  4RA8 A;  4JI3 Q;  2B63 B;  1QVC A;  2JA6 B;  3NQT A;  3G7L A;  3C1E A;  4F7X A;  2JA5 G;  1N32 L;  3BU2 A;  1PTO B;  1EOV A;  5M5Y H;  1EFW A;  5M3F H;  4DR1 Q;  1SYE A;  2JA9 A;  4KV6 A;  3A74 A;  3JAM E;  1DON A;  1VQ5 A;  5IYC G;  5K36 H;  1E3P A;  1S4Z A;  2BA1 A;  4EVO A;  1NTG A;  4ZYS A;  4PV1 C;  2K1B A;  1JOO A;  4HMJ A;  4A75 A;  1Y8O B;  3J80 L;  1Q8I A;  3CCV A;  4F8M A;  2JA8 B;  1GUT A;  2KCT A;  4ZRZ A;  4ZUI A;  1XPU A;  3M4P A;  1F9P A;  2JN4 A;  1TWH H;  4LF8 L;  3TZD A;  5D3D A;  4IPH A;  3E0J A;  1DD2 A;  1N9W A;  2CKZ B;  2GVB A;  3UDF A;  4A3I G;  4B3M Q;  1X56 A;  3KBG A;  3J81 c;  1IW7 C;  4HN7 A;  4C3I G;  1IZ6 A;  2HIX A;  4DAM A;  1VQJ A;  5KIX A;  5IP7 G;  2DY7 A;  4CJ0 B;  1VQ4 A;  4JI7 Q;  4X64 Q;  2ZT9 C;  1K0R A;  5IP9 H;  2VXW A;  4J15 A;  5C5M A;  2Q8I B;  1VQ7 A;  4DR6 Q;  3RUZ A;  3GTP B;  3X3N A;  3I91 A;  5K36 G;  1YNN C;  3SVM A;  4QMG A;  4EQN A;  3PO2 G;  5ELO A;  4DF7 A;  2FMM A;  1TS2 A;  4RGM A;  1A15 A;  2MJ8 A;  4JOI C;  1YJ9 A;  1OXU A;  2B2T C;  4JV5 L;  3VR6 A;  3GD7 A;  1DJR D;  1EIG A;  2UXD Q;  1OXS C;  4BXX G;  3HOX H;  3AFQ A;  1JB3 A;  3TN2 A;  1A0I A;  5HUR A;  2R3Z A;  5FOB B;  1AE3 A;  2R7F A;  2XSC A;  2I0Q A;  4QQB X;  3HOU B;  2I5H A;  2LXK A;  4JOI A;  1J5E L;  1EL0 A;  4PMB A;  4DR2 L;  1PFS A;  2PZW A;  4ODG A;  4R4I A;  2Z9H A;  2J7Z A;  4A3K B;  4GLX A;  3M4O H;  5JPM C;  1DM0 B;  5M3F G;  1EWC A;  4DUY L;  2NVT H;  1UE1 A;  1VQK A;  2L15 A;  3L2P A;  1W6J A;  4LUO A;  2F0P A;  2EJG C;  1R4P B;  1RHP A;  3OIQ A;  3NHH A;  1B53 A;  4XIG S;  2H4O A;  4N9P A;  4PZ7 A;  4C3H G;  1A6X A;  3HKZ G;  1FNU A;  4JC0 A;  5CGK A;  3GTM H;  2WP8 J;  1B8A A;  3NSW A;  2MFI A;  3HOV G;  1HNX Q;  3GTO H;  1STE A;  3OYY A;  5I9P A;  2FIN B;  5C44 H;  3EBE A;  4Z9C B;  1K8O A;  4LF4 L;  1MD2 D;  1CHP D;  4B9X A;  1I5F A;  2VW9 A;  4FVM A;  1WTR A;  5M9O A;  3J81 j;  5T1I A;  1SNC A;  2IHF A;  4OIJ A;  3UDI A;  4P74 A;  2JSO A;  1LYL A;  1JR0 D;  3TSS A;  2OCE A;  1I50 H;  2A6H C;  2F0W A;  3MEH A;  4A3C G;  4QUC A;  2B2U A;  4KMU C;  2MPM A;  3TBI B;  2B2Y A;  2PPB C;  1EY7 A;  2EYM A;  2UUC L;  4LUZ A;  3TME A;  2EY6 A;  2B39 A;  3G6J B;  3HG9 A;  1PH5 A;  4BBS B;  3PO2 H;  3IKJ A;  1CKO A;  4O1N A;  2EYO A;  2B2U C;  5EBD A;  3FHW A;  1ZKO A;  2Z1C A;  1CUK A;  4DV5 L;  1DOM A;  2EYP A;  1JCK B;  2ID0 A;  3IFD A;  3S2D B;  4ABN A;  2A8V A;  2R92 G;  2VNU D;  2N49 A;  3CRL C;  4TKO B;  5FKA C;  1E2V A;  3Q6S A;  4IFD J;  5GAH C;  1CQF A;  4P75 A;  1SMY D;  2BDO A;  5IYB G;  1OXT A;  4QIW B;  3OW7 A;  1CSQ A;  4CBV A;  1LTT D;  5CV8 A;  1I6H H;  1LLR D;  4OON A;  2XN9 C;  3L9A X;  1I4Q A;  3I4L A;  2F03 A;  3HOW B;  5FJ8 G;  4A3J G;  2WII B;  1P8L A;  3NE5 B;  3SK4 A;  1NJI C;  3TDQ A;  2K5Q A;  2TMP A;  5IP9 G;  2A68 D;  3J80 i;  1I4X A;  5C6A A;  4JW0 A;  4C3J G;  1IYJ B;  1K73 C;  1SAP A;  4KY6 A;  2F0F A;  3DWA A;  3G4S A;  1GO3 E;  5GRO A;  5HGQ A;  4IFD I;  4R8N A;  5C4J H;  1R4Q B;  5IOD A;  1MJE A;  2R7D A;  4B3R Q;  3STB C;  4NKL A;  2PZU A;  1D1I A;  3HFZ B;  2NVT B;  3L7Z C;  1KDC A;  1XNQ Q;  4FDB A;  2BCO A;  5KGU A;  5M3M H;  5LMN W;  3RLN A;  4DK1 A;  3GTQ B;  5LMU L;  1IW7 D;  1Z6H A;  4OHJ A;  2WB1 G;  4R4O A;  2E2J B;  2FXQ A;  4IN3 A;  4FF3 A;  4DN4 M;  4YCW A;  3FMC A;  4JI0 L;  2IT1 A;  2RCF A;  4DR4 Q;  4AIM A;  5GAG C;  4KHP Q;  1SFO B;  1LT4 D;  2WAQ G;  1SN8 A;  4P2C B;  4C3H H;  4WOR A;  3T16 A;  5C4X H;  2KED A;  4Q0F A;  2K5W A;  1R9T B;  2AKW B;  5JVH 3;  1RF2 D;  5E4X A;  1G8Z D;  2DGY A;  1AFP A;  1K3R A;  2B63 H;  3SXH A;  4AH6 A;  1BBU A;  4HED A;  5CYU A;  1HZ9 A;  4K8J A;  5IWA L;  4Y7N B;  3EN2 A;  1QVF A;  3MTS A;  1BCP F;  5M3F B;  1UE7 A;  3DMU A;  4XQN A;  1OXV A;  1S5B D;  2X6L A;  3VR2 A;  3DLL A;  3MXN A;  3G6E A;  5H1S E;  1SND A;  1BUV T;  2RQX A;  5JVG 3;  2EJM A;  1BQQ T;  3S14 B;  2K33 A;  2NWG A;  1CT1 D;  3QB3 A;  5EAY A;  2A69 D;  4K0K L;  3H94 A;  5LMU Q;  2JJQ A;  1BXT A;  1LO5 D;  3BS1 A;  1NNX A;  3CC4 A;  1HXY D;  2Q8T A;  1XNQ L;  1IL8 A;  1AP0 A;  3E5S A;  2ASB A;  3NPP A;  2YU9 H;  1ASZ A;  1HTL D;  3I2Z A;  3OTO Q;  1Q86 C;  4LF7 L;  5I6W A;  1NMG A;  1I4H A;  4DR7 L;  4C1N K;  3Q24 A;  3K5O A;  5LMN Q;  2JEA I;  3HKZ E;  1PH2 A;  2JA7 G;  1BF4 A;  4RFB A;  4GLV B;  4IJH A;  3QOJ A;  1AE2 A;  1CSP A;  4NXM Q;  4X3K A;  2ZJR A;  3AB9 A;  3P20 A;  1S3O A;  4P71 A;  1EZ8 A;  3D31 A;  2DY8 A;  2R6G A;  4X66 L;  1HUN A;  1QVG A;  1VQO A;  3PUV A;  3RZO B;  3DWP A;  2R7Z B;  1ENC A;  5JEA J;  4GN4 B;  4C56 C;  2LFN A;  1HR0 Q;  1KD1 C;  5IGF A;  1SDF A;  4JBM A;  1KAW A;  1KHI A;  1KQS A;  1EFI D;  5IT9 c;  1JWS D;  2AQ1 B;  3H3V I;  3AFP A;  4RAU C;  3PIP A;  1LAB A;  1WTP A;  3KF6 B;  1EY9 A;  3O13 A;  2OT2 A;  1PA6 A;  2B2V C;  4HIO A;  1UEB A;  1SYF A;  2AWN A;  1DCZ A;  5CV7 A;  5IGE A;  2Q2T A;  3H6M A;  3U58 A;  1LT6 D;  4EGV A;  4A3F H;  4K0K Q;  3MAQ A;  3HP3 A;  3JC6 6;  2SEB D;  2ZTD A;  3AYH B;  1FNW A;  1Y8N B;  4RMF A;  2IWH A;  1SSO A;  3T1H Q;  5NUC A;  3SK6 A;  1ICF B;  1SNP A;  1B3A A;  1QZH A;  3UDX A;  1X9N A;  4TQU S;  5EPK A;  5IGB A;  4JI4 L;  1RDP D;  1PXU A;  1ZEQ X;  2V1C C;  3QWN A;  2YYZ A;  4XXE A;  4DK0 A;  5IWA Q;  2HCI A;  4BY1 B;  2HDM A;  5EPJ A;  1BR9 A;  3D6C A;  1KL9 A;  4DV7 Q;  4MIU A;  4I65 A;  3OIP A;  2JA5 B;  3HOY H;  2K14 A;  3FKI G;  4U67 3;  3HOV B;  4DUZ Q;  1D5Z C;  4AYB G;  2C35 B;  4QJF A;  1RL2 A;  5KNB A;  4BY1 H;  4BY7 B;  2M9V A;  1VQD A;  1BDO A;  4LF4 Q;  2NVY H;  4B08 A;  4KHP L;  2WB1 B;  4JI0 Q;  1XMO L;  1HNX L;  1VQG A;  3A0J A;  2F1M A;  3K0Y A;  3I72 A;  5C44 G;  3P1H A;  5C4X G;  3HOX G;  5ISR A;  4K5W A;  4A3K G;  2GN5 A;  1Q1E A;  2K50 A;  2MHV A;  4OO1 I;  3GP7 A;  4LWC A;  5C3E B;  5DEH A;  1JE4 A;  3J7A 5;  1QNU A;  1EQT A;  4B3S Q;  1U4M A;  2F0T A;  3S2D H;  3OHX C;  1FD7 D;  5M3M G;  2VQE Q;  4LFA Q;  3S9W A;  3A7L A;  1N8R C;  4ME5 A;  5E7N A;  1SNO A;  3ERO A;  3WWV A;  1HFN A;  2WAC A;  3WOE A;  2F0G A;  2FFK B;  3ZJY C;  4DU9 A;  5A2Q E;  4UAI A;  2M00 A;  4DNT B;  1PLF A;  3GTK H;  2KUM A;  5CV5 A;  1HRJ A;  1U4P A;  4QGU A;  3D6W A;  5D3I B;  1NUC A;  5JPN C;  3KF8 A;  4ZK9 B;  4A3B B;  1YNJ C;  2H5X A;  1A3V A;  1SYD A;  4RG1 A;  1Y1W B;  4L8J A;  1K8A C;  3UE1 A;  3KLR A;  5C3E H;  1YIJ A;  2ZM6 L;  5EJW A;  5KEE A;  2ALY B;  2F0E A;  2JA8 G;  2I5L X;  2F0I A;  2F0N A;  4AYB E;  1T5E A;  1KLU D;  4G7H C;  3GTL B;  1I4P A;  3H0G B;  5CV4 A;  3P75 A;  1D6E C;  1EWI A;  1M4V A;  4X3S A;  1E1T A;  1I94 L;  3ERQ A;  1LUZ A;  1SE8 A;  3S17 H;  4RGN A;  4F88 A;  4KTA A;  5C4Z A;  3S1N B;  4LFC L;  2K28 A;  1RD9 D;  4KN7 C;  1T5X D;  2I46 A;  3M4Q A;  3T1Y L;  2EYJ A;  2MGS A;  1RTO A;  5IYD H;  2ZXR A;  1O7Y A;  2UUB L;  1G29 1;  5K5P A;  2K5H A;  1DOL A;  4I7A A;  1SRO A;  3QJY A;  1RKN A;  4C3H B;  1KDA A;  3OOC A;  2PO4 A;  3CP0 A;  3NXW A;  1K9M C;  3K80 C;  2HUG A;  4DV6 Q;  2ES2 A;  1CK1 A;  3MZ5 A;  4JI2 Q;  4E6I A;  1JMC A;  3DM1 A;  2XWB B;  1YJW A;  4IFD H;  2VS1 A;  4QIW E;  4DV1 L;  1AZP A;  2R93 H;  1EWH A;  1YZ6 A;  3CCL A;  4LK1 C;  1WI5 A;  3HOV H;  1ZYR C;  4DUY Q;  3CC7 A;  4ZLT F;  1PZI D;  1UE5 A;  1TVX A;  2E8G A;  4XDX A;  4A3E B;  2LS0 1;  2WAQ B;  4YCU A;  2NVY B;  1O7L A;  4OO1 H;  2NZO A;  5G3L F;  1IYU A;  5BR8 L;  4P73 A;  5LL6 X;  1S72 A;  3STB D;  1EY4 A;  1WJJ A;  5DNF A;  1XPR A;  4HJ8 A;  3HOY G;  3BDL A;  1VQP A;  5IGD A;  3NP8 A;  1TII D;  4YHH Q;  3K59 A;  1F77 A;  1FJG L;  3A5Z B;  1HHV A;  1WYD A;  1M90 C;  4JVZ A;  1N34 Q;  1TWA H;  5JAV A;  1HH2 P;  2OQ0 A;  3U9O A;  2BA0 A;  4HSV A;  5I2X A;  2UXC Q;  5ELC A;  2AQ3 B;  4BBR H;  2L1B A;  3EA6 A;  4PQX A;  3A55 A;  5GQO A;  3HRZ C;  4O0A A;  5KND A;  1YHQ A;  1ICW A;  1CFM A;  2R92 B;  2Z0S A;  1WTQ A;  1D7Q A;  4X64 L;  3UE0 A;  5EQ0 A;  4JI1 L;  3HOW H;  4GKJ Q;  3PO2 B;  1VQH A;  1ILQ A;  2KVM A;  1L1O B;  1DOK A;  1JJ2 A;  2Z6K C;  1PFM A;  1GHK A;  1STN A;  1QCB D;  3V96 A;  1WD1 A;  5E4W C;  2N88 A;  2V4D A;  4LFB Q;  3GTL H;  3LWE A;  3T4A C;  1Y14 B;  2IX0 A;  4IUV A;  1TWC H;  3T13 A;  5M3M B;  1BOS A;  2G9D A;  3TRE A;  1A2T A;  3VYT A;  3I4N G;  4X65 Q;  1C0A A;  1HQM C;  1O78 A;  2R7Z H;  1Y1W H;  1X3Q A;  1EY5 A;  2JA7 H;  5CR3 A;  3BZD B;  4PMW A;  1BCP C;  3C2P A;  4YHH L;  2IX1 A;  2BDN A;  2KCC A;  2RHQ B;  4IPG A;  2KEN A;  3L3O C;  1SJH D;  2K5D A;  5BR8 Q;  3C46 A;  1X54 A;  2IY5 B;  3DXJ C;  4HJ5 A;  1GUO A;  1LT5 D;  3HGB A;  5IGC A;  3ICE A;  2F0S A;  2R93 G;  2WFW A;  5IGG A;  4BA2 I;  3AMU A;  3OW2 A;  2PNR C;  1HPC A;  5KYI A;  1SE3 A;  2Y0S B;  1N36 L;  1NCV A;  4GNX B;  1E0B A;  2JA6 G;  4YWM A;  4CKB A;  4MNO A;  1PH3 A;  2UXB Q;  2XIW A;  1A63 A;  2I5M X;  3QO2 A;  4R1J A;  4FF1 A;  1QB5 D;  1EQV A;  1VDZ A;  3GTP H;  4ID6 A;  1LM0 A;  4UP8 A;  3CU7 A;  3X3M A;  1GJX A;  3KOJ A;  1CM9 A;  2ZTC A;  1E2Z A;  1A2U A;  2NZH A;  4RH6 A;  4NPS A;  4DGZ A;  3KUP A;  2F4V L;  3SE0 A;  2C9O A;  4DV0 Q;  4L5R C;  5AJ3 Q;  1S40 A;  2VY3 A;  1N33 L;  4BBS H;  4HJ9 A;  4BY1 G;  2B2Y C;  1H9M A;  3K6O A;  1E2W A;  1EYG A;  2J0T D;  4QL5 A;  1EYC A;  4DAV A;  3D3R A;  1H9S B;  4A3D H;  4LJZ C;  3E3X A;  1YNN D;  2LXJ A;  2K4K A;  4LW1 A;  1CKM A;  3H0G G;  2RF4 A;  2XVS A;  4LNQ A;  4YWK A;  3PIO 3;  3H15 A;  3E6Z X;  4JI5 L;  2DUD A;  2Q2H A;  3OSO A;  2OEO A;  4DV7 L;  4A3M G;  4DAP A;  5IP7 H;  4RGO S;  3MA2 B;  4XT3 B;  4NP5 A;  1X6O A;  1G6P A;  4QUF A;  2VZA A;  1EY8 A;  1F9Q A;  3D4W A;  4MHE A;  1STH A;  3DEO A;  4GN3 B;  5TSS A;  2EZV A;  4WRD A;  1HA5 A;  5J39 A;  5C5L A;  4FP5 D;  1X65 A;  1WOC A;  3CCR A;  2A19 A;  4XQJ A;  3W3A A;  3J80 E;  5BN5 A;  5M5W H;  1Q7Y C;  1KXL A;  1TWH B;  1MI2 A;  5KRU A;  3MFY A;  3FEW X;  2QGQ A;  2WAQ E;  3KDF A;  2EJF C;  3GQB A;  2QCP X;  1PRT D;  4A3J H;  1KNA A;  3B6Y A;  1D5X C;  3QR8 A;  1S5C D;  1YHA A;  2RCN A;  4X62 L;  1D2B A;  2KOL A;  4AQY L;  5I2Y A;  4K6L A;  3ER0 A;  3U9S A;  1GOZ A;  5CV6 A;  3RZO H;  4N9T A;  1UAP A;  4RGT A;  3V05 A;  4FF4 A;  2CWA A;  4RKL A;  4LF9 L;  1HNW Q;  4DV4 Q;  2Z4H A;  1VQN A;  2ICE C;  3S1R B;  2PCF B;  2MNA A;  3GV3 A;  3ULJ A;  2X69 A;  4X66 Q;  3I55 A;  4B3S L;  3S1N H;  3QOL A;  2BE5 D;  4H0L C;  4J8Q A;  3G71 A;  1CHQ D;  3VR3 A;  3E9H A;  4NXM L;  2E2I B;  1Y1V B;  4GLA C;  3DM3 A;  4OIK A;  5EKI A;  1G91 A;  3J81 L;  2K03 A;  4JI2 L;  4K5V A;  1VQL A;  3RD4 A;  2A74 C;  3HOZ B;  5LMN L;  1MJC A;  3CHB D;  3M4O B;  4WJ4 A;  1MHW C;  3OTO L;  2NVQ B;  4B3T L;  2F0O A;  1LTI D;  5IOC A;  2L55 A;  1PFB A;  3CQZ B;  3W1B A;  4K2L A;  2FHT A;  4OO1 G;  2X6G A;  4TSS A;  2CW0 D;  1L0Y B;  2A73 B;  3K7A B;  2L5T A;  3MEF A;  2QEJ C;  4K6D A;  4HAE A;  2F0H A;  4QCL A;  3URY A;  4JI6 L;  3T1Y Q;  4CKE A;  3DUZ A;  2PZT A;  4XQQ A;  4LFC Q;  3EQL C;  2RSN A;  3K7A H;  3RZD B;  4IOA A;  1F2Z A;  2NTS A;  1YI2 A;  4CHT B;  3TEH B;  2ATW A;  1Q1B A;  4GKK Q;  1EYD A;  2KA7 A;  3MWY W;  1I50 B;  2IL8 A;  4R8I A;  1C4Q A;  3H3V C;  1VQF A;  1PTO F;  2RHS B;  1VQB A;  2WV6 D;  2MO1 A;  3VDY A;  3U50 C;  1WTW A;  3I70 A;  3NK9 A;  2K52 A;  4UHV A;  1SFO H;  5BN3 A;  2RDG A;  4P72 A;  3A8I E;  3KBX A;  2F4I A;  4CGY B;  2SNS A;  5HY6 A;  1ROD A;  1TU2 B;  3BVZ A;  3BYT B;  4FF2 A;  2OF1 A;  3TP8 A;  2PI2 E;  2A6E D;  1GUW A;  3A7A B;  1TWF B;  4K14 A;  2F3V A;  5FJ8 H;  2MO0 A;  3KLS A;  2KQ3 A;  1Q46 A;  4A3B G;  1EZ6 A;  3M7N A;  5C0X I;  2JA7 B;  2K01 A;  4M1U B;  4B3R L;  3HOW G;  3I4M G;  3NTK A;  5G3L D;  1II3 A;  1HNW L;  4FNF A;  1CTM A;  4RHS A;  3TP5 A;  1D5M C;  5CBA E;  2D2C C;  2HIV A;  1HCZ A;  3M9B A;  4C3J B;  2VQE L;  1I3Q H;  1WCM H;  1U5K A;  2C5C A;  1Z47 A;  1EQQ A;  1MIU A;  2VL6 A;  4UP9 A;  2ZXO A;  2ZTE A;  1IHZ A;  1Y8P B;  3I4O A;  4X62 Q;  4LF7 Q;  4DK3 C;  4HSP A;  5IYC H;  2MQH A;  3I4M H;  1TS3 A;  1J8I A;  4JBK A;  3W5O A;  1K8G A;  1EIY B;  2K04 A;  1PH4 A;  4RKB A;  5C0X G;  4PZ8 A;  1CKN B;  2JA5 H;  2R92 H;  5CMD A;  1VF7 A;  1YNX A;  5GAE C;  2HDL A;  5JJI A;  3QG1 A;  1HQR D;  3C3L A;  1LV9 A;  1UUP A;  2VUM B;  4BY7 H;  2NN6 I;  3ONA B;  3DEP A;  2K05 A;  4A3M B;  3UDG A;  1PRT C;  4DUZ L;  1SNM A;  1NR2 A;  4RCO A;  3Q0A A;  3GTG H;  2WKD A;  5JJL A;  2R61 A;  4KI0 A;  1H9S A;  2ZXP A;  3J7A V;  3P7J A;  4KHV A;  4A3C H;  1B44 D;  1SJE D;  4ALP A;  1STB A;  4ZAI A;  3F2B A;  3FRP B;  4A3L H;  2CHB D;  5M5Y B;  2E74 C;  1WTH A;  4CJ2 C;  4RHR A;  2NVQ H;  1KTK A;  1X3P A;  4R9W A;  2L9H A;  2XGT A;  4DNI A;  1H95 A;  4IUR A;  2A5H A;  2K5V A;  3CCM A;  3FDT A;  3SDZ A;  3HOU G;  4Y7N H;  2LSS A;  3RNU A;  1Y1V G;  1TY0 A;  4N8F A;  3M4Y A;  3OMG A;  1KRS A;  4HIK A;  1PZK D;  3TP7 A;  4IUP A;  1ASY A;  2F4V Q;  3K5M A;  2IHE A;  1B70 B;  4B3T Q;  1CZG A;  2PYK A;  4OWW B;  2KHI A;  1H9R A;  1BO0 A;  3ULL A;  1C48 A;  3S14 H;  1HZA A;  3CF5 A;  1I4R A;  1BCP D;  1UNS A;  3RLO A;  1Y1W G;  4OXP A;  1TWF H;  2DJG C;  2D0P A;  2E2H B;  1B9N A;  1FNV A;  2Q2U A;  3CMA A;  5DM6 3;  5M5X B;  3CD6 A;  3VA7 A;  1YBY A;  3A5U A;  1N36 Q;  4A3J B;  1WCM G;  2AMC B;  3HOZ G;  4KKT A;  4XT1 B;  4LMQ D;  1RCV D;  4KKU A;  3R3O A;  1SYB A;  1NMF A;  1L1O A;  3GDE A;  4DV4 L;  4LF9 Q;  2EYF A;  4MTN A;  1HJP A;  4YWL A;  2HQE A;  1JJC B;  3E0E A;  1CZW A;  1PHJ A;  2SDF A;  3K58 A;  1JB7 A;  1P16 A;  4TVA B;  5BN4 A;  2EDG A;  2UXD L;  5AFW A;  1IKM A;  5JOB A;  1A8V A;  3CRK C;  1PH9 A;  2Q8R E;  2EY1 A;  2QA4 A;  1B2T A;  4L5Q A;  2M2L A;  2EE1 A;  1F2M A;  3HS0 C;  4C2M H;  3BZC A;  4DR6 L;  1FR3 A;  1IXR A;  3KF6 A;  3W1G A;  1BBW A;  2E2J H;  1EIH A;  1GD7 A;  1LTS D;  3H09 A;  2VQF L;  4PMC A;  1DZ1 A;  3SEB A;  2XNA C;  1ESF A;  1V9P A;  1B3Q A;  1SMX A;  4I7Z C;  1D8L A;  3ND9 A;  3S17 B;  1KNE A;  3FVQ A;  2B2W C;  1VQA A;  2LMC B;  1PYW D;  1X3G A;  1V1Q A;  5I4D A;  3MHB A;  4A3G B;  1PH7 A;  5J1Z A;  4JI6 Q;  3F2D A;  1VMC A;  1L0W A;  3AU7 A;  3S16 H;  2EVB A;  1F9S A;  2NB0 A;  2B2W A;  3AQQ A;  2KCM A;  1A3T A;  2BH2 A;  4JPB W;  5DLQ E;  3MC0 B;  4FO2 A;  3PIP 3;  4IUT A;  1J6Q A;  3KJP A;  3TQY A;  3ZYY X;  3FP9 A;  1E1O A;  3FPU B;  1K3B C;  1DXM A;  3K7U C;  4KK7 A;  4KD4 A;  3NBH B;  1N33 Q;  1U0L A;  2Z8L A;  1N32 Q;  1G2T A;  1QWY A;  2R93 B;  4DV0 L;  4YCV A;  4X6A H;  2HHH L;  2A69 C;  4WFN 3;  4DXG A;  4BY7 G;  4A93 B;  4CDC C;  5LL6 S;  4GS3 A;  1Q12 A;  1G2S A;  1VCI A;  4X3U A;  3PUZ A;  3SHL A;  1SYG A;  5JEA H;  4DV1 Q;  2QDB A;  3CCU A;  1K83 H;  1VQC A;  2F0U A;  2UXB L;  1HFG A;  2NTT A;  3KYH C;  4TRD A;  2ZJQ A;  2UU9 L;  1B1Z A;  1OTC A;  4AQY Q;  2PMZ B;  4NXN L;  1FGB D;  4L5T A;  2GA4 B;  1RTN A;  3PCO B;  1G51 A;  3N6R A;  2F0M A;  4KJO A;  4JV5 Q;  4K2K A;  5D14 A;  2YTY A;  1FGU A;  1OO9 B;  4LUV A;  4FXD A;  2L4N A;  3BDC A;  1O80 A;  2YTV A;  2Z6K A;  2PQE A;  1IBL Q;  2NZ1 D;  5EPL A;  3PV0 A;  4GOP A;  4JI7 L;  3PUW A;  2G9H D;  4UP7 A;  3MXN B;  5FO7 B;  4CDE C;  1Q90 A;  3C1F A;  4B3M L;  1NR4 A;  2KBN A;  3SK5 A;  1JT8 A;  3GTJ H;  2KEC A;  3K5N A;  5IIF A;  3KDF B;  1GM5 A;  4HJ7 A;  1PYS B;  2MP1 A;  4KY5 A;  1QZG A;  2UUA L;  4GOP C;  2RDH A;  4X3T A;  3A8K E;  4LF8 Q;  4N8X 1;  3TZU A;  3K8A A;  4H7B A;  1U4L A;  1K0S A;  4POF A;  3VYS A;  4CJ1 B;  5FLX c;  2EXZ A;  4MN3 A;  3GV6 A;  4LFB L;  5FLX L;  4FXG C;  4KHZ A;  1BBX C;  1I4G A;  1IKL A;  2XRQ D;  1WTV A;  1EOT A;  1ZYR D;  1R9T H;  2WB1 E;  2DJF C;  5EKL A;  4V19 0;  4LF6 L;  3PSI A;  4R4T A;  1PH6 A;  1WTO A;  2RA4 A;  3PF5 A;  4G4K A;  4BA1 I;  1V1O A;  1IBK L;  3HEJ A;  4C2M B;  2A68 C;  1K28 A;  5ELD A;  3OMC A;  4R4Q A;  3OWE B;  5AJ3 L;  5ELE A;  4EQO A;  4C1N I;  2N55 A;  1V8Q A;  3IAY A;  3PGZ A;  5COY A;  1CQV A;  3HOZ H;  4BBR G;  1EU4 A;  3TP6 A;  2Z4I A;  4NXN Q;  3K0X A;  1OXX K;  4ILW A;  2B63 G;  2E2I H;  1KAA A;  2XWJ B;  4G7O C;  1A3U A;  1E7Z A;  2VB3 X;  3DWQ A;  1V1P A;  2F0Q A;  3BVG A;  3HOY B;  4ZCK A;  1B7Y B;  1XMQ L;  1NAP A;  1B9M A;  5JEA G;  1XMQ Q;  1X32 A;  2EQS A;  2NBF A;  5ELF A;  1FL0 A;  3NQI A;  3F1Z A;  1WD0 A;  4MTK A;  2ENB A;  4BBR B;  5FO9 B;  3S1M B;  3M3Y H;  2OXP A;  1HTP A;  5F2D A;  2F3W A;  3K5L A;  3I4N B;  3FKI B;  1H9J A;  2CH4 W;  2Y0S G;  1KLG D;  2F0L A;  1QIL A;  2EYH A;  1SBB B;  4BXX H;  3JAM c;  3VA5 A;  3VYR A;  2IJ0 A;  1KDB A;  4A4I A;  4KKS A;  3I7F A;  1SNQ A;  1IYV A;  3H91 A;  2FMC A;  1K83 B;  1YVC A;  3CCE A;  1EQR A;  3ND8 A;  4DK6 C;  1RIP A;  2KHS A;  3NEN A;  1PH1 A;  2AQ2 B;  1ESR A;  3NWS A;  1O7I A;  2GVA A;  3ERS X;  5EBC A;  1HNZ L;  1S5D D;  1I6V C;  1AN8 A;  4LF5 Q;  5C3X A;  3NTH A;  4GKJ L;  1PTO H;  2K5N A;  1EY6 A;  4JI1 Q;  2WIN B;  1I6H B;  4G57 A;  3GTK B;  3CKI B;  4DA2 A;  4KLK A;  3NUC A;  2UUA Q;  3BYY B;  2DN8 A;  1AH9 A;  3K81 C;  4A3D B;  1BKB A;  3S1Q H;  3IL8 A;  2E5L Q;  2L0C A;  3K57 A;  2ZM6 Q;  4M8A A;  1N34 L;  4C3J H;  1FJG Q;  1MSG A;  4IPC A;  5D65 A;  3G48 A;  2O5I C;  3HKS A;  4DAY B;  3BG3 A;  3MXG A;  2F0D A;  4ZKB B;  1XTD A;  3LNN A;  4DNR B;  4JI3 L;  1AEX A;  3D0F A;  4HJA A;  3U4Z A;  5IYB H;  4A3B H;  1O7Z A;  4RWS C;  1IL2 A;  2UU9 Q;  3GTG B;  1LTR D;  4DV3 Q;  1W2B A;  2B8G A;  3I4M B;  4BBS G;  4HTH A;  4NMZ A;  5DM7 3;  2NN6 G;  3S16 B;  2B2T A;  2JXM B;  2O4X A;  4A93 G;  4DR7 Q;  3S1M H;  1PZJ D;  2CVR A;  2CQO A;  4H13 C;  1LTA D;  4IFD G;  1SMY C;  1STY A;  3A56 A;  4IAL A;  3GTO B;  1J9O A;  5C44 B;  2HHH Q;  3FKI H;  1AW7 A;  1TKW B;  1ENF A;  1C8C A;  2K6A A;  3DHQ A;  3T51 B;  4J6H A;  3JAM i;  3M7G A;  2UUB Q;  1L0X B;  2O5J C;  3LX0 A;  1Z7T A;  1GUG A;  2IX3 A;  2NUC A;  1XMO Q;  2RVL A;  4AYB B;  4IZ8 A;  1JWU D;  1JOK A;  3Q8D A;  3SK8 A;  1QUQ A;  4L6T B;  4DR3 L;  4OX9 Q;  4HID A;  1QJO A;  3I3C A;  4IUQ A;  1EEF D;  1M8A A;  4GOP B;  1I94 Q;  1JE5 A;  1LT3 D;  4K5X A;  2N78 A;  1ENA A;  2JK8 A;  3EFX D;  2QEX A;  3CCJ A;  1YHB A;  2D62 A;  1HUM A;  1EU3 A;  2TSS A;  4JI8 Q;  3RZD H;  4JBW A;  1ILP A;  4JBJ A;  4JK1 C;  1VQ6 A;  1PDQ A;  2HD3 A;  5LHY 1;  3I4N H;  2NN6 H;  4KY7 A;  4B9W A;  2SOB A;  3NEM A;  1LTG D;  4A3G G;  3T1H L;  2DNE A;  3T56 B;  4BS9 A;  1S5E D;  2VQF Q;  1JQY D;  5IT9 L;  1HZC A;  4H44 C;  1ET9 A;  4C3I H;  4V0B A;  1Q82 C;  2FJ2 A;  1L2F A;  1XTC D;  4R4C A;  4DKA C;  2BOS A;  4UPA A;  1XWE A;  1Q3L A;  3CW2 C;  2F0J A;  4NDX A;  3S1R H;  2SNM A;  4DFA A;  2G5D A;  5E1F A;  4J1M A;  1SEB D;  5KYL A;  2PI2 A;  3JAM L;  2R7Z G;  3LWU A;  1PV4 A;  2OWO A;  3N52 A;  2RKS A;  1FVI A;  4LFA L;  2CQA A;  2K32 A;  1HR0 L;  3A8J E;  1VQ9 A;  1WCM B;  3KLW A;  5FO8 B;  1CA6 A;  3D8G A;  4JYA Q;  4EQ5 A;  2AHO B;  2LY7 A;  5FK9 C;  5C4X B;  3MXU A;  2B8F A;  1GUN A;  2OTJ A;  4JYA L;  2KHJ A;  4A3G H;  1TWG B;  3HZX A;  1MSH A;  3TS2 A;  3KK7 A;  4DR5 L;  5A2Q L;  2N8N A;  4KD3 A;  4DXF A;  1V1P B;  3OWF A;  3PQI A;  2L12 A;  1GUS A;  2HCC A;  5C3W A;  1IBM L;  4JCV E;  1YIT A;  1X3E A;  5CBE E;  3BDO A;  4PG3 A;  3RN5 A;  1PRT F;  4APV A;  3WOF A;  2B29 A;  4XYQ A;  4OEL B;  2JE6 I;  4A3M H;  2HQL A;  2EXD A;  4YY3 L;  3A54 A;  4Y52 H;  2A1A A;  1SXT A;  2O2L D;  5A35 A;  4DV5 Q;  3F2U A;  3M85 A;  2EOT A;  2PW5 A;  2CCZ A;  5C4H A;  1JOR A;  1QOH A;  1TT2 A;  2AUJ D;  2VB2 X;  4K8I A;  3T53 B;  3WDN A;  1B4O A;  5L37 A;  1QE6 A;  2XTI A;  4GZY C; 
#chains in the Genus database with same CATH homology
 1D8L A;  1L1O B;  2OCE A;  1I50 H;  4A3C G;  4H02 A;  1JJ2 A;  2Z6K C;  1LYL A;  3J7Z C;  1VQA A;  4JI4 Q;  2AWO A;  1X3G A;  1A62 A;  4NB3 A;  2UUC L;  1V1Q A;  4LUZ A;  1PH7 A;  4LFB Q;  3GTL H;  4JI6 Q;  3F2D A;  1PH5 A;  1L0W A;  1Y14 B;  2IX0 A;  1TWC H;  3PO2 H;  1CKO A;  1EUJ A;  3S16 H;  1HR0 W;  3FHW A;  1BVS A;  5M5X H;  3TRE A;  1CUK A;  2KCM A;  3AQQ A;  4DV5 L;  2BH2 A;  3I4N G;  2ID0 A;  4X65 Q;  1C0A A;  4YY3 Q;  2VUM H;  2A8V A;  2R92 G;  2VNU D;  5DLQ E;  2N49 A;  2R7Z H;  4IFD J;  2PQA B;  1UE6 A;  1Y1W H;  1KC8 C;  1J6Q A;  5GAH C;  2F52 A;  3KJP A;  3TQY A;  2JA7 H;  4P75 A;  3CQZ H;  4DR4 L;  3FP9 A;  1E1O A;  1E24 A;  4PMW A;  1OXT A;  3K7U C;  5IYB G;  4A3F G;  4YHH L;  2IX1 A;  2RHQ B;  3RN2 A;  1CSQ A;  1I6H H;  4IPG A;  5C0X J;  2KEN A;  3H3V H;  4OON A;  3PO3 G;  5BR8 Q;  3S2H H;  3NBH B;  1N33 Q;  5FJ8 G;  1U0L A;  1KIX A;  3I56 A;  1N32 Q;  1L1O C;  4A3J G;  1X54 A;  1P8L A;  1NJI C;  4DV0 L;  4YCV A;  4EX5 A;  2HHH L;  5IP9 G;  5IYD G;  2IY5 B;  4X6A H;  3J80 i;  3F8T A;  4HJ5 A;  4BY7 G;  3ICE A;  2R93 G;  2WFW A;  1IYJ B;  4GS3 A;  4BA2 I;  1K73 C;  1Q12 A;  1XPO A;  1VCI A;  3OW2 A;  1YJN A;  4DR2 Q;  1N36 L;  3PUZ A;  4GNX B;  3J80 c;  3G4S A;  4DV1 Q;  2JA6 G;  4YWM A;  1GO3 E;  5GRO A;  1K83 H;  3CCU A;  1XJV A;  1VQC A;  1KRT A;  5HGQ A;  1MKH A;  4MNO A;  1NY4 A;  4DV2 L;  1PH3 A;  4A3I H;  4IFD I;  4DV2 Q;  2UXB L;  2UXB Q;  1Z9F A;  3KYH C;  2Q2I A;  2I5M X;  4R1J A;  2ZJQ A;  1A63 A;  2UU9 L;  3PUY A;  1OTC A;  3KF8 B;  5C4J H;  4AQY Q;  3GTP H;  1LM0 A;  4UP8 A;  4NXN L;  5GAD C;  2R7D A;  1MJE A;  4O2D A;  3KOJ A;  4L5T A;  4B3R Q;  3STB C;  2ZTC A;  1TWG H;  3PCO B;  1G51 A;  2NZH A;  4JV5 Q;  3HFZ B;  4NPS A;  1PYB A;  2F4V L;  3L7Z C;  2YTY A;  1FGU A;  1XNQ Q;  4LUV A;  4FDB A;  1IBM L;  4DV0 Q;  4L5R C;  5M3M H;  5AJ3 Q;  5LMN W;  3RLN A;  1S40 A;  2VY3 A;  2YTV A;  1GVP A;  2Z6K A;  4IOC A;  2JQO A;  3CCQ A;  5LMU L;  1N33 L;  2HT1 A;  4BBS H;  1IBL Q;  2WB1 G;  4R4O A;  4HJ9 A;  4BY1 G;  2FXQ A;  1GKH A;  3PV0 A;  4GOP A;  1VQE A;  4JI7 L;  2E2H H;  3PUW A;  4YCW A;  1EYG A;  1Q8K A;  4QL5 A;  4UP7 A;  2IT1 A;  3MXN B;  4JI0 L;  4A3D H;  4DR4 Q;  4AIM A;  3H0G H;  5GAG C;  4KHP Q;  4B3M L;  2E5L L;  2KBN A;  3J81 i;  2WAQ G;  2LXJ A;  3RLF A;  3CXC A;  2K4K A;  2YV5 A;  1SN8 A;  1CKM A;  2N3S A;  4LW1 A;  4C3H H;  3GTJ H;  3PO3 H;  3H0G G;  3KDF B;  1GM5 A;  4POG A;  5C4X H;  2RF4 A;  4HJ7 A;  1PYS B;  4LNQ A;  4YWK A;  1QZG A;  4A3K H;  4GOP C;  2K75 A;  2UUA L;  3H15 A;  2AKW B;  3GTQ H;  4JI5 L;  4IPD A;  2DUD A;  3CME A;  4HIM A;  2DGY A;  2Q2H A;  1HZB A;  1K3R A;  4LF8 Q;  3K8A A;  2B63 H;  4AH6 A;  2NVX H;  4DV7 L;  4A3M G;  1BBU A;  2PNH A;  4POF A;  5IP7 H;  3HOU H;  4GKK L;  4A3D G;  1Q81 C;  1HZ9 A;  5FLX c;  1X6O A;  4LF5 L;  1G6P A;  1TXY A;  4LFB L;  2VZA A;  5IWA L;  3EN2 A;  5IE8 A;  3RR5 A;  1QVF A;  4GN3 B;  4KHZ A;  1HNZ Q;  1UE7 A;  1EIF A;  4DPG A;  5J3B A;  1X65 A;  1R9T H;  2WB1 E;  4JG2 A;  1WOC A;  3CCR A;  2A19 A;  3EIV A;  1SR3 A;  2YTX A;  3PSI A;  1OXV A;  4R4T A;  1PH6 A;  4LF6 L;  5FLM H;  5M5W H;  3DLL A;  1Q7Y C;  4MZ9 A;  3PF5 A;  4L5S A;  1KXL A;  4BA1 I;  5H1S E;  2B3G A;  3G6E A;  1NE3 A;  2OTL A;  3LGJ A;  3TRZ A;  1IBK L;  5FLM G;  4DR1 L;  2QGQ A;  2WAQ E;  5EAY A;  3S24 A;  3KDF A;  2VUM G;  4K0K L;  5LMU Q;  4R4Q A;  4A3E H;  3CC2 A;  2JJQ A;  3KFU A;  1LTL A;  5AJ3 L;  3CC4 A;  1XNQ L;  1JJG A;  2ASB A;  4A3J H;  2YU9 H;  1ASZ A;  2JA6 H;  3PGZ A;  3B6Y A;  3I2Z A;  1X3F A;  3OTO Q;  3HOZ H;  1Q86 C;  4BBR G;  4LF7 L;  4X62 L;  1NMG A;  1YHA A;  2RCN A;  4NXN Q;  4AQY L;  3K0X A;  1OXX K;  3F2C A;  1IBM Q;  4DR7 L;  3ER0 A;  3ULP A;  2B63 G;  2E2I H;  2CWP A;  3GO5 A;  5LMN Q;  1NBW A;  2JEA I;  3RZO H;  3HKZ E;  2EIF A;  4A3E G;  1PH2 A;  2CWA A;  2JA7 G;  1E7Z A;  3U4V A;  4GLV B;  4IJH A;  4DR5 Q;  4LF9 L;  1HNW Q;  1AE2 A;  1UWV A;  4DV4 Q;  1VQN A;  1CSP A;  4NXM Q;  2JEB I;  5IY0 A;  2MNA A;  2ZJR A;  3ULJ A;  4X66 Q;  3I55 A;  4B3S L;  1B7Y B;  1XMQ L;  3S1N H;  1S3O A;  4P71 A;  5JEA G;  1XMQ Q;  3D31 A;  3G71 A;  2R6G A;  1DGS A;  4GN5 A;  4X66 L;  2EQS A;  1QVG A;  1VQO A;  3L0O A;  1W3S A;  1FL0 A;  3PUV A;  3E9H A;  4NXM L;  3F1Z A;  4GLA C;  3DM3 A;  4GN4 B;  5JEA J;  1HR0 Q;  3PIO A;  1KD1 C;  4JI2 L;  1VQL A;  4JBM A;  1KAW A;  1KHI A;  3BJU A;  1MJC A;  5LMN L;  1KQS A;  3E9I A;  5IT9 c;  1XNR L;  3M3Y H;  3H3V I;  3AFP A;  3PIP A;  3KF6 B;  3CPF A;  1VS0 A;  4WJ4 A;  1PA6 A;  3OTO L;  4HIO A;  1UEB A;  2AWN A;  4B3T L;  2Y0S G;  1M1K C;  3IRB A;  2Q2T A;  3W1B A;  4OO1 G;  4X65 L;  4BXX H;  3JAM c;  3KJO A;  2BH8 A;  3U58 A;  4A3F H;  4K0K Q;  4A4I A;  1C9O A;  3JC6 6;  2JA8 H;  3CAM A;  3I7F A;  3MEF A;  1IBK Q;  2ZTD A;  3AYH B;  4RMF A;  1YVC A;  3CCE A;  3T1H Q;  4JI6 L;  3T1Y Q;  3AEV A;  4LF6 Q;  1EQR A;  4UY8 C;  4DK6 C;  2UUC Q;  1RIP A;  1QZH A;  3UDX A;  3NEN A;  4QY7 A;  1VQM A;  1X9N A;  1PH1 A;  4LFC Q;  4TQU S;  4JI4 L;  1O7I A;  2GVA A;  3K7A H;  3ERS X;  4IOA A;  1HNZ L;  3CPW A;  2V1C C;  1SRU A;  2YYZ A;  4JI8 L;  5IWA Q;  1YI2 A;  5C3E G;  2ZJP A;  4LF5 Q;  3PF4 A;  3TEH B;  2CFM A;  2ATW A;  4GKJ L;  1Q1B A;  1KL9 A;  4GKK Q;  2K5N A;  4JI1 Q;  4DV7 Q;  4IO9 A;  3PUX A;  3HOY H;  2K14 A;  3FKI G;  2Y0S E;  1VQF A;  4JI5 Q;  4OWX B;  1VQI A;  4KLK A;  2RHS B;  1VQB A;  2UUA Q;  2MO1 A;  3VDY A;  4DUZ Q;  3U50 C;  1AH9 A;  3K81 C;  4AYB G;  2C35 B;  4QJF A;  4GNX C;  1RL2 A;  2K52 A;  4DR3 Q;  1SFO H;  4BY1 H;  1BKB A;  4OX9 L;  2UXC L;  3S1Q H;  1VQD A;  4P72 A;  4LF4 Q;  2E5L Q;  2F3I A;  2NVY H;  2ZM6 Q;  1N34 L;  4KHP L;  3TS0 A;  1V43 A;  1Y1V H;  4C3J H;  1XMO L;  2PMZ E;  1HNX L;  4JI0 Q;  5HY6 A;  1FJG Q;  3SGI A;  4IPC A;  1VQG A;  3A0J A;  4PZ6 A;  3G48 A;  1E22 A;  3HKS A;  5C44 G;  1XNR Q;  1X55 A;  1IBL L;  5C4X G;  4DAY B;  2PI2 E;  4OWT B;  4XTC S;  3HOX G;  4GNX A;  4A76 A;  4A3K G;  2GN5 A;  1Q1E A;  2K50 A;  2PQA A;  3NEL A;  4OO1 I;  1XTD A;  4LWC A;  5FJ8 H;  2MO0 A;  1CKN A;  1Q46 A;  4A3B G;  4JI3 L;  3M7N A;  1T9H A;  3D0F A;  3J7A 5;  5C0X I;  4HJA A;  3S15 H;  3U4Z A;  5IYB H;  4B3R L;  1WFQ A;  4IJL A;  4B3S Q;  4A3B H;  4ME3 A;  3HOW G;  3I4M G;  3S2D H;  1IL2 A;  2UU9 Q;  1W2B A;  4DV3 Q;  1VQ8 A;  1QUQ B;  5M3M G;  2VQE Q;  1J5E Q;  1HNW L;  5JJK A;  4LFA Q;  4BBS G;  2HIV A;  3M9B A;  1N8R C;  5E7N A;  4WJ3 M;  2NN6 G;  3CCS A;  2VQE L;  1I3Q H;  1SLJ A;  1U5K A;  1WCM H;  4DV3 L;  4DV6 L;  1Z47 A;  1EQQ A;  2D0O A;  3WWV A;  4DR7 Q;  4A93 G;  1MIU A;  2VL6 A;  1C7Y A;  3S1M H;  4UP9 A;  2OQK A;  1PVO A;  2ZTE A;  2CQO A;  3BZK A;  3I4O A;  4X62 Q;  3ZJY C;  1PH8 A;  4DK3 C;  4LF7 Q;  1YEZ A;  4A93 H;  4A3L G;  5IYC H;  5ELN A;  4IFD G;  4JI3 Q;  1QVC A;  2MQH A;  3I4M H;  2HHH Q;  3FKI H;  4JBK A;  3W5O A;  2JA5 G;  1K8G A;  3GTK H;  3JAM i;  1EIY B;  1N32 L;  3BU2 A;  1PH4 A;  4QGU A;  1EOV A;  5C0X G;  2UUB Q;  4PZ8 A;  1CKN B;  2JA5 H;  5M5Y H;  1EFW A;  5M3F H;  2R92 H;  4DR1 Q;  1YNX A;  2JA9 A;  5GAE C;  3A74 A;  2H5X A;  1VQ5 A;  4RG1 A;  1XMO Q;  5IYC G;  5JJI A;  1K8A C;  3UE1 A;  5C3E H;  1E3P A;  2BA1 A;  3Q8D A;  2ZM6 L;  1YIJ A;  4BY7 H;  1QUQ A;  1NTG A;  2NN6 I;  4DR3 L;  4OX9 Q;  4HID A;  2ALY B;  3UDG A;  2JA8 G;  2I5L X;  4DUZ L;  4A75 A;  4AYB E;  4GOP B;  1I94 Q;  3GTG H;  1JE5 A;  3CCV A;  5JJL A;  2N78 A;  2JK8 A;  4KI0 A;  2QEX A;  2KCT A;  3CCJ A;  1JT8 A;  4A3C H;  1EWI A;  1YHB A;  1XPU A;  2D62 A;  1E1T A;  3M4P A;  4ALP A;  1TWH H;  3F2B A;  4LF8 L;  1I94 L;  4IPH A;  1LUZ A;  4JI8 Q;  3RZD H;  1SE8 A;  3S17 H;  4A3L H;  1N9W A;  4JBW A;  4JBJ A;  2CKZ B;  4LFC L;  2NVQ H;  2GVB A;  3UDF A;  1VQ6 A;  4A3I G;  3I4N H;  2XGT A;  4DNI A;  4B3M Q;  1X56 A;  3M4Q A;  3NEM A;  3J81 c;  1H95 A;  3T1Y L;  4A3G G;  2K5V A;  4DAM A;  3T1H L;  1IZ6 A;  2HIX A;  3CCM A;  1VQJ A;  5IP7 G;  2VQF Q;  3HOU G;  4Y7N H;  1VQ4 A;  4JI7 Q;  1HZC A;  2LSS A;  4X64 Q;  3RNU A;  4C3I H;  1K0R A;  1Y1V G;  5IP9 H;  4J15 A;  5IYD H;  1VQ7 A;  1Q82 C;  4DR6 Q;  1L2F A;  2UUB L;  1KRS A;  4HIK A;  1G29 1;  4R4C A;  4DKA C;  5K36 G;  2K5H A;  3PO2 G;  5ELO A;  4UPA A;  1ASY A;  1SRO A;  3CW2 C;  2F4V Q;  4JOI C;  2IHE A;  1OXU A;  1B70 B;  1YJ9 A;  4B3T Q;  4JV5 L;  3S1R H;  3GD7 A;  3CP0 A;  1K9M C;  4OWW B;  2KHI A;  2UXD Q;  3K80 C;  2PI2 A;  1OXS C;  4BXX G;  3ULL A;  3HOX H;  3AFQ A;  2R7Z G;  1PV4 A;  4DV6 Q;  2ES2 A;  2OWO A;  1HZA A;  1A0I A;  3CF5 A;  3S14 H;  3HOY G;  3RLO A;  1AE3 A;  2R7F A;  1Y1W G;  4OXP A;  1TWF H;  2I0Q A;  4QQB X;  2D0P A;  4JI2 Q;  1JMC A;  2I5H A;  1FVI A;  1YJW A;  1HR0 L;  2LXK A;  4JOI A;  2Q2U A;  3CMA A;  2VS1 A;  1VQ9 A;  4LFA L;  3KLW A;  1J5E L;  4QIW E;  4DV1 L;  2R93 H;  3CD6 A;  1YBY A;  3A5U A;  1PFS A;  1YZ6 A;  4R4I A;  4DR2 L;  1N36 Q;  1WI5 A;  3CCL A;  3HOV H;  4JYA Q;  4EQ5 A;  4DUY Q;  4GLX A;  1WCM G;  2AMC B;  3CC7 A;  3HOZ G;  2AHO B;  3M4O H;  1UE5 A;  2E8G A;  5M3F G;  4DUY L;  2NVT H;  1UE1 A;  1VQK A;  4JYA L;  2OTJ A;  2L15 A;  4YCU A;  3L2P A;  2KHJ A;  4A3G H;  4LUO A;  1NMF A;  1L1O A;  3GDE A;  4DV4 L;  3TS2 A;  4LF9 Q;  2NZO A;  4DR5 L;  2N8N A;  4XIG S;  4PZ7 A;  5BR8 L;  4P73 A;  4MTN A;  1HJP A;  3STB D;  4YWL A;  1S72 A;  1JJC B;  1WJJ A;  3E0E A;  1XPR A;  4HJ8 A;  1PHJ A;  4JCV E;  1VQP A;  1YIT A;  1X3E A;  3HKZ G;  1P16 A;  4JC0 A;  4TVA B;  4PG3 A;  3RN5 A;  1JB7 A;  3GTM H;  2WP8 J;  1B8A A;  4YHH Q;  1FJG L;  3HOV G;  2MFI A;  2UXD L;  3A5Z B;  1HNX Q;  1WYD A;  3GTO H;  1A8V A;  3OYY A;  4APV A;  1M90 C;  5C44 H;  3EBE A;  1N34 Q;  1TWA H;  1PH9 A;  1HH2 P;  2B29 A;  2OQ0 A;  4LF4 L;  2QA4 A;  2BA0 A;  2UXC Q;  2JE6 I;  1I5F A;  4L5Q A;  2VW9 A;  4BBR H;  4A3M H;  2HQL A;  2EXD A;  4YY3 L;  4Y52 H;  2A1A A;  5GQO A;  4C2M H;  3BZC A;  4DV5 Q;  3J81 j;  4O0A A;  3M85 A;  2CCZ A;  4DR6 L;  1IXR A;  3KF6 A;  3W1G A;  1BBW A;  2IHF A;  1YHQ A;  2E2J H;  2Z0S A;  1D7Q A;  3UDI A;  1GD7 A;  4P74 A;  3UE0 A;  4X64 L;  4JI1 L;  2VQF L;  3HOW H;  4GKJ Q;  2XTI A;  1V9P A;  1VQH A;  1SMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...