4L6EA

Crystal structure of the ranbd1 fourth domain of e3 sumo-protein ligase ranbp2. northeast structural genomics consortium (nesg) target hr9193b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
SGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 SUMO-protein ligase RanBP2
publication title Crystal Structure of the RanBD1 fourth domain of E3 SUMO-protein ligase RanBP2.
rcsb
source organism Homo sapiens
molecule tags Ligase, isomerase
total genus 29
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4l6eA00
5HE0A 3HQCA 2CY5A 3V5WA 1FHWA 3ZDTA 4IAPA 3AU5A 4D0NB 4BBKA 2L2IA 1U27A 3A8PA 1FHXA 5L81A 1N3HA 5C6RA 3PVLA 3SYXA 3P6AA 3PVWA 5FI0A 2LYDA 3T06A 1PLSA 1OQNA 1P3RA 2I5FA 1UNRA 3U8ZA 4TKNA 2COFA 1SHCA 2EMSA 5KQ4A 2H7EA 1MKEA 1V5UA 1KZGA 3D8DA 5KCVA 2HTHB 1B55A 1MIXA 2COCA 4NSWA 5DH9B 1ISNA 3BJIA 2GS0A 2RUKB 4HAUB 1FAOA 5HE3A 1V89A 4KHBB 4YL8A 2ROVA 2DKQA 4TYZA 5JLJB 1X11A 2D9YA 2EMTA 4K81A 1WGQA 1PMSA 2CRFA 1TQZA 4PNKA 3OANA 1LW3A 3F5RA 2QKMA 2KUPA 1K5DB 1MK7B 2E2XA 3BINA 2P0HA 4KHAA 1AWEA 1ZSQA 4Y94A 4IOYX 2Y7BA 5D3XA 4K2OA 2G35A 1U5EA 2MFQA 1V61A 1U5GA 2V76A 2UZRA 3N7CA 2Y8FA 2RSGA 2DHKA 5KQ1A 4DX90 1Z87A 1MK9B 2DN6A 1SGHA 5JP4A 1DDVA 3FM8C 2D9VA 4HAYB 3DXDA 2X18A 3KY9A 1I7AA 4EKUA 2VRWB 1OMWA 4A5KA 2YS5A 1WJMA 2CY4A 2D2QA 3QWMA 3PP2A 5J3QA 2W2XD 1FOEA 4WVFB 1QQGA 1K5GB 1BAKA 2MKRA 1UNQA 5LONB 4CHMA 4EMOA 2GJYA 2D10A 1KI1B 1I2HA 4HAVB 5C5BA 2ROZB 4KHOA 5HE2A 2KCJA 2FJLA 1ZC3B 3HK0A 2UVMA 2K2UA 2YF0A 1UNPA 4HB3B 2UZSA 1BTNA 3ODWA 5C79A 2YS3A 4ZRKA 2YSZA 3ML4A 1MPHA 1NTYA 2H7DA 3IVFA 5DI9B 3AJ4A 1X86A 1XCGA 2YT0A 3D8FA 2D11A 1RRPB 1BTKA 3QIJA 2Z0PA 2CAYA 3CIKA 1M7RA 1DDMA 4WJ7A 5J3TA 4P7IA 1FB8A 3UZTA 3WA0A 4CYEA 2GCJA 1RJ2A 2P0FA 1U5DA 3DXCA 2P8VA 3O96A 3PVUA 2BCJA 2DHIA 4YONA 1WGUA 3D8EA 2I1KA 3SUZA 2I1JA 1FGYA 3X23A 1NI2A 4GPTB 5D3VA 3A8QA 4ZRIA 2J0MA 1Q67A 3MDBC 2R09A 2J59M 4GMXB 5CLQB 3KRWA 5D3WA 5DIFB 2N0YA 2RLOA 4K17A 3VIAA 2N23A 1KZ7A 2DFKA 4HDQA 2Z0QA 2VKIA 2Z0OA 3QBVB 1ZC4B 2J0KA 1FGZA 4DXAB 1IRSA 1TJ6A 3TW1A 5D27A 2D9WA 2LOZA 4GN1A 1U2BA 1UPRA 2ELAA 1ZVRA 2DX1A 3CXBB 4A6FB 2EJ8A 1WJ1A 3A98B 2DYNA 2DA0A 3U7DA 2W2WA 4NY0A 1UEFA 2DKPA 2D9XA 1WI1A 1EF1A 4DX8A 2L1CA 2LOXA 1GC6A 4HAWB 4HATB 1LB1A 1FHOA 2ADZA 2DTCA 2P0DA 1H4RA 3PEGA 4HDOA 3ULBA 1MIZB 1BWNA 3ZVRA 2ELBA 3FEHA 2DX5A 2I5CA 1J0WA 1M7EA 5C16A 1UPQA 4HB2B 2MDXA 1XKEA 3ULCA 1AQCA 2PZ1A 1WG7A 3SO6A 4C0AA 3TVVA 1NTVA 3DXEA 4WSFA 5EFXA 2AEHA 2JP2A 1H10A 4A6HA 4L6EA 3VOQA 4F7HA 1P5TA 1P6SA 5FI1A 4HAXB 3WYFB 4MT7A 4HAZB 2D9ZA 1PFJA 2LULA 3P7ZA 1Y5OA 4XWXA 3KSYA 4MY6A 2J0JA 4DBBA 1V5PA 2K2JA 1J19A 2Y8GA 4A6FA 5JHGA 1U29A 4GXBA 5JHHA 1MAIA 4GZUA 1DROA 5LOPB 4CHJA 2COAA 5C5BB 2ZPYA 4K2PA 1V88A 2KGXB 2NZ8B 3TFMA 4HB0B 3PG7A 1V5MA 2IFSA 3LJUX 4EJNA 2CODA 5GOWB 5J3YA 1XX0A 3TCAA 2K00A 1TXDA 4F7GA 2VSZA 3G9WA 4KVGB 3TO1A 2M38A 4GMVA 2YT1A 2NMBA 3MPXA 1GC7A 4H8SA 3KRXA 3ODOA 2YVCA 2R0DA 2RGNB 3ODXA 1DYNA 1ZM0A 2EC1A 1W1DA 4MK0A 5D3YA 4IFSA 1QC6A 2IYBA 1EVHA 3KZ1A 4A6KA 2YS1A 2XQNM 1OY2A 5HE1A 3SV1A 5CLLB 3FSSA 5DHAB 2LKOA 3NSUA 2DHJA 3HW2B 1EAZA 4HB4B 2YRYA 4KAXB 1DBHA 2HE7A 2RVBB 1XD4A 1U5FA 2OTXA 1XR0B 1WVHA 5DHFB 1X05A 2OQBA 1EGXA 3PZDA 2Q13A 4HHVA 1W1GA 1X1GA 4Z2MB 4F7UP 2DLWA 4PQ0A 1Y19B 4B6HA 2QKLA 1X1FA 2D4QA 1GG3A 1DDWA 3PSCA 3F0WA 2W2XC 1XODA 2M14A 3AU4A 2DYQA 1W1HA 2MWNB 3GYOA 1E5WA 2RNRB 2AL6A 4Z2NA 3SNHA 3M1IB 1NU2A 2GCLA 3RCPA 3GYPA 2LG1A 4ZRJA
chains in the Genus database with same CATH superfamily
5HE0A 3HQCA 2CY5A 3V5WA 1FHWA 3ZDTA 3OHMB 4IAPA 3AU5A 4D0NB 3NWFA 4BBKA 2L2IA 1U27A 3A8PA 1FHXA 5L81A 1N3HA 5C6RA 3PVLA 3SYXA 3P6AA 3PVWA 5FI0A 1T77A 2LYDA 3T06A 1PLSA 2KIGA 1OQNA 1P3RA 2I5FA 1UNRA 3U8ZA 4TKNA 2COFA 1SHCA 2EMSA 5KQ4A 2H7EA 1MKEA 1V5UA 1KZGA 3D8DA 5KCVA 2HTHB 1B55A 2KIEA 1MIXA 2COCA 4NSWA 4OT1A 5DH9B 1ISNA 3BJIA 2GS0A 2FJUB 2RUKB 4HAUB 1FAOA 5HE3A 1V89A 4KHBB 4YL8A 2ROVA 2DKQA 4TYZA 5JLJB 1X11A 2D9YA 2EMTA 4K81A 1WGQA 1PMSA 2CRFA 1TQZA 4PNKA 3OANA 3U12A 1LW3A 4HSIA 5IRSA 3F5RA 2QKMA 2KUPA 1K5DB 1MK7B 2E2XA 3BINA 2P0HA 4KHAA 1AWEA 1ZSQA 4OSNA 4Y94A 4IOYX 2Y7BA 5D3XA 4QJ3B 4K2OA 2G35A 1U5EA 2MFQA 1V61A 1U5GA 2V76A 2UZRA 3N7CA 2Y8FA 2RSGA 2DHKA 5KQ1A 4DX90 1Z87A 1MK9B 2DN6A 1SGHA 5JP4A 1DDVA 3FM8C 2D9VA 4HAYB 3DXDA 2X18A 3KY9A 1I7AA 4EKUA 2VRWB 1OMWA 4A5KA 2YS5A 1WJMA 2CY4A 2D2QA 3QWMA 3PP2A 4GNKB 5J3QA 2W2XD 1FOEA 4WVFB 1QQGA 1K5GB 1BAKA 1MI1A 2MKRA 1UNQA 5LONB 4CHMA 4EMOA 2GJYA 2D10A 2K49A 1KI1B 1I2HA 4HAVB 5C5BA 2ROZB 4KHOA 5HE2A 2KCJA 2FJLA 1ZC3B 3HK0A 2UVMA 2K2UA 2YF0A 1UNPA 5I2MA 4HB3B 2UZSA 1BTNA 4KHBA 3ODWA 5C79A 2YS3A 4ZRKA 2YSZA 3ML4A 2KR0A 1MPHA 1NTYA 3NWAA 2H7DA 3IVFA 5DI9B 3AJ4A 1X86A 1XCGA 2YT0A 3D8FA 2D11A 1RRPB 1BTKA 3QIJA 2Z0PA 2CAYA 3CIKA 1M7RA 1DDMA 4WJ7A 5J3TA 4P7IA 1FB8A 3UZTA 3WA0A 4CYEA 2GCJA 1RJ2A 2ZKMX 2P0FA 1U5DA 2Z13A 3DXCA 2NBVA 2P8VA 3O96A 2BCJA 3PVUA 2DHIA 4YONA 1WGUA 3D8EA 2I1KA 3SUZA 5M4YB 2I1JA 1FGYA 3X23A 2K8EA 1NI2A 4GPTB 5D3VA 3A8QA 4ZRIA 2J0MA 1Q67A 3MDBC 2R09A 2J59M 4GMXB 5CLQB 3KRWA 5D3WA 5DIFB 2N0YA 2RLOA 4K17A 3VIAA 2N23A 1KZ7A 2DFKA 4HDQA 2Z0QA 2VKIA 2Z0OA 3QBVB 3A58A 1ZC4B 2J0KA 1FGZA 4CSQA 1IRSA 1TJ6A 4DXAB 3TW1A 5D27A 2D9WA 2LOZA 4GN1A 1U2BA 1UPRA 2ELAA 4DIXA 1ZVRA 2DX1A 3CXBB 4A6FB 2EJ8A 2GUMA 1WJ1A 3A98B 2DYNA 2DA0A 3U7DA 2W2WA 4NY0A 1UEFA 2DKPA 2D9XA 1WI1A 1EF1A 4DX8A 2L1CA 2LOXA 1GC6A 2Z4DA 4HAWB 4HATB 1LB1A 1FHOA 2ADZA 2DTCA 2P0DA 1H4RA 3PEGA 4HDOA 3ULBA 1MIZB 1BWNA 3ZVRA 2ELBA 3FEHA 2DX5A 2I5CA 1J0WA 1M7EA 5C16A 1UPQA 4HB2B 2MDXA 1XKEA 3ULCA 1AQCA 2PZ1A 1WG7A 3SO6A 3NW8A 4C0AA 3TVVA 1NTVA 3DXEA 4WSFA 5EFXA 4D6WA 2AEHA 4L1RA 2JP2A 1H10A 4A6HA 4L6EA 3VOQA 4F7HA 1P5TA 1P6SA 5FI1A 4QJ5B 4HAXB 3WYFB 4MT7A 4HAZB 2D9ZA 1PFJA 2LULA 3P7ZA 1Y5OA 3FVCA 4QXAB 4XWXA 3NWDA 3KSYA 4MY6A 2J0JA 4DBBA 2Z14A 1V5PA 2K2JA 1J19A 2Y8GA 4A6FA 5JHGA 1U29A 4GXBA 2RRFA 5JHHA 1MAIA 4GZUA 2R2YA 1DROA 5LOPB 4CHJA 2COAA 5C5BB 2ZPYA 4K2PA 1V88A 2KGXB 2NZ8B 3TFMA 4HB0B 3PG7A 1V5MA 2IFSA 3LJUX 4EJNA 2CODA 5GOWB 5J3YA 1XX0A 3TCAA 2K00A 1TXDA 4F7GA 2VSZA 3G9WA 4KVGB 3TO1A 2M38A 4GMVA 2YT1A 2NMBA 5I2SA 3MPXA 1GC7A 4H8SA 3KRXA 3HSAA 3ODOA 2YVCA 2R0DA 2RGNB 3ODXA 1DYNA 1ZM0A 2EC1A 2YT2A 1W1DA 4MK0A 5D3YA 4IFSA 1QC6A 2IYBA 1EVHA 3KZ1A 4GOUA 4A6KA 2YS1A 3HIEA 2XQNM 1OY2A 5HE1A 3SV1A 5CLLB 3FSSA 5DHAB 2LKOA 3NSUA 2DHJA 3HW2B 1EAZA 4HB4B 2YRYA 4KAXB 1DBHA 2HE7A 2RVBB 1XD4A 1U5FA 2Z59A 2OTXA 1ZYIA 1XR0B 1WVHA 5DHFB 3DCXA 2KUQA 3B77A 1X05A 2OQBA 1EGXA 3PZDA 2Q13A 4HHVA 1W1GA 1X1GA 4Z2MB 4F7UP 2DLWA 5LG4B 4PQ0A 1Y19B 4QJ4B 4B6HA 2QKLA 1X1FA 2D4QA 1GG3A 1DDWA 3PSCA 3F0WA 2W2XC 1XODA 2M14A 3AU4A 2DYQA 1W1HA 2MWNB 3GYOA 1E5WA 2RNRB 2AL6A 4Z2NA 3SNHA 3M1IB 1NU2A 2GCLA 3RCPA 3GYPA 2LG1A 4ZRJA
chains in the Genus database with same CATH topology
5HE0A 3HQCA 2CY5A 3V5WA 1FHWA 3ZDTA 4IAPA 3AU5A 4D0NB 4BBKA 2L2IA 1U27A 3A8PA 1FHXA 5L81A 1N3HA 5C6RA 3PVLA 3SYXA 3P6AA 3PVWA 5FI0A 2LYDA 3T06A 1PLSA 1OQNA 1P3RA 2I5FA 1UNRA 3U8ZA 4TKNA 2COFA 1SHCA 2EMSA 5KQ4A 2H7EA 1MKEA 1V5UA 1KZGA 3D8DA 5KCVA 2HTHB 1B55A 1MIXA 2COCA 4NSWA 5DH9B 1ISNA 3BJIA 2GS0A 2RUKB 4HAUB 1FAOA 5HE3A 1V89A 4KHBB 4YL8A 2ROVA 2DKQA 4TYZA 5JLJB 1X11A 2D9YA 2EMTA 4K81A 1WGQA 1PMSA 2CRFA 1TQZA 4PNKA 3OANA 1LW3A 3F5RA 2QKMA 2KUPA 1K5DB 1MK7B 2E2XA 3BINA 2P0HA 4KHAA 1AWEA 1ZSQA 4Y94A 4IOYX 2Y7BA 5D3XA 4K2OA 2G35A 1U5EA 2MFQA 1V61A 1U5GA 2V76A 2UZRA 3N7CA 2Y8FA 2RSGA 2DHKA 5KQ1A 4DX90 1Z87A 1MK9B 2DN6A 1SGHA 5JP4A 1DDVA 3FM8C 2D9VA 4HAYB 3DXDA 2X18A 3KY9A 1I7AA 4EKUA 2VRWB 1OMWA 4A5KA 2YS5A 1WJMA 2CY4A 2D2QA 3QWMA 3PP2A 5J3QA 2W2XD 1FOEA 4WVFB 1QQGA 1K5GB 1BAKA 2MKRA 1UNQA 5LONB 4CHMA 4EMOA 2GJYA 2D10A 1KI1B 1I2HA 4HAVB 5C5BA 2ROZB 4KHOA 5HE2A 2KCJA 2FJLA 1ZC3B 3HK0A 2UVMA 2K2UA 2YF0A 1UNPA 4HB3B 2UZSA 1BTNA 3ODWA 5C79A 2YS3A 4ZRKA 2YSZA 3ML4A 1MPHA 1NTYA 2H7DA 3IVFA 5DI9B 3AJ4A 1X86A 1XCGA 2YT0A 3D8FA 2D11A 1RRPB 1BTKA 3QIJA 2Z0PA 2CAYA 3CIKA 1M7RA 1DDMA 4WJ7A 5J3TA 4P7IA 1FB8A 3UZTA 3WA0A 4CYEA 2GCJA 1RJ2A 2P0FA 1U5DA 3DXCA 2P8VA 3O96A 3PVUA 2BCJA 2DHIA 4YONA 1WGUA 3D8EA 2I1KA 3SUZA 2I1JA 1FGYA 3X23A 1NI2A 4GPTB 5D3VA 3A8QA 4ZRIA 2J0MA 1Q67A 3MDBC 2R09A 2J59M 4GMXB 5CLQB 3KRWA 5D3WA 5DIFB 2N0YA 2RLOA 4K17A 3VIAA 2N23A 1KZ7A 2DFKA 4HDQA 2Z0QA 2VKIA 2Z0OA 3QBVB 1ZC4B 2J0KA 1FGZA 4DXAB 1IRSA 1TJ6A 3TW1A 5D27A 2D9WA 2LOZA 4GN1A 1U2BA 1UPRA 2ELAA 1ZVRA 2DX1A 3CXBB 4A6FB 2EJ8A 1WJ1A 3A98B 2DYNA 2DA0A 3U7DA 2W2WA 4NY0A 1UEFA 2DKPA 2D9XA 1WI1A 1EF1A 4DX8A 2L1CA 2LOXA 1GC6A 4HAWB 4HATB 1LB1A 1FHOA 2ADZA 2DTCA 2P0DA 1H4RA 3PEGA 4HDOA 3ULBA 1MIZB 1BWNA 3ZVRA 2ELBA 3FEHA 2DX5A 2I5CA 1J0WA 1M7EA 5C16A 1UPQA 4HB2B 2MDXA 1XKEA 3ULCA 1AQCA 2PZ1A 1WG7A 3SO6A 4C0AA 3TVVA 1NTVA 3DXEA 4WSFA 5EFXA 2AEHA 2JP2A 1H10A 4A6HA 4L6EA 3VOQA 4F7HA 1P5TA 1P6SA 5FI1A 4HAXB 3WYFB 4MT7A 4HAZB 2D9ZA 1PFJA 2LULA 3P7ZA 1Y5OA 4XWXA 3KSYA 4MY6A 2J0JA 4DBBA 1V5PA 2K2JA 1J19A 2Y8GA 4A6FA 5JHGA 1U29A 4GXBA 5JHHA 1MAIA 4GZUA 1DROA 5LOPB 4CHJA 2COAA 5C5BB 2ZPYA 4K2PA 1V88A 2KGXB 2NZ8B 3TFMA 4HB0B 3PG7A 1V5MA 2IFSA 3LJUX 4EJNA 2CODA 5GOWB 5J3YA 1XX0A 3TCAA 2K00A 1TXDA 4F7GA 2VSZA 3G9WA 4KVGB 3TO1A 2M38A 4GMVA 2YT1A 2NMBA 3MPXA 1GC7A 4H8SA 3KRXA 3ODOA 2YVCA 2R0DA 2RGNB 3ODXA 1DYNA 1ZM0A 2EC1A 1W1DA 4MK0A 5D3YA 4IFSA 1QC6A 2IYBA 1EVHA 3KZ1A 4A6KA 2YS1A 2XQNM 1OY2A 5HE1A 3SV1A 5CLLB 3FSSA 5DHAB 2LKOA 3NSUA 2DHJA 3HW2B 1EAZA 4HB4B 2YRYA 4KAXB 1DBHA 2HE7A 2RVBB 1XD4A 1U5FA 2OTXA 1XR0B 1WVHA 5DHFB 1X05A 2OQBA 1EGXA 3PZDA 2Q13A 4HHVA 1W1GA 1X1GA 4Z2MB 4F7UP 2DLWA 4PQ0A 1Y19B 4B6HA 2QKLA 1X1FA 2D4QA 1GG3A 1DDWA 3PSCA 3F0WA 2W2XC 1XODA 2M14A 3AU4A 2DYQA 1W1HA 2MWNB 3GYOA 1E5WA 2RNRB 2AL6A 4Z2NA 3SNHA 3M1IB 1NU2A 2GCLA 3RCPA 3GYPA 2LG1A 4ZRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE0 A;  3HQC A;  2CY5 A;  3V5W A;  1FHW A;  3ZDT A;  4IAP A;  3AU5 A;  4D0N B;  4BBK A;  2L2I A;  1U27 A;  3A8P A;  1FHX A;  5L81 A;  1N3H A;  5C6R A;  3PVL A;  3SYX A;  3P6A A;  3PVW A;  5FI0 A;  2LYD A;  3T06 A;  1PLS A;  1OQN A;  1P3R A;  2I5F A;  1UNR A;  3U8Z A;  4TKN A;  2COF A;  1SHC A;  2EMS A;  5KQ4 A;  2H7E A;  1MKE A;  1V5U A;  1KZG A;  3D8D A;  5KCV A;  2HTH B;  1B55 A;  1MIX A;  2COC A;  4NSW A;  5DH9 B;  1ISN A;  3BJI A;  2GS0 A;  2RUK B;  4HAU B;  1FAO A;  5HE3 A;  1V89 A;  4KHB B;  4YL8 A;  2ROV A;  2DKQ A;  4TYZ A;  5JLJ B;  1X11 A;  2D9Y A;  2EMT A;  4K81 A;  1WGQ A;  1PMS A;  2CRF A;  1TQZ A;  4PNK A;  3OAN A;  1LW3 A;  3F5R A;  2QKM A;  2KUP A;  1K5D B;  1MK7 B;  2E2X A;  3BIN A;  2P0H A;  4KHA A;  1AWE A;  1ZSQ A;  4Y94 A;  4IOY X;  2Y7B A;  5D3X A;  4K2O A;  2G35 A;  1U5E A;  2MFQ A;  1V61 A;  1U5G A;  2V76 A;  2UZR A;  3N7C A;  2Y8F A;  2RSG A;  2DHK A;  5KQ1 A;  4DX9 0;  1Z87 A;  1MK9 B;  2DN6 A;  1SGH A;  5JP4 A;  1DDV A;  3FM8 C;  2D9V A;  4HAY B;  3DXD A;  2X18 A;  3KY9 A;  1I7A A;  4EKU A;  2VRW B;  1OMW A;  4A5K A;  2YS5 A;  1WJM A;  2CY4 A;  2D2Q A;  3QWM A;  3PP2 A;  5J3Q A;  2W2X D;  1FOE A;  4WVF B;  1QQG A;  1K5G B;  1BAK A;  2MKR A;  1UNQ A;  5LON B;  4CHM A;  4EMO A;  2GJY A;  2D10 A;  1KI1 B;  1I2H A;  4HAV B;  5C5B A;  2ROZ B;  4KHO A;  5HE2 A;  2KCJ A;  2FJL A;  1ZC3 B;  3HK0 A;  2UVM A;  2K2U A;  2YF0 A;  1UNP A;  4HB3 B;  2UZS A;  1BTN A;  3ODW A;  5C79 A;  2YS3 A;  4ZRK A;  2YSZ A;  3ML4 A;  1MPH A;  1NTY A;  2H7D A;  3IVF A;  5DI9 B;  3AJ4 A;  1X86 A;  1XCG A;  2YT0 A;  3D8F A;  2D11 A;  1RRP B;  1BTK A;  3QIJ A;  2Z0P A;  2CAY A;  3CIK A;  1M7R A;  1DDM A;  4WJ7 A;  5J3T A;  4P7I A;  1FB8 A;  3UZT A;  3WA0 A;  4CYE A;  2GCJ A;  1RJ2 A;  2P0F A;  1U5D A;  3DXC A;  2P8V A;  3O96 A;  3PVU A;  2BCJ A;  2DHI A;  4YON A;  1WGU A;  3D8E A;  2I1K A;  3SUZ A;  2I1J A;  1FGY A;  3X23 A;  1NI2 A;  4GPT B;  5D3V A;  3A8Q A;  4ZRI A;  2J0M A;  1Q67 A;  3MDB C;  2R09 A;  2J59 M;  4GMX B;  5CLQ B;  3KRW A;  5D3W A;  5DIF B;  2N0Y A;  2RLO A;  4K17 A;  3VIA A;  2N23 A;  1KZ7 A;  2DFK A;  4HDQ A;  2Z0Q A;  2VKI A;  2Z0O A;  3QBV B;  1ZC4 B;  2J0K A;  1FGZ A;  4DXA B;  1IRS A;  1TJ6 A;  3TW1 A;  5D27 A;  2D9W A;  2LOZ A;  4GN1 A;  1U2B A;  1UPR A;  2ELA A;  1ZVR A;  2DX1 A;  3CXB B;  4A6F B;  2EJ8 A;  1WJ1 A;  3A98 B;  2DYN A;  2DA0 A;  3U7D A;  2W2W A;  4NY0 A;  1UEF A;  2DKP A;  2D9X A;  1WI1 A;  1EF1 A;  4DX8 A;  2L1C A;  2LOX A;  1GC6 A;  4HAW B;  4HAT B;  1LB1 A;  1FHO A;  2ADZ A;  2DTC A;  2P0D A;  1H4R A;  3PEG A;  4HDO A;  3ULB A;  1MIZ B;  1BWN A;  3ZVR A;  2ELB A;  3FEH A;  2DX5 A;  2I5C A;  1J0W A;  1M7E A;  5C16 A;  1UPQ A;  4HB2 B;  2MDX A;  1XKE A;  3ULC A;  1AQC A;  2PZ1 A;  1WG7 A;  3SO6 A;  4C0A A;  3TVV A;  1NTV A;  3DXE A;  4WSF A;  5EFX A;  2AEH A;  2JP2 A;  1H10 A;  4A6H A;  4L6E A;  3VOQ A;  4F7H A;  1P5T A;  1P6S A;  5FI1 A;  4HAX B;  3WYF B;  4MT7 A;  4HAZ B;  2D9Z A;  1PFJ A;  2LUL A;  3P7Z A;  1Y5O A;  4XWX A;  3KSY A;  4MY6 A;  2J0J A;  4DBB A;  1V5P A;  2K2J A;  1J19 A;  2Y8G A;  4A6F A;  5JHG A;  1U29 A;  4GXB A;  5JHH A;  1MAI A;  4GZU A;  1DRO A;  5LOP B;  4CHJ A;  2COA A;  5C5B B;  2ZPY A;  4K2P A;  1V88 A;  2KGX B;  2NZ8 B;  3TFM A;  4HB0 B;  3PG7 A;  1V5M A;  2IFS A;  3LJU X;  4EJN A;  2COD A;  5GOW B;  5J3Y A;  1XX0 A;  3TCA A;  2K00 A;  1TXD A;  4F7G A;  2VSZ A;  3G9W A;  4KVG B;  3TO1 A;  2M38 A;  4GMV A;  2YT1 A;  2NMB A;  3MPX A;  1GC7 A;  4H8S A;  3KRX A;  3ODO A;  2YVC A;  2R0D A;  2RGN B;  3ODX A;  1DYN A;  1ZM0 A;  2EC1 A;  1W1D A;  4MK0 A;  5D3Y A;  4IFS A;  1QC6 A;  2IYB A;  1EVH A;  3KZ1 A;  4A6K A;  2YS1 A;  2XQN M;  1OY2 A;  5HE1 A;  3SV1 A;  5CLL B;  3FSS A;  5DHA B;  2LKO A;  3NSU A;  2DHJ A;  3HW2 B;  1EAZ A;  4HB4 B;  2YRY A;  4KAX B;  1DBH A;  2HE7 A;  2RVB B;  1XD4 A;  1U5F A;  2OTX A;  1XR0 B;  1WVH A;  5DHF B;  1X05 A;  2OQB A;  1EGX A;  3PZD A;  2Q13 A;  4HHV A;  1W1G A;  1X1G A;  4Z2M B;  4F7U P;  2DLW A;  4PQ0 A;  1Y19 B;  4B6H A;  2QKL A;  1X1F A;  2D4Q A;  1GG3 A;  1DDW A;  3PSC A;  3F0W A;  2W2X C;  1XOD A;  2M14 A;  3AU4 A;  2DYQ A;  1W1H A;  2MWN B;  3GYO A;  1E5W A;  2RNR B;  2AL6 A;  4Z2N A;  3SNH A;  3M1I B;  1NU2 A;  2GCL A;  3RCP A;  3GYP A;  2LG1 A;  4ZRJ A; 
#chains in the Genus database with same CATH topology
 5HE0 A;  3HQC A;  2CY5 A;  3V5W A;  1FHW A;  3ZDT A;  3OHM B;  4IAP A;  3AU5 A;  4D0N B;  3NWF A;  4BBK A;  2L2I A;  1U27 A;  3A8P A;  1FHX A;  5L81 A;  1N3H A;  5C6R A;  3PVL A;  3SYX A;  3P6A A;  3PVW A;  5FI0 A;  1T77 A;  2LYD A;  3T06 A;  1PLS A;  2KIG A;  1OQN A;  1P3R A;  2I5F A;  1UNR A;  3U8Z A;  4TKN A;  2COF A;  1SHC A;  2EMS A;  5KQ4 A;  2H7E A;  1MKE A;  1V5U A;  1KZG A;  3D8D A;  5KCV A;  2HTH B;  1B55 A;  2KIE A;  1MIX A;  2COC A;  4NSW A;  4OT1 A;  5DH9 B;  1ISN A;  3BJI A;  2GS0 A;  2FJU B;  2RUK B;  4HAU B;  1FAO A;  5HE3 A;  1V89 A;  4KHB B;  4YL8 A;  2ROV A;  2DKQ A;  4TYZ A;  5JLJ B;  1X11 A;  2D9Y A;  2EMT A;  4K81 A;  1WGQ A;  1PMS A;  2CRF A;  1TQZ A;  4PNK A;  3OAN A;  3U12 A;  1LW3 A;  4HSI A;  5IRS A;  3F5R A;  2QKM A;  2KUP A;  1K5D B;  1MK7 B;  2E2X A;  3BIN A;  2P0H A;  4KHA A;  1AWE A;  1ZSQ A;  4OSN A;  4Y94 A;  4IOY X;  2Y7B A;  5D3X A;  4QJ3 B;  4K2O A;  2G35 A;  1U5E A;  2MFQ A;  1V61 A;  1U5G A;  2V76 A;  2UZR A;  3N7C A;  2Y8F A;  2RSG A;  2DHK A;  5KQ1 A;  4DX9 0;  1Z87 A;  1MK9 B;  2DN6 A;  1SGH A;  5JP4 A;  1DDV A;  3FM8 C;  2D9V A;  4HAY B;  3DXD A;  2X18 A;  3KY9 A;  1I7A A;  4EKU A;  2VRW B;  1OMW A;  4A5K A;  2YS5 A;  1WJM A;  2CY4 A;  2D2Q A;  3QWM A;  3PP2 A;  4GNK B;  5J3Q A;  2W2X D;  1FOE A;  4WVF B;  1QQG A;  1K5G B;  1BAK A;  1MI1 A;  2MKR A;  1UNQ A;  5LON B;  4CHM A;  4EMO A;  2GJY A;  2D10 A;  2K49 A;  1KI1 B;  1I2H A;  4HAV B;  5C5B A;  2ROZ B;  4KHO A;  5HE2 A;  2KCJ A;  2FJL A;  1ZC3 B;  3HK0 A;  2UVM A;  2K2U A;  2YF0 A;  1UNP A;  5I2M A;  4HB3 B;  2UZS A;  1BTN A;  4KHB A;  3ODW A;  5C79 A;  2YS3 A;  4ZRK A;  2YSZ A;  3ML4 A;  2KR0 A;  1MPH A;  1NTY A;  3NWA A;  2H7D A;  3IVF A;  5DI9 B;  3AJ4 A;  1X86 A;  1XCG A;  2YT0 A;  3D8F A;  2D11 A;  1RRP B;  1BTK A;  3QIJ A;  2Z0P A;  2CAY A;  3CIK A;  1M7R A;  1DDM A;  4WJ7 A;  5J3T A;  4P7I A;  1FB8 A;  3UZT A;  3WA0 A;  4CYE A;  2GCJ A;  1RJ2 A;  2ZKM X;  2P0F A;  1U5D A;  2Z13 A;  3DXC A;  2NBV A;  2P8V A;  3O96 A;  2BCJ A;  3PVU A;  2DHI A;  4YON A;  1WGU A;  3D8E A;  2I1K A;  3SUZ A;  5M4Y B;  2I1J A;  1FGY A;  3X23 A;  2K8E A;  1NI2 A;  4GPT B;  5D3V A;  3A8Q A;  4ZRI A;  2J0M A;  1Q67 A;  3MDB C;  2R09 A;  2J59 M;  4GMX B;  5CLQ B;  3KRW A;  5D3W A;  5DIF B;  2N0Y A;  2RLO A;  4K17 A;  3VIA A;  2N23 A;  1KZ7 A;  2DFK A;  4HDQ A;  2Z0Q A;  2VKI A;  2Z0O A;  3QBV B;  3A58 A;  1ZC4 B;  2J0K A;  1FGZ A;  4CSQ A;  1IRS A;  1TJ6 A;  4DXA B;  3TW1 A;  5D27 A;  2D9W A;  2LOZ A;  4GN1 A;  1U2B A;  1UPR A;  2ELA A;  4DIX A;  1ZVR A;  2DX1 A;  3CXB B;  4A6F B;  2EJ8 A;  2GUM A;  1WJ1 A;  3A98 B;  2DYN A;  2DA0 A;  3U7D A;  2W2W A;  4NY0 A;  1UEF A;  2DKP A;  2D9X A;  1WI1 A;  1EF1 A;  4DX8 A;  2L1C A;  2LOX A;  1GC6 A;  2Z4D A;  4HAW B;  4HAT B;  1LB1 A;  1FHO A;  2ADZ A;  2DTC A;  2P0D A;  1H4R A;  3PEG A;  4HDO A;  3ULB A;  1MIZ B;  1BWN A;  3ZVR A;  2ELB A;  3FEH A;  2DX5 A;  2I5C A;  1J0W A;  1M7E A;  5C16 A;  1UPQ A;  4HB2 B;  2MDX A;  1XKE A;  3ULC A;  1AQC A;  2PZ1 A;  1WG7 A;  3SO6 A;  3NW8 A;  4C0A A;  3TVV A;  1NTV A;  3DXE A;  4WSF A;  5EFX A;  4D6W A;  2AEH A;  4L1R A;  2JP2 A;  1H10 A;  4A6H A;  4L6E A;  3VOQ A;  4F7H A;  1P5T A;  1P6S A;  5FI1 A;  4QJ5 B;  4HAX B;  3WYF B;  4MT7 A;  4HAZ B;  2D9Z A;  1PFJ A;  2LUL A;  3P7Z A;  1Y5O A;  3FVC A;  4QXA B;  4XWX A;  3NWD A;  3KSY A;  4MY6 A;  2J0J A;  4DBB A;  2Z14 A;  1V5P A;  2K2J A;  1J19 A;  2Y8G A;  4A6F A;  5JHG A;  1U29 A;  4GXB A;  2RRF A;  5JHH A;  1MAI A;  4GZU A;  2R2Y A;  1DRO A;  5LOP B;  4CHJ A;  2COA A;  5C5B B;  2ZPY A;  4K2P A;  1V88 A;  2KGX B;  2NZ8 B;  3TFM A;  4HB0 B;  3PG7 A;  1V5M A;  2IFS A;  3LJU X;  4EJN A;  2COD A;  5GOW B;  5J3Y A;  1XX0 A;  3TCA A;  2K00 A;  1TXD A;  4F7G A;  2VSZ A;  3G9W A;  4KVG B;  3TO1 A;  2M38 A;  4GMV A;  2YT1 A;  2NMB A;  5I2S A;  3MPX A;  1GC7 A;  4H8S A;  3KRX A;  3HSA A;  3ODO A;  2YVC A;  2R0D A;  2RGN B;  3ODX A;  1DYN A;  1ZM0 A;  2EC1 A;  2YT2 A;  1W1D A;  4MK0 A;  5D3Y A;  4IFS A;  1QC6 A;  2IYB A;  1EVH A;  3KZ1 A;  4GOU A;  4A6K A;  2YS1 A;  3HIE A;  2XQN M;  1OY2 A;  5HE1 A;  3SV1 A;  5CLL B;  3FSS A;  5DHA B;  2LKO A;  3NSU A;  2DHJ A;  3HW2 B;  1EAZ A;  4HB4 B;  2YRY A;  4KAX B;  1DBH A;  2HE7 A;  2RVB B;  1XD4 A;  1U5F A;  2Z59 A;  2OTX A;  1ZYI A;  1XR0 B;  1WVH A;  5DHF B;  3DCX A;  2KUQ A;  3B77 A;  1X05 A;  2OQB A;  1EGX A;  3PZD A;  2Q13 A;  4HHV A;  1W1G A;  1X1G A;  4Z2M B;  4F7U P;  2DLW A;  5LG4 B;  4PQ0 A;  1Y19 B;  4QJ4 B;  4B6H A;  2QKL A;  1X1F A;  2D4Q A;  1GG3 A;  1DDW A;  3PSC A;  3F0W A;  2W2X C;  1XOD A;  2M14 A;  3AU4 A;  2DYQ A;  1W1H A;  2MWN B;  3GYO A;  1E5W A;  2RNR B;  2AL6 A;  4Z2N A;  3SNH A;  3M1I B;  1NU2 A;  2GCL A;  3RCP A;  3GYP A;  2LG1 A;  4ZRJ A; 
#chains in the Genus database with same CATH homology
 5HE0 A;  3HQC A;  2CY5 A;  3V5W A;  1FHW A;  3ZDT A;  4IAP A;  3AU5 A;  4D0N B;  4BBK A;  2L2I A;  1U27 A;  3A8P A;  1FHX A;  5L81 A;  1N3H A;  5C6R A;  3PVL A;  3SYX A;  3P6A A;  3PVW A;  5FI0 A;  2LYD A;  3T06 A;  1PLS A;  1OQN A;  1P3R A;  2I5F A;  1UNR A;  3U8Z A;  4TKN A;  2COF A;  1SHC A;  2EMS A;  5KQ4 A;  2H7E A;  1MKE A;  1V5U A;  1KZG A;  3D8D A;  5KCV A;  2HTH B;  1B55 A;  1MIX A;  2COC A;  4NSW A;  5DH9 B;  1ISN A;  3BJI A;  2GS0 A;  2RUK B;  4HAU B;  1FAO A;  5HE3 A;  1V89 A;  4KHB B;  4YL8 A;  2ROV A;  2DKQ A;  4TYZ A;  5JLJ B;  1X11 A;  2D9Y A;  2EMT A;  4K81 A;  1WGQ A;  1PMS A;  2CRF A;  1TQZ A;  4PNK A;  3OAN A;  1LW3 A;  3F5R A;  2QKM A;  2KUP A;  1K5D B;  1MK7 B;  2E2X A;  3BIN A;  2P0H A;  4KHA A;  1AWE A;  1ZSQ A;  4Y94 A;  4IOY X;  2Y7B A;  5D3X A;  4K2O A;  2G35 A;  1U5E A;  2MFQ A;  1V61 A;  1U5G A;  2V76 A;  2UZR A;  3N7C A;  2Y8F A;  2RSG A;  2DHK A;  5KQ1 A;  4DX9 0;  1Z87 A;  1MK9 B;  2DN6 A;  1SGH A;  5JP4 A;  1DDV A;  3FM8 C;  2D9V A;  4HAY B;  3DXD A;  2X18 A;  3KY9 A;  1I7A A;  4EKU A;  2VRW B;  1OMW A;  4A5K A;  2YS5 A;  1WJM A;  2CY4 A;  2D2Q A;  3QWM A;  3PP2 A;  5J3Q A;  2W2X D;  1FOE A;  4WVF B;  1QQG A;  1K5G B;  1BAK A;  2MKR A;  1UNQ A;  5LON B;  4CHM A;  4EMO A;  2GJY A;  2D10 A;  1KI1 B;  1I2H A;  4HAV B;  5C5B A;  2ROZ B;  4KHO A;  5HE2 A;  2KCJ A;  2FJL A;  1ZC3 B;  3HK0 A;  2UVM A;  2K2U A;  2YF0 A;  1UNP A;  4HB3 B;  2UZS A;  1BTN A;  3ODW A;  5C79 A;  2YS3 A;  4ZRK A;  2YSZ A;  3ML4 A;  1MPH A;  1NTY A;  2H7D A;  3IVF A;  5DI9 B;  3AJ4 A;  1X86 A;  1XCG A;  2YT0 A;  3D8F A;  2D11 A;  1RRP B;  1BTK A;  3QIJ A;  2Z0P A;  2CAY A;  3CIK A;  1M7R A;  1DDM A;  4WJ7 A;  5J3T A;  4P7I A;  1FB8 A;  3UZT A;  3WA0 A;  4CYE A;  2GCJ A;  1RJ2 A;  2P0F A;  1U5D A;  3DXC A;  2P8V A;  3O96 A;  3PVU A;  2BCJ A;  2DHI A;  4YON A;  1WGU A;  3D8E A;  2I1K A;  3SUZ A;  2I1J A;  1FGY A;  3X23 A;  1NI2 A;  4GPT B;  5D3V A;  3A8Q A;  4ZRI A;  2J0M A;  1Q67 A;  3MDB C;  2R09 A;  2J59 M;  4GMX B;  5CLQ B;  3KRW A;  5D3W A;  5DIF B;  2N0Y A;  2RLO A;  4K17 A;  3VIA A;  2N23 A;  1KZ7 A;  2DFK A;  4HDQ A;  2Z0Q A;  2VKI A;  2Z0O A;  3QBV B;  1ZC4 B;  2J0K A;  1FGZ A;  4DXA B;  1IRS A;  1TJ6 A;  3TW1 A;  5D27 A;  2D9W A;  2LOZ A;  4GN1 A;  1U2B A;  1UPR A;  2ELA A;  1ZVR A;  2DX1 A;  3CXB B;  4A6F B;  2EJ8 A;  1WJ1 A;  3A98 B;  2DYN A;  2DA0 A;  3U7D A;  2W2W A;  4NY0 A;  1UEF A;  2DKP A;  2D9X A;  1WI1 A;  1EF1 A;  4DX8 A;  2L1C A;  2LOX A;  1GC6 A;  4HAW B;  4HAT B;  1LB1 A;  1FHO A;  2ADZ A;  2DTC A;  2P0D A;  1H4R A;  3PEG A;  4HDO A;  3ULB A;  1MIZ B;  1BWN A;  3ZVR A;  2ELB A;  3FEH A;  2DX5 A;  2I5C A;  1J0W A;  1M7E A;  5C16 A;  1UPQ A;  4HB2 B;  2MDX A;  1XKE A;  3ULC A;  1AQC A;  2PZ1 A;  1WG7 A;  3SO6 A;  4C0A A;  3TVV A;  1NTV A;  3DXE A;  4WSF A;  5EFX A;  2AEH A;  2JP2 A;  1H10 A;  4A6H A;  4L6E A;  3VOQ A;  4F7H A;  1P5T A;  1P6S A;  5FI1 A;  4HAX B;  3WYF B;  4MT7 A;  4HAZ B;  2D9Z A;  1PFJ A;  2LUL A;  3P7Z A;  1Y5O A;  4XWX A;  3KSY A;  4MY6 A;  2J0J A;  4DBB A;  1V5P A;  2K2J A;  1J19 A;  2Y8G A;  4A6F A;  5JHG A;  1U29 A;  4GXB A;  5JHH A;  1MAI A;  4GZU A;  1DRO A;  5LOP B;  4CHJ A;  2COA A;  5C5B B;  2ZPY A;  4K2P A;  1V88 A;  2KGX B;  2NZ8 B;  3TFM A;  4HB0 B;  3PG7 A;  1V5M A;  2IFS A;  3LJU X;  4EJN A;  2COD A;  5GOW B;  5J3Y A;  1XX0 A;  3TCA A;  2K00 A;  1TXD A;  4F7G A;  2VSZ A;  3G9W A;  4KVG B;  3TO1 A;  2M38 A;  4GMV A;  2YT1 A;  2NMB A;  3MPX A;  1GC7 A;  4H8S A;  3KRX A;  3ODO A;  2YVC A;  2R0D A;  2RGN B;  3ODX A;  1DYN A;  1ZM0 A;  2EC1 A;  1W1D A;  4MK0 A;  5D3Y A;  4IFS A;  1QC6 A;  2IYB A;  1EVH A;  3KZ1 A;  4A6K A;  2YS1 A;  2XQN M;  1OY2 A;  5HE1 A;  3SV1 A;  5CLL B;  3FSS A;  5DHA B;  2LKO A;  3NSU A;  2DHJ A;  3HW2 B;  1EAZ A;  4HB4 B;  2YRY A;  4KAX B;  1DBH A;  2HE7 A;  2RVB B;  1XD4 A;  1U5F A;  2OTX A;  1XR0 B;  1WVH A;  5DHF B;  1X05 A;  2OQB A;  1EGX A;  3PZD A;  2Q13 A;  4HHV A;  1W1G A;  1X1G A;  4Z2M B;  4F7U P;  2DLW A;  4PQ0 A;  1Y19 B;  4B6H A;  2QKL A;  1X1F A;  2D4Q A;  1GG3 A;  1DDW A;  3PSC A;  3F0W A;  2W2X C;  1XOD A;  2M14 A;  3AU4 A;  2DYQ A;  1W1H A;  2MWN B;  3GYO A;  1E5W A;  2RNR B;  2AL6 A;  4Z2N A;  3SNH A;  3M1I B;  1NU2 A;  2GCL A;  3RCP A;  3GYP A;  2LG1 A;  4ZRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...