4L6EA

Crystal structure of the ranbd1 fourth domain of e3 sumo-protein ligase ranbp2. northeast structural genomics consortium (nesg) target hr9193b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
SGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the RanBD1 fourth domain of E3 SUMO-protein ligase RanBP2.
rcsb
source organism Homo sapiens
molecule tags Ligase, isomerase
molecule keywords E3 SUMO-protein ligase RanBP2
total genus 29
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4l6eA00
4IAPA 1TJ6A 2YVCA 2DYQA 1FHWA 4A6FA 4TYZA 1B55A 4D0NB 2MKRA 3KRWA 4XWXA 1ZVRA 4IOYX 4MY6A 4C0AA 2YF0A 1PLSA 2DN6A 1UNPA 2LG1A 1UEFA 2IFSA 2VSZA 1MKEA 3WA0A 1MK7B 3A98B 1M7RA 3GYOA 2RSGA 5HE3A 2GCJA 2GCLA 2CY5A 4GMXB 3ZVRA 1ZM0A 3HQCA 1RRPB 3U8ZA 5JHHA 1V5UA 1QQGA 4K2OA 1XR0B 2CRFA 3G9WA 1M7EA 1J0WA 3HW2B 5JP4A 1BTNA 2FJLA 2M14A 1WGQA 3ULCA 4HB0B 2RVBB 3PG7A 3OANA 2MDXA 2J0MA 4HAWB 4CYEA 2L1CA 1V89A 3RCPA 2D9YA 3AJ4A 3TFMA 5HE1A 1I7AA 2DX1A 1X86A 5D3WA 2COFA 2I5CA 1WGUA 2EJ8A 3V5WA 2V76A 3FM8C 5LONB 3FEHA 3AU4A 2RGNB 4TKNA 1EGXA 1X05A 1K5DB 4EJNA 5L81A 1FAOA 4HHVA 1Z87A 1U2BA 5J3QA 2AEHA 1MK9B 2MWNB 1LB1A 1U5GA 2Y7BA 3LJUX 2D9XA 1MIXA 1PMSA 5C5BA 1V61A 5DI9B 2EC1A 1V5MA 2ELAA 2KGXB 1MIZB 3DXEA 2DKPA 5HE2A 2N23A 4HDOA 2D2QA 2DYNA 4EKUA 4K81A 4Z2NA 2R0DA 1V5PA 5EFXA 2DLWA 1DDVA 1XKEA 2H7DA 2W2XD 5HE0A 2Y8GA 4ZRIA 4A6HA 2I1JA 2CAYA 2R09A 5LOPB 3F0WA 2QKLA 2UZRA 3QBVB 2K00A 1EAZA 4MK0A 1U5FA 1V88A 1W1DA 2DFKA 3HK0A 3SV1A 2ROVA 1FHXA 2I5FA 2LOZA 2VKIA 2YS5A 5D27A 2ZPYA 5C5BB 2COAA 1H4RA 4DXAB 1FHOA 1ZC3B 1P5TA 2OQBA 2L2IA 1H10A 2YSZA 4DX90 2P0DA 3ODWA 1WI1A 4HAZB 1XX0A 2E2XA 3A8PA 2D9ZA 3ML4A 4NSWA 4GPTB 2D9VA 1SGHA 1FOEA 4CHJA 4F7GA 4F7HA 3N7CA 3SUZA 1X1FA 5DHFB 1SHCA 4ZRJA 1Y5OA 2RNRB 5KQ4A 1DYNA 1XCGA 2G35A 4GXBA 5KCVA 1FGYA 1W1HA 2X18A 5J3YA 4EMOA 4MT7A 4DBBA 2J0KA 2IYBA 1J19A 1FB8A 2GJYA 2M38A 1OMWA 3FSSA 5JLJB 3PSCA 3O96A 2CODA 2D11A 4PQ0A 1AWEA 1E5WA 4YONA 2Z0PA 2HTHB 3KY9A 3QWMA 4HB4B 3GYPA 2Y8FA 1WVHA 5GOWB 2JP2A 3PEGA 2LOXA 2DX5A 4GZUA 2NMBA 2YT1A 2UZSA 1AQCA 2DHJA 3PP2A 1FGZA 1NTVA 2D9WA 1KI1B 1TXDA 2DHKA 3F5RA 4PNKA 3BINA 4KVGB 3ULBA 1U27A 1LW3A 4WVFB 3VOQA 5DIFB 1U5EA 2KUPA 2Q13A 2Z0QA 5FI1A 2I1KA 3X23A 3SNHA 3UZTA 2N0YA 2K2JA 1K5GB 1KZGA 2CY4A 2RUKB 1OQNA 1U29A 1NTYA 1UPRA 1MPHA 1BTKA 3D8DA 5C16A 1P3RA 4NY0A 4HAYB 4F7UP 3PVUA 2EMTA 2P0HA 2DTCA 2ROZB 4HAVB 4KHBB 4HAUB 2Z0OA 3PVLA 3MDBC 4Z2MB 4L6EA 2RLOA 5CLLB 3KRXA 1DDWA 1U5DA 5DHAB 2D10A 3M1IB 2KCJA 3TCAA 3QIJA 4HDQA 1P6SA 4A6FB 1NI2A 1ISNA 4K17A 3NSUA 3DXCA 3PVWA 4YL8A 2D4QA 3WYFB 4P7IA 1DDMA 4KAXB 3BJIA 2DA0A 3TVVA 4HB2B 2NZ8B 4ZRKA 2YS3A 1KZ7A 1PFJA 2K2UA 4A6KA 1QC6A 3A8QA 3ODXA 2HE7A 1Q67A 2DKQA 2ADZA 4A5KA 3KSYA 2J0JA 5KQ1A 3VIAA 3AU5A 1TQZA 3P7ZA 1XODA 4WJ7A 5JHGA 1W1GA 5DH9B 1UNQA 1GC6A 2OTXA 2QKMA 4KHAA 1MAIA 2BCJA 3TW1A 2P8VA 2H7EA 3U7DA 1EVHA 1X1GA 1X11A 5J3TA 3MPXA 2EMSA 3TO1A 5C79A 2DHIA 2W2WA 2VRWB 3DXDA 2YS1A 3SYXA 2YT0A 2LULA 3D8FA 1ZSQA 1NU2A 2P0FA 4Y94A 1I2HA 3CXBB 1UNRA 2UVMA 3ZDTA 4HB3B 1ZC4B 2AL6A 2J59M 4GN1A 5D3YA 3KZ1A 1Y19B 3SO6A 2PZ1A 1DROA 4IFSA 3ODOA 2LYDA 1GG3A 4BBKA 2YRYA 4GMVA 3P6AA 4WSFA 1BWNA 3PZDA 5CLQB 4DX8A 3IVFA 1EF1A 2LKOA 5FI0A 2GS0A 5D3XA 4HATB 1DBHA 4HAXB 2MFQA 1IRSA 2COCA 1OY2A 3D8EA 4B6HA 2ELBA 1WG7A 5D3VA 1WJ1A 1RJ2A 4K2PA 2W2XC 3CIKA 4H8SA 4KHOA 5C6RA 1UPQA 1N3HA 3T06A 1WJMA 1BAKA 1GC7A 4CHMA 1XD4A 2XQNM
chains in the Genus database with same CATH superfamily
4IAPA 1TJ6A 2YVCA 2DYQA 1FHWA 4A6FA 4TYZA 1B55A 4D0NB 2MKRA 3KRWA 4XWXA 1ZVRA 4IOYX 4MY6A 2K8EA 4C0AA 2KIEA 2YF0A 1PLSA 2DN6A 1UNPA 2LG1A 1UEFA 2IFSA 2VSZA 1MKEA 3WA0A 1MK7B 3A98B 4QJ3B 1M7RA 3GYOA 2RSGA 5HE3A 2GCJA 2GCLA 2CY5A 4GMXB 3ZVRA 5LG4B 1ZM0A 3HQCA 1RRPB 3U8ZA 5JHHA 1V5UA 1QQGA 4K2OA 1XR0B 2CRFA 3G9WA 1M7EA 1J0WA 2NBVA 3HW2B 5JP4A 1BTNA 2FJLA 2M14A 1WGQA 3ULCA 4HB0B 2RVBB 3PG7A 3OANA 2MDXA 2J0MA 4HAWB 4CYEA 2L1CA 1V89A 3RCPA 2D9YA 3AJ4A 3TFMA 5HE1A 1I7AA 2DX1A 1X86A 4KHBA 5D3WA 2KIGA 2COFA 2I5CA 2Z59A 1WGUA 2EJ8A 4D6WA 3V5WA 2V76A 3FM8C 5LONB 3FEHA 3AU4A 2RGNB 4TKNA 1EGXA 1X05A 1K5DB 4EJNA 5L81A 1FAOA 4HHVA 1Z87A 1U2BA 4QJ4B 5J3QA 2AEHA 1MK9B 2MWNB 1LB1A 1U5GA 2Y7BA 3LJUX 2D9XA 1MIXA 1PMSA 5C5BA 1V61A 5DI9B 2EC1A 1V5MA 2ELAA 2KGXB 3B77A 1MIZB 3DXEA 2DKPA 5HE2A 2N23A 4HDOA 2YT2A 2D2QA 2DYNA 4EKUA 4K81A 4Z2NA 2R0DA 1V5PA 5EFXA 2DLWA 1DDVA 1XKEA 4OSNA 2H7DA 2W2XD 3U12A 5HE0A 2Y8GA 4ZRIA 4A6HA 2I1JA 2CAYA 2R09A 5LOPB 3F0WA 2QKLA 2UZRA 3QBVB 2K00A 1EAZA 4MK0A 1U5FA 1V88A 1W1DA 2DFKA 3HK0A 3SV1A 2ROVA 1FHXA 2I5FA 2LOZA 2VKIA 2YS5A 5D27A 2ZPYA 5C5BB 2COAA 1H4RA 4DXAB 1FHOA 1ZC3B 1P5TA 2OQBA 2L2IA 1H10A 2YSZA 4DX90 2P0DA 3ODWA 1WI1A 4HAZB 1XX0A 2E2XA 3A8PA 2D9ZA 3ML4A 4NSWA 4GPTB 2Z4DA 2D9VA 1SGHA 1FOEA 4CHJA 4F7GA 4F7HA 3N7CA 3SUZA 1X1FA 3NWAA 2K49A 4L1RA 5DHFB 1SHCA 4ZRJA 1Y5OA 2RNRB 5KQ4A 1DYNA 1XCGA 2G35A 4GXBA 5KCVA 1FGYA 3A58A 1W1HA 2X18A 5J3YA 4EMOA 4MT7A 4DBBA 2J0KA 2IYBA 1J19A 1FB8A 2GJYA 2M38A 5I2MA 1OMWA 3FSSA 5JLJB 3PSCA 3O96A 2CODA 2FJUB 2D11A 4PQ0A 1AWEA 1E5WA 4YONA 2Z0PA 2ZKMX 2HTHB 4OT1A 3KY9A 3QWMA 4HB4B 3GYPA 2Y8FA 1WVHA 5GOWB 2JP2A 3PEGA 2LOXA 2DX5A 4GZUA 2NMBA 2YT1A 2UZSA 1AQCA 2DHJA 3PP2A 1FGZA 1NTVA 2D9WA 1KI1B 1TXDA 2DHKA 2Z13A 3F5RA 3BINA 4KVGB 4PNKA 3ULBA 1U27A 1ZYIA 1LW3A 4WVFB 3VOQA 5DIFB 1U5EA 2KUPA 2Q13A 2Z0QA 5FI1A 2I1KA 3X23A 3SNHA 3UZTA 2N0YA 2K2JA 1K5GB 3NWDA 1KZGA 2CY4A 2RUKB 1OQNA 1U29A 1NTYA 1UPRA 1MPHA 1BTKA 3D8DA 5C16A 1P3RA 4QXAB 4NY0A 4HAYB 4F7UP 3PVUA 2EMTA 2P0HA 2DTCA 2ROZB 4HAVB 4KHBB 4HAUB 2Z0OA 3PVLA 3MDBC 4Z2MB 4L6EA 2RLOA 5CLLB 3KRXA 1DDWA 1U5DA 2GUMA 5DHAB 2D10A 3NW8A 3M1IB 2KCJA 3TCAA 3QIJA 4HDQA 1P6SA 4A6FB 1NI2A 3HIEA 1ISNA 4K17A 3NSUA 3DXCA 3PVWA 4YL8A 2D4QA 3WYFB 4P7IA 1DDMA 4KAXB 3BJIA 2DA0A 3TVVA 4HB2B 2NZ8B 4ZRKA 2YS3A 1KZ7A 1PFJA 2K2UA 4A6KA 1QC6A 3A8QA 3ODXA 2HE7A 1Q67A 2DKQA 2ADZA 4A5KA 3KSYA 2J0JA 5KQ1A 3VIAA 4QJ5B 3AU5A 1TQZA 3P7ZA 1XODA 4WJ7A 5JHGA 1W1GA 3NWFA 5DH9B 1UNQA 1GC6A 2OTXA 2QKMA 4KHAA 1MAIA 2BCJA 3TW1A 2P8VA 2H7EA 2Z14A 3U7DA 3HSAA 1EVHA 1X1GA 1X11A 5J3TA 4DIXA 3MPXA 4GOUA 2EMSA 3TO1A 5C79A 2DHIA 2W2WA 2VRWB 4GNKB 3DXDA 2YS1A 3DCXA 3SYXA 2YT0A 2LULA 3D8FA 1ZSQA 1NU2A 2P0FA 4Y94A 1I2HA 3CXBB 1UNRA 2UVMA 3ZDTA 4HB3B 1ZC4B 4HSIA 2AL6A 2J59M 4GN1A 5D3YA 3KZ1A 1Y19B 5M4YB 3SO6A 2KUQA 2PZ1A 1DROA 4IFSA 3ODOA 5I2SA 2LYDA 1GG3A 4BBKA 2YRYA 4GMVA 3P6AA 2R2YA 4WSFA 1BWNA 3PZDA 5CLQB 2KR0A 4DX8A 3IVFA 1EF1A 2LKOA 5FI0A 2GS0A 5D3XA 3OHMB 4HATB 1DBHA 4HAXB 1T77A 2MFQA 1IRSA 2COCA 3FVCA 1OY2A 3D8EA 4B6HA 1MI1A 2ELBA 1WG7A 5D3VA 4CSQA 1WJ1A 1RJ2A 4K2PA 2W2XC 3CIKA 4H8SA 4KHOA 5C6RA 1UPQA 5IRSA 1N3HA 3T06A 1WJMA 1BAKA 1GC7A 2RRFA 4CHMA 1XD4A 2XQNM
chains in the Genus database with same CATH topology
4IAPA 1TJ6A 2YVCA 2DYQA 1FHWA 4A6FA 4TYZA 1B55A 4D0NB 2MKRA 3KRWA 4XWXA 1ZVRA 4IOYX 4MY6A 4C0AA 2YF0A 1PLSA 2DN6A 1UNPA 2LG1A 1UEFA 2IFSA 2VSZA 1MKEA 3WA0A 1MK7B 3A98B 1M7RA 3GYOA 2RSGA 5HE3A 2GCJA 2GCLA 2CY5A 4GMXB 3ZVRA 1ZM0A 3HQCA 1RRPB 3U8ZA 5JHHA 1V5UA 1QQGA 4K2OA 1XR0B 2CRFA 3G9WA 1M7EA 1J0WA 3HW2B 5JP4A 1BTNA 2FJLA 2M14A 1WGQA 3ULCA 4HB0B 2RVBB 3PG7A 3OANA 2MDXA 2J0MA 4HAWB 4CYEA 2L1CA 1V89A 3RCPA 2D9YA 3AJ4A 3TFMA 5HE1A 1I7AA 2DX1A 1X86A 5D3WA 2COFA 2I5CA 1WGUA 2EJ8A 3V5WA 2V76A 3FM8C 5LONB 3FEHA 3AU4A 2RGNB 4TKNA 1EGXA 1X05A 1K5DB 4EJNA 5L81A 1FAOA 4HHVA 1Z87A 1U2BA 5J3QA 2AEHA 1MK9B 2MWNB 1LB1A 1U5GA 2Y7BA 3LJUX 2D9XA 1MIXA 1PMSA 5C5BA 1V61A 5DI9B 2EC1A 1V5MA 2ELAA 2KGXB 1MIZB 3DXEA 2DKPA 5HE2A 2N23A 4HDOA 2D2QA 2DYNA 4EKUA 4K81A 4Z2NA 2R0DA 1V5PA 5EFXA 2DLWA 1DDVA 1XKEA 2H7DA 2W2XD 5HE0A 2Y8GA 4ZRIA 4A6HA 2I1JA 2CAYA 2R09A 5LOPB 3F0WA 2QKLA 2UZRA 3QBVB 2K00A 1EAZA 4MK0A 1U5FA 1V88A 1W1DA 2DFKA 3HK0A 3SV1A 2ROVA 1FHXA 2I5FA 2LOZA 2VKIA 2YS5A 5D27A 2ZPYA 5C5BB 2COAA 1H4RA 4DXAB 1FHOA 1ZC3B 1P5TA 2OQBA 2L2IA 1H10A 2YSZA 4DX90 2P0DA 3ODWA 1WI1A 4HAZB 1XX0A 2E2XA 3A8PA 2D9ZA 3ML4A 4NSWA 4GPTB 2D9VA 1SGHA 1FOEA 4CHJA 4F7GA 4F7HA 3N7CA 3SUZA 1X1FA 5DHFB 1SHCA 4ZRJA 1Y5OA 2RNRB 5KQ4A 1DYNA 1XCGA 2G35A 4GXBA 5KCVA 1FGYA 1W1HA 2X18A 5J3YA 4EMOA 4MT7A 4DBBA 2J0KA 2IYBA 1J19A 1FB8A 2GJYA 2M38A 1OMWA 3FSSA 5JLJB 3PSCA 3O96A 2CODA 2D11A 4PQ0A 1AWEA 1E5WA 4YONA 2Z0PA 2HTHB 3KY9A 3QWMA 4HB4B 3GYPA 2Y8FA 1WVHA 5GOWB 2JP2A 3PEGA 2LOXA 2DX5A 4GZUA 2NMBA 2YT1A 2UZSA 1AQCA 2DHJA 3PP2A 1FGZA 1NTVA 2D9WA 1KI1B 1TXDA 2DHKA 3F5RA 4PNKA 3BINA 4KVGB 3ULBA 1U27A 1LW3A 4WVFB 3VOQA 5DIFB 1U5EA 2KUPA 2Q13A 2Z0QA 5FI1A 2I1KA 3X23A 3SNHA 3UZTA 2N0YA 2K2JA 1K5GB 1KZGA 2CY4A 2RUKB 1OQNA 1U29A 1NTYA 1UPRA 1MPHA 1BTKA 3D8DA 5C16A 1P3RA 4NY0A 4HAYB 4F7UP 3PVUA 2EMTA 2P0HA 2DTCA 2ROZB 4HAVB 4KHBB 4HAUB 2Z0OA 3PVLA 3MDBC 4Z2MB 4L6EA 2RLOA 5CLLB 3KRXA 1DDWA 1U5DA 5DHAB 2D10A 3M1IB 2KCJA 3TCAA 3QIJA 4HDQA 1P6SA 4A6FB 1NI2A 1ISNA 4K17A 3NSUA 3DXCA 3PVWA 4YL8A 2D4QA 3WYFB 4P7IA 1DDMA 4KAXB 3BJIA 2DA0A 3TVVA 4HB2B 2NZ8B 4ZRKA 2YS3A 1KZ7A 1PFJA 2K2UA 4A6KA 1QC6A 3A8QA 3ODXA 2HE7A 1Q67A 2DKQA 2ADZA 4A5KA 3KSYA 2J0JA 5KQ1A 3VIAA 3AU5A 1TQZA 3P7ZA 1XODA 4WJ7A 5JHGA 1W1GA 5DH9B 1UNQA 1GC6A 2OTXA 2QKMA 4KHAA 1MAIA 2BCJA 3TW1A 2P8VA 2H7EA 3U7DA 1EVHA 1X1GA 1X11A 5J3TA 3MPXA 2EMSA 3TO1A 5C79A 2DHIA 2W2WA 2VRWB 3DXDA 2YS1A 3SYXA 2YT0A 2LULA 3D8FA 1ZSQA 1NU2A 2P0FA 4Y94A 1I2HA 3CXBB 1UNRA 2UVMA 3ZDTA 4HB3B 1ZC4B 2AL6A 2J59M 4GN1A 5D3YA 3KZ1A 1Y19B 3SO6A 2PZ1A 1DROA 4IFSA 3ODOA 2LYDA 1GG3A 4BBKA 2YRYA 4GMVA 3P6AA 4WSFA 1BWNA 3PZDA 5CLQB 4DX8A 3IVFA 1EF1A 2LKOA 5FI0A 2GS0A 5D3XA 4HATB 1DBHA 4HAXB 2MFQA 1IRSA 2COCA 1OY2A 3D8EA 4B6HA 2ELBA 1WG7A 5D3VA 1WJ1A 1RJ2A 4K2PA 2W2XC 3CIKA 4H8SA 4KHOA 5C6RA 1UPQA 1N3HA 3T06A 1WJMA 1BAKA 1GC7A 4CHMA 1XD4A 2XQNM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  1TJ6 A;  2YVC A;  2DYQ A;  1FHW A;  4A6F A;  4TYZ A;  1B55 A;  4D0N B;  2MKR A;  3KRW A;  4XWX A;  1ZVR A;  4IOY X;  4MY6 A;  4C0A A;  2YF0 A;  1PLS A;  2DN6 A;  1UNP A;  2LG1 A;  1UEF A;  2IFS A;  2VSZ A;  1MKE A;  3WA0 A;  1MK7 B;  3A98 B;  1M7R A;  3GYO A;  2RSG A;  5HE3 A;  2GCJ A;  2GCL A;  2CY5 A;  4GMX B;  3ZVR A;  1ZM0 A;  3HQC A;  1RRP B;  3U8Z A;  5JHH A;  1V5U A;  1QQG A;  4K2O A;  1XR0 B;  2CRF A;  3G9W A;  1M7E A;  1J0W A;  3HW2 B;  5JP4 A;  1BTN A;  2FJL A;  2M14 A;  1WGQ A;  3ULC A;  4HB0 B;  2RVB B;  3PG7 A;  3OAN A;  2MDX A;  2J0M A;  4HAW B;  4CYE A;  2L1C A;  1V89 A;  3RCP A;  2D9Y A;  3AJ4 A;  3TFM A;  5HE1 A;  1I7A A;  2DX1 A;  1X86 A;  5D3W A;  2COF A;  2I5C A;  1WGU A;  2EJ8 A;  3V5W A;  2V76 A;  3FM8 C;  5LON B;  3FEH A;  3AU4 A;  2RGN B;  4TKN A;  1EGX A;  1X05 A;  1K5D B;  4EJN A;  5L81 A;  1FAO A;  4HHV A;  1Z87 A;  1U2B A;  5J3Q A;  2AEH A;  1MK9 B;  2MWN B;  1LB1 A;  1U5G A;  2Y7B A;  3LJU X;  2D9X A;  1MIX A;  1PMS A;  5C5B A;  1V61 A;  5DI9 B;  2EC1 A;  1V5M A;  2ELA A;  2KGX B;  1MIZ B;  3DXE A;  2DKP A;  5HE2 A;  2N23 A;  4HDO A;  2D2Q A;  2DYN A;  4EKU A;  4K81 A;  4Z2N A;  2R0D A;  1V5P A;  5EFX A;  2DLW A;  1DDV A;  1XKE A;  2H7D A;  2W2X D;  5HE0 A;  2Y8G A;  4ZRI A;  4A6H A;  2I1J A;  2CAY A;  2R09 A;  5LOP B;  3F0W A;  2QKL A;  2UZR A;  3QBV B;  2K00 A;  1EAZ A;  4MK0 A;  1U5F A;  1V88 A;  1W1D A;  2DFK A;  3HK0 A;  3SV1 A;  2ROV A;  1FHX A;  2I5F A;  2LOZ A;  2VKI A;  2YS5 A;  5D27 A;  2ZPY A;  5C5B B;  2COA A;  1H4R A;  4DXA B;  1FHO A;  1ZC3 B;  1P5T A;  2OQB A;  2L2I A;  1H10 A;  2YSZ A;  4DX9 0;  2P0D A;  3ODW A;  1WI1 A;  4HAZ B;  1XX0 A;  2E2X A;  3A8P A;  2D9Z A;  3ML4 A;  4NSW A;  4GPT B;  2D9V A;  1SGH A;  1FOE A;  4CHJ A;  4F7G A;  4F7H A;  3N7C A;  3SUZ A;  1X1F A;  5DHF B;  1SHC A;  4ZRJ A;  1Y5O A;  2RNR B;  5KQ4 A;  1DYN A;  1XCG A;  2G35 A;  4GXB A;  5KCV A;  1FGY A;  1W1H A;  2X18 A;  5J3Y A;  4EMO A;  4MT7 A;  4DBB A;  2J0K A;  2IYB A;  1J19 A;  1FB8 A;  2GJY A;  2M38 A;  1OMW A;  3FSS A;  5JLJ B;  3PSC A;  3O96 A;  2COD A;  2D11 A;  4PQ0 A;  1AWE A;  1E5W A;  4YON A;  2Z0P A;  2HTH B;  3KY9 A;  3QWM A;  4HB4 B;  3GYP A;  2Y8F A;  1WVH A;  5GOW B;  2JP2 A;  3PEG A;  2LOX A;  2DX5 A;  4GZU A;  2NMB A;  2YT1 A;  2UZS A;  1AQC A;  2DHJ A;  3PP2 A;  1FGZ A;  1NTV A;  2D9W A;  1KI1 B;  1TXD A;  2DHK A;  3F5R A;  4PNK A;  3BIN A;  4KVG B;  3ULB A;  1U27 A;  1LW3 A;  4WVF B;  3VOQ A;  5DIF B;  1U5E A;  2KUP A;  2Q13 A;  2Z0Q A;  5FI1 A;  2I1K A;  3X23 A;  3SNH A;  3UZT A;  2N0Y A;  2K2J A;  1K5G B;  1KZG A;  2CY4 A;  2RUK B;  1OQN A;  1U29 A;  1NTY A;  1UPR A;  1MPH A;  1BTK A;  3D8D A;  5C16 A;  1P3R A;  4NY0 A;  4HAY B;  4F7U P;  3PVU A;  2EMT A;  2P0H A;  2DTC A;  2ROZ B;  4HAV B;  4KHB B;  4HAU B;  2Z0O A;  3PVL A;  3MDB C;  4Z2M B;  4L6E A;  2RLO A;  5CLL B;  3KRX A;  1DDW A;  1U5D A;  5DHA B;  2D10 A;  3M1I B;  2KCJ A;  3TCA A;  3QIJ A;  4HDQ A;  1P6S A;  4A6F B;  1NI2 A;  1ISN A;  4K17 A;  3NSU A;  3DXC A;  3PVW A;  4YL8 A;  2D4Q A;  3WYF B;  4P7I A;  1DDM A;  4KAX B;  3BJI A;  2DA0 A;  3TVV A;  4HB2 B;  2NZ8 B;  4ZRK A;  2YS3 A;  1KZ7 A;  1PFJ A;  2K2U A;  4A6K A;  1QC6 A;  3A8Q A;  3ODX A;  2HE7 A;  1Q67 A;  2DKQ A;  2ADZ A;  4A5K A;  3KSY A;  2J0J A;  5KQ1 A;  3VIA A;  3AU5 A;  1TQZ A;  3P7Z A;  1XOD A;  4WJ7 A;  5JHG A;  1W1G A;  5DH9 B;  1UNQ A;  1GC6 A;  2OTX A;  2QKM A;  4KHA A;  1MAI A;  2BCJ A;  3TW1 A;  2P8V A;  2H7E A;  3U7D A;  1EVH A;  1X1G A;  1X11 A;  5J3T A;  3MPX A;  2EMS A;  3TO1 A;  5C79 A;  2DHI A;  2W2W A;  2VRW B;  3DXD A;  2YS1 A;  3SYX A;  2YT0 A;  2LUL A;  3D8F A;  1ZSQ A;  1NU2 A;  2P0F A;  4Y94 A;  1I2H A;  3CXB B;  1UNR A;  2UVM A;  3ZDT A;  4HB3 B;  1ZC4 B;  2AL6 A;  2J59 M;  4GN1 A;  5D3Y A;  3KZ1 A;  1Y19 B;  3SO6 A;  2PZ1 A;  1DRO A;  4IFS A;  3ODO A;  2LYD A;  1GG3 A;  4BBK A;  2YRY A;  4GMV A;  3P6A A;  4WSF A;  1BWN A;  3PZD A;  5CLQ B;  4DX8 A;  3IVF A;  1EF1 A;  2LKO A;  5FI0 A;  2GS0 A;  5D3X A;  4HAT B;  1DBH A;  4HAX B;  2MFQ A;  1IRS A;  2COC A;  1OY2 A;  3D8E A;  4B6H A;  2ELB A;  1WG7 A;  5D3V A;  1WJ1 A;  1RJ2 A;  4K2P A;  2W2X C;  3CIK A;  4H8S A;  4KHO A;  5C6R A;  1UPQ A;  1N3H A;  3T06 A;  1WJM A;  1BAK A;  1GC7 A;  4CHM A;  1XD4 A;  2XQN M; 
#chains in the Genus database with same CATH topology
 4IAP A;  1TJ6 A;  2YVC A;  2DYQ A;  1FHW A;  4A6F A;  4TYZ A;  1B55 A;  4D0N B;  2MKR A;  3KRW A;  4XWX A;  1ZVR A;  4IOY X;  4MY6 A;  2K8E A;  4C0A A;  2KIE A;  2YF0 A;  1PLS A;  2DN6 A;  1UNP A;  2LG1 A;  1UEF A;  2IFS A;  2VSZ A;  1MKE A;  3WA0 A;  1MK7 B;  3A98 B;  4QJ3 B;  1M7R A;  3GYO A;  2RSG A;  5HE3 A;  2GCJ A;  2GCL A;  2CY5 A;  4GMX B;  3ZVR A;  5LG4 B;  1ZM0 A;  3HQC A;  1RRP B;  3U8Z A;  5JHH A;  1V5U A;  1QQG A;  4K2O A;  1XR0 B;  2CRF A;  3G9W A;  1M7E A;  1J0W A;  2NBV A;  3HW2 B;  5JP4 A;  1BTN A;  2FJL A;  2M14 A;  1WGQ A;  3ULC A;  4HB0 B;  2RVB B;  3PG7 A;  3OAN A;  2MDX A;  2J0M A;  4HAW B;  4CYE A;  2L1C A;  1V89 A;  3RCP A;  2D9Y A;  3AJ4 A;  3TFM A;  5HE1 A;  1I7A A;  2DX1 A;  1X86 A;  4KHB A;  5D3W A;  2KIG A;  2COF A;  2I5C A;  2Z59 A;  1WGU A;  2EJ8 A;  4D6W A;  3V5W A;  2V76 A;  3FM8 C;  5LON B;  3FEH A;  3AU4 A;  2RGN B;  4TKN A;  1EGX A;  1X05 A;  1K5D B;  4EJN A;  5L81 A;  1FAO A;  4HHV A;  1Z87 A;  1U2B A;  4QJ4 B;  5J3Q A;  2AEH A;  1MK9 B;  2MWN B;  1LB1 A;  1U5G A;  2Y7B A;  3LJU X;  2D9X A;  1MIX A;  1PMS A;  5C5B A;  1V61 A;  5DI9 B;  2EC1 A;  1V5M A;  2ELA A;  2KGX B;  3B77 A;  1MIZ B;  3DXE A;  2DKP A;  5HE2 A;  2N23 A;  4HDO A;  2YT2 A;  2D2Q A;  2DYN A;  4EKU A;  4K81 A;  4Z2N A;  2R0D A;  1V5P A;  5EFX A;  2DLW A;  1DDV A;  1XKE A;  4OSN A;  2H7D A;  2W2X D;  3U12 A;  5HE0 A;  2Y8G A;  4ZRI A;  4A6H A;  2I1J A;  2CAY A;  2R09 A;  5LOP B;  3F0W A;  2QKL A;  2UZR A;  3QBV B;  2K00 A;  1EAZ A;  4MK0 A;  1U5F A;  1V88 A;  1W1D A;  2DFK A;  3HK0 A;  3SV1 A;  2ROV A;  1FHX A;  2I5F A;  2LOZ A;  2VKI A;  2YS5 A;  5D27 A;  2ZPY A;  5C5B B;  2COA A;  1H4R A;  4DXA B;  1FHO A;  1ZC3 B;  1P5T A;  2OQB A;  2L2I A;  1H10 A;  2YSZ A;  4DX9 0;  2P0D A;  3ODW A;  1WI1 A;  4HAZ B;  1XX0 A;  2E2X A;  3A8P A;  2D9Z A;  3ML4 A;  4NSW A;  4GPT B;  2Z4D A;  2D9V A;  1SGH A;  1FOE A;  4CHJ A;  4F7G A;  4F7H A;  3N7C A;  3SUZ A;  1X1F A;  3NWA A;  2K49 A;  4L1R A;  5DHF B;  1SHC A;  4ZRJ A;  1Y5O A;  2RNR B;  5KQ4 A;  1DYN A;  1XCG A;  2G35 A;  4GXB A;  5KCV A;  1FGY A;  3A58 A;  1W1H A;  2X18 A;  5J3Y A;  4EMO A;  4MT7 A;  4DBB A;  2J0K A;  2IYB A;  1J19 A;  1FB8 A;  2GJY A;  2M38 A;  5I2M A;  1OMW A;  3FSS A;  5JLJ B;  3PSC A;  3O96 A;  2COD A;  2FJU B;  2D11 A;  4PQ0 A;  1AWE A;  1E5W A;  4YON A;  2Z0P A;  2ZKM X;  2HTH B;  4OT1 A;  3KY9 A;  3QWM A;  4HB4 B;  3GYP A;  2Y8F A;  1WVH A;  5GOW B;  2JP2 A;  3PEG A;  2LOX A;  2DX5 A;  4GZU A;  2NMB A;  2YT1 A;  2UZS A;  1AQC A;  2DHJ A;  3PP2 A;  1FGZ A;  1NTV A;  2D9W A;  1KI1 B;  1TXD A;  2DHK A;  2Z13 A;  3F5R A;  3BIN A;  4KVG B;  4PNK A;  3ULB A;  1U27 A;  1ZYI A;  1LW3 A;  4WVF B;  3VOQ A;  5DIF B;  1U5E A;  2KUP A;  2Q13 A;  2Z0Q A;  5FI1 A;  2I1K A;  3X23 A;  3SNH A;  3UZT A;  2N0Y A;  2K2J A;  1K5G B;  3NWD A;  1KZG A;  2CY4 A;  2RUK B;  1OQN A;  1U29 A;  1NTY A;  1UPR A;  1MPH A;  1BTK A;  3D8D A;  5C16 A;  1P3R A;  4QXA B;  4NY0 A;  4HAY B;  4F7U P;  3PVU A;  2EMT A;  2P0H A;  2DTC A;  2ROZ B;  4HAV B;  4KHB B;  4HAU B;  2Z0O A;  3PVL A;  3MDB C;  4Z2M B;  4L6E A;  2RLO A;  5CLL B;  3KRX A;  1DDW A;  1U5D A;  2GUM A;  5DHA B;  2D10 A;  3NW8 A;  3M1I B;  2KCJ A;  3TCA A;  3QIJ A;  4HDQ A;  1P6S A;  4A6F B;  1NI2 A;  3HIE A;  1ISN A;  4K17 A;  3NSU A;  3DXC A;  3PVW A;  4YL8 A;  2D4Q A;  3WYF B;  4P7I A;  1DDM A;  4KAX B;  3BJI A;  2DA0 A;  3TVV A;  4HB2 B;  2NZ8 B;  4ZRK A;  2YS3 A;  1KZ7 A;  1PFJ A;  2K2U A;  4A6K A;  1QC6 A;  3A8Q A;  3ODX A;  2HE7 A;  1Q67 A;  2DKQ A;  2ADZ A;  4A5K A;  3KSY A;  2J0J A;  5KQ1 A;  3VIA A;  4QJ5 B;  3AU5 A;  1TQZ A;  3P7Z A;  1XOD A;  4WJ7 A;  5JHG A;  1W1G A;  3NWF A;  5DH9 B;  1UNQ A;  1GC6 A;  2OTX A;  2QKM A;  4KHA A;  1MAI A;  2BCJ A;  3TW1 A;  2P8V A;  2H7E A;  2Z14 A;  3U7D A;  3HSA A;  1EVH A;  1X1G A;  1X11 A;  5J3T A;  4DIX A;  3MPX A;  4GOU A;  2EMS A;  3TO1 A;  5C79 A;  2DHI A;  2W2W A;  2VRW B;  4GNK B;  3DXD A;  2YS1 A;  3DCX A;  3SYX A;  2YT0 A;  2LUL A;  3D8F A;  1ZSQ A;  1NU2 A;  2P0F A;  4Y94 A;  1I2H A;  3CXB B;  1UNR A;  2UVM A;  3ZDT A;  4HB3 B;  1ZC4 B;  4HSI A;  2AL6 A;  2J59 M;  4GN1 A;  5D3Y A;  3KZ1 A;  1Y19 B;  5M4Y B;  3SO6 A;  2KUQ A;  2PZ1 A;  1DRO A;  4IFS A;  3ODO A;  5I2S A;  2LYD A;  1GG3 A;  4BBK A;  2YRY A;  4GMV A;  3P6A A;  2R2Y A;  4WSF A;  1BWN A;  3PZD A;  5CLQ B;  2KR0 A;  4DX8 A;  3IVF A;  1EF1 A;  2LKO A;  5FI0 A;  2GS0 A;  5D3X A;  3OHM B;  4HAT B;  1DBH A;  4HAX B;  1T77 A;  2MFQ A;  1IRS A;  2COC A;  3FVC A;  1OY2 A;  3D8E A;  4B6H A;  1MI1 A;  2ELB A;  1WG7 A;  5D3V A;  4CSQ A;  1WJ1 A;  1RJ2 A;  4K2P A;  2W2X C;  3CIK A;  4H8S A;  4KHO A;  5C6R A;  1UPQ A;  5IRS A;  1N3H A;  3T06 A;  1WJM A;  1BAK A;  1GC7 A;  2RRF A;  4CHM A;  1XD4 A;  2XQN M; 
#chains in the Genus database with same CATH homology
 4IAP A;  1TJ6 A;  2YVC A;  2DYQ A;  1FHW A;  4A6F A;  4TYZ A;  1B55 A;  4D0N B;  2MKR A;  3KRW A;  4XWX A;  1ZVR A;  4IOY X;  4MY6 A;  4C0A A;  2YF0 A;  1PLS A;  2DN6 A;  1UNP A;  2LG1 A;  1UEF A;  2IFS A;  2VSZ A;  1MKE A;  3WA0 A;  1MK7 B;  3A98 B;  1M7R A;  3GYO A;  2RSG A;  5HE3 A;  2GCJ A;  2GCL A;  2CY5 A;  4GMX B;  3ZVR A;  1ZM0 A;  3HQC A;  1RRP B;  3U8Z A;  5JHH A;  1V5U A;  1QQG A;  4K2O A;  1XR0 B;  2CRF A;  3G9W A;  1M7E A;  1J0W A;  3HW2 B;  5JP4 A;  1BTN A;  2FJL A;  2M14 A;  1WGQ A;  3ULC A;  4HB0 B;  2RVB B;  3PG7 A;  3OAN A;  2MDX A;  2J0M A;  4HAW B;  4CYE A;  2L1C A;  1V89 A;  3RCP A;  2D9Y A;  3AJ4 A;  3TFM A;  5HE1 A;  1I7A A;  2DX1 A;  1X86 A;  5D3W A;  2COF A;  2I5C A;  1WGU A;  2EJ8 A;  3V5W A;  2V76 A;  3FM8 C;  5LON B;  3FEH A;  3AU4 A;  2RGN B;  4TKN A;  1EGX A;  1X05 A;  1K5D B;  4EJN A;  5L81 A;  1FAO A;  4HHV A;  1Z87 A;  1U2B A;  5J3Q A;  2AEH A;  1MK9 B;  2MWN B;  1LB1 A;  1U5G A;  2Y7B A;  3LJU X;  2D9X A;  1MIX A;  1PMS A;  5C5B A;  1V61 A;  5DI9 B;  2EC1 A;  1V5M A;  2ELA A;  2KGX B;  1MIZ B;  3DXE A;  2DKP A;  5HE2 A;  2N23 A;  4HDO A;  2D2Q A;  2DYN A;  4EKU A;  4K81 A;  4Z2N A;  2R0D A;  1V5P A;  5EFX A;  2DLW A;  1DDV A;  1XKE A;  2H7D A;  2W2X D;  5HE0 A;  2Y8G A;  4ZRI A;  4A6H A;  2I1J A;  2CAY A;  2R09 A;  5LOP B;  3F0W A;  2QKL A;  2UZR A;  3QBV B;  2K00 A;  1EAZ A;  4MK0 A;  1U5F A;  1V88 A;  1W1D A;  2DFK A;  3HK0 A;  3SV1 A;  2ROV A;  1FHX A;  2I5F A;  2LOZ A;  2VKI A;  2YS5 A;  5D27 A;  2ZPY A;  5C5B B;  2COA A;  1H4R A;  4DXA B;  1FHO A;  1ZC3 B;  1P5T A;  2OQB A;  2L2I A;  1H10 A;  2YSZ A;  4DX9 0;  2P0D A;  3ODW A;  1WI1 A;  4HAZ B;  1XX0 A;  2E2X A;  3A8P A;  2D9Z A;  3ML4 A;  4NSW A;  4GPT B;  2D9V A;  1SGH A;  1FOE A;  4CHJ A;  4F7G A;  4F7H A;  3N7C A;  3SUZ A;  1X1F A;  5DHF B;  1SHC A;  4ZRJ A;  1Y5O A;  2RNR B;  5KQ4 A;  1DYN A;  1XCG A;  2G35 A;  4GXB A;  5KCV A;  1FGY A;  1W1H A;  2X18 A;  5J3Y A;  4EMO A;  4MT7 A;  4DBB A;  2J0K A;  2IYB A;  1J19 A;  1FB8 A;  2GJY A;  2M38 A;  1OMW A;  3FSS A;  5JLJ B;  3PSC A;  3O96 A;  2COD A;  2D11 A;  4PQ0 A;  1AWE A;  1E5W A;  4YON A;  2Z0P A;  2HTH B;  3KY9 A;  3QWM A;  4HB4 B;  3GYP A;  2Y8F A;  1WVH A;  5GOW B;  2JP2 A;  3PEG A;  2LOX A;  2DX5 A;  4GZU A;  2NMB A;  2YT1 A;  2UZS A;  1AQC A;  2DHJ A;  3PP2 A;  1FGZ A;  1NTV A;  2D9W A;  1KI1 B;  1TXD A;  2DHK A;  3F5R A;  4PNK A;  3BIN A;  4KVG B;  3ULB A;  1U27 A;  1LW3 A;  4WVF B;  3VOQ A;  5DIF B;  1U5E A;  2KUP A;  2Q13 A;  2Z0Q A;  5FI1 A;  2I1K A;  3X23 A;  3SNH A;  3UZT A;  2N0Y A;  2K2J A;  1K5G B;  1KZG A;  2CY4 A;  2RUK B;  1OQN A;  1U29 A;  1NTY A;  1UPR A;  1MPH A;  1BTK A;  3D8D A;  5C16 A;  1P3R A;  4NY0 A;  4HAY B;  4F7U P;  3PVU A;  2EMT A;  2P0H A;  2DTC A;  2ROZ B;  4HAV B;  4KHB B;  4HAU B;  2Z0O A;  3PVL A;  3MDB C;  4Z2M B;  4L6E A;  2RLO A;  5CLL B;  3KRX A;  1DDW A;  1U5D A;  5DHA B;  2D10 A;  3M1I B;  2KCJ A;  3TCA A;  3QIJ A;  4HDQ A;  1P6S A;  4A6F B;  1NI2 A;  1ISN A;  4K17 A;  3NSU A;  3DXC A;  3PVW A;  4YL8 A;  2D4Q A;  3WYF B;  4P7I A;  1DDM A;  4KAX B;  3BJI A;  2DA0 A;  3TVV A;  4HB2 B;  2NZ8 B;  4ZRK A;  2YS3 A;  1KZ7 A;  1PFJ A;  2K2U A;  4A6K A;  1QC6 A;  3A8Q A;  3ODX A;  2HE7 A;  1Q67 A;  2DKQ A;  2ADZ A;  4A5K A;  3KSY A;  2J0J A;  5KQ1 A;  3VIA A;  3AU5 A;  1TQZ A;  3P7Z A;  1XOD A;  4WJ7 A;  5JHG A;  1W1G A;  5DH9 B;  1UNQ A;  1GC6 A;  2OTX A;  2QKM A;  4KHA A;  1MAI A;  2BCJ A;  3TW1 A;  2P8V A;  2H7E A;  3U7D A;  1EVH A;  1X1G A;  1X11 A;  5J3T A;  3MPX A;  2EMS A;  3TO1 A;  5C79 A;  2DHI A;  2W2W A;  2VRW B;  3DXD A;  2YS1 A;  3SYX A;  2YT0 A;  2LUL A;  3D8F A;  1ZSQ A;  1NU2 A;  2P0F A;  4Y94 A;  1I2H A;  3CXB B;  1UNR A;  2UVM A;  3ZDT A;  4HB3 B;  1ZC4 B;  2AL6 A;  2J59 M;  4GN1 A;  5D3Y A;  3KZ1 A;  1Y19 B;  3SO6 A;  2PZ1 A;  1DRO A;  4IFS A;  3ODO A;  2LYD A;  1GG3 A;  4BBK A;  2YRY A;  4GMV A;  3P6A A;  4WSF A;  1BWN A;  3PZD A;  5CLQ B;  4DX8 A;  3IVF A;  1EF1 A;  2LKO A;  5FI0 A;  2GS0 A;  5D3X A;  4HAT B;  1DBH A;  4HAX B;  2MFQ A;  1IRS A;  2COC A;  1OY2 A;  3D8E A;  4B6H A;  2ELB A;  1WG7 A;  5D3V A;  1WJ1 A;  1RJ2 A;  4K2P A;  2W2X C;  3CIK A;  4H8S A;  4KHO A;  5C6R A;  1UPQ A;  1N3H A;  3T06 A;  1WJM A;  1BAK A;  1GC7 A;  4CHM A;  1XD4 A;  2XQN M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...