4L6EA

Crystal structure of the ranbd1 fourth domain of e3 sumo-protein ligase ranbp2. northeast structural genomics consortium (nesg) target hr9193b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
SGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the RanBD1 fourth domain of E3 SUMO-protein ligase RanBP2.
rcsb
source organism Homo sapiens
molecule tags Ligase, isomerase
molecule keywords E3 SUMO-protein ligase RanBP2
total genus 29
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4l6eA00
2DX5A 2VSZA 2LOXA 1TJ6A 1GG3A 1NTVA 1U27A 2YRYA 3BJIA 2X18A 4H8SA 5HE2A 3ZVRA 1I7AA 2L2IA 2YSZA 2P0FA 4CHMA 2DTCA 3PVUA 3UZTA 5D3YA 5DI9B 1WG7A 1V89A 1I2HA 2GJYA 5D27A 4EKUA 1M7RA 1UNQA 4HB2B 2N0YA 3ULCA 3PVWA 4HAWB 2EMTA 2W2XD 1PLSA 4TYZA 4WJ7A 1FOEA 4GN1A 4Y94A 1FHXA 2J0MA 2DHIA 1AQCA 2COFA 2EMSA 2W2WA 1DBHA 1SHCA 2DKQA 3MPXA 2YS3A 5KQ1A 3ODOA 3ULBA 4A6FB 5JHGA 1ISNA 1UNPA 4HDQA 1KZGA 1FGZA 1V88A 3PVLA 2R09A 2DYNA 3TFMA 2DHJA 3D8EA 2G35A 1UNRA 5FI1A 4KVGB 5KCVA 4A6HA 2MWNB 2IFSA 2IYBA 2QKMA 2UZSA 4L6EA 3SV1A 3AJ4A 5J3YA 1W1DA 4DX8A 4ZRIA 5C5BA 2KCJA 3FM8C 3U7DA 2MKRA 2OTXA 1FHWA 1MIXA 4CHJA 2D2QA 3X23A 2J0KA 3TCAA 4B6HA 1IRSA 2D9YA 2ROZB 3FEHA 2VKIA 4NY0A 4CYEA 1EVHA 2LOZA 2GCLA 2M14A 4EJNA 4MY6A 1P3RA 2YT0A 2CY5A 1LB1A 1K5GB 4HB4B 3AU5A 1U5FA 4IAPA 4D0NB 3PZDA 2GS0A 1XD4A 5LOPB 1KZ7A 2ROVA 2Y7BA 4KHAA 2XQNM 3V5WA 4F7GA 2AL6A 5C79A 4DXAB 3NSUA 4HAYB 2DA0A 3O96A 2HE7A 1BTKA 2I5FA 1WGUA 2LKOA 2E2XA 2Z0QA 3ML4A 1SGHA 4ZRKA 1GC6A 3HW2B 4F7UP 2RLOA 2LULA 3N7CA 1OQNA 1WVHA 3A98B 4P7IA 1AWEA 2YF0A 2RNRB 5FI0A 3RCPA 2BCJA 1DROA 2COCA 3KRWA 2D11A 5C5BB 5LONB 1PFJA 1XKEA 1X1FA 1EAZA 2RVBB 1WJMA 2EC1A 5JP4A 2CY4A 3ODXA 2RGNB 4HAZB 1ZC3B 2COAA 1GC7A 5D3WA 1U5EA 3KZ1A 4GMVA 3ODWA 4GMXB 5J3QA 1ZSQA 2I1KA 3KY9A 4TKNA 1W1HA 1XX0A 2ELAA 1ZVRA 3D8DA 4K2PA 2Y8GA 2DKPA 2VRWB 3CIKA 4XWXA 5C16A 1MK9B 4A6FA 2YT1A 4YONA 3IVFA 1MIZB 1W1GA 4KHBB 4EMOA 2N23A 2YS1A 4HB3B 1Q67A 2QKLA 3LJUX 2ELBA 2P8VA 3VIAA 3PG7A 1Y5OA 4HAUB 2H7EA 2MFQA 3WA0A 2NZ8B 3F5RA 2Y8FA 5HE3A 3OANA 3U8ZA 5D3XA 3QIJA 1NI2A 4A5KA 4KAXB 1Z87A 3DXDA 1J0WA 3PP2A 4YL8A 1RRPB 4ZRJA 4GZUA 4Z2MB 1QC6A 2J0JA 3ZDTA 3G9WA 1U5GA 1UEFA 2D9WA 2UVMA 5EFXA 2UZRA 2CAYA 4A6KA 2PZ1A 3CXBB 1B55A 1FGYA 3GYOA 3SYXA 3AU4A 1X1GA 4K2OA 2OQBA 1LW3A 2GCJA 2JP2A 2D9VA 4MT7A 2I5CA 1P5TA 1MPHA 3A8PA 4MK0A 3M1IB 2H7DA 1ZC4B 1XR0B 5JLJB 2CRFA 5KQ4A 1X05A 1XCGA 3HQCA 5DHFB 3DXEA 3KSYA 1QQGA 3SUZA 1V5MA 3TVVA 1K5DB 1NTYA 3BINA 1WGQA 2D9ZA 1EF1A 2W2XC 1P6SA 5D3VA 1NU2A 2P0DA 2ADZA 5C6RA 4IFSA 1FAOA 4PQ0A 4HB0B 1Y19B 3TW1A 2DFKA 2CODA 3VOQA 2DX1A 1MK7B 3TO1A 3PEGA 4GXBA 2MDXA 3F0WA 1DDMA 1J19A 1UPQA 1RJ2A 4Z2NA 1UPRA 3WYFB 2D10A 3P6AA 1XODA 5J3TA 1MKEA 1U2BA 2J59M 4DBBA 1N3HA 4K81A 2R0DA 2YS5A 2Z0OA 4K17A 1V5PA 2K2JA 2DHKA 2D9XA 1FHOA 4C0AA 5CLQB 3KRXA 4IOYX 1DDWA 3SNHA 2YVCA 2Q13A 4HAVB 2KUPA 4WVFB 2KGXB 1X86A 1OMWA 5DIFB 4F7HA 2NMBA 2FJLA 3QBVB 3FSSA 2RUKB 4PNKA 4NSWA 3GYPA 5HE1A 1FB8A 2P0HA 4HATB 3SO6A 5GOWB 4DX90 1E5WA 2RSGA 3DXCA 3QWMA 1OY2A 4HDOA 2DYQA 5L81A 1EGXA 1U5DA 2ZPYA 1WJ1A 1BAKA 2LG1A 4HHVA 1H10A 2AEHA 5CLLB 2K2UA 1BTNA 3A8QA 3HK0A 1X11A 4GPTB 4KHOA 2D4QA 1MAIA 5DHAB 2L1CA 1H4RA 3PSCA 2EJ8A 5HE0A 2LYDA 1ZM0A 1WI1A 2DN6A 4WSFA 2DLWA 1M7EA 4BBKA 2Z0PA 1PMSA 2V76A 3MDBC 5JHHA 1KI1B 3T06A 5DH9B 1U29A 1DYNA 1TQZA 1DDVA 1V5UA 3P7ZA 2K00A 4HAXB 3D8FA 1TXDA 1BWNA 1V61A 2I1JA 2M38A 2HTHB
chains in the Genus database with same CATH superfamily
2DX5A 2VSZA 2LOXA 1TJ6A 1GG3A 1NTVA 1U27A 3HSAA 2YRYA 3BJIA 2X18A 4H8SA 5HE2A 3ZVRA 1I7AA 2L2IA 2YSZA 2P0FA 4CHMA 2DTCA 3PVUA 3UZTA 5D3YA 5DI9B 1WG7A 1V89A 1I2HA 2GJYA 5D27A 4EKUA 1M7RA 2FJUB 1UNQA 4HB2B 2N0YA 3ULCA 3PVWA 4HAWB 2EMTA 2W2XD 1PLSA 4TYZA 4WJ7A 1FOEA 4GN1A 4Y94A 1FHXA 2J0MA 2DHIA 1AQCA 2COFA 2EMSA 2W2WA 1DBHA 1SHCA 2DKQA 3NWAA 3MPXA 2YS3A 5KQ1A 3ODOA 3ULBA 4A6FB 5JHGA 1ISNA 1UNPA 4HDQA 1KZGA 1FGZA 1V88A 3PVLA 2R09A 2DYNA 3TFMA 5IRSA 2DHJA 3D8EA 2G35A 1UNRA 5FI1A 5M4YB 4KVGB 5KCVA 4A6HA 2MWNB 5LG4B 2IFSA 2IYBA 2QKMA 2UZSA 4L6EA 3SV1A 3AJ4A 5J3YA 1ZYIA 1W1DA 4DX8A 4ZRIA 5C5BA 2KCJA 3NW8A 1MI1A 3FM8C 3U7DA 2MKRA 2OTXA 1FHWA 1MIXA 4CHJA 2D2QA 3X23A 2J0KA 2K8EA 3TCAA 4B6HA 1IRSA 2D9YA 2ROZB 3FEHA 2VKIA 4NY0A 4CYEA 1EVHA 2LOZA 2GCLA 2M14A 4EJNA 4MY6A 1P3RA 4HSIA 2YT0A 2CY5A 1LB1A 1K5GB 3AU5A 4HB4B 1U5FA 4IAPA 4D0NB 3PZDA 2GS0A 1XD4A 5LOPB 1KZ7A 2ROVA 2Y7BA 4KHAA 2XQNM 3V5WA 4F7GA 2AL6A 5C79A 4DXAB 3U12A 3NSUA 2NBVA 4HAYB 2K49A 2DA0A 3O96A 2HE7A 4QXAB 5I2SA 1BTKA 2I5FA 1WGUA 2LKOA 2Z14A 2E2XA 2Z0QA 3ML4A 1SGHA 4ZRKA 1GC6A 3HW2B 4F7UP 2RLOA 2LULA 3N7CA 1OQNA 1WVHA 3A98B 4P7IA 1AWEA 3DCXA 2YF0A 4CSQA 2RNRB 5FI0A 3RCPA 4GOUA 2BCJA 1DROA 2COCA 2KR0A 3KRWA 2D11A 5C5BB 5LONB 2KUQA 1PFJA 1XKEA 1X1FA 1EAZA 2RVBB 1WJMA 2EC1A 5JP4A 2CY4A 3ODXA 2Z4DA 2RGNB 4HAZB 1ZC3B 2COAA 1GC7A 5D3WA 1U5EA 3KZ1A 4GMVA 3ODWA 4GMXB 5J3QA 1ZSQA 2I1KA 3KY9A 4TKNA 1W1HA 1XX0A 4OSNA 2ELAA 1ZVRA 3D8DA 4K2PA 2Y8GA 2DKPA 2VRWB 3CIKA 4XWXA 5C16A 1MK9B 4A6FA 2YT1A 4YONA 3IVFA 1MIZB 1W1GA 4KHBB 4EMOA 2R2YA 2N23A 2YS1A 4HB3B 1Q67A 2QKLA 3LJUX 2ELBA 2P8VA 3VIAA 3PG7A 1Y5OA 4HAUB 2H7EA 2MFQA 3WA0A 2NZ8B 3F5RA 2Y8FA 5HE3A 3OANA 3U8ZA 5D3XA 3QIJA 1NI2A 4A5KA 4KAXB 1Z87A 3DXDA 1J0WA 3FVCA 3PP2A 4YL8A 1RRPB 4ZRJA 4GZUA 4Z2MB 1QC6A 2J0JA 3ZDTA 3G9WA 3NWFA 1U5GA 1UEFA 2D9WA 5I2MA 2UVMA 5EFXA 2UZRA 2CAYA 4A6KA 2PZ1A 3CXBB 1B55A 1FGYA 3GYOA 3SYXA 3AU4A 1X1GA 2KIGA 4K2OA 2OQBA 1LW3A 2GCJA 2JP2A 2D9VA 4MT7A 2I5CA 1P5TA 1MPHA 3A8PA 4MK0A 3M1IB 2H7DA 1ZC4B 1XR0B 4DIXA 2CRFA 5JLJB 5KQ4A 1X05A 1XCGA 3HQCA 4L1RA 5DHFB 3DXEA 3KSYA 1QQGA 3SUZA 1V5MA 4KHBA 3TVVA 1K5DB 1NTYA 3BINA 1WGQA 2D9ZA 1EF1A 2W2XC 1P6SA 3A58A 5D3VA 1NU2A 2P0DA 2ADZA 2ZKMX 4QJ4B 5C6RA 4IFSA 4QJ5B 1FAOA 4PQ0A 4HB0B 3B77A 1Y19B 3TW1A 2DFKA 2CODA 3VOQA 2DX1A 2KIEA 1MK7B 3TO1A 3PEGA 4OT1A 4GXBA 2MDXA 3F0WA 1DDMA 1J19A 1UPQA 1RJ2A 4Z2NA 1UPRA 3WYFB 3HIEA 2D10A 3P6AA 1XODA 5J3TA 1MKEA 1U2BA 2J59M 2YT2A 4DBBA 1N3HA 4K81A 2R0DA 2YS5A 2Z0OA 3NWDA 4K17A 1V5PA 2K2JA 2DHKA 2D9XA 1FHOA 4C0AA 5CLQB 3KRXA 4IOYX 1DDWA 4QJ3B 3SNHA 2YVCA 2Q13A 1T77A 2KUPA 4HAVB 4WVFB 2KGXB 1X86A 1OMWA 5DIFB 4F7HA 2NMBA 2FJLA 3QBVB 3FSSA 2RUKB 4PNKA 4NSWA 3GYPA 5HE1A 1FB8A 2P0HA 4HATB 3SO6A 5GOWB 4DX90 1E5WA 2RSGA 3DXCA 2Z13A 3QWMA 2RRFA 4D6WA 1OY2A 4HDOA 2DYQA 5L81A 1EGXA 1U5DA 2ZPYA 1WJ1A 1BAKA 2LG1A 4HHVA 1H10A 2AEHA 5CLLB 2K2UA 1BTNA 3OHMB 3A8QA 3HK0A 1X11A 4GPTB 4KHOA 2D4QA 1MAIA 5DHAB 2L1CA 1H4RA 3PSCA 2EJ8A 5HE0A 2LYDA 1ZM0A 1WI1A 2DN6A 4WSFA 2DLWA 1M7EA 4GNKB 4BBKA 2Z0PA 1PMSA 2V76A 3MDBC 5JHHA 1KI1B 3T06A 5DH9B 1U29A 1DYNA 1TQZA 1DDVA 2GUMA 1V5UA 3P7ZA 2K00A 4HAXB 3D8FA 1TXDA 1BWNA 1V61A 2Z59A 2I1JA 2M38A 2HTHB
chains in the Genus database with same CATH topology
2DX5A 2VSZA 2LOXA 1TJ6A 1GG3A 1NTVA 1U27A 2YRYA 3BJIA 2X18A 4H8SA 5HE2A 3ZVRA 1I7AA 2L2IA 2YSZA 2P0FA 4CHMA 2DTCA 3PVUA 3UZTA 5D3YA 5DI9B 1WG7A 1V89A 1I2HA 2GJYA 5D27A 4EKUA 1M7RA 1UNQA 4HB2B 2N0YA 3ULCA 3PVWA 4HAWB 2EMTA 2W2XD 1PLSA 4TYZA 4WJ7A 1FOEA 4GN1A 4Y94A 1FHXA 2J0MA 2DHIA 1AQCA 2COFA 2EMSA 2W2WA 1DBHA 1SHCA 2DKQA 3MPXA 2YS3A 5KQ1A 3ODOA 3ULBA 4A6FB 5JHGA 1ISNA 1UNPA 4HDQA 1KZGA 1FGZA 1V88A 3PVLA 2R09A 2DYNA 3TFMA 2DHJA 3D8EA 2G35A 1UNRA 5FI1A 4KVGB 5KCVA 4A6HA 2MWNB 2IFSA 2IYBA 2QKMA 2UZSA 4L6EA 3SV1A 3AJ4A 5J3YA 1W1DA 4DX8A 4ZRIA 5C5BA 2KCJA 3FM8C 3U7DA 2MKRA 2OTXA 1FHWA 1MIXA 4CHJA 2D2QA 3X23A 2J0KA 3TCAA 4B6HA 1IRSA 2D9YA 2ROZB 3FEHA 2VKIA 4NY0A 4CYEA 1EVHA 2LOZA 2GCLA 2M14A 4EJNA 4MY6A 1P3RA 2YT0A 2CY5A 1LB1A 1K5GB 4HB4B 3AU5A 1U5FA 4IAPA 4D0NB 3PZDA 2GS0A 1XD4A 5LOPB 1KZ7A 2ROVA 2Y7BA 4KHAA 2XQNM 3V5WA 4F7GA 2AL6A 5C79A 4DXAB 3NSUA 4HAYB 2DA0A 3O96A 2HE7A 1BTKA 2I5FA 1WGUA 2LKOA 2E2XA 2Z0QA 3ML4A 1SGHA 4ZRKA 1GC6A 3HW2B 4F7UP 2RLOA 2LULA 3N7CA 1OQNA 1WVHA 3A98B 4P7IA 1AWEA 2YF0A 2RNRB 5FI0A 3RCPA 2BCJA 1DROA 2COCA 3KRWA 2D11A 5C5BB 5LONB 1PFJA 1XKEA 1X1FA 1EAZA 2RVBB 1WJMA 2EC1A 5JP4A 2CY4A 3ODXA 2RGNB 4HAZB 1ZC3B 2COAA 1GC7A 5D3WA 1U5EA 3KZ1A 4GMVA 3ODWA 4GMXB 5J3QA 1ZSQA 2I1KA 3KY9A 4TKNA 1W1HA 1XX0A 2ELAA 1ZVRA 3D8DA 4K2PA 2Y8GA 2DKPA 2VRWB 3CIKA 4XWXA 5C16A 1MK9B 4A6FA 2YT1A 4YONA 3IVFA 1MIZB 1W1GA 4KHBB 4EMOA 2N23A 2YS1A 4HB3B 1Q67A 2QKLA 3LJUX 2ELBA 2P8VA 3VIAA 3PG7A 1Y5OA 4HAUB 2H7EA 2MFQA 3WA0A 2NZ8B 3F5RA 2Y8FA 5HE3A 3OANA 3U8ZA 5D3XA 3QIJA 1NI2A 4A5KA 4KAXB 1Z87A 3DXDA 1J0WA 3PP2A 4YL8A 1RRPB 4ZRJA 4GZUA 4Z2MB 1QC6A 2J0JA 3ZDTA 3G9WA 1U5GA 1UEFA 2D9WA 2UVMA 5EFXA 2UZRA 2CAYA 4A6KA 2PZ1A 3CXBB 1B55A 1FGYA 3GYOA 3SYXA 3AU4A 1X1GA 4K2OA 2OQBA 1LW3A 2GCJA 2JP2A 2D9VA 4MT7A 2I5CA 1P5TA 1MPHA 3A8PA 4MK0A 3M1IB 2H7DA 1ZC4B 1XR0B 5JLJB 2CRFA 5KQ4A 1X05A 1XCGA 3HQCA 5DHFB 3DXEA 3KSYA 1QQGA 3SUZA 1V5MA 3TVVA 1K5DB 1NTYA 3BINA 1WGQA 2D9ZA 1EF1A 2W2XC 1P6SA 5D3VA 1NU2A 2P0DA 2ADZA 5C6RA 4IFSA 1FAOA 4PQ0A 4HB0B 1Y19B 3TW1A 2DFKA 2CODA 3VOQA 2DX1A 1MK7B 3TO1A 3PEGA 4GXBA 2MDXA 3F0WA 1DDMA 1J19A 1UPQA 1RJ2A 4Z2NA 1UPRA 3WYFB 2D10A 3P6AA 1XODA 5J3TA 1MKEA 1U2BA 2J59M 4DBBA 1N3HA 4K81A 2R0DA 2YS5A 2Z0OA 4K17A 1V5PA 2K2JA 2DHKA 2D9XA 1FHOA 4C0AA 5CLQB 3KRXA 4IOYX 1DDWA 3SNHA 2YVCA 2Q13A 4HAVB 2KUPA 4WVFB 2KGXB 1X86A 1OMWA 5DIFB 4F7HA 2NMBA 2FJLA 3QBVB 3FSSA 2RUKB 4PNKA 4NSWA 3GYPA 5HE1A 1FB8A 2P0HA 4HATB 3SO6A 5GOWB 4DX90 1E5WA 2RSGA 3DXCA 3QWMA 1OY2A 4HDOA 2DYQA 5L81A 1EGXA 1U5DA 2ZPYA 1WJ1A 1BAKA 2LG1A 4HHVA 1H10A 2AEHA 5CLLB 2K2UA 1BTNA 3A8QA 3HK0A 1X11A 4GPTB 4KHOA 2D4QA 1MAIA 5DHAB 2L1CA 1H4RA 3PSCA 2EJ8A 5HE0A 2LYDA 1ZM0A 1WI1A 2DN6A 4WSFA 2DLWA 1M7EA 4BBKA 2Z0PA 1PMSA 2V76A 3MDBC 5JHHA 1KI1B 3T06A 5DH9B 1U29A 1DYNA 1TQZA 1DDVA 1V5UA 3P7ZA 2K00A 4HAXB 3D8FA 1TXDA 1BWNA 1V61A 2I1JA 2M38A 2HTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX5 A;  2VSZ A;  2LOX A;  1TJ6 A;  1GG3 A;  1NTV A;  1U27 A;  2YRY A;  3BJI A;  2X18 A;  4H8S A;  5HE2 A;  3ZVR A;  1I7A A;  2L2I A;  2YSZ A;  2P0F A;  4CHM A;  2DTC A;  3PVU A;  3UZT A;  5D3Y A;  5DI9 B;  1WG7 A;  1V89 A;  1I2H A;  2GJY A;  5D27 A;  4EKU A;  1M7R A;  1UNQ A;  4HB2 B;  2N0Y A;  3ULC A;  3PVW A;  4HAW B;  2EMT A;  2W2X D;  1PLS A;  4TYZ A;  4WJ7 A;  1FOE A;  4GN1 A;  4Y94 A;  1FHX A;  2J0M A;  2DHI A;  1AQC A;  2COF A;  2EMS A;  2W2W A;  1DBH A;  1SHC A;  2DKQ A;  3MPX A;  2YS3 A;  5KQ1 A;  3ODO A;  3ULB A;  4A6F B;  5JHG A;  1ISN A;  1UNP A;  4HDQ A;  1KZG A;  1FGZ A;  1V88 A;  3PVL A;  2R09 A;  2DYN A;  3TFM A;  2DHJ A;  3D8E A;  2G35 A;  1UNR A;  5FI1 A;  4KVG B;  5KCV A;  4A6H A;  2MWN B;  2IFS A;  2IYB A;  2QKM A;  2UZS A;  4L6E A;  3SV1 A;  3AJ4 A;  5J3Y A;  1W1D A;  4DX8 A;  4ZRI A;  5C5B A;  2KCJ A;  3FM8 C;  3U7D A;  2MKR A;  2OTX A;  1FHW A;  1MIX A;  4CHJ A;  2D2Q A;  3X23 A;  2J0K A;  3TCA A;  4B6H A;  1IRS A;  2D9Y A;  2ROZ B;  3FEH A;  2VKI A;  4NY0 A;  4CYE A;  1EVH A;  2LOZ A;  2GCL A;  2M14 A;  4EJN A;  4MY6 A;  1P3R A;  2YT0 A;  2CY5 A;  1LB1 A;  1K5G B;  4HB4 B;  3AU5 A;  1U5F A;  4IAP A;  4D0N B;  3PZD A;  2GS0 A;  1XD4 A;  5LOP B;  1KZ7 A;  2ROV A;  2Y7B A;  4KHA A;  2XQN M;  3V5W A;  4F7G A;  2AL6 A;  5C79 A;  4DXA B;  3NSU A;  4HAY B;  2DA0 A;  3O96 A;  2HE7 A;  1BTK A;  2I5F A;  1WGU A;  2LKO A;  2E2X A;  2Z0Q A;  3ML4 A;  1SGH A;  4ZRK A;  1GC6 A;  3HW2 B;  4F7U P;  2RLO A;  2LUL A;  3N7C A;  1OQN A;  1WVH A;  3A98 B;  4P7I A;  1AWE A;  2YF0 A;  2RNR B;  5FI0 A;  3RCP A;  2BCJ A;  1DRO A;  2COC A;  3KRW A;  2D11 A;  5C5B B;  5LON B;  1PFJ A;  1XKE A;  1X1F A;  1EAZ A;  2RVB B;  1WJM A;  2EC1 A;  5JP4 A;  2CY4 A;  3ODX A;  2RGN B;  4HAZ B;  1ZC3 B;  2COA A;  1GC7 A;  5D3W A;  1U5E A;  3KZ1 A;  4GMV A;  3ODW A;  4GMX B;  5J3Q A;  1ZSQ A;  2I1K A;  3KY9 A;  4TKN A;  1W1H A;  1XX0 A;  2ELA A;  1ZVR A;  3D8D A;  4K2P A;  2Y8G A;  2DKP A;  2VRW B;  3CIK A;  4XWX A;  5C16 A;  1MK9 B;  4A6F A;  2YT1 A;  4YON A;  3IVF A;  1MIZ B;  1W1G A;  4KHB B;  4EMO A;  2N23 A;  2YS1 A;  4HB3 B;  1Q67 A;  2QKL A;  3LJU X;  2ELB A;  2P8V A;  3VIA A;  3PG7 A;  1Y5O A;  4HAU B;  2H7E A;  2MFQ A;  3WA0 A;  2NZ8 B;  3F5R A;  2Y8F A;  5HE3 A;  3OAN A;  3U8Z A;  5D3X A;  3QIJ A;  1NI2 A;  4A5K A;  4KAX B;  1Z87 A;  3DXD A;  1J0W A;  3PP2 A;  4YL8 A;  1RRP B;  4ZRJ A;  4GZU A;  4Z2M B;  1QC6 A;  2J0J A;  3ZDT A;  3G9W A;  1U5G A;  1UEF A;  2D9W A;  2UVM A;  5EFX A;  2UZR A;  2CAY A;  4A6K A;  2PZ1 A;  3CXB B;  1B55 A;  1FGY A;  3GYO A;  3SYX A;  3AU4 A;  1X1G A;  4K2O A;  2OQB A;  1LW3 A;  2GCJ A;  2JP2 A;  2D9V A;  4MT7 A;  2I5C A;  1P5T A;  1MPH A;  3A8P A;  4MK0 A;  3M1I B;  2H7D A;  1ZC4 B;  1XR0 B;  5JLJ B;  2CRF A;  5KQ4 A;  1X05 A;  1XCG A;  3HQC A;  5DHF B;  3DXE A;  3KSY A;  1QQG A;  3SUZ A;  1V5M A;  3TVV A;  1K5D B;  1NTY A;  3BIN A;  1WGQ A;  2D9Z A;  1EF1 A;  2W2X C;  1P6S A;  5D3V A;  1NU2 A;  2P0D A;  2ADZ A;  5C6R A;  4IFS A;  1FAO A;  4PQ0 A;  4HB0 B;  1Y19 B;  3TW1 A;  2DFK A;  2COD A;  3VOQ A;  2DX1 A;  1MK7 B;  3TO1 A;  3PEG A;  4GXB A;  2MDX A;  3F0W A;  1DDM A;  1J19 A;  1UPQ A;  1RJ2 A;  4Z2N A;  1UPR A;  3WYF B;  2D10 A;  3P6A A;  1XOD A;  5J3T A;  1MKE A;  1U2B A;  2J59 M;  4DBB A;  1N3H A;  4K81 A;  2R0D A;  2YS5 A;  2Z0O A;  4K17 A;  1V5P A;  2K2J A;  2DHK A;  2D9X A;  1FHO A;  4C0A A;  5CLQ B;  3KRX A;  4IOY X;  1DDW A;  3SNH A;  2YVC A;  2Q13 A;  4HAV B;  2KUP A;  4WVF B;  2KGX B;  1X86 A;  1OMW A;  5DIF B;  4F7H A;  2NMB A;  2FJL A;  3QBV B;  3FSS A;  2RUK B;  4PNK A;  4NSW A;  3GYP A;  5HE1 A;  1FB8 A;  2P0H A;  4HAT B;  3SO6 A;  5GOW B;  4DX9 0;  1E5W A;  2RSG A;  3DXC A;  3QWM A;  1OY2 A;  4HDO A;  2DYQ A;  5L81 A;  1EGX A;  1U5D A;  2ZPY A;  1WJ1 A;  1BAK A;  2LG1 A;  4HHV A;  1H10 A;  2AEH A;  5CLL B;  2K2U A;  1BTN A;  3A8Q A;  3HK0 A;  1X11 A;  4GPT B;  4KHO A;  2D4Q A;  1MAI A;  5DHA B;  2L1C A;  1H4R A;  3PSC A;  2EJ8 A;  5HE0 A;  2LYD A;  1ZM0 A;  1WI1 A;  2DN6 A;  4WSF A;  2DLW A;  1M7E A;  4BBK A;  2Z0P A;  1PMS A;  2V76 A;  3MDB C;  5JHH A;  1KI1 B;  3T06 A;  5DH9 B;  1U29 A;  1DYN A;  1TQZ A;  1DDV A;  1V5U A;  3P7Z A;  2K00 A;  4HAX B;  3D8F A;  1TXD A;  1BWN A;  1V61 A;  2I1J A;  2M38 A;  2HTH B; 
#chains in the Genus database with same CATH topology
 2DX5 A;  2VSZ A;  2LOX A;  1TJ6 A;  1GG3 A;  1NTV A;  1U27 A;  3HSA A;  2YRY A;  3BJI A;  2X18 A;  4H8S A;  5HE2 A;  3ZVR A;  1I7A A;  2L2I A;  2YSZ A;  2P0F A;  4CHM A;  2DTC A;  3PVU A;  3UZT A;  5D3Y A;  5DI9 B;  1WG7 A;  1V89 A;  1I2H A;  2GJY A;  5D27 A;  4EKU A;  1M7R A;  2FJU B;  1UNQ A;  4HB2 B;  2N0Y A;  3ULC A;  3PVW A;  4HAW B;  2EMT A;  2W2X D;  1PLS A;  4TYZ A;  4WJ7 A;  1FOE A;  4GN1 A;  4Y94 A;  1FHX A;  2J0M A;  2DHI A;  1AQC A;  2COF A;  2EMS A;  2W2W A;  1DBH A;  1SHC A;  2DKQ A;  3NWA A;  3MPX A;  2YS3 A;  5KQ1 A;  3ODO A;  3ULB A;  4A6F B;  5JHG A;  1ISN A;  1UNP A;  4HDQ A;  1KZG A;  1FGZ A;  1V88 A;  3PVL A;  2R09 A;  2DYN A;  3TFM A;  5IRS A;  2DHJ A;  3D8E A;  2G35 A;  1UNR A;  5FI1 A;  5M4Y B;  4KVG B;  5KCV A;  4A6H A;  2MWN B;  5LG4 B;  2IFS A;  2IYB A;  2QKM A;  2UZS A;  4L6E A;  3SV1 A;  3AJ4 A;  5J3Y A;  1ZYI A;  1W1D A;  4DX8 A;  4ZRI A;  5C5B A;  2KCJ A;  3NW8 A;  1MI1 A;  3FM8 C;  3U7D A;  2MKR A;  2OTX A;  1FHW A;  1MIX A;  4CHJ A;  2D2Q A;  3X23 A;  2J0K A;  2K8E A;  3TCA A;  4B6H A;  1IRS A;  2D9Y A;  2ROZ B;  3FEH A;  2VKI A;  4NY0 A;  4CYE A;  1EVH A;  2LOZ A;  2GCL A;  2M14 A;  4EJN A;  4MY6 A;  1P3R A;  4HSI A;  2YT0 A;  2CY5 A;  1LB1 A;  1K5G B;  3AU5 A;  4HB4 B;  1U5F A;  4IAP A;  4D0N B;  3PZD A;  2GS0 A;  1XD4 A;  5LOP B;  1KZ7 A;  2ROV A;  2Y7B A;  4KHA A;  2XQN M;  3V5W A;  4F7G A;  2AL6 A;  5C79 A;  4DXA B;  3U12 A;  3NSU A;  2NBV A;  4HAY B;  2K49 A;  2DA0 A;  3O96 A;  2HE7 A;  4QXA B;  5I2S A;  1BTK A;  2I5F A;  1WGU A;  2LKO A;  2Z14 A;  2E2X A;  2Z0Q A;  3ML4 A;  1SGH A;  4ZRK A;  1GC6 A;  3HW2 B;  4F7U P;  2RLO A;  2LUL A;  3N7C A;  1OQN A;  1WVH A;  3A98 B;  4P7I A;  1AWE A;  3DCX A;  2YF0 A;  4CSQ A;  2RNR B;  5FI0 A;  3RCP A;  4GOU A;  2BCJ A;  1DRO A;  2COC A;  2KR0 A;  3KRW A;  2D11 A;  5C5B B;  5LON B;  2KUQ A;  1PFJ A;  1XKE A;  1X1F A;  1EAZ A;  2RVB B;  1WJM A;  2EC1 A;  5JP4 A;  2CY4 A;  3ODX A;  2Z4D A;  2RGN B;  4HAZ B;  1ZC3 B;  2COA A;  1GC7 A;  5D3W A;  1U5E A;  3KZ1 A;  4GMV A;  3ODW A;  4GMX B;  5J3Q A;  1ZSQ A;  2I1K A;  3KY9 A;  4TKN A;  1W1H A;  1XX0 A;  4OSN A;  2ELA A;  1ZVR A;  3D8D A;  4K2P A;  2Y8G A;  2DKP A;  2VRW B;  3CIK A;  4XWX A;  5C16 A;  1MK9 B;  4A6F A;  2YT1 A;  4YON A;  3IVF A;  1MIZ B;  1W1G A;  4KHB B;  4EMO A;  2R2Y A;  2N23 A;  2YS1 A;  4HB3 B;  1Q67 A;  2QKL A;  3LJU X;  2ELB A;  2P8V A;  3VIA A;  3PG7 A;  1Y5O A;  4HAU B;  2H7E A;  2MFQ A;  3WA0 A;  2NZ8 B;  3F5R A;  2Y8F A;  5HE3 A;  3OAN A;  3U8Z A;  5D3X A;  3QIJ A;  1NI2 A;  4A5K A;  4KAX B;  1Z87 A;  3DXD A;  1J0W A;  3FVC A;  3PP2 A;  4YL8 A;  1RRP B;  4ZRJ A;  4GZU A;  4Z2M B;  1QC6 A;  2J0J A;  3ZDT A;  3G9W A;  3NWF A;  1U5G A;  1UEF A;  2D9W A;  5I2M A;  2UVM A;  5EFX A;  2UZR A;  2CAY A;  4A6K A;  2PZ1 A;  3CXB B;  1B55 A;  1FGY A;  3GYO A;  3SYX A;  3AU4 A;  1X1G A;  2KIG A;  4K2O A;  2OQB A;  1LW3 A;  2GCJ A;  2JP2 A;  2D9V A;  4MT7 A;  2I5C A;  1P5T A;  1MPH A;  3A8P A;  4MK0 A;  3M1I B;  2H7D A;  1ZC4 B;  1XR0 B;  4DIX A;  2CRF A;  5JLJ B;  5KQ4 A;  1X05 A;  1XCG A;  3HQC A;  4L1R A;  5DHF B;  3DXE A;  3KSY A;  1QQG A;  3SUZ A;  1V5M A;  4KHB A;  3TVV A;  1K5D B;  1NTY A;  3BIN A;  1WGQ A;  2D9Z A;  1EF1 A;  2W2X C;  1P6S A;  3A58 A;  5D3V A;  1NU2 A;  2P0D A;  2ADZ A;  2ZKM X;  4QJ4 B;  5C6R A;  4IFS A;  4QJ5 B;  1FAO A;  4PQ0 A;  4HB0 B;  3B77 A;  1Y19 B;  3TW1 A;  2DFK A;  2COD A;  3VOQ A;  2DX1 A;  2KIE A;  1MK7 B;  3TO1 A;  3PEG A;  4OT1 A;  4GXB A;  2MDX A;  3F0W A;  1DDM A;  1J19 A;  1UPQ A;  1RJ2 A;  4Z2N A;  1UPR A;  3WYF B;  3HIE A;  2D10 A;  3P6A A;  1XOD A;  5J3T A;  1MKE A;  1U2B A;  2J59 M;  2YT2 A;  4DBB A;  1N3H A;  4K81 A;  2R0D A;  2YS5 A;  2Z0O A;  3NWD A;  4K17 A;  1V5P A;  2K2J A;  2DHK A;  2D9X A;  1FHO A;  4C0A A;  5CLQ B;  3KRX A;  4IOY X;  1DDW A;  4QJ3 B;  3SNH A;  2YVC A;  2Q13 A;  1T77 A;  2KUP A;  4HAV B;  4WVF B;  2KGX B;  1X86 A;  1OMW A;  5DIF B;  4F7H A;  2NMB A;  2FJL A;  3QBV B;  3FSS A;  2RUK B;  4PNK A;  4NSW A;  3GYP A;  5HE1 A;  1FB8 A;  2P0H A;  4HAT B;  3SO6 A;  5GOW B;  4DX9 0;  1E5W A;  2RSG A;  3DXC A;  2Z13 A;  3QWM A;  2RRF A;  4D6W A;  1OY2 A;  4HDO A;  2DYQ A;  5L81 A;  1EGX A;  1U5D A;  2ZPY A;  1WJ1 A;  1BAK A;  2LG1 A;  4HHV A;  1H10 A;  2AEH A;  5CLL B;  2K2U A;  1BTN A;  3OHM B;  3A8Q A;  3HK0 A;  1X11 A;  4GPT B;  4KHO A;  2D4Q A;  1MAI A;  5DHA B;  2L1C A;  1H4R A;  3PSC A;  2EJ8 A;  5HE0 A;  2LYD A;  1ZM0 A;  1WI1 A;  2DN6 A;  4WSF A;  2DLW A;  1M7E A;  4GNK B;  4BBK A;  2Z0P A;  1PMS A;  2V76 A;  3MDB C;  5JHH A;  1KI1 B;  3T06 A;  5DH9 B;  1U29 A;  1DYN A;  1TQZ A;  1DDV A;  2GUM A;  1V5U A;  3P7Z A;  2K00 A;  4HAX B;  3D8F A;  1TXD A;  1BWN A;  1V61 A;  2Z59 A;  2I1J A;  2M38 A;  2HTH B; 
#chains in the Genus database with same CATH homology
 2DX5 A;  2VSZ A;  2LOX A;  1TJ6 A;  1GG3 A;  1NTV A;  1U27 A;  2YRY A;  3BJI A;  2X18 A;  4H8S A;  5HE2 A;  3ZVR A;  1I7A A;  2L2I A;  2YSZ A;  2P0F A;  4CHM A;  2DTC A;  3PVU A;  3UZT A;  5D3Y A;  5DI9 B;  1WG7 A;  1V89 A;  1I2H A;  2GJY A;  5D27 A;  4EKU A;  1M7R A;  1UNQ A;  4HB2 B;  2N0Y A;  3ULC A;  3PVW A;  4HAW B;  2EMT A;  2W2X D;  1PLS A;  4TYZ A;  4WJ7 A;  1FOE A;  4GN1 A;  4Y94 A;  1FHX A;  2J0M A;  2DHI A;  1AQC A;  2COF A;  2EMS A;  2W2W A;  1DBH A;  1SHC A;  2DKQ A;  3MPX A;  2YS3 A;  5KQ1 A;  3ODO A;  3ULB A;  4A6F B;  5JHG A;  1ISN A;  1UNP A;  4HDQ A;  1KZG A;  1FGZ A;  1V88 A;  3PVL A;  2R09 A;  2DYN A;  3TFM A;  2DHJ A;  3D8E A;  2G35 A;  1UNR A;  5FI1 A;  4KVG B;  5KCV A;  4A6H A;  2MWN B;  2IFS A;  2IYB A;  2QKM A;  2UZS A;  4L6E A;  3SV1 A;  3AJ4 A;  5J3Y A;  1W1D A;  4DX8 A;  4ZRI A;  5C5B A;  2KCJ A;  3FM8 C;  3U7D A;  2MKR A;  2OTX A;  1FHW A;  1MIX A;  4CHJ A;  2D2Q A;  3X23 A;  2J0K A;  3TCA A;  4B6H A;  1IRS A;  2D9Y A;  2ROZ B;  3FEH A;  2VKI A;  4NY0 A;  4CYE A;  1EVH A;  2LOZ A;  2GCL A;  2M14 A;  4EJN A;  4MY6 A;  1P3R A;  2YT0 A;  2CY5 A;  1LB1 A;  1K5G B;  4HB4 B;  3AU5 A;  1U5F A;  4IAP A;  4D0N B;  3PZD A;  2GS0 A;  1XD4 A;  5LOP B;  1KZ7 A;  2ROV A;  2Y7B A;  4KHA A;  2XQN M;  3V5W A;  4F7G A;  2AL6 A;  5C79 A;  4DXA B;  3NSU A;  4HAY B;  2DA0 A;  3O96 A;  2HE7 A;  1BTK A;  2I5F A;  1WGU A;  2LKO A;  2E2X A;  2Z0Q A;  3ML4 A;  1SGH A;  4ZRK A;  1GC6 A;  3HW2 B;  4F7U P;  2RLO A;  2LUL A;  3N7C A;  1OQN A;  1WVH A;  3A98 B;  4P7I A;  1AWE A;  2YF0 A;  2RNR B;  5FI0 A;  3RCP A;  2BCJ A;  1DRO A;  2COC A;  3KRW A;  2D11 A;  5C5B B;  5LON B;  1PFJ A;  1XKE A;  1X1F A;  1EAZ A;  2RVB B;  1WJM A;  2EC1 A;  5JP4 A;  2CY4 A;  3ODX A;  2RGN B;  4HAZ B;  1ZC3 B;  2COA A;  1GC7 A;  5D3W A;  1U5E A;  3KZ1 A;  4GMV A;  3ODW A;  4GMX B;  5J3Q A;  1ZSQ A;  2I1K A;  3KY9 A;  4TKN A;  1W1H A;  1XX0 A;  2ELA A;  1ZVR A;  3D8D A;  4K2P A;  2Y8G A;  2DKP A;  2VRW B;  3CIK A;  4XWX A;  5C16 A;  1MK9 B;  4A6F A;  2YT1 A;  4YON A;  3IVF A;  1MIZ B;  1W1G A;  4KHB B;  4EMO A;  2N23 A;  2YS1 A;  4HB3 B;  1Q67 A;  2QKL A;  3LJU X;  2ELB A;  2P8V A;  3VIA A;  3PG7 A;  1Y5O A;  4HAU B;  2H7E A;  2MFQ A;  3WA0 A;  2NZ8 B;  3F5R A;  2Y8F A;  5HE3 A;  3OAN A;  3U8Z A;  5D3X A;  3QIJ A;  1NI2 A;  4A5K A;  4KAX B;  1Z87 A;  3DXD A;  1J0W A;  3PP2 A;  4YL8 A;  1RRP B;  4ZRJ A;  4GZU A;  4Z2M B;  1QC6 A;  2J0J A;  3ZDT A;  3G9W A;  1U5G A;  1UEF A;  2D9W A;  2UVM A;  5EFX A;  2UZR A;  2CAY A;  4A6K A;  2PZ1 A;  3CXB B;  1B55 A;  1FGY A;  3GYO A;  3SYX A;  3AU4 A;  1X1G A;  4K2O A;  2OQB A;  1LW3 A;  2GCJ A;  2JP2 A;  2D9V A;  4MT7 A;  2I5C A;  1P5T A;  1MPH A;  3A8P A;  4MK0 A;  3M1I B;  2H7D A;  1ZC4 B;  1XR0 B;  5JLJ B;  2CRF A;  5KQ4 A;  1X05 A;  1XCG A;  3HQC A;  5DHF B;  3DXE A;  3KSY A;  1QQG A;  3SUZ A;  1V5M A;  3TVV A;  1K5D B;  1NTY A;  3BIN A;  1WGQ A;  2D9Z A;  1EF1 A;  2W2X C;  1P6S A;  5D3V A;  1NU2 A;  2P0D A;  2ADZ A;  5C6R A;  4IFS A;  1FAO A;  4PQ0 A;  4HB0 B;  1Y19 B;  3TW1 A;  2DFK A;  2COD A;  3VOQ A;  2DX1 A;  1MK7 B;  3TO1 A;  3PEG A;  4GXB A;  2MDX A;  3F0W A;  1DDM A;  1J19 A;  1UPQ A;  1RJ2 A;  4Z2N A;  1UPR A;  3WYF B;  2D10 A;  3P6A A;  1XOD A;  5J3T A;  1MKE A;  1U2B A;  2J59 M;  4DBB A;  1N3H A;  4K81 A;  2R0D A;  2YS5 A;  2Z0O A;  4K17 A;  1V5P A;  2K2J A;  2DHK A;  2D9X A;  1FHO A;  4C0A A;  5CLQ B;  3KRX A;  4IOY X;  1DDW A;  3SNH A;  2YVC A;  2Q13 A;  4HAV B;  2KUP A;  4WVF B;  2KGX B;  1X86 A;  1OMW A;  5DIF B;  4F7H A;  2NMB A;  2FJL A;  3QBV B;  3FSS A;  2RUK B;  4PNK A;  4NSW A;  3GYP A;  5HE1 A;  1FB8 A;  2P0H A;  4HAT B;  3SO6 A;  5GOW B;  4DX9 0;  1E5W A;  2RSG A;  3DXC A;  3QWM A;  1OY2 A;  4HDO A;  2DYQ A;  5L81 A;  1EGX A;  1U5D A;  2ZPY A;  1WJ1 A;  1BAK A;  2LG1 A;  4HHV A;  1H10 A;  2AEH A;  5CLL B;  2K2U A;  1BTN A;  3A8Q A;  3HK0 A;  1X11 A;  4GPT B;  4KHO A;  2D4Q A;  1MAI A;  5DHA B;  2L1C A;  1H4R A;  3PSC A;  2EJ8 A;  5HE0 A;  2LYD A;  1ZM0 A;  1WI1 A;  2DN6 A;  4WSF A;  2DLW A;  1M7E A;  4BBK A;  2Z0P A;  1PMS A;  2V76 A;  3MDB C;  5JHH A;  1KI1 B;  3T06 A;  5DH9 B;  1U29 A;  1DYN A;  1TQZ A;  1DDV A;  1V5U A;  3P7Z A;  2K00 A;  4HAX B;  3D8F A;  1TXD A;  1BWN A;  1V61 A;  2I1J A;  2M38 A;  2HTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...