4L7PA

Human artd3 (parp3) - catalytic domain in complex with inhibitor me0395
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
356
structure length
350
Chain Sequence
MKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Probes to Study ADP-Ribosylation: Synthesis and Biochemical Evaluation of Inhibitors of the Human ADP-Ribosyltransferase ARTD3/PARP3.
pubmed doi rcsb
molecule keywords Poly [ADP-ribose] polymerase 3
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 110
structure length 350
sequence length 356
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02877 PARP_reg Poly(ADP-ribose) polymerase, regulatory domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.142.10 Mainly Alpha Up-down Bundle Poly(ADP-ribose) Polymerase; domain 1 Poly(ADP-ribose) polymerase, regulatory domain 4l7pA01
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4l7pA02
4PAXA 4BFPA 4UNDA 4X52A 4UVXA 5AL1A 4ZZYA 4BU8A 4KZLA 3P0PA 4UI8A 4LI6A 4N4TA 4PNLA 4L6ZA 3BLJA 4RV6A 4KRSA 4GV4A 5ETYA 3GJWA 4L0BA 4W5SA 5AL5A 4ZZXA 3GEYA 4BU3A 4PJTA 4W6EA 5FPFA 5AL2A 4BUVA 4L32A 4L7LA 4UVTA 4L0SA 4BJBA 4UVOA 3SE2A 4HMHA 4MT9A 4PNTA 4L09A 4IUEA 4J3MA 4F1LA 1PAXA 5AKUA 4UI3A 4HL5A 4M7BA 1UK1A 4L0TA 2PQFA 4L2GA 5LX6A 4BS4A 2X5YA 2PAWA 4N3RA 5AL3A 3SMIA 3UH2A 4L7OA 5A00A 4BUEA 3UH4A 4OPXC 4BU5A 4K4FA 4OQBC 4BUWA 4BUSA 4DVIA 3KR7A 3C49A 3P0NA 4L6SA 5ADSA 3HKVA 3PAXA 4LI7A 4L0IA 4BJCA 3U9HA 4J1ZA 4TKIA 4LI8A 4AVUA 4UVLA 4PNRA 4HLGA 4U6AA 4UHGA 5ECEA 4N4VA 3UA9A 5AEHA 4PNSA 4L7UA 4PNNA 4HLKA 4UI7A 4UVZA 5EBTA 4L0VA 5LXPA 4BUYA 4PMLA 5AKWA 3L3MA 3GOYA 4BUIA 4F0EA 1A26A 4UUHA 4TORA 4UXBA 2PAXA 4TVJA 4L10A 4MSKA 4L7RA 4BU6A 3CE0A 4DQYC 4HKNA 4BUAA 1EFYA 4OA7A 5AL4A 4HYFA 4UI5A 3FHBA 3MHKA 4UVYA 3W51A 4BU9A 4TK5A 3KCZA 4J3LA 4L33A 4HLMA 4UX4A 4L7NA 4KZUA 4UVPA 4TKFA 4GV2A 5DCZA 4R5WA 4TJYA 4MSGA 4UVNA 4UW1A 4J22A 3KR8A 4PNMA 3U9YA 5C5PA 4L70A 4XHUA 4UVUA 4UVSA 5LYHA 3C4HA 2RD6A 3GN7A 4BJ9A 4TKGA 4TOSA 1UK0A 3SMJA 5ADRA 4L2FA 4PNQA 4AVWA 4L31A 4TJUA 1WOKA 4J21A 4TK0A 4K4EA 4GV0A 4PJVA 4W5IA 4BUUA 4GV7A 4PY4A 3KJDA 4R6EA 4L34A 5ADQA 5C5QA 2RF5A 4BU7A 4HKIA 4HHYA 5FPGA 4UFYA 4BUFA 4BUDA 1GS0A 3L3LA 2RCWA 4HKKA 3UDDA 4BUTA 4UVWA 4HHZA 4L2KA 4F1QA 4ZZZA 4HLFA 4KZQA 4UFUA 5C5RA 4I9IA 4HLHA 4UI6A 4OQAC 3MHJA 4BUXA 4UVVA 4UI4A 4TJWA 5ADTA 3P0QA 4L7PA
chains in the Genus database with same CATH superfamily
4PAXA 3P0PA 4N4TA 3BLJA 2GMVA 4RV6A 5ETYA 4BU3A 4L32A 4L7LA 4OX2A 4L0SA 4BJBA 4HMHA 4PNTA 4IUEA 4F1LA 1KHGA 2PC9A 4UI3A 4M7BA 1UK1A 4L2GA 2X5YA 3SMIA 1M51A 3UH4A 4BU5A 2RK8A 3KR7A 5ADSA 3HKVA 4LI7A 2RKDA 4TKIA 4UVLA 4UHGA 3UA9A 5AEHA 4UVZA 4L0VA 5AKWA 4UUHA 4MSKA 3CE0A 4DQYC 4HKNA 5AL4A 4HYFA 4UVYA 4TK5A 4J3LA 3DT7A 4GV2A 2RK7A 4UW1A 3KR8A 4TKGA 4WPTA 4L2FA 4TJUA 5FH3A 4BUUA 3KJDA 4R6EA 1YTMA 2OLRA 4L34A 5C5QA 5ADQA 2RF5A 4HHYA 4BUFA 4BUDA 1GS0A 3UDDA 1AYLA 4HHZA 5C5RA 4I9IA 4BUXA 2FAFA 4IDUB 4JNGA 4UVXA 5AL1A 4ZZYA 4WL8A 4BU8A 4KZLA 4KRSA 4BGPA 4L0BA 4W5SA 4PJTA 2QEYA 4BUVA 3SE2A 1PAXA 5AKUA 4IJSA 5LX6A 4BS4A 2PAWA 4N3RA 4GMMA 3UH2A 4BUSA 4K4FA 4BUWA 4DVIA 3C49A 4L6SA 4L0IA 4J1ZA 4PNRA 4WIEA 1YLHA 5EBTA 4BUYA 4J1JA 4TORA 4TVJA 4BU6A 3KCZA 4HLMA 4UX4A 5FH0A 4KZUA 4GMWA 2QEWA 2QZYA 4L70A 4XHUA 4J1GA 4GNPA 3ZL9A 4PNQA 4TK0A 4K4EA 1K3CA 4W5IA 4GV7A 4PY4A 4UFYA 1AQ2A 2RCWA 4HKKA 4YWDA 3ZLAA 4ZZZA 4UFUA 4UI6A 4OQAC 3MHJA 4J22A 4L7RA 4GMUA 4BFPA 4UI8A 3GJWA 5FPFA 5AL5A 3GEYA 5FH4A 5AL2A 4UVTA 4GMZA 4L09A 4J3MA 4L0TA 4L7OA 5A00A 4BUEA 4OPXC 3P0NA 4LI8A 4HLGA 4U6AA 5ECEA 5FH2A 5FH5A 4PNSA 1XKVA 4GNLA 1KHBA 3DT4A 3L3MA 4GNQA 4BUIA 4F0EA 1A26A 4UXBA 1EFYA 4OA7A 4UI5A 3FHBA 4BU9A 4L7NA 4UVPA 2PY7X 4MSGA 4YWBA 4PNMA 5C5PA 3C4HA 1NHXA 4YW9A 2RD6A 3GN7A 4TOSA 3SMJA 4AVWA 4L31A 1WOKA 4J21A 4GV0A 4PJVA 4WOUA 4BU7A 5FPGA 3L3LA 4L2KA 4F1QA 4KZQA 2RKAA 2QF1A 3MOFA 4UVVA 1OS1A 4TJWA 3P0QA 4UNDA 4X52A 4IDXA 1K3DA 4LI6A 4PNLA 4L6ZA 2ZCIA 4GV4A 1II2A 4ZZXA 4W6EA 2QF2A 4UVOA 4MT9A 4WPVA 4HL5A 1YGGA 2PQFA 1YVYA 2OLQA 5AL3A 2PXZX 4OQBC 1OENA 3PAXA 3MOEA 4BJCA 3U9HA 1KHEA 4AVUA 4N4VA 4L7UA 4PNNA 4HLKA 4UI7A 5LXPA 4RCGA 3MOHA 4PMLA 3GOYA 2PAXA 4L10A 4BUAA 2FAHA 3MHKA 4IDUA 3W51A 4GNOA 4BHHB 4L33A 4YW8A 4TKFA 5DCZA 4R5WA 5FH1A 4TJYA 4WIUA 5I67A 4UVNA 3U9YA 4UVUA 4UVSA 5LYHA 1KHFA 4BJ9A 1J3BA 1UK0A 5ADRA 4HKIA 4GNMA 4WPUA 2RKEA 4BUTA 3DTBA 4UVWA 4HLFA 4HLHA 4UI4A 3DT2A 5ADTA 4L7PA 4R43A
chains in the Genus database with same CATH topology
4PAXA 4BFPA 4UNDA 4X52A 4UVXA 5AL1A 4ZZYA 4WL8A 4BU8A 4KZLA 1K3DA 3P0PA 4LI6A 4N4TA 4PNLA 4L6ZA 3BLJA 4UI8A 2GMVA 2ZCIA 4RV6A 4KRSA 4GV4A 1II2A 3GJWA 4L0BA 4W5SA 5AL5A 4ZZXA 3GEYA 4BU3A 4PJTA 4W6EA 5FPFA 5FH4A 2QEYA 5AL2A 4BUVA 4L32A 4L7LA 2QF2A 4OX2A 4GMZA 4L0SA 4UVTA 4UVOA 3SE2A 4BJBA 4HMHA 4MT9A 4PNTA 4L09A 4IUEA 4J3MA 4F1LA 1PAXA 1KHGA 2PC9A 5AKUA 4UI3A 4WPVA 4HL5A 4M7BA 1UK1A 1YGGA 4L0TA 2PQFA 4L2GA 5LX6A 4BS4A 2X5YA 1YVYA 2PAWA 2OLQA 4N3RA 5AL3A 3SMIA 4GMMA 3UH2A 4L7OA 2PXZX 1M51A 5A00A 4BUEA 3UH4A 4OPXC 4BU5A 4K4FA 4OQBC 4BUWA 4BUSA 4DVIA 2RK8A 3C49A 3KR7A 3P0NA 4L6SA 5ADSA 1OENA 3PAXA 3HKVA 2RKDA 4LI7A 3MOEA 4L0IA 4BJCA 3U9HA 4J1ZA 4TKIA 4LI8A 1KHEA 4AVUA 4UVLA 4PNRA 4HLGA 4U6AA 4UHGA 5ECEA 4N4VA 5FH2A 5FH5A 4WIEA 1YLHA 5AEHA 3UA9A 4PNSA 1XKVA 4L7UA 4PNNA 4GNLA 4HLKA 4UI7A 4UVZA 5EBTA 1KHBA 3MOHA 4L0VA 4PMLA 4BUYA 4RCGA 5LXPA 5AKWA 3DT4A 3L3MA 3GOYA 4GNQA 4BUIA 4F0EA 1A26A 4UUHA 4TORA 4UXBA 2PAXA 4TVJA 4L10A 4MSKA 4BU6A 3CE0A 4DQYC 4HKNA 4BUAA 1EFYA 4OA7A 5AL4A 2FAHA 4HYFA 4UI5A 3FHBA 3MHKA 3P0QA 4UVYA 3W51A 4GNOA 4BU9A 4TK5A 3KCZA 4J3LA 4L33A 4HLMA 3DT7A 4UX4A 4YW8A 4L7NA 4KZUA 4UVPA 5FH0A 2PY7X 4TKFA 4GV2A 5DCZA 4R5WA 4GMWA 5FH1A 4TJYA 4WIUA 2QEWA 2RK7A 5I67A 4MSGA 4UVNA 4UW1A 4J22A 3KR8A 4YWBA 4PNMA 2QZYA 3U9YA 5C5PA 4L70A 4XHUA 4GNPA 4UVUA 4UVSA 5LYHA 3C4HA 1NHXA 4YW9A 2RD6A 1KHFA 3GN7A 4BJ9A 4TKGA 1J3BA 4WPTA 4TOSA 1UK0A 3SMJA 5ADRA 4L2FA 4PNQA 4AVWA 4L31A 4TJUA 1WOKA 4J21A 4TK0A 4K4EA 1K3CA 4GV0A 4PJVA 4W5IA 4BUUA 4GV7A 5FH3A 4PY4A 3KJDA 4R6EA 1YTMA 2OLRA 4L34A 4WOUA 5C5QA 5ADQA 2RF5A 4BU7A 4HKIA 4HHYA 5FPGA 4UFYA 4BUFA 4GNMA 4WPUA 4BUDA 1GS0A 3L3LA 2RCWA 4HKKA 1AQ2A 3UDDA 2RKEA 4BUTA 4YWDA 1AYLA 3DTBA 4UVWA 4HHZA 4L2KA 4F1QA 4ZZZA 4HLFA 4KZQA 4UFUA 2RKAA 5C5RA 2QF1A 4I9IA 4HLHA 4UI6A 4OQAC 3MHJA 3MOFA 4BUXA 4UVVA 2FAFA 5ETYA 1OS1A 4UI4A 4TJWA 3DT2A 5ADTA 4L7RA 4L7PA 4GMUA 4R43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAX A;  4BFP A;  4UND A;  4X52 A;  4UVX A;  5AL1 A;  4ZZY A;  4BU8 A;  4KZL A;  3P0P A;  4UI8 A;  4LI6 A;  4N4T A;  4PNL A;  4L6Z A;  3BLJ A;  4RV6 A;  4KRS A;  4GV4 A;  5ETY A;  3GJW A;  4L0B A;  4W5S A;  5AL5 A;  4ZZX A;  3GEY A;  4BU3 A;  4PJT A;  4W6E A;  5FPF A;  5AL2 A;  4BUV A;  4L32 A;  4L7L A;  4UVT A;  4L0S A;  4BJB A;  4UVO A;  3SE2 A;  4HMH A;  4MT9 A;  4PNT A;  4L09 A;  4IUE A;  4J3M A;  4F1L A;  1PAX A;  5AKU A;  4UI3 A;  4HL5 A;  4M7B A;  1UK1 A;  4L0T A;  2PQF A;  4L2G A;  5LX6 A;  4BS4 A;  2X5Y A;  2PAW A;  4N3R A;  5AL3 A;  3SMI A;  3UH2 A;  4L7O A;  5A00 A;  4BUE A;  3UH4 A;  4OPX C;  4BU5 A;  4K4F A;  4OQB C;  4BUW A;  4BUS A;  4DVI A;  3KR7 A;  3C49 A;  3P0N A;  4L6S A;  5ADS A;  3HKV A;  3PAX A;  4LI7 A;  4L0I A;  4BJC A;  3U9H A;  4J1Z A;  4TKI A;  4LI8 A;  4AVU A;  4UVL A;  4PNR A;  4HLG A;  4U6A A;  4UHG A;  5ECE A;  4N4V A;  3UA9 A;  5AEH A;  4PNS A;  4L7U A;  4PNN A;  4HLK A;  4UI7 A;  4UVZ A;  5EBT A;  4L0V A;  5LXP A;  4BUY A;  4PML A;  5AKW A;  3L3M A;  3GOY A;  4BUI A;  4F0E A;  1A26 A;  4UUH A;  4TOR A;  4UXB A;  2PAX A;  4TVJ A;  4L10 A;  4MSK A;  4L7R A;  4BU6 A;  3CE0 A;  4DQY C;  4HKN A;  4BUA A;  1EFY A;  4OA7 A;  5AL4 A;  4HYF A;  4UI5 A;  3FHB A;  3MHK A;  4UVY A;  3W51 A;  4BU9 A;  4TK5 A;  3KCZ A;  4J3L A;  4L33 A;  4HLM A;  4UX4 A;  4L7N A;  4KZU A;  4UVP A;  4TKF A;  4GV2 A;  5DCZ A;  4R5W A;  4TJY A;  4MSG A;  4UVN A;  4UW1 A;  4J22 A;  3KR8 A;  4PNM A;  3U9Y A;  5C5P A;  4L70 A;  4XHU A;  4UVU A;  4UVS A;  5LYH A;  3C4H A;  2RD6 A;  3GN7 A;  4BJ9 A;  4TKG A;  4TOS A;  1UK0 A;  3SMJ A;  5ADR A;  4L2F A;  4PNQ A;  4AVW A;  4L31 A;  4TJU A;  1WOK A;  4J21 A;  4TK0 A;  4K4E A;  4GV0 A;  4PJV A;  4W5I A;  4BUU A;  4GV7 A;  4PY4 A;  3KJD A;  4R6E A;  4L34 A;  5ADQ A;  5C5Q A;  2RF5 A;  4BU7 A;  4HKI A;  4HHY A;  5FPG A;  4UFY A;  4BUF A;  4BUD A;  1GS0 A;  3L3L A;  2RCW A;  4HKK A;  3UDD A;  4BUT A;  4UVW A;  4HHZ A;  4L2K A;  4F1Q A;  4ZZZ A;  4HLF A;  4KZQ A;  4UFU A;  5C5R A;  4I9I A;  4HLH A;  4UI6 A;  4OQA C;  3MHJ A;  4BUX A;  4UVV A;  4UI4 A;  4TJW A;  5ADT A;  3P0Q A;  4L7P A; 
#chains in the Genus database with same CATH topology
 4PAX A;  3P0P A;  4N4T A;  3BLJ A;  2GMV A;  4RV6 A;  5ETY A;  4BU3 A;  4L32 A;  4L7L A;  4OX2 A;  4L0S A;  4BJB A;  4HMH A;  4PNT A;  4IUE A;  4F1L A;  1KHG A;  2PC9 A;  4UI3 A;  4M7B A;  1UK1 A;  4L2G A;  2X5Y A;  3SMI A;  1M51 A;  3UH4 A;  4BU5 A;  2RK8 A;  3KR7 A;  5ADS A;  3HKV A;  4LI7 A;  2RKD A;  4TKI A;  4UVL A;  4UHG A;  3UA9 A;  5AEH A;  4UVZ A;  4L0V A;  5AKW A;  4UUH A;  4MSK A;  3CE0 A;  4DQY C;  4HKN A;  5AL4 A;  4HYF A;  4UVY A;  4TK5 A;  4J3L A;  3DT7 A;  4GV2 A;  2RK7 A;  4UW1 A;  3KR8 A;  4TKG A;  4WPT A;  4L2F A;  4TJU A;  5FH3 A;  4BUU A;  3KJD A;  4R6E A;  1YTM A;  2OLR A;  4L34 A;  5C5Q A;  5ADQ A;  2RF5 A;  4HHY A;  4BUF A;  4BUD A;  1GS0 A;  3UDD A;  1AYL A;  4HHZ A;  5C5R A;  4I9I A;  4BUX A;  2FAF A;  4IDU B;  4JNG A;  4UVX A;  5AL1 A;  4ZZY A;  4WL8 A;  4BU8 A;  4KZL A;  4KRS A;  4BGP A;  4L0B A;  4W5S A;  4PJT A;  2QEY A;  4BUV A;  3SE2 A;  1PAX A;  5AKU A;  4IJS A;  5LX6 A;  4BS4 A;  2PAW A;  4N3R A;  4GMM A;  3UH2 A;  4BUS A;  4K4F A;  4BUW A;  4DVI A;  3C49 A;  4L6S A;  4L0I A;  4J1Z A;  4PNR A;  4WIE A;  1YLH A;  5EBT A;  4BUY A;  4J1J A;  4TOR A;  4TVJ A;  4BU6 A;  3KCZ A;  4HLM A;  4UX4 A;  5FH0 A;  4KZU A;  4GMW A;  2QEW A;  2QZY A;  4L70 A;  4XHU A;  4J1G A;  4GNP A;  3ZL9 A;  4PNQ A;  4TK0 A;  4K4E A;  1K3C A;  4W5I A;  4GV7 A;  4PY4 A;  4UFY A;  1AQ2 A;  2RCW A;  4HKK A;  4YWD A;  3ZLA A;  4ZZZ A;  4UFU A;  4UI6 A;  4OQA C;  3MHJ A;  4J22 A;  4L7R A;  4GMU A;  4BFP A;  4UI8 A;  3GJW A;  5FPF A;  5AL5 A;  3GEY A;  5FH4 A;  5AL2 A;  4UVT A;  4GMZ A;  4L09 A;  4J3M A;  4L0T A;  4L7O A;  5A00 A;  4BUE A;  4OPX C;  3P0N A;  4LI8 A;  4HLG A;  4U6A A;  5ECE A;  5FH2 A;  5FH5 A;  4PNS A;  1XKV A;  4GNL A;  1KHB A;  3DT4 A;  3L3M A;  4GNQ A;  4BUI A;  4F0E A;  1A26 A;  4UXB A;  1EFY A;  4OA7 A;  4UI5 A;  3FHB A;  4BU9 A;  4L7N A;  4UVP A;  2PY7 X;  4MSG A;  4YWB A;  4PNM A;  5C5P A;  3C4H A;  1NHX A;  4YW9 A;  2RD6 A;  3GN7 A;  4TOS A;  3SMJ A;  4AVW A;  4L31 A;  1WOK A;  4J21 A;  4GV0 A;  4PJV A;  4WOU A;  4BU7 A;  5FPG A;  3L3L A;  4L2K A;  4F1Q A;  4KZQ A;  2RKA A;  2QF1 A;  3MOF A;  4UVV A;  1OS1 A;  4TJW A;  3P0Q A;  4UND A;  4X52 A;  4IDX A;  1K3D A;  4LI6 A;  4PNL A;  4L6Z A;  2ZCI A;  4GV4 A;  1II2 A;  4ZZX A;  4W6E A;  2QF2 A;  4UVO A;  4MT9 A;  4WPV A;  4HL5 A;  1YGG A;  2PQF A;  1YVY A;  2OLQ A;  5AL3 A;  2PXZ X;  4OQB C;  1OEN A;  3PAX A;  3MOE A;  4BJC A;  3U9H A;  1KHE A;  4AVU A;  4N4V A;  4L7U A;  4PNN A;  4HLK A;  4UI7 A;  5LXP A;  4RCG A;  3MOH A;  4PML A;  3GOY A;  2PAX A;  4L10 A;  4BUA A;  2FAH A;  3MHK A;  4IDU A;  3W51 A;  4GNO A;  4BHH B;  4L33 A;  4YW8 A;  4TKF A;  5DCZ A;  4R5W A;  5FH1 A;  4TJY A;  4WIU A;  5I67 A;  4UVN A;  3U9Y A;  4UVU A;  4UVS A;  5LYH A;  1KHF A;  4BJ9 A;  1J3B A;  1UK0 A;  5ADR A;  4HKI A;  4GNM A;  4WPU A;  2RKE A;  4BUT A;  3DTB A;  4UVW A;  4HLF A;  4HLH A;  4UI4 A;  3DT2 A;  5ADT A;  4L7P A;  4R43 A; 
#chains in the Genus database with same CATH homology
 4PAX A;  4BFP A;  4UND A;  4X52 A;  4UVX A;  5AL1 A;  4ZZY A;  4WL8 A;  4BU8 A;  4KZL A;  1K3D A;  3P0P A;  4LI6 A;  4N4T A;  4PNL A;  4L6Z A;  3BLJ A;  4UI8 A;  2GMV A;  2ZCI A;  4RV6 A;  4KRS A;  4GV4 A;  1II2 A;  3GJW A;  4L0B A;  4W5S A;  5AL5 A;  4ZZX A;  3GEY A;  4BU3 A;  4PJT A;  4W6E A;  5FPF A;  5FH4 A;  2QEY A;  5AL2 A;  4BUV A;  4L32 A;  4L7L A;  2QF2 A;  4OX2 A;  4GMZ A;  4L0S A;  4UVT A;  4UVO A;  3SE2 A;  4BJB A;  4HMH A;  4MT9 A;  4PNT A;  4L09 A;  4IUE A;  4J3M A;  4F1L A;  1PAX A;  1KHG A;  2PC9 A;  5AKU A;  4UI3 A;  4WPV A;  4HL5 A;  4M7B A;  1UK1 A;  1YGG A;  4L0T A;  2PQF A;  4L2G A;  5LX6 A;  4BS4 A;  2X5Y A;  1YVY A;  2PAW A;  2OLQ A;  4N3R A;  5AL3 A;  3SMI A;  4GMM A;  3UH2 A;  4L7O A;  2PXZ X;  1M51 A;  5A00 A;  4BUE A;  3UH4 A;  4OPX C;  4BU5 A;  4K4F A;  4OQB C;  4BUW A;  4BUS A;  4DVI A;  2RK8 A;  3C49 A;  3KR7 A;  3P0N A;  4L6S A;  5ADS A;  1OEN A;  3PAX A;  3HKV A;  2RKD A;  4LI7 A;  3MOE A;  4L0I A;  4BJC A;  3U9H A;  4J1Z A;  4TKI A;  4LI8 A;  1KHE A;  4AVU A;  4UVL A;  4PNR A;  4HLG A;  4U6A A;  4UHG A;  5ECE A;  4N4V A;  5FH2 A;  5FH5 A;  4WIE A;  1YLH A;  5AEH A;  3UA9 A;  4PNS A;  1XKV A;  4L7U A;  4PNN A;  4GNL A;  4HLK A;  4UI7 A;  4UVZ A;  5EBT A;  1KHB A;  3MOH A;  4L0V A;  4PML A;  4BUY A;  4RCG A;  5LXP A;  5AKW A;  3DT4 A;  3L3M A;  3GOY A;  4GNQ A;  4BUI A;  4F0E A;  1A26 A;  4UUH A;  4TOR A;  4UXB A;  2PAX A;  4TVJ A;  4L10 A;  4MSK A;  4BU6 A;  3CE0 A;  4DQY C;  4HKN A;  4BUA A;  1EFY A;  4OA7 A;  5AL4 A;  2FAH A;  4HYF A;  4UI5 A;  3FHB A;  3MHK A;  3P0Q A;  4UVY A;  3W51 A;  4GNO A;  4BU9 A;  4TK5 A;  3KCZ A;  4J3L A;  4L33 A;  4HLM A;  3DT7 A;  4UX4 A;  4YW8 A;  4L7N A;  4KZU A;  4UVP A;  5FH0 A;  2PY7 X;  4TKF A;  4GV2 A;  5DCZ A;  4R5W A;  4GMW A;  5FH1 A;  4TJY A;  4WIU A;  2QEW A;  2RK7 A;  5I67 A;  4MSG A;  4UVN A;  4UW1 A;  4J22 A;  3KR8 A;  4YWB A;  4PNM A;  2QZY A;  3U9Y A;  5C5P A;  4L70 A;  4XHU A;  4GNP A;  4UVU A;  4UVS A;  5LYH A;  3C4H A;  1NHX A;  4YW9 A;  2RD6 A;  1KHF A;  3GN7 A;  4BJ9 A;  4TKG A;  1J3B A;  4WPT A;  4TOS A;  1UK0 A;  3SMJ A;  5ADR A;  4L2F A;  4PNQ A;  4AVW A;  4L31 A;  4TJU A;  1WOK A;  4J21 A;  4TK0 A;  4K4E A;  1K3C A;  4GV0 A;  4PJV A;  4W5I A;  4BUU A;  4GV7 A;  5FH3 A;  4PY4 A;  3KJD A;  4R6E A;  1YTM A;  2OLR A;  4L34 A;  4WOU A;  5C5Q A;  5ADQ A;  2RF5 A;  4BU7 A;  4HKI A;  4HHY A;  5FPG A;  4UFY A;  4BUF A;  4GNM A;  4WPU A;  4BUD A;  1GS0 A;  3L3L A;  2RCW A;  4HKK A;  1AQ2 A;  3UDD A;  2RKE A;  4BUT A;  4YWD A;  1AYL A;  3DTB A;  4UVW A;  4HHZ A;  4L2K A;  4F1Q A;  4ZZZ A;  4HLF A;  4KZQ A;  4UFU A;  2RKA A;  5C5R A;  2QF1 A;  4I9I A;  4HLH A;  4UI6 A;  4OQA C;  3MHJ A;  3MOF A;  4BUX A;  4UVV A;  2FAF A;  5ETY A;  1OS1 A;  4UI4 A;  4TJW A;  3DT2 A;  5ADT A;  4L7R A;  4L7P A;  4GMU A;  4R43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...