4L7TA

B. fragilis nanu
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
499
structure length
490
Chain Sequence
IDPTSSIADSNYWKTEAQFSTFNVGLHALLRECSFNFFLLGEPRADIYGDVPFGGEATQGMERLPFNTINKENTGISNFAGMYKVINQINLMIAKTKETTVLSEAGKNYYLGEAYGMRAYLYFHLLRSWGDVILYLDYTNSKAASPAEEVMKQIKEDITASEKGFGSDYSFKYGRYYWSMAATQMLKGEVYLWSGRQMGGGTADYTTAKTALQSIVSNANVSLQDDFSKVFAYNNKDNSEIIFSIRNAKDEYNMWDDRFRQNLVPQQAYMTSTYCNKEGVSFKDLPEGQLNGLIRLQIRYDLYNKAFRDGDTRKDASMTAVYQKQQDGTVKYIAPFCNKYQGVLLDGASQRSFLNDYPIYRYADCLLLLAEAKALLGEDPTAEINQVRERAYGKEFFEANKATLAYPNDKGDFYTDNKYMSGDEDPLEAILKERMREFMFEGKRWYDLRLLGADYVTKRTSAVATRLLWPINESVLTDNPALKQTPGYQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional characterization of NanU, a novel high-affinity sialic acid-inducible binding protein of oral and gut-dwelling Bacteroidetes species.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Sialic acid-binding protein
molecule keywords NanU sialic acid binding protein
total genus 181
structure length 490
sequence length 499
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
A PF14322 SusD-like_3 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4l7tA00
3KEZA 3CKCA 5FQ6A 3GZSA 3MYVA 3CGHA 4F7AA 3QNKA 4Q69A 3HDXA 4MRUA 3NQPA 3SGHA 5FQ8A 5E76A 5FQ7A 3EJNA 3FDHA 3JQ1A 4F53A 3JQ0A 4PUCA 3I4GA 3MX3A 4LERA 5T3RA 3CK9A 3MCXA 3SNXA 3L22A 3P1UA 5FQ4A 3CK8A 3OTNA 5T4YA 3EHNA 3EHMA 5LX8A 3CK7A 5J90A 4L7TA 3JYSA 3LEWA 5E75A 3CKBA 3IV0A
chains in the Genus database with same CATH superfamily
3LDZA 3RAUA 2KZTB 2VQ2A 4V3IA 2R02A 3SBTB 3FU5A 2KZTA 1TEZA 1JCQA 5G2NA 1H6PA 5C1DA 3ASNE 4HBDA 4M3OA 4I1AA 3CKBA 1A5EA 3B7RL 2Y0BG 2WXQA 1UJJA 4ZFHA 2J08A 2KBXA 4WWNA 5FQ8A 2WXFA 1H2UA 1RZ4A 3PRZA 3DSTA 3BG1B 2B0OE 3Q15A 4XKCA 2V0PA 4GA1A 2XEHA 4MKTA 4FADA 3LY9A 3CEQA 2AWIA 1NZNA 3NB2A 3IBEA 3RU0A 2VGYA 5FZRA 1DVPA 4G8KA 1N4PA 2IONA 1YCSB 4XEIG 3CQCB 3LKUA 4KVMA 1IQRA 2ZU6B 2JEKA 4GTVA 3J5PA 1UN9A 4FC8A 1TN8A 4ANWA 4FLHA 5KCMA 5IY5E 2WXGA 1N4RA 3S7DA 4NRHB 3DXKG 4PS3A 1N0RA 2CG2A 4N3AA 2CFZA 2ZISA 4L23A 4U8VD 2PM6A 5D66A 4AIFA 1EDUA 4ME2A 3ZIMA 3UI2A 3VTXA 4NQ0A 1HXIA 3ULQA 1SW6A 4KZ0A 3SFZA 3TWXA 3PNLB 4UWKA 3ZVVA 4DLOA 2V8SE 4AEZC 3ZFWA 2IQCA 3FH5A 4JVSA 3HG0D 2QZAA 4MS6A 3ML9A 3L13A 5JJ7A 4J6IA 5HQ8A 3NQPA 1X5BA 3V30A 4JZYA 4HLEA 4MLPA 2XS1A 3ASFA 3G2TA 4B94A 4Y6WA 5ENSD 4GMLA 5ENNA 2X6JA 3NF1A 5AIJA 2BKKB 3RSEG 4BT9A 5BNWA 5AQAA 3HHMA 4GCNA 3ESKA 2M63A 4DUIA 5FZSA 4F1PA 5ENTD 2VSYA 1PC2A 3W9GA 2Y4TA 3FUEA 2XEVA 4FLBA 2IU1A 2ZGDA 4U04A 4GZ5A 4JW1A 3ZYLA 4WWOA 3DXMG 4FP7A 4DX5D 3C98A 5KNGA 1NP7A 3DWLG 2WXHA 2V4HC 4KT6B 2WMNA 4TXPA 2NYJA 1NL4A 5LP0A 4DI3A 1YYHA 2FO7A 1SZ9A 3B7BA 5KJLA 4E85A 4L2LA 3EJNA 4Y6CA 2WXMA 2F8XK 3FTVA 4CDMA 2RFAA 1BU9A 3QWWA 3NOCD 4WNGA 3UXGA 3Q9NC 3AS5A 4NIKA 4O60A 3PS6A 4XI0A 4KVOA 3ASGA 3HVEA 3TWWA 5CCMA 1QBQA 3KEZA 4HNAD 3AG2E 4N5CA 4PH4B 2V5FA 1BD8A 3RKVA 4NACA 1MYOA 1Z3XA 4AOFA 3ZXPA 4N2QA 1K3ZD 3HYMB 3QK0A 3JUEA 3ULEG 4Q69A 2NSZA 1ELRA 2FULA 1TNOA 2VJ8A 3HXBA 4GA2A 2J49A 1EYHA 2I9CA 4DK5A 1H2TC 3TXMA 2GRQB 3RO3A 4WUYA 2Y3AA 4FULA 1O1SA 3FEYA 3TGOA 3OXGA 5LCWJ 2IOLA 2X6HA 4B8CB 3PNTB 5E76A 1A17A 2PL2A 2LXMA 4BTAA 3GZ1A 4YDOA 5A6CA 3MKQB 3RO2A 2R5SA 3FUJA 3CV0A 1UG3A 3QOUA 4BEPA 2GW1A 4DX2A 3PUKA 4TXRA 4GPMA 2XZTG 2R2LA 3G2SA 4GPKA 2V4LA 4J7WA 2GRRB 5FTPA 2MHKA 5KBAA 2YHEA 1UOHA 3CK7A 2I1JA 4L7TA 1SQMA 3T5VA 3LEWA 4JD2G 2H6GA 5EILA 2IO3C 4N5QA 3UT4A 5ANLA 4ILIA 2FBNA 4U0ZA 2VTBB 4U8HA 3ZRHA 3OXLA 2BTDA 3OTNA 3EHMA 3CVNA 4G11A 3FULA 3FTZA 1MX2A 4GTPA 2DZOA 4R7LA 3ZNGA 3UM1A 2DCPA 4RLYA 1YA0A 5FT9A 3CHRA 1FVHA 3I3NA 4DI4A 2DIWA 2YHCA 4JHKA 4I2WA 1QZ2A 3ML8A 4UQZA 1OY3D 5B3SE 4U0UA 3R9AB 4JEUA 3NOGD 3Q75A 4APOA 2YINA 3EHRA 4G24A 2DBAA 5EIDA 3ZW3A 3APFA 2MRIA 1HX8A 3JXIA 4DLQA 3VLFA 3AAAC 3CHMA 4WWPA 4JL0A 3HIZA 3KSQA 1MHQA 1D9SA 4UWLA 3UMVA 4HRLA 1ELWA 4GYYA 5AQ9A 2DYSE 3UM2A 3MV3B 4GZCA 4GZ3A 4GTMA 2C0LA 3IHVA 2F37A 1E8ZA 2WQ7A 3T5XA 2J09A 2J9QA 3PZ1A 3ZXSA 4B0ZA 2QFCA 1G3NB 5AAOA 2IO2C 1FPPA 2ILRA 3PREA 3AJIA 4AM9A 5HI7A 4HVBA 4BT8A 4JPSA 1LD7A 4U95D 5EX3A 3FDHA 4M7CA 2J07A 3KD7A 1E7VA 4ACKA 3ZYKA 5LCWC 1W3BA 2XPYA 3URZA 5H7PA 3D9MA 5DIZA 4BESA 2LSUA 3MA5A 3TL5A 1AP7A 4U8YD 5EYPF 4BSXA 3UKRG 3MEKA 2MOWA 2BF0X 3EDTB 4G26A 5FJYA 2LAIA 5KNHD 2XHEA 3EIJA 5D0OD 4EZLA 1BLXB 2IY0C 4CGWA 2AVPA 4I2ZA 3E32A 3QWPA 4GTOA 3UKUG 4JHRA 1E8WA 1GW6A 1QYMA 3HXEA 3VLDA 5ANRA 4P29A 1Z5SC 4N3BA 3JCKC 2BEDA 3FUHA 2NXPA 1ZB1A 3E34A 3NZSA 4EZKA 1OWNA 4GB9A 2R17C 3L9TA 3UM0A 1IHBA 3FHEA 2WM9A 3RK6A 4LG6A 5BW8C 3UQ3A 5A23A 1JUQA 4UUCA 2L6BA 3ABLE 3I5PA 2WXLA 4OAUC 5HKPA 4C0EA 3CSFA 1QQEA 4HOUA 2OVFA 3Q9UC 4RVBA 2QY7A 3OAWA 5C2YA 3TWRA 1HS6A 4TUUA 4JHJA 2J4DA 1KT0A 4PDXA 2KM4A 4C48B 2X6FA 1N0QA 4BFRA 3FFLA 1DNPA 2AJAA 5CMYA 4JB8P 4EBAG 3RIBA 1WAO1 3CHSA 1Y8MA 3ZHEB 3Q4AB 1FCHA 2FF4A 3BG0B 1SVXA 5T3RA 2YNQA 3SNXA 5BV0A 2X6KA 4HOSA 3VTYA 3U4TA 3JYSA 3L6AA 2ETCA 3PZ3A 2CHZA 2I1KA 3FUKA 2Y1LE 3JQ0A 2XGMA 3I4GA 3D9IA 4AP2A 3V31A 2GROB 2C0MA 3CVUA 3TXNA 2UY1B 3SO8A 3CKCA 5JMND 2ZIRA 1OCOE 2HYZA 3C3QA 3BEEA 2DWZA 2J8SD 3MGBA 1ELKA 1OCZE 2IEJA 3PE4A 2R05A 3MV2B 4CCAA 3ZN3A 2GRNB 1SZAA 3CVYA 2R03A 3AU4A 4G23A 4DX1A 1K8KG 4Q96A 4LNUD 3LJ3A 2EIME 4OVUA 2UWJG 3LXUX 4GTRA 4E6HA 3L17A 2KATA 4A3TA 4GTTA 3QDNA 3JUIA 5CBOA 3FU6A 4LSZE 1E8YA 2XRZA 5BV1A 3TG4A 3FWVA 4BTBA 4CDRA 4ZHBA 2DVWA 1PY1A 4BETA 1EF1C 2HR2A 1SA4A 5EX0A 2L0TB 4IULA 5BXOA 2LUHA 4UQXA 4I9CA 1WY6A 3SI5A 2ETAA 4YDEA 3CVWA 2XCCA 4UWHA 2A5UA 3G2WA 3AG4E 3GZ2A 3HVEB 4Z68A 5BUZA 4BY6A 1TNYA 3D9HA 1KZOA 1Z6TA 3ZYQA 1HH8A 2LXLA 3QC1A 3Q5MA 3TWTA 1P5QA 1WM5A 3D9JA 1N95A 3LJNA 4GMJA 1S70B 2L0IA 3Q78A 4I17A 5KJKA 3EHNA 3FUFA 4X8QA 4HI8A 4EHMA 2OV8A 2MYOA 4GU5A 4GTSA 4HORA 5FWQA 4AV7A 4D10C 2OVBA 4UWGA 2IJGX 3DPYA 5CEAA 4TXQA 2Y69E 4EECA 2CFUA 3QB2A 4QQIA 3TWQA 4APFA 3Q7AA 2XPIA 5E75A 4HOQA 3PVLA 2F0YA 3PEUB 4L2YA 3U64A 2F8YA 2A5EA 3D9LA 3TJPA 1KLXA 3AS4A 2X38A 5AYWD 3DSSA 3PZ4A 3FP3A 4WNFA 1H6KA 3S7FA 5ENQD 2E2EA 4UI9J 3NAWA 2KCVA 3ZPJA 4CZ2D 3IKOB 4JEHA 4K03A 4XZ4A 4G25A 3DEOA 3N71A 5CERB 4KYOB 3PE3A 1D8EA 4EPZA 4LNGA 3C3OA 4LERA 4I6JA 3CQGB 3TAXA 4A1GA 4CT4A 1TJFA 4MBGA 4J8DA 2VSOE 5A7DB 4I43A 3TWUA 2EIKE 2X6IA 1IKND 4L9PA 2WMOA 5CHEE 3D9OA 4GCOA 3Q47B 1Z3YA 4URKA 1WG0A 1JCSA 2XEEA 3B7UX 3S7BA 2P9PG 2NC9A 4YVOA 1HO8A 2XRYA 3G2UA 4HLLA 2OEWA 3BUAA 3ASHA 1XGWA 3B13A 3EU9A 3F6QA 3DSWA 5FQ7A 2GRLA 1WDYA 3JXJA 4KZCA 4O6FA 4KXKB 5DBKA 2AXVA 3PZ2A 5JA4D 2X3MA 3LYAA 4B8AA 3ESLA 4IYPA 2FEZA 3FH8A 2RFMA 4U7EB 3SF4A 1DCQA 3CVPA 4DJAA 2WXIA 1Y6IA 4BX8A 2WPVA 4GTQA 2PM7A 3D9PA 3LVRE 3RRNB 1Q2ZA 1DC2A 3APCA 4K0RA 3V79K 4IN3B 2WQHA 4FU3A 3APDA 4FHKA 1MZCA 1JCRA 3CVXA 2C2LA 3NZUA 3QKYA 4CRWA 5AQBA 3MYVA 3K9IA 3S2AA 4HS2A 2XGOA 1ZU2A 2GRPB 2B6CA 1U2VG 4AY5A 3DPDA 1FVFA 5AJLA 1K1BA 4GA0A 2P9SG 4A1SA 1V54E 3AS8A 3S7JA 1LTXA 4J8SA 5FZQA 1NA3A 2KCKA 2P9LG 1BPOA 2OCCE 3LPZA 4U63A 1N11A 4PS7A 2VSNA 4KBQA 4A55A 3PH0C 5CEDB 5J90A 2XCBA 4FJYA 1SA5A 3UTMA 4I1OB 4N2SA 3HRAA 3AG1E 2H6IA 3L16A 4K5CA 5ENRD 3UPVA 4AY6A 3FU3A 3SD5A 3UUXA 3UINC 1FT1A 4ANXA 1H19A 3CLJA 2XQ0A 4CDNA 5JHAA 4LUNU 3FU0A 2HE0A 1JWFA 3DEPA 2PQNA 4OAVB 2LO6A 4MRUA 3Q49B 2L6JA 3EUVA 4PS8A 2JLBA 3ONLA 4HQDA 4WAFA 1HG2A 1AWCB 5EN5D 3ZHEA 1TNZA 4J8EA 5CECB 4XE0A 3SBSA 2AXUA 5KWDA 4HI9A 4ACLA 5ITZF 4N3CA 4TV3A 2I2OA 4YVQC 3AG3E 4YDYA 3FUIA 3HXFA 3FH7A 5ENOD 3EHQA 4LCTA 4CGVA 4TRQA 3D9NA 3FUMA 1KT1A 4EBAA 4F1SA 2LNIA 3UT8A 2Q7FA 1YMPA 2P9IG 4A63B 1BI7B 1N54A 4I1MA 3HDXA 1KZPA 3NBNB 3RRMB 4YNDA 3J5QB 3DSVA 4O1PA 5FIOA 5AQ7A 1U3DA 3P2BA 1NFIE 4N39A 4W9RA 1DCEA 1OCRE 3ASOE 2H6HA 4G2VA 3FUDA 4DRXE 1H6OA 2YQ8A 4IRUA 2XGSA 1HG5A 3U9WA 3D3MA 2XS8A 2BUGA 2P58C 4HOTA 5T8IA 3FUNA 5B1AE 2OOEA 3SHFA 3U3WA 1TJCA 4DPRA 4U07A 4ATGA 1TN7A 2IFUA 5FINA 3TWVA 1INZA 4A3VA 1EPUA 4Q94A 1ZBPA 3SY2A 5EKQD 4XIFA 4I6EA 4H7XA 2ONDA 2ZXWE 4ATZD 4RQIA 1OUVA 2EINE 2RKKA 3SFXA 3T9KA 4GYWA 1JPLA 1OWOA 4ANVA 1NI1A 4GZDA 5B1BE 3SFYA 2WB2A 5G04J 5J08A 3OXFA 2LSVA 5AJDA 1MX4A 4GZ6A 1E8XA 1N9AA 2Y4UA 2P2CP 3R7RA 2WVIA 2PZIA 5ARGA 3FTXA 5HS0A 4F7AA 2P9UG 2HM8A 2A4ZA 3T8KA 1HFAA 2WXRA 2AXZA 2IF4A 3L08A 2QYUA 3C5RA 1O5MA 5CBNA 2ZGGA 3QJZA 3C72A 3BU8A 1V55E 3V2XA 2KCLA 4JXTA 4AJWA 5ARFA 3GW4A 3MKRA 3QNKA 1X81A 4F3VA 3KSLA 3EU5A 2IOSA 2WXJA 1RW2A 4ILGA 3LCAA 3UT7A 2I6HA 3KS2A 4FHJA 1H2VC 1IHGA 3UX4A 1LD8A 3SZ7A 1TNUA 1UW4B 4B93B 3ONKA 1S63A 1OXJA 1H0AA 5D0QD 5KJNA 3MZLB 1UN8A 1IXVA 2QYJA 4F53A 1FT2A 4OYSA 1E90A 5BXUA 2GRMA 2HO1A 3Q7FA 3LY8A 2VGXB 1HZ4A 4C9BB 3TWSA 2V5QC 3KEAA 3ZUVB 3U66A 2PQRA 2QC9A 3D9KA 2E0IA 1N52A 2AW6A 3W9FA 2EILE 3IHYA 3IEGA 2VGXA 5JHBA 5FQ4A 4UI9K 4U0SA 3PZDA 3LY7A 1TN6A 4QFVA 1E7UA 2P9NG 2J4BA 3CVQA 3EIQC 4BERA 2RG8A 4H7YA 4K5AB 4WNDA 1N4QA 3SGHA 4YDWA 2DYRE 4ANUA 3ABME 3DRAA 3B95A 3L22A 2WXPA 3CK8A 4J8YA 3CHOA 1L5JA 2ETBA 3I4RB 4DX7D 3GYZA 3IV0A 5EYLA 5ENPD 5FQ6A 4ILHB 1HU3A 2FI7A 3QWVA 5HRYA 3R9MA 2LAHA 3B7TA 2CG3A 1D8DA 4LNBA 4LRZA 4KMOA 4U96D 5EIBE 1UJKA 3LVQE 1BI8B 2XZDG 1HF8A 1PAQA 3MKQA 5G55A 4BX9A 1N4SA 5G05C 4FJZA 4B89A 3V2OA 3E37A 3CK9A 2DZNA 3T8MA 4CT0A 2BKGA 2XENA 2JABA 3L54A 3P1UA 3R7QA 3Q79A 4JA9A 5T4YA 5CCLA 1TNBA 5KJMA 4RG6A 2WXKA 3DBSA 3ULYA 3CHPA 4GYOA 2GGFA 3CGHA 3IXEA 4WNEA 1LF8A 3HXCA 3JQ1A 1S0PA 3MJWA 2OEVA 4F6RD 3ENEA 1E96B 3PDNA 2FO1E 1B89A 4EZJA 4CYMD 4J0UA 4LEUA 3PUJA 4UWFA 3FEXA 4RSYA 1OWPA 1MQSA 2R59A 3G2VA 3MCXA 1VDYA 4I9EA 2CHXA 4OVVA 3DSUA 4AXHA 2XPZA 3TG5A 1K1AA 1MJ0A 4L1BA 2WXOA 1IYGA 4JC8A 4G8LA 1QNFA 2WQ6A 5D2MC 2PNNA 3B7SA 3QAQA 1U3CA 3C3RA 1XNFA 4ABNA 5G04C 4NURA 2VTBA 5BPPA 3FTSA 4XX5A 3E30A 3AU5A 3KAEA 4J8FA 5AARA 5EDSA 3MX3A 4TUMA 3UIOC 3ZYMA 4BWRA 5AENA 3ISMC 3ZKJA 5CMWA 3O4ZA 5LX8A 1N94A 4XKBA 1O1RA 1KPSB 1O1TA 3O48A 3PEVB 3FY4A 4HFGA 1JWGA 4BSZB 3HXDA 4GAAA 3X2QE 4FA6A 3CSTA 1TR4A 4HXIA 3Q73A 2L9BA 5LOZA 3CVLA 3LS8A 4UQYA 4RG9A 1OCCE 4AVXA 3ZU7B 4HRMB 3DSXA 3WG7E 3ABKE 2EIJE 4G1TA 3FTYA 5JJ6A 3UM3A 1OWMA 3VLEA 2RD0A 2CHWA 4CEMA 5M72A 4HB5A 2VSXE 4K5BA 5G05J 3ZEFA 4HRNA 5BT1A 1NA0A 1S64A 3GZSA 1TYQG 1IQUA 3CHQA 2KC7A 4EQFA 4PUCA 3E4BA 3UIPC 3WXXA 4UI9C 3ZGQA 5CRVA 3CVVA 2WXNA 3RJVA 4JA7A 3RRUA 2KXPC 4O1OA 5CRUA 5LFAA 3FTWA 2EQXA 1OT8A 3L82A 4C0MA 1MX6A 1OWLA 5AN8A 3FTUA 3SQVA 4I6GA 3ASDA 3CR3A 3BQOA 1HE8A 3QARA 2VGEA 3CIAA 3E33A 4XI9A 4DX6D 2P9KG 2H6FA 2UY1A 2VYIA 5JJTA 4GMRA
chains in the Genus database with same CATH topology
1H6KA 3MV3B 3S7FA 4GZCA 2PZIA 4GZ3A 5ARGA 3FTXA 4F7AA 2HM8A 3LDZA 2E2EA 2A4ZA 4UI9J 1HFAA 2KZTB 2C0LA 2WXRA 2AXZA 3IHVA 1E8ZA 2IF4A 2KCVA 3ZPJA 2WQ7A 3IKOB 4JEHA 2VQ2A 3L08A 4V3IA 4K03A 3SBTB 3T5XA 3FU5A 2J09A 2J9QA 2KZTA 3ZXSA 4B0ZA 2QFCA 4XZ4A 1TEZA 3QJZA 5G2NA 4G25A 2ILRA 3PREA 5C1DA 4AM9A 2KCLA 4JXTA 4AJWA 3N71A 4M3OA 4I1AA 5ARFA 5HI7A 3CKBA 4KYOB 4HVBA 3GW4A 4BT8A 3MKRA 3B7RL 3PE3A 4JPSA 2WXQA 1UJJA 3QNKA 2J08A 5EX3A 4WWNA 4F3VA 5FQ8A 4EPZA 2WXFA 3FDHA 1H2UA 2J07A 3KD7A 4LERA 2IOSA 4I6JA 1E7VA 4ACKA 3ZYKA 2WXJA 3CQGB 3TAXA 3PRZA 4A1GA 3BG1B 4CT4A 5LCWC 1TJFA 3Q15A 4ILGA 1W3BA 4XKCA 4J8DA 2VSOE 2XPYA 3LCAA 3URZA 2V0PA 2I6HA 3KS2A 5A7DB 3UT7A 4GA1A 4I43A 4FHJA 3D9MA 4MKTA 1H2VC 2X6IA 5DIZA 4FADA 3LY9A 1IHGA 2WMOA 3CEQA 2AWIA 2LSUA 5CHEE 3UX4A 1NZNA 3MA5A 3D9OA 4GCOA 3IBEA 1Z3YA 3Q47B 3RU0A 3TL5A 4URKA 3SZ7A 2VGYA 5FZRA 1DVPA 1UW4B 2IONA 4BSXA 3ONKA 3MEKA 2MOWA 3B7UX 3CQCB 3S7BA 3LKUA 2BF0X 2NC9A 3EDTB 4KVMA 4YVOA 1IQRA 2ZU6B 1HO8A 4G26A 5FJYA 2JEKA 2LAIA 2XRYA 3G2UA 1H0AA 1UN9A 5D0QD 3ASHA 4FC8A 1XGWA 3B13A 5KJNA 3MZLB 4ANWA 4FLHA 5KCMA 1UN8A 5FQ7A 2WXGA 4F53A 2XHEA 3S7DA 2GRLA 1E90A 4NRHB 3EIJA 4OYSA 4KZCA 4O6FA 5D0OD 4EZLA 4PS3A 2GRMA 2HO1A 3LY8A 4KXKB 5DBKA 2AXVA 2VGXB 1HZ4A 4C9BB 4CGWA 2CG2A 4N3AA 2X3MA 2AVPA 4I2ZA 3QWPA 2CFZA 3LYAA 4L23A 4B8AA 2PM6A 3ESLA 4IYPA 4AIFA 4JHRA 1EDUA 1E8WA 2FEZA 3FH8A 4ME2A 3U66A 2PQRA 3SF4A 3D9KA 1GW6A 3ZIMA 2E0IA 1N52A 3VTXA 3VLDA 4NQ0A 1HXIA 3ULQA 5ANRA 4P29A 2AW6A 3CVPA 3IHYA 4KZ0A 3SFZA 4N3BA 3JCKC 3FUHA 3PNLB 2NXPA 4DJAA 3IEGA 2VGXA 2WXIA 5FQ4A 4UWKA 5JHBA 4UI9K 3ZVVA 4DLOA 3NZSA 1Y6IA 4U0SA 3PZDA 4EZKA 1OWNA 3LY7A 2V8SE 2R17C 4GB9A 4QFVA 4AEZC 4BX8A 1E7UA 2IQCA 2WPVA 3FH5A 4JVSA 3ZFWA 2J4BA 3CVQA 2PM7A 3D9PA 3EIQC 3LVRE 3RRNB 3FHEA 2RG8A 4H7YA 3ML9A 4MS6A 2WM9A 3L13A 5JJ7A 3RK6A 4J6IA 5BW8C 3UQ3A 3APCA 4WNDA 5A23A 5HQ8A 4K0RA 3NQPA 3SGHA 1JUQA 4IN3B 1X5BA 2WQHA 4ANUA 4JZYA 4FU3A 3APDA 4FHKA 4MLPA 4HLEA 3I5PA 2WXLA 3L22A 2WXPA 4C0EA 3ASFA 3CK8A 3CVXA 2C2LA 3NZUA 3G2TA 3CHOA 3CSFA 3QKYA 4Y6WA 1QQEA 4B94A 4CRWA 1L5JA 4HOUA 2OVFA 4GMLA 3I4RB 3GYZA 3IV0A 4RVBA 2QY7A 3OAWA 5ENNA 3MYVA 5FQ6A 2X6JA 3K9IA 4ILHB 3NF1A 5C2YA 3S2AA 4HS2A 1HU3A 2FI7A 3QWVA 4BT9A 2XGOA 1ZU2A 1HS6A 5AIJA 4TUUA 5BNWA 3HHMA 4GCNA 3ESKA 4JHJA 2J4DA 4AY5A 3DPDA 1FVFA 2M63A 5AJLA 2LAHA 1KT0A 3B7TA 5FZSA 4PDXA 2VSYA 2CG3A 1PC2A 2KM4A 2X6FA 4GA0A 4LRZA 4BFRA 3FFLA 1DNPA 2Y4TA 4A1SA 4KMOA 3FUEA 2XEVA 4FLBA 2IU1A 5CMYA 3AS8A 4U04A 3S7JA 1UJKA 3LVQE 4GZ5A 4EBAG 3RIBA 1WAO1 1HF8A 4J8SA 1PAQA 4JW1A 3MKQA 3CHSA 1Y8MA 3ZYLA 5FZQA 5G55A 1NA3A 2KCKA 4WWOA 3ZHEB 3Q4AB 1BPOA 1FCHA 4FP7A 2FF4A 4BX9A 5G05C 4FJZA 3BG0B 4B89A 3LPZA 4U63A 5T3RA 2YNQA 3CK9A 4PS7A 3SNXA 2VSNA 3T8MA 5BV0A 4CT0A 3P1UA 3L54A 3C98A 4KBQA 1NP7A 3R7QA 2X6KA 4A55A 4JA9A 3PH0C 4HOSA 5T4YA 5CCLA 2WXHA 5J90A 4KT6B 5KJMA 2WMNA 3VTYA 3U4TA 3JYSA 2XCBA 4FJYA 3L6AA 4RG6A 4DI3A 5LP0A 2WXKA 4I1OB 2FO7A 3DBSA 1SZ9A 5KJLA 4N2SA 2CHZA 3CHPA 4GYOA 2GGFA 3CGHA 4E85A 4WNEA 2I1KA 3L16A 4L2LA 3EJNA 1LF8A 3FUKA 3JQ1A 4Y6CA 1S0PA 2XGMA 3JQ0A 3UPVA 2WXMA 3I4GA 4AY6A 3FU3A 3MJWA 3D9IA 4AP2A 3SD5A 3UUXA 3FTVA 4CDMA 3ENEA 4ANXA 1E96B 1H19A 3CLJA 2C0MA 2XQ0A 3PDNA 4CDNA 3QWWA 5JHAA 4LUNU 4WNGA 1B89A 4EZJA 3CVUA 3TXNA 3FU0A 3AS5A 4J0UA 1JWFA 2UY1B 3PS6A 4XI0A 4KVOA 3ASGA 3HVEA 5CCMA 3KEZA 3CKCA 4LEUA 3PUJA 4N5CA 2PQNA 2V5FA 4PH4B 4UWFA 2LO6A 4MRUA 3RKVA 2HYZA 3FEXA 3Q49B 4RSYA 3BEEA 1OWPA 4NACA 2L6JA 1MQSA 1Z3XA 2R59A 3G2VA 3MGBA 4AOFA 3MCXA 4PS8A 1VDYA 2JLBA 3ONLA 4WAFA 1ELKA 1HG2A 4I9EA 2CHXA 4N2QA 4OVVA 3PE4A 2XPZA 3HYMB 3ZHEA 4AXHA 3TG5A 3QK0A 4J8EA 4Q69A 3MV2B 2NSZA 4L1BA 1ELRA 2FULA 4XE0A 2AXUA 2VJ8A 2WXOA 3SBSA 3ZN3A 4GA2A 4CCAA 1IYGA 1SZAA 3CVYA 2J49A 4JC8A 1EYHA 4ACLA 3AU4A 1QNFA 2I9CA 4N3CA 4G23A 4TV3A 2WQ6A 2I2OA 4DK5A 1H2TC 3B7SA 4YVQC 4Q96A 3TXMA 3QAQA 1U3CA 1XNFA 3FUIA 4ABNA 3LJ3A 5G04C 3FH7A 4NURA 4OVUA 4WUYA 3RO3A 5BPPA 2VTBA 2Y3AA 4FULA 2UWJG 3FEYA 3LXUX 4LCTA 3TGOA 3OXGA 3FTSA 4E6HA 4XX5A 3L17A 4TRQA 2IOLA 2KATA 4A3TA 4CGVA 5LCWJ 3D9NA 2X6HA 3QDNA 3AU5A 3JUIA 3FU6A 3PNTB 4B8CB 3FUMA 3KAEA 1E8YA 1KT1A 4J8FA 5E76A 4EBAA 1A17A 4F1SA 5EDSA 2XRZA 2PL2A 4BTAA 5BV1A 2LNIA 3TG4A 3MX3A 3FWVA 3UT8A 2Q7FA 3ZYMA 3GZ1A 4BWRA 4BTBA 4CDRA 5AENA 1PY1A 5A6CA 1EF1C 5CMWA 2HR2A 5EX0A 3O4ZA 5LX8A 2L0TB 3MKQB 3RO2A 4IULA 2R5SA 3FUJA 3CV0A 1N54A 1UG3A 4UQXA 4I9CA 4XKBA 3QOUA 1WY6A 2GW1A 5BT1A 3PUKA 3SI5A 4I1MA 3HDXA 3O48A 3PEVB 3CVWA 3FY4A 4HFGA 1JWGA 2XCCA 4GAAA 3RRMB 4FA6A 3CSTA 4HXIA 2A5UA 3G2WA 3HVEB 3G2SA 3GZ2A 4UWHA 4YNDA 4GPKA 2L9BA 2V4LA 5FTPA 2MHKA 5BUZA 5LOZA 3CVLA 2YHEA 3LS8A 4BY6A 3CK7A 2I1JA 4UQYA 4L7TA 1SQMA 4RG9A 1U3DA 3P2BA 3LEWA 3T5VA 4AVXA 1Z6TA 4N39A 3ZYQA 1HH8A 4W9RA 3QC1A 3UT4A 4G1TA 3Q5MA 4G2VA 5ANLA 3FTYA 3FUDA 4ILIA 5JJ6A 1P5QA 2FBNA 2YQ8A 4IRUA 1WM5A 2XGSA 3D9JA 4U0ZA 1HG5A 1OWMA 2VTBB 3U9WA 4U8HA 3ZRHA 3OXLA 4GMJA 3D3MA 2L0IA 3VLEA 2BUGA 4I17A 2BTDA 3OTNA 5KJKA 3EHNA 3EHMA 2P58C 4HOTA 2RD0A 3FUFA 2CHWA 4CEMA 5M72A 5T8IA 2VSXE 2OV8A 4GU5A 3FUNA 5G05J 3ZEFA 4HORA 3CVNA 4G11A 3FULA 1NA0A 5FWQA 2OOEA 3SHFA 3FTZA 3GZSA 4AV7A 3U3WA 1TJCA 1IQUA 2OVBA 4D10C 4R7LA 4DPRA 3CHQA 2KC7A 4UWGA 4U07A 4ATGA 2DCPA 4EQFA 2IFUA 3E4BA 1YA0A 4PUCA 3WXXA 4UI9C 5FT9A 3ZGQA 3CHRA 1FVHA 3I3NA 3CVVA 2IJGX 2WXNA 1INZA 3RJVA 4A3VA 4JA7A 1EPUA 4Q94A 2DIWA 1ZBPA 3QB2A 2CFUA 5EKQD 4XIFA 3RRUA 4DI4A 4EECA 2YHCA 4APFA 4I6EA 4H7XA 4JHKA 2ONDA 2XPIA 5E75A 4I2WA 4HOQA 1QZ2A 5LFAA 3FTWA 3ML8A 4UQZA 3PVLA 2EQXA 1OUVA 4GYWA 3PEUB 4U0UA 1JPLA 1OWOA 4ANVA 3R9AB 4L2YA 4C0MA 4GZDA 4JEUA 3U64A 2WB2A 1OWLA 4APOA 2YINA 5G04J 3D9LA 2DBAA 3FTUA 4G24A 5J08A 4I6GA 3OXFA 3ZW3A 3TJPA 2LSVA 3APFA 5AJDA 2MRIA 3ASDA 1KLXA 1HX8A 3AS4A 3CR3A 4DLQA 2X38A 1HE8A 3QARA 3CHMA 5AYWD 4WWPA 3VLFA 4JL0A 3HIZA 4GZ6A 1E8XA 1MHQA 3CIAA 4XI9A 4UWLA 3FP3A 3UMVA 1ELWA 2Y4UA 4GYYA 2UY1A 4WNFA 2VYIA 5JJTA 3R7RA 2WVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEZ A;  3CKC A;  5FQ6 A;  3GZS A;  3MYV A;  3CGH A;  4F7A A;  3QNK A;  4Q69 A;  3HDX A;  4MRU A;  3NQP A;  3SGH A;  5FQ8 A;  5E76 A;  5FQ7 A;  3EJN A;  3FDH A;  3JQ1 A;  4F53 A;  3JQ0 A;  4PUC A;  3I4G A;  3MX3 A;  4LER A;  5T3R A;  3CK9 A;  3MCX A;  3SNX A;  3L22 A;  3P1U A;  5FQ4 A;  3CK8 A;  3OTN A;  5T4Y A;  3EHN A;  3EHM A;  5LX8 A;  3CK7 A;  5J90 A;  4L7T A;  3JYS A;  3LEW A;  5E75 A;  3CKB A;  3IV0 A; 
#chains in the Genus database with same CATH topology
 3LDZ A;  3RAU A;  2KZT B;  2VQ2 A;  4V3I A;  2R02 A;  3SBT B;  3FU5 A;  2KZT A;  1TEZ A;  1JCQ A;  5G2N A;  1H6P A;  5C1D A;  3ASN E;  4HBD A;  4M3O A;  4I1A A;  3CKB A;  1A5E A;  3B7R L;  2Y0B G;  2WXQ A;  1UJJ A;  4ZFH A;  2J08 A;  2KBX A;  4WWN A;  5FQ8 A;  2WXF A;  1H2U A;  1RZ4 A;  3PRZ A;  3DST A;  3BG1 B;  2B0O E;  3Q15 A;  4XKC A;  2V0P A;  4GA1 A;  2XEH A;  4MKT A;  4FAD A;  3LY9 A;  3CEQ A;  2AWI A;  1NZN A;  3NB2 A;  3IBE A;  3RU0 A;  2VGY A;  5FZR A;  1DVP A;  4G8K A;  1N4P A;  2ION A;  1YCS B;  4XEI G;  3CQC B;  3LKU A;  4KVM A;  1IQR A;  2ZU6 B;  2JEK A;  4GTV A;  3J5P A;  1UN9 A;  4FC8 A;  1TN8 A;  4ANW A;  4FLH A;  5KCM A;  5IY5 E;  2WXG A;  1N4R A;  3S7D A;  4NRH B;  3DXK G;  4PS3 A;  1N0R A;  2CG2 A;  4N3A A;  2CFZ A;  2ZIS A;  4L23 A;  4U8V D;  2PM6 A;  5D66 A;  4AIF A;  1EDU A;  4ME2 A;  3ZIM A;  3UI2 A;  3VTX A;  4NQ0 A;  1HXI A;  3ULQ A;  1SW6 A;  4KZ0 A;  3SFZ A;  3TWX A;  3PNL B;  4UWK A;  3ZVV A;  4DLO A;  2V8S E;  4AEZ C;  3ZFW A;  2IQC A;  3FH5 A;  4JVS A;  3HG0 D;  2QZA A;  4MS6 A;  3ML9 A;  3L13 A;  5JJ7 A;  4J6I A;  5HQ8 A;  3NQP A;  1X5B A;  3V30 A;  4JZY A;  4HLE A;  4MLP A;  2XS1 A;  3ASF A;  3G2T A;  4B94 A;  4Y6W A;  5ENS D;  4GML A;  5ENN A;  2X6J A;  3NF1 A;  5AIJ A;  2BKK B;  3RSE G;  4BT9 A;  5BNW A;  5AQA A;  3HHM A;  4GCN A;  3ESK A;  2M63 A;  4DUI A;  5FZS A;  4F1P A;  5ENT D;  2VSY A;  1PC2 A;  3W9G A;  2Y4T A;  3FUE A;  2XEV A;  4FLB A;  2IU1 A;  2ZGD A;  4U04 A;  4GZ5 A;  4JW1 A;  3ZYL A;  4WWO A;  3DXM G;  4FP7 A;  4DX5 D;  3C98 A;  5KNG A;  1NP7 A;  3DWL G;  2WXH A;  2V4H C;  4KT6 B;  2WMN A;  4TXP A;  2NYJ A;  1NL4 A;  5LP0 A;  4DI3 A;  1YYH A;  2FO7 A;  1SZ9 A;  3B7B A;  5KJL A;  4E85 A;  4L2L A;  3EJN A;  4Y6C A;  2WXM A;  2F8X K;  3FTV A;  4CDM A;  2RFA A;  1BU9 A;  3QWW A;  3NOC D;  4WNG A;  3UXG A;  3Q9N C;  3AS5 A;  4NIK A;  4O60 A;  3PS6 A;  4XI0 A;  4KVO A;  3ASG A;  3HVE A;  3TWW A;  5CCM A;  1QBQ A;  3KEZ A;  4HNA D;  3AG2 E;  4N5C A;  4PH4 B;  2V5F A;  1BD8 A;  3RKV A;  4NAC A;  1MYO A;  1Z3X A;  4AOF A;  3ZXP A;  4N2Q A;  1K3Z D;  3HYM B;  3QK0 A;  3JUE A;  3ULE G;  4Q69 A;  2NSZ A;  1ELR A;  2FUL A;  1TNO A;  2VJ8 A;  3HXB A;  4GA2 A;  2J49 A;  1EYH A;  2I9C A;  4DK5 A;  1H2T C;  3TXM A;  2GRQ B;  3RO3 A;  4WUY A;  2Y3A A;  4FUL A;  1O1S A;  3FEY A;  3TGO A;  3OXG A;  5LCW J;  2IOL A;  2X6H A;  4B8C B;  3PNT B;  5E76 A;  1A17 A;  2PL2 A;  2LXM A;  4BTA A;  3GZ1 A;  4YDO A;  5A6C A;  3MKQ B;  3RO2 A;  2R5S A;  3FUJ A;  3CV0 A;  1UG3 A;  3QOU A;  4BEP A;  2GW1 A;  4DX2 A;  3PUK A;  4TXR A;  4GPM A;  2XZT G;  2R2L A;  3G2S A;  4GPK A;  2V4L A;  4J7W A;  2GRR B;  5FTP A;  2MHK A;  5KBA A;  2YHE A;  1UOH A;  3CK7 A;  2I1J A;  4L7T A;  1SQM A;  3T5V A;  3LEW A;  4JD2 G;  2H6G A;  5EIL A;  2IO3 C;  4N5Q A;  3UT4 A;  5ANL A;  4ILI A;  2FBN A;  4U0Z A;  2VTB B;  4U8H A;  3ZRH A;  3OXL A;  2BTD A;  3OTN A;  3EHM A;  3CVN A;  4G11 A;  3FUL A;  3FTZ A;  1MX2 A;  4GTP A;  2DZO A;  4R7L A;  3ZNG A;  3UM1 A;  2DCP A;  4RLY A;  1YA0 A;  5FT9 A;  3CHR A;  1FVH A;  3I3N A;  4DI4 A;  2DIW A;  2YHC A;  4JHK A;  4I2W A;  1QZ2 A;  3ML8 A;  4UQZ A;  1OY3 D;  5B3S E;  4U0U A;  3R9A B;  4JEU A;  3NOG D;  3Q75 A;  4APO A;  2YIN A;  3EHR A;  4G24 A;  2DBA A;  5EID A;  3ZW3 A;  3APF A;  2MRI A;  1HX8 A;  3JXI A;  4DLQ A;  3VLF A;  3AAA C;  3CHM A;  4WWP A;  4JL0 A;  3HIZ A;  3KSQ A;  1MHQ A;  1D9S A;  4UWL A;  3UMV A;  4HRL A;  1ELW A;  4GYY A;  5AQ9 A;  2DYS E;  3UM2 A;  3MV3 B;  4GZC A;  4GZ3 A;  4GTM A;  2C0L A;  3IHV A;  2F37 A;  1E8Z A;  2WQ7 A;  3T5X A;  2J09 A;  2J9Q A;  3PZ1 A;  3ZXS A;  4B0Z A;  2QFC A;  1G3N B;  5AAO A;  2IO2 C;  1FPP A;  2ILR A;  3PRE A;  3AJI A;  4AM9 A;  5HI7 A;  4HVB A;  4BT8 A;  4JPS A;  1LD7 A;  4U95 D;  5EX3 A;  3FDH A;  4M7C A;  2J07 A;  3KD7 A;  1E7V A;  4ACK A;  3ZYK A;  5LCW C;  1W3B A;  2XPY A;  3URZ A;  5H7P A;  3D9M A;  5DIZ A;  4BES A;  2LSU A;  3MA5 A;  3TL5 A;  1AP7 A;  4U8Y D;  5EYP F;  4BSX A;  3UKR G;  3MEK A;  2MOW A;  2BF0 X;  3EDT B;  4G26 A;  5FJY A;  2LAI A;  5KNH D;  2XHE A;  3EIJ A;  5D0O D;  4EZL A;  1BLX B;  2IY0 C;  4CGW A;  2AVP A;  4I2Z A;  3E32 A;  3QWP A;  4GTO A;  3UKU G;  4JHR A;  1E8W A;  1GW6 A;  1QYM A;  3HXE A;  3VLD A;  5ANR A;  4P29 A;  1Z5S C;  4N3B A;  3JCK C;  2BED A;  3FUH A;  2NXP A;  1ZB1 A;  3E34 A;  3NZS A;  4EZK A;  1OWN A;  4GB9 A;  2R17 C;  3L9T A;  3UM0 A;  1IHB A;  3FHE A;  2WM9 A;  3RK6 A;  4LG6 A;  5BW8 C;  3UQ3 A;  5A23 A;  1JUQ A;  4UUC A;  2L6B A;  3ABL E;  3I5P A;  2WXL A;  4OAU C;  5HKP A;  4C0E A;  3CSF A;  1QQE A;  4HOU A;  2OVF A;  3Q9U C;  4RVB A;  2QY7 A;  3OAW A;  5C2Y A;  3TWR A;  1HS6 A;  4TUU A;  4JHJ A;  2J4D A;  1KT0 A;  4PDX A;  2KM4 A;  4C48 B;  2X6F A;  1N0Q A;  4BFR A;  3FFL A;  1DNP A;  2AJA A;  5CMY A;  4JB8 P;  4EBA G;  3RIB A;  1WAO 1;  3CHS A;  1Y8M A;  3ZHE B;  3Q4A B;  1FCH A;  2FF4 A;  3BG0 B;  1SVX A;  5T3R A;  2YNQ A;  3SNX A;  5BV0 A;  2X6K A;  4HOS A;  3VTY A;  3U4T A;  3JYS A;  3L6A A;  2ETC A;  3PZ3 A;  2CHZ A;  2I1K A;  3FUK A;  2Y1L E;  3JQ0 A;  2XGM A;  3I4G A;  3D9I A;  4AP2 A;  3V31 A;  2GRO B;  2C0M A;  3CVU A;  3TXN A;  2UY1 B;  3SO8 A;  3CKC A;  5JMN D;  2ZIR A;  1OCO E;  2HYZ A;  3C3Q A;  3BEE A;  2DWZ A;  2J8S D;  3MGB A;  1ELK A;  1OCZ E;  2IEJ A;  3PE4 A;  2R05 A;  3MV2 B;  4CCA A;  3ZN3 A;  2GRN B;  1SZA A;  3CVY A;  2R03 A;  3AU4 A;  4G23 A;  4DX1 A;  1K8K G;  4Q96 A;  4LNU D;  3LJ3 A;  2EIM E;  4OVU A;  2UWJ G;  3LXU X;  4GTR A;  4E6H A;  3L17 A;  2KAT A;  4A3T A;  4GTT A;  3QDN A;  3JUI A;  5CBO A;  3FU6 A;  4LSZ E;  1E8Y A;  2XRZ A;  5BV1 A;  3TG4 A;  3FWV A;  4BTB A;  4CDR A;  4ZHB A;  2DVW A;  1PY1 A;  4BET A;  1EF1 C;  2HR2 A;  1SA4 A;  5EX0 A;  2L0T B;  4IUL A;  5BXO A;  2LUH A;  4UQX A;  4I9C A;  1WY6 A;  3SI5 A;  2ETA A;  4YDE A;  3CVW A;  2XCC A;  4UWH A;  2A5U A;  3G2W A;  3AG4 E;  3GZ2 A;  3HVE B;  4Z68 A;  5BUZ A;  4BY6 A;  1TNY A;  3D9H A;  1KZO A;  1Z6T A;  3ZYQ A;  1HH8 A;  2LXL A;  3QC1 A;  3Q5M A;  3TWT A;  1P5Q A;  1WM5 A;  3D9J A;  1N95 A;  3LJN A;  4GMJ A;  1S70 B;  2L0I A;  3Q78 A;  4I17 A;  5KJK A;  3EHN A;  3FUF A;  4X8Q A;  4HI8 A;  4EHM A;  2OV8 A;  2MYO A;  4GU5 A;  4GTS A;  4HOR A;  5FWQ A;  4AV7 A;  4D10 C;  2OVB A;  4UWG A;  2IJG X;  3DPY A;  5CEA A;  4TXQ A;  2Y69 E;  4EEC A;  2CFU A;  3QB2 A;  4QQI A;  3TWQ A;  4APF A;  3Q7A A;  2XPI A;  5E75 A;  4HOQ A;  3PVL A;  2F0Y A;  3PEU B;  4L2Y A;  3U64 A;  2F8Y A;  2A5E A;  3D9L A;  3TJP A;  1KLX A;  3AS4 A;  2X38 A;  5AYW D;  3DSS A;  3PZ4 A;  3FP3 A;  4WNF A;  1H6K A;  3S7F A;  5ENQ D;  2E2E A;  4UI9 J;  3NAW A;  2KCV A;  3ZPJ A;  4CZ2 D;  3IKO B;  4JEH A;  4K03 A;  4XZ4 A;  4G25 A;  3DEO A;  3N71 A;  5CER B;  4KYO B;  3PE3 A;  1D8E A;  4EPZ A;  4LNG A;  3C3O A;  4LER A;  4I6J A;  3CQG B;  3TAX A;  4A1G A;  4CT4 A;  1TJF A;  4MBG A;  4J8D A;  2VSO E;  5A7D B;  4I43 A;  3TWU A;  2EIK E;  2X6I A;  1IKN D;  4L9P A;  2WMO A;  5CHE E;  3D9O A;  4GCO A;  3Q47 B;  1Z3Y A;  4URK A;  1WG0 A;  1JCS A;  2XEE A;  3B7U X;  3S7B A;  2P9P G;  2NC9 A;  4YVO A;  1HO8 A;  2XRY A;  3G2U A;  4HLL A;  2OEW A;  3BUA A;  3ASH A;  1XGW A;  3B13 A;  3EU9 A;  3F6Q A;  3DSW A;  5FQ7 A;  2GRL A;  1WDY A;  3JXJ A;  4KZC A;  4O6F A;  4KXK B;  5DBK A;  2AXV A;  3PZ2 A;  5JA4 D;  2X3M A;  3LYA A;  4B8A A;  3ESL A;  4IYP A;  2FEZ A;  3FH8 A;  2RFM A;  4U7E B;  3SF4 A;  1DCQ A;  3CVP A;  4DJA A;  2WXI A;  1Y6I A;  4BX8 A;  2WPV A;  4GTQ A;  2PM7 A;  3D9P A;  3LVR E;  3RRN B;  1Q2Z A;  1DC2 A;  3APC A;  4K0R A;  3V79 K;  4IN3 B;  2WQH A;  4FU3 A;  3APD A;  4FHK A;  1MZC A;  1JCR A;  3CVX A;  2C2L A;  3NZU A;  3QKY A;  4CRW A;  5AQB A;  3MYV A;  3K9I A;  3S2A A;  4HS2 A;  2XGO A;  1ZU2 A;  2GRP B;  2B6C A;  1U2V G;  4AY5 A;  3DPD A;  1FVF A;  5AJL A;  1K1B A;  4GA0 A;  2P9S G;  4A1S A;  1V54 E;  3AS8 A;  3S7J A;  1LTX A;  4J8S A;  5FZQ A;  1NA3 A;  2KCK A;  2P9L G;  1BPO A;  2OCC E;  3LPZ A;  4U63 A;  1N11 A;  4PS7 A;  2VSN A;  4KBQ A;  4A55 A;  3PH0 C;  5CED B;  5J90 A;  2XCB A;  4FJY A;  1SA5 A;  3UTM A;  4I1O B;  4N2S A;  3HRA A;  3AG1 E;  2H6I A;  3L16 A;  4K5C A;  5ENR D;  3UPV A;  4AY6 A;  3FU3 A;  3SD5 A;  3UUX A;  3UIN C;  1FT1 A;  4ANX A;  1H19 A;  3CLJ A;  2XQ0 A;  4CDN A;  5JHA A;  4LUN U;  3FU0 A;  2HE0 A;  1JWF A;  3DEP A;  2PQN A;  4OAV B;  2LO6 A;  4MRU A;  3Q49 B;  2L6J A;  3EUV A;  4PS8 A;  2JLB A;  3ONL A;  4HQD A;  4WAF A;  1HG2 A;  1AWC B;  5EN5 D;  3ZHE A;  1TNZ A;  4J8E A;  5CEC B;  4XE0 A;  3SBS A;  2AXU A;  5KWD A;  4HI9 A;  4ACL A;  5ITZ F;  4N3C A;  4TV3 A;  2I2O A;  4YVQ C;  3AG3 E;  4YDY A;  3FUI A;  3HXF A;  3FH7 A;  5ENO D;  3EHQ A;  4LCT A;  4CGV A;  4TRQ A;  3D9N A;  3FUM A;  1KT1 A;  4EBA A;  4F1S A;  2LNI A;  3UT8 A;  2Q7F A;  1YMP A;  2P9I G;  4A63 B;  1BI7 B;  1N54 A;  4I1M A;  3HDX A;  1KZP A;  3NBN B;  3RRM B;  4YND A;  3J5Q B;  3DSV A;  4O1P A;  5FIO A;  5AQ7 A;  1U3D A;  3P2B A;  1NFI E;  4N39 A;  4W9R A;  1DCE A;  1OCR E;  3ASO E;  2H6H A;  4G2V A;  3FUD A;  4DRX E;  1H6O A;  2YQ8 A;  4IRU A;  2XGS A;  1HG5 A;  3U9W A;  3D3M A;  2XS8 A;  2BUG A;  2P58 C;  4HOT A;  5T8I A;  3FUN A;  5B1A E;  2OOE A;  3SHF A;  3U3W A;  1TJC A;  4DPR A;  4U07 A;  4ATG A;  1TN7 A;  2IFU A;  5FIN A;  3TWV A;  1INZ A;  4A3V A;  1EPU A;  4Q94 A;  1ZBP A;  3SY2 A;  5EKQ D;  4XIF A;  4I6E A;  4H7X A;  2OND A;  2ZXW E;  4ATZ D;  4RQI A;  1OUV A;  2EIN E;  2RKK A;  3SFX A;  3T9K A;  4GYW A;  1JPL A;  1OWO A;  4ANV A;  1NI1 A;  4GZD A;  5B1B E;  3SFY A;  2WB2 A;  5G04 J;  5J08 A;  3OXF A;  2LSV A;  5AJD A;  1MX4 A;  4GZ6 A;  1E8X A;  1N9A A;  2Y4U A;  2P2C P;  3R7R A;  2WVI A;  2PZI A;  5ARG A;  3FTX A;  5HS0 A;  4F7A A;  2P9U G;  2HM8 A;  2A4Z A;  3T8K A;  1HFA A;  2WXR A;  2AXZ A;  2IF4 A;  3L08 A;  2QYU A;  3C5R A;  1O5M A;  5CBN A;  2ZGG A;  3QJZ A;  3C72 A;  3BU8 A;  1V55 E;  3V2X A;  2KCL A;  4JXT A;  4AJW A;  5ARF A;  3GW4 A;  3MKR A;  3QNK A;  1X81 A;  4F3V A;  3KSL A;  3EU5 A;  2IOS A;  2WXJ A;  1RW2 A;  4ILG A;  3LCA A;  3UT7 A;  2I6H A;  3KS2 A;  4FHJ A;  1H2V C;  1IHG A;  3UX4 A;  1LD8 A;  3SZ7 A;  1TNU A;  1UW4 B;  4B93 B;  3ONK A;  1S63 A;  1OXJ A;  1H0A A;  5D0Q D;  5KJN A;  3MZL B;  1UN8 A;  1IXV A;  2QYJ A;  4F53 A;  1FT2 A;  4OYS A;  1E90 A;  5BXU A;  2GRM A;  2HO1 A;  3Q7F A;  3LY8 A;  2VGX B;  1HZ4 A;  4C9B B;  3TWS A;  2V5Q C;  3KEA A;  3ZUV B;  3U66 A;  2PQR A;  2QC9 A;  3D9K A;  2E0I A;  1N52 A;  2AW6 A;  3W9F A;  2EIL E;  3IHY A;  3IEG A;  2VGX A;  5JHB A;  5FQ4 A;  4UI9 K;  4U0S A;  3PZD A;  3LY7 A;  1TN6 A;  4QFV A;  1E7U A;  2P9N G;  2J4B A;  3CVQ A;  3EIQ C;  4BER A;  2RG8 A;  4H7Y A;  4K5A B;  4WND A;  1N4Q A;  3SGH A;  4YDW A;  2DYR E;  4ANU A;  3ABM E;  3DRA A;  3B95 A;  3L22 A;  2WXP A;  3CK8 A;  4J8Y A;  3CHO A;  1L5J A;  2ETB A;  3I4R B;  4DX7 D;  3GYZ A;  3IV0 A;  5EYL A;  5ENP D;  5FQ6 A;  4ILH B;  1HU3 A;  2FI7 A;  3QWV A;  5HRY A;  3R9M A;  2LAH A;  3B7T A;  2CG3 A;  1D8D A;  4LNB A;  4LRZ A;  4KMO A;  4U96 D;  5EIB E;  1UJK A;  3LVQ E;  1BI8 B;  2XZD G;  1HF8 A;  1PAQ A;  3MKQ A;  5G55 A;  4BX9 A;  1N4S A;  5G05 C;  4FJZ A;  4B89 A;  3V2O A;  3E37 A;  3CK9 A;  2DZN A;  3T8M A;  4CT0 A;  2BKG A;  2XEN A;  2JAB A;  3L54 A;  3P1U A;  3R7Q A;  3Q79 A;  4JA9 A;  5T4Y A;  5CCL A;  1TNB A;  5KJM A;  4RG6 A;  2WXK A;  3DBS A;  3ULY A;  3CHP A;  4GYO A;  2GGF A;  3CGH A;  3IXE A;  4WNE A;  1LF8 A;  3HXC A;  3JQ1 A;  1S0P A;  3MJW A;  2OEV A;  4F6R D;  3ENE A;  1E96 B;  3PDN A;  2FO1 E;  1B89 A;  4EZJ A;  4CYM D;  4J0U A;  4LEU A;  3PUJ A;  4UWF A;  3FEX A;  4RSY A;  1OWP A;  1MQS A;  2R59 A;  3G2V A;  3MCX A;  1VDY A;  4I9E A;  2CHX A;  4OVV A;  3DSU A;  4AXH A;  2XPZ A;  3TG5 A;  1K1A A;  1MJ0 A;  4L1B A;  2WXO A;  1IYG A;  4JC8 A;  4G8L A;  1QNF A;  2WQ6 A;  5D2M C;  2PNN A;  3B7S A;  3QAQ A;  1U3C A;  3C3R A;  1XNF A;  4ABN A;  5G04 C;  4NUR A;  2VTB A;  5BPP A;  3FTS A;  4XX5 A;  3E30 A;  3AU5 A;  3KAE A;  4J8F A;  5AAR A;  5EDS A;  3MX3 A;  4TUM A;  3UIO C;  3ZYM A;  4BWR A;  5AEN A;  3ISM C;  3ZKJ A;  5CMW A;  3O4Z A;  5LX8 A;  1N94 A;  4XKB A;  1O1R A;  1KPS B;  1O1T A;  3O48 A;  3PEV B;  3FY4 A;  4HFG A;  1JWG A;  4BSZ B;  3HXD A;  4GAA A;  3X2Q E;  4FA6 A;  3CST A;  1TR4 A;  4HXI A;  3Q73 A;  2L9B A;  5LOZ A;  3CVL A;  3LS8 A;  4UQY A;  4RG9 A;  1OCC E;  4AVX A;  3ZU7 B;  4HRM B;  3DSX A;  3WG7 E;  3ABK E;  2EIJ E;  4G1T A;  3FTY A;  5JJ6 A;  3UM3 A;  1OWM A;  3VLE A;  2RD0 A;  2CHW A;  4CEM A;  5M72 A;  4HB5 A;  2VSX E;  4K5B A;  5G05 J;  3ZEF A;  4HRN A;  5BT1 A;  1NA0 A;  1S64 A;  3GZS A;  1TYQ G;  1IQU A;  3CHQ A;  2KC7 A;  4EQF A;  4PUC A;  3E4B A;  3UIP C;  3WXX A;  4UI9 C;  3ZGQ A;  5CRV A;  3CVV A;  2WXN A;  3RJV A;  4JA7 A;  3RRU A;  2KXP C;  4O1O A;  5CRU A;  5LFA A;  3FTW A;  2EQX A;  1OT8 A;  3L82 A;  4C0M A;  1MX6 A;  1OWL A;  5AN8 A;  3FTU A;  3SQV A;  4I6G A;  3ASD A;  3CR3 A;  3BQO A;  1HE8 A;  3QAR A;  2VGE A;  3CIA A;  3E33 A;  4XI9 A;  4DX6 D;  2P9K G;  2H6F A;  2UY1 A;  2VYI A;  5JJT A;  4GMR A; 
#chains in the Genus database with same CATH homology
 1H6K A;  3MV3 B;  3S7F A;  4GZC A;  2PZI A;  4GZ3 A;  5ARG A;  3FTX A;  4F7A A;  2HM8 A;  3LDZ A;  2E2E A;  2A4Z A;  4UI9 J;  1HFA A;  2KZT B;  2C0L A;  2WXR A;  2AXZ A;  3IHV A;  1E8Z A;  2IF4 A;  2KCV A;  3ZPJ A;  2WQ7 A;  3IKO B;  4JEH A;  2VQ2 A;  3L08 A;  4V3I A;  4K03 A;  3SBT B;  3T5X A;  3FU5 A;  2J09 A;  2J9Q A;  2KZT A;  3ZXS A;  4B0Z A;  2QFC A;  4XZ4 A;  1TEZ A;  3QJZ A;  5G2N A;  4G25 A;  2ILR A;  3PRE A;  5C1D A;  4AM9 A;  2KCL A;  4JXT A;  4AJW A;  3N71 A;  4M3O A;  4I1A A;  5ARF A;  5HI7 A;  3CKB A;  4KYO B;  4HVB A;  3GW4 A;  4BT8 A;  3MKR A;  3B7R L;  3PE3 A;  4JPS A;  2WXQ A;  1UJJ A;  3QNK A;  2J08 A;  5EX3 A;  4WWN A;  4F3V A;  5FQ8 A;  4EPZ A;  2WXF A;  3FDH A;  1H2U A;  2J07 A;  3KD7 A;  4LER A;  2IOS A;  4I6J A;  1E7V A;  4ACK A;  3ZYK A;  2WXJ A;  3CQG B;  3TAX A;  3PRZ A;  4A1G A;  3BG1 B;  4CT4 A;  5LCW C;  1TJF A;  3Q15 A;  4ILG A;  1W3B A;  4XKC A;  4J8D A;  2VSO E;  2XPY A;  3LCA A;  3URZ A;  2V0P A;  2I6H A;  3KS2 A;  5A7D B;  3UT7 A;  4GA1 A;  4I43 A;  4FHJ A;  3D9M A;  4MKT A;  1H2V C;  2X6I A;  5DIZ A;  4FAD A;  3LY9 A;  1IHG A;  2WMO A;  3CEQ A;  2AWI A;  2LSU A;  5CHE E;  3UX4 A;  1NZN A;  3MA5 A;  3D9O A;  4GCO A;  3IBE A;  1Z3Y A;  3Q47 B;  3RU0 A;  3TL5 A;  4URK A;  3SZ7 A;  2VGY A;  5FZR A;  1DVP A;  1UW4 B;  2ION A;  4BSX A;  3ONK A;  3MEK A;  2MOW A;  3B7U X;  3CQC B;  3S7B A;  3LKU A;  2BF0 X;  2NC9 A;  3EDT B;  4KVM A;  4YVO A;  1IQR A;  2ZU6 B;  1HO8 A;  4G26 A;  5FJY A;  2JEK A;  2LAI A;  2XRY A;  3G2U A;  1H0A A;  1UN9 A;  5D0Q D;  3ASH A;  4FC8 A;  1XGW A;  3B13 A;  5KJN A;  3MZL B;  4ANW A;  4FLH A;  5KCM A;  1UN8 A;  5FQ7 A;  2WXG A;  4F53 A;  2XHE A;  3S7D A;  2GRL A;  1E90 A;  4NRH B;  3EIJ A;  4OYS A;  4KZC A;  4O6F A;  5D0O D;  4EZL A;  4PS3 A;  2GRM A;  2HO1 A;  3LY8 A;  4KXK B;  5DBK A;  2AXV A;  2VGX B;  1HZ4 A;  4C9B B;  4CGW A;  2CG2 A;  4N3A A;  2X3M A;  2AVP A;  4I2Z A;  3QWP A;  2CFZ A;  3LYA A;  4L23 A;  4B8A A;  2PM6 A;  3ESL A;  4IYP A;  4AIF A;  4JHR A;  1EDU A;  1E8W A;  2FEZ A;  3FH8 A;  4ME2 A;  3U66 A;  2PQR A;  3SF4 A;  3D9K A;  1GW6 A;  3ZIM A;  2E0I A;  1N52 A;  3VTX A;  3VLD A;  4NQ0 A;  1HXI A;  3ULQ A;  5ANR A;  4P29 A;  2AW6 A;  3CVP A;  3IHY A;  4KZ0 A;  3SFZ A;  4N3B A;  3JCK C;  3FUH A;  3PNL B;  2NXP A;  4DJA A;  3IEG A;  2VGX A;  2WXI A;  5FQ4 A;  4UWK A;  5JHB A;  4UI9 K;  3ZVV A;  4DLO A;  3NZS A;  1Y6I A;  4U0S A;  3PZD A;  4EZK A;  1OWN A;  3LY7 A;  2V8S E;  2R17 C;  4GB9 A;  4QFV A;  4AEZ C;  4BX8 A;  1E7U A;  2IQC A;  2WPV A;  3FH5 A;  4JVS A;  3ZFW A;  2J4B A;  3CVQ A;  2PM7 A;  3D9P A;  3EIQ C;  3LVR E;  3RRN B;  3FHE A;  2RG8 A;  4H7Y A;  3ML9 A;  4MS6 A;  2WM9 A;  3L13 A;  5JJ7 A;  3RK6 A;  4J6I A;  5BW8 C;  3UQ3 A;  3APC A;  4WND A;  5A23 A;  5HQ8 A;  4K0R A;  3NQP A;  3SGH A;  1JUQ A;  4IN3 B;  1X5B A;  2WQH A;  4ANU A;  4JZY A;  4FU3 A;  3APD A;  4FHK A;  4MLP A;  4HLE A;  3I5P A;  2WXL A;  3L22 A;  2WXP A;  4C0E A;  3ASF A;  3CK8 A;  3CVX A;  2C2L A;  3NZU A;  3G2T A;  3CHO A;  3CSF A;  3QKY A;  4Y6W A;  1QQE A;  4B94 A;  4CRW A;  1L5J A;  4HOU A;  2OVF A;  4GML A;  3I4R B;  3GYZ A;  3IV0 A;  4RVB A;  2QY7 A;  3OAW A;  5ENN A;  3MYV A;  5FQ6 A;  2X6J A;  3K9I A;  4ILH B;  3NF1 A;  5C2Y A;  3S2A A;  4HS2 A;  1HU3 A;  2FI7 A;  3QWV A;  4BT9 A;  2XGO A;  1ZU2 A;  1HS6 A;  5AIJ A;  4TUU A;  5BNW A;  3HHM A;  4GCN A;  3ESK A;  4JHJ A;  2J4D A;  4AY5 A;  3DPD A;  1FVF A;  2M63 A;  5AJL A;  2LAH A;  1KT0 A;  3B7T A;  5FZS A;  4PDX A;  2VSY A;  2CG3 A;  1PC2 A;  2KM4 A;  2X6F A;  4GA0 A;  4LRZ A;  4BFR A;  3FFL A;  1DNP A;  2Y4T A;  4A1S A;  4KMO A;  3FUE A;  2XEV A;  4FLB A;  2IU1 A;  5CMY A;  3AS8 A;  4U04 A;  3S7J A;  1UJK A;  3LVQ E;  4GZ5 A;  4EBA G;  3RIB A;  1WAO 1;  1HF8 A;  4J8S A;  1PAQ A;  4JW1 A;  3MKQ A;  3CHS A;  1Y8M A;  3ZYL A;  5FZQ A;  5G55 A;  1NA3 A;  2KCK A;  4WWO A;  3ZHE B;  3Q4A B;  1BPO A;  1FCH A;  4FP7 A;  2FF4 A;  4BX9 A;  5G05 C;  4FJZ A;  3BG0 B;  4B89 A;  3LPZ A;  4U63 A;  5T3R A;  2YNQ A;  3CK9 A;  4PS7 A;  3SNX A;  2VSN A;  3T8M A;  5BV0 A;  4CT0 A;  3P1U A;  3L54 A;  3C98 A;  4KBQ A;  1NP7 A;  3R7Q A;  2X6K A;  4A55 A;  4JA9 A;  3PH0 C;  4HOS A;  5T4Y A;  5CCL A;  2WXH A;  5J90 A;  4KT6 B;  5KJM A;  2WMN A;  3VTY A;  3U4T A;  3JYS A;  2XCB A;  4FJY A;  3L6A A;  4RG6 A;  4DI3 A;  5LP0 A;  2WXK A;  4I1O B;  2FO7 A;  3DBS A;  1SZ9 A;  5KJL A;  4N2S A;  2CHZ A;  3CHP A;  4GYO A;  2GGF A;  3CGH A;  4E85 A;  4WNE A;  2I1K A;  3L16 A;  4L2L A;  3EJN A;  1LF8 A;  3FUK A;  3JQ1 A;  4Y6C A;  1S0P A;  2XGM A;  3JQ0 A;  3UPV A;  2WXM A;  3I4G A;  4AY6 A;  3FU3 A;  3MJW A;  3D9I A;  4AP2 A;  3SD5 A;  3UUX A;  3FTV A;  4CDM A;  3ENE A;  4ANX A;  1E96 B;  1H19 A;  3CLJ A;  2C0M A;  2XQ0 A;  3PDN A;  4CDN A;  3QWW A;  5JHA A;  4LUN U;  4WNG A;  1B89 A;  4EZJ A;  3CVU A;  3TXN A;  3FU0 A;  3AS5 A;  4J0U A;  1JWF A;  2UY1 B;  3PS6 A;  4XI0 A;  4KVO A;  3ASG A;  3HVE A;  5CCM A;  3KEZ A;  3CKC A;  4LEU A;  3PUJ A;  4N5C A;  2PQN A;  2V5F A;  4PH4 B;  4UWF A;  2LO6 A;  4MRU A;  3RKV A;  2HYZ A;  3FEX A;  3Q49 B;  4RSY A;  3BEE A;  1OWP A;  4NAC A;  2L6J A;  1MQS A;  1Z3X A;  2R59 A;  3G2V A;  3MGB A;  4AOF A;  3MCX A;  4PS8 A;  1VDY A;  2JLB A;  3ONL A;  4WAF A;  1ELK A;  1HG2 A;  4I9E A;  2CHX A;  4N2Q A;  4OVV A;  3PE4 A;  2XPZ A;  3HYM B;  3ZHE A;  4AXH A;  3TG5 A;  3QK0 A;  4J8E A;  4Q69 A;  3MV2 B;  2NSZ A;  4L1B A;  1ELR A;  2FUL A;  4XE0 A;  2AXU A;  2VJ8 A;  2WXO A;  3SBS A;  3ZN3 A;  4GA2 A;  4CCA A;  1IYG A;  1SZA A;  3CVY A;  2J49 A;  4JC8 A;  1EYH A;  4ACL A;  3AU4 A;  1QNF A;  2I9C A;  4N3C A;  4G23 A;  4TV3 A;  2WQ6 A;  2I2O A;  4DK5 A;  1H2T C;  3B7S A;  4YVQ C;  4Q96 A;  3TXM A;  3QAQ A;  1U3C A;  1XNF A;  3FUI A;  4ABN A;  3LJ3 A;  5G04 C;  3FH7 A;  4NUR A;  4OVU A;  4WUY A;  3RO3 A;  5BPP A;  2VTB A;  2Y3A A;  4FUL A;  2UWJ G;  3FEY A;  3LXU X;  4LCT A;  3TGO A;  3OXG A;  3FTS A;  4E6H A;  4XX5 A;  3L17 A;  4TRQ A;  2IOL A;  2KAT A;  4A3T A;  4CGV A;  5LCW J;  3D9N A;  2X6H A;  3QDN A;  3AU5 A;  3JUI A;  3FU6 A;  3PNT B;  4B8C B;  3FUM A;  3KAE A;  1E8Y A;  1KT1 A;  4J8F A;  5E76 A;  4EBA A;  1A17 A;  4F1S A;  5EDS A;  2XRZ A;  2PL2 A;  4BTA A;  5BV1 A;  2LNI A;  3TG4 A;  3MX3 A;  3FWV A;  3UT8 A;  2Q7F A;  3ZYM A;  3GZ1 A;  4BWR A;  4BTB A;  4CDR A;  5AEN A;  1PY1 A;  5A6C A;  1EF1 C;  5CMW A;  2HR2 A;  5EX0 A;  3O4Z A;  5LX8 A;  2L0T B;  3MKQ B;  3RO2 A;  4IUL A;  2R5S A;  3FUJ A;  3CV0 A;  1N54 A;  1UG3 A;  4UQX A;  4I9C A;  4XKB A;  3QOU A;  1WY6 A;  2GW1 A;  5BT1 A;  3PUK A;  3SI5 A;  4I1M A;  3HDX A;  3O48 A;  3PEV B;  3CVW A;  3FY4 A;  4HFG A;  1JWG A;  2XCC A;  4GAA A;  3RRM B;  4FA6 A;  3CST A;  4HXI A;  2A5U A;  3G2W A;  3HVE B;  3G2S A;  3GZ2 A;  4UWH A;  4YND A;  4GPK A;  2L9B A;  2V4L A;  5FTP A;  2MHK A;  5BUZ A;  5LOZ A;  3CVL A;  2YHE A;  3LS8 A;  4BY6 A;  3CK7 A;  2I1J A;  4UQY A;  4L7T A;  1SQM A;  4RG9 A;  1U3D A;  3P2B A;  3LEW A;  3T5V A;  4AVX A;  1Z6T A;  4N39 A;  3ZYQ A;  1HH8 A;  4W9R A;  3QC1 A;  3UT4 A;  4G1T A;  3Q5M A;  4G2V A;  5ANL A;  3FTY A;  3FUD A;  4ILI A;  5JJ6 A;  1P5Q A;  2FBN A;  2YQ8 A;  4IRU A;  1WM5 A;  2XGS A;  3D9J A;  4U0Z A;  1HG5 A;  1OWM A;  2VTB B;  3U9W A;  4U8H A;  3ZRH A;  3OXL A;  4GMJ A;  3D3M A;  2L0I A;  3VLE A;  2BUG A;  4I17 A;  2BTD A;  3OTN A;  5KJK A;  3EHN A;  3EHM A;  2P58 C;  4HOT A;  2RD0 A;  3FUF A;  2CHW A;  4CEM A;  5M72 A;  5T8I A;  2VSX E;  2OV8 A;  4GU5 A;  3FUN A;  5G05 J;  3ZEF A;  4HOR A;  3CVN A;  4G11 A;  3FUL A;  1NA0 A;  5FWQ A;  2OOE A;  3SHF A;  3FTZ A;  3GZS A;  4AV7 A;  3U3W A;  1TJC A;  1IQU A;  2OVB A;  4D10 C;  4R7L A;  4DPR A;  3CHQ A;  2KC7 A;  4UWG A;  4U07 A;  4ATG A;  2DCP A;  4EQF A;  2IFU A;  3E4B A;  1YA0 A;  4PUC A;  3WXX A;  4UI9 C;  5FT9 A;  3ZGQ A;  3CHR A;  1FVH A;  3I3N A;  3CVV A;  2IJG X;  2WXN A;  1INZ A;  3RJV A;  4A3V A;  4JA7 A;  1EPU A;  4Q94 A;  2DIW A;  1ZBP A;  3QB2 A;  2CFU A;  5EKQ D;  4XIF A;  3RRU A;  4DI4 A;  4EEC A;  2YHC A;  4APF A;  4I6E A;  4H7X A;  4JHK A;  2OND A;  2XPI A;  5E75 A;  4I2W A;  4HOQ A;  1QZ2 A;  5LFA A;  3FTW A;  3ML8 A;  4UQZ A;  3PVL A;  2EQX A;  1OUV A;  4GYW A;  3PEU B;  4U0U A;  1JPL A;  1OWO A;  4ANV A;  3R9A B;  4L2Y A;  4C0M A;  4GZD A;  4JEU A;  3U64 A;  2WB2 A;  1OWL A;  4APO A;  2YIN A;  5G04 J;  3D9L A;  2DBA A;  3FTU A;  4G24 A;  5J08 A;  4I6G A;  3OXF A;  3ZW3 A;  3TJP A;  2LSV A;  3APF A;  5AJD A;  2MRI A;  3ASD A;  1KLX A;  1HX8 A;  3AS4 A;  3CR3 A;  4DLQ A;  2X38 A;  1HE8 A;  3QAR A;  3CHM A;  5AYW D;  4WWP A;  3VLF A;  4JL0 A;  3HIZ A;  4GZ6 A;  1E8X A;  1MHQ A;  3CIA A;  4XI9 A;  4UWL A;  3FP3 A;  3UMV A;  1ELW A;  2Y4U A;  4GYY A;  2UY1 A;  4WNF A;  2VYI A;  5JJT A;  3R7R A;  2WVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...