4L7TA

B. fragilis nanu
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
499
structure length
490
Chain Sequence
IDPTSSIADSNYWKTEAQFSTFNVGLHALLRECSFNFFLLGEPRADIYGDVPFGGEATQGMERLPFNTINKENTGISNFAGMYKVINQINLMIAKTKETTVLSEAGKNYYLGEAYGMRAYLYFHLLRSWGDVILYLDYTNSKAASPAEEVMKQIKEDITASEKGFGSDYSFKYGRYYWSMAATQMLKGEVYLWSGRQMGGGTADYTTAKTALQSIVSNANVSLQDDFSKVFAYNNKDNSEIIFSIRNAKDEYNMWDDRFRQNLVPQQAYMTSTYCNKEGVSFKDLPEGQLNGLIRLQIRYDLYNKAFRDGDTRKDASMTAVYQKQQDGTVKYIAPFCNKYQGVLLDGASQRSFLNDYPIYRYADCLLLLAEAKALLGEDPTAEINQVRERAYGKEFFEANKATLAYPNDKGDFYTDNKYMSGDEDPLEAILKERMREFMFEGKRWYDLRLLGADYVTKRTSAVATRLLWPINESVLTDNPALKQTPGYQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NanU sialic acid binding protein
publication title Structural and functional characterization of NanU, a novel high-affinity sialic acid-inducible binding protein of oral and gut-dwelling Bacteroidetes species.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Sialic acid-binding protein
total genus 181
structure length 490
sequence length 499
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
A PF14322 SusD-like_3 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4l7tA00
5T3RA 3CK8A 3JQ0A 3QNKA 3JQ1A 5E76A 5LX8A 4L7TA 3EHNA 3SGHA 5FQ6A 5T4YA 3CKBA 3JYSA 4F53A 5FQ7A 3IV0A 3I4GA 3OTNA 5J90A 3EJNA 5FQ4A 3NQPA 3CK7A 4F7AA 3CGHA 3MYVA 4MRUA 3HDXA 3LEWA 5FQ8A 3EHMA 3SNXA 4Q69A 3MX3A 3KEZA 4PUCA 3P1UA 5E75A 3FDHA 4LERA 3MCXA 3GZSA 3CK9A 3CKCA 3L22A
chains in the Genus database with same CATH superfamily
4YDOA 2DVWA 3SFYA 4HRNA 4ACKA 4ANWA 1K8KG 3D9HA 2R2LA 3AU4A 4HOUA 5FQ4A 1EPUA 2VQ2A 1PC2A 3QDNA 3RAUA 1ELKA 4F3VA 5CBOA 3CKCA 3RU0A 3C3RA 2YINA 4B89A 3FTXA 4LUNU 3Q5MA 1P5QA 3FWVA 5D0QD 4G25A 3VTXA 3JUIA 2XPZA 3DEOA 5ENPD 1MX2A 5G05C 4KXKB 1YYHA 4FLHA 2VTBA 1OWNA 4IN3B 3KSQA 5H7PA 4ANXA 4BTBA 3G2SA 3D9OA 1UW4B 4EQFA 1DCQA 2CHXA 5BNWA 3V31A 2AWIA 3CVNA 2WQ7A 3LXUX 4K0RA 2GRRB 2XPYA 3UIOC 3I3NA 3G2VA 3APDA 3RKVA 1Z3YA 3B95A 3HXEA 3K9IA 2X3MA 1OT8A 3QAQA 4DX6D 2GGFA 5BV0A 2VTBB 5JJ7A 5FQ6A 3CKBA 3TXNA 3JXIA 4APFA 4AXHA 3ABLE 2XGOA 3TWRA 3E37A 2DWZA 3PEUB 2L6JA 2FBNA 4MRUA 3V79K 2HE0A 4HORA 2P9SG 4PS8A 4GMLA 3UX4A 1N4RA 3AS4A 4U0SA 4O6FA 3Q49B 3RRUA 4F6RD 3FTUA 4CGWA 3ZXSA 3CSTA 3CK7A 4PS7A 1EF1C 4EZLA 3HXDA 3QWVA 4O1PA 5D66A 4I43A 3BU8A 4LSZE 1N95A 2PM7A 2WXRA 1E90A 2EILE 3CHSA 3UPVA 5KJNA 4J8SA 2ONDA 4E85A 2LSUA 1N54A 2V8SE 5AYWD 4H7XA 2R05A 3HIZA 2ETAA 3ULQA 5CMWA 3PDNA 3FY4A 2XEHA 3U4TA 3Q47B 1MX4A 3ZEFA 3PZ3A 1JWGA 4GA1A 4FHKA 2CG3A 3C3QA 4DK5A 1E8ZA 5ENQD 3PH0C 3LYAA 2ETCA 5EYPF 3Q7FA 3NOCD 2F8XK 1INZA 2XS1A 2PNNA 3LS8A 3UT4A 3V30A 1IHGA 1TJFA 1HFAA 3IKOB 5EILA 4N3CA 4JEHA 4TRQA 5AQAA 3DSWA 3EHRA 2DYRE 1OWPA 2P58C 4I1MA 3NB2A 3C3OA 2XPIA 2FI7A 4I1AA 1DCEA 3UT8A 2WQ6A 3GW4A 3KEAA 2KC7A 4V3IA 1N4SA 2NYJA 1BU9A 4I1OB 5JJTA 3MKRA 2J4DA 2BF0X 3SFZA 5ARFA 1L5JA 1LD7A 1PY1A 3OTNA 4Y6WA 4EZJA 3Q79A 1E7VA 1O1RA 3DSTA 4N3AA 4LCTA 3J5QB 3PE4A 4AP2A 2OEVA 4DLOA 1D8DA 5ENRD 3QB2A 4UI9C 3LVRE 4JA7A 4U96D 3GZ1A 3I4RB 3ABKE 2E2EA 4GCOA 1KZPA 5ENNA 4DLQA 4OAUC 1NFIE 5FZRA 3O4ZA 3CVXA 2WXIA 1ELRA 3Q9NC 5B1AE 3ASGA 3NBNB 4LEUA 4L1BA 1N0RA 2RKKA 5BUZA 2I6HA 2R17C 4GZDA 5FZQA 4YVOA 5LFAA 1JCRA 3FTYA 5BT1A 5EIBE 1Y8MA 4HBDA 1U3DA 5FJYA 4CCAA 4BERA 2F37A 2WXJA 5JHAA 4GA0A 2R03A 4BESA 4U95D 3ULEG 1NL4A 2H6GA 2FEZA 1UN9A 3D9LA 3Q78A 4J0UA 1NA3A 5T3RA 4U8YD 4WWPA 5T8IA 4DX2A 2OEWA 3R9AB 3DPDA 4I9EA 3DXKG 1S64A 1N4QA 3S7BA 1IHBA 3ZN3A 2F0YA 3OXFA 4BETA 3AG4E 3CSFA 3KEZA 3TWTA 1VDYA 3SFXA 1UOHA 3J5PA 2QYJA 2XHEA 2WXGA 4G8LA 3P2BA 2VSOE 3LJNA 4HI9A 2HM8A 3FUKA 3PNTB 3ZFWA 4B0ZA 1Q2ZA 3EIJA 1B89A 2GRLA 4DI3A 3FUJA 3FU5A 4G26A 1TNYA 3UM2A 3SBTB 5KJMA 1ZB1A 2F8YA 4HXIA 1EYHA 3DSUA 4FULA 4AM9A 1OCRE 2CHZA 1YMPA 4BFRA 3UKRG 2ZGGA 3LDZA 4JD2G 4YDEA 3FEYA 3PRZA 5AENA 1QBQA 3D9MA 4FJYA 3NOGD 4DI4A 3D3MA 3MCXA 3AJIA 1DNPA 3LPZA 4U8HA 1HG2A 2J07A 3CVVA 3UM0A 2XQ0A 2C2LA 4CDMA 1XGWA 5EKQD 3CVLA 4Q69A 3EHQA 2VYIA 1ZU2A 4ATZD 4DX7D 3UTMA 2X6IA 3CVUA 2AXZA 2HYZA 5FTPA 1K1AA 2V5QC 3FUNA 5ENTD 2R5SA 2GROB 3FUHA 1Z3XA 4LNGA 3QOUA 3ZYMA 5KNGA 4FLBA 3UT7A 3DPYA 5BV1A 1O5MA 4KVMA 2JEKA 5G04J 4CDNA 1WG0A 3U9WA 4JC8A 3S7DA 1UJKA 5EN5D 3EU5A 4LRZA 4RVBA 3PREA 4N5QA 4BT8A 2J09A 3UI2A 2XCCA 5LCWJ 2Y69E 3TG5A 4Z68A 1OWLA 2IF4A 2IONA 3W9FA 4OVVA 3NAWA 3FUIA 2X6HA 2XZTG 2DYSE 5HKPA 5HQ8A 1S0PA 4AVXA 4JL0A 2UWJG 3C5RA 3ENEA 4BX9A 3ASFA 1A17A 1BPOA 3BG0B 3B7SA 1TN6A 5AQ9A 2L0TB 1H2TC 3ZYQA 5C1DA 4F1SA 3ZU7B 2ZU6B 1NI1A 3GZSA 1H2UA 3PZ1A 2VJ8A 2V0PA 3JQ1A 3U66A 2QYUA 3QKYA 4M7CA 1K1BA 3TWVA 4U7EB 5D2MC 3CV0A 4J8EA 2I1KA 4XKBA 4HLEA 1K3ZD 2H6IA 4J6IA 2XS8A 3L08A 3JUEA 4U04A 2BTDA 4E6HA 3SY2A 1U3CA 4JXTA 2WXLA 4GTPA 1HZ4A 2QY7A 1TYQG 3OXLA 4Q96A 2Y4TA 3TL5A 2LUHA 5CRUA 5AN8A 2QC9A 4HQDA 4WWNA 4N5CA 3EU9A 1LF8A 3E33A 1TNZA 5AARA 2KCLA 3CVWA 3TJPA 2J49A 2Y4UA 1TN7A 5G05J 4UWHA 4G11A 4HFGA 4XKCA 3SZ7A 1SA5A 3HDXA 2Q7FA 4L9PA 4KT6B 2OVFA 4LERA 2UY1A 3QJZA 1N11A 1TNUA 1KLXA 4A63B 3HRAA 3JQ0A 3SI5A 3CHMA 3IV0A 3CQGB 3ESLA 3BEEA 3CEQA 4GTMA 2WB2A 5DBKA 4WNEA 3KSLA 3FU6A 1E7UA 3FP3A 1FPPA 4A1SA 3S7JA 2M63A 2MOWA 1S70B 2VGXA 2WXOA 2Y3AA 3D9NA 4RQIA 3AS5A 4HLLA 1PAQA 2OV8A 2BUGA 5IY5E 2XENA 2PQNA 1GW6A 4NACA 1SZAA 1N94A 4A55A 2UY1B 1SA4A 4G2VA 2AJAA 2J4BA 4ZHBA 3HG0D 4ZFHA 3LKUA 1RW2A 3CHPA 3RRNB 3SD5A 3R9MA 5J08A 4GAAA 1JCQA 1KT0A 4DX5D 2VSNA 1X5BA 4GYYA 4H7YA 4OYSA 2VGXB 4O1OA 1FCHA 4QQIA 3UQ3A 3QWPA 1HE8A 1HS6A 5T4YA 4UWKA 4IRUA 2PZIA 3CHOA 4U63A 3EDTB 4HVBA 5CMYA 3TWXA 3C72A 3HYMB 4LNUD 5FQ8A 2FO1E 3CLJA 5BXOA 3HXCA 4HOTA 2J8SD 3UM1A 3UKUG 3FUMA 2X38A 2WXPA 2RD0A 3RIBA 1HO8A 2WXNA 3UIPC 3D9IA 2V5FA 3QWWA 5FIOA 5J90A 4JA9A 4ABNA 1TNBA 4R7LA 2XCBA 3UINC 3ONKA 4WWOA 4GZ5A 2I9CA 2XRZA 1NA0A 3ABME 2WXFA 3UXGA 2QFCA 5A23A 3CQCB 4W9RA 2GRQB 2L6BA 2PM6A 2L9BA 4UQXA 2OOEA 2DIWA 1FVFA 5JA4D 3ASNE 3Q9UC 2C0MA 2EQXA 3ZNGA 1X81A 4BX8A 4HRLA 4AIFA 4IYPA 3BG1B 3L9TA 2FF4A 5G2NA 1E8YA 2GRMA 3FFLA 4GTRA 3Q73A 4APOA 3RK6A 3DSSA 1ZBPA 4XX5A 1HF8A 4J8FA 2KZTA 3WG7E 3URZA 1MYOA 1H6KA 2EIME 3CK9A 3GYZA 3PZDA 4GTSA 1D8EA 3ASOE 3ULYA 4FHJA 2VGYA 3PE3A 3B13A 3NZUA 2WQHA 5FZSA 3O48A 3ZHEA 3T5VA 1AP7A 2LAIA 4BY6A 2J9QA 5ENOD 2PQRA 5KBAA 4OAVB 3AG3E 3ML8A 4JHJA 1TN8A 2P9IG 1H6PA 4K03A 5FINA 1N52A 4BEPA 3JYSA 4GYWA 3UM3A 4GA2A 4EZKA 2KZTB 2CFZA 3Q4AB 3D9JA 3ESKA 4UI9J 3WXXA 4DRXE 3CK8A 2RFAA 5KJLA 3I5PA 1QQEA 3ZHEB 4I2WA 5AQBA 4A3TA 4NRHB 4F7AA 3QARA 3DBSA 1LTXA 4URKA 4XIFA 2E0IA 5CEAA 3OAWA 2IOLA 4UWGA 3TWUA 1E8XA 1WDYA 5EDSA 2WXHA 2ILRA 2IJGX 3FEXA 1OCCE 5CCLA 3DWLG 2HR2A 3CGHA 3MYVA 2XEEA 1JUQA 4Y6CA 3P1UA 4AOFA 3FTZA 4MS6A 2MRIA 4TUUA 3TAXA 3CHRA 4KZ0A 4GB9A 4CGVA 4F53A 4FC8A 4JPSA 2J08A 4DJAA 5KJKA 4K5CA 3Q75A 4A1GA 3APCA 1MZCA 1UG3A 1LD8A 4I6GA 5AJLA 4GTQA 1H0AA 4NIKA 1SZ9A 3B7BA 1WY6A 4ACLA 3DRAA 5A7DB 4K5BA 4TXRA 3FUEA 4C48B 4HS2A 5CERB 2FULA 3SNXA 4J8YA 3AS8A 2P9UG 5ITZF 2XGMA 2P9KG 3L17A 4HOQA 4AV7A 3BQOA 3PNLB 2DZNA 3HHMA 3Q15A 5HI7A 5M72A 4YNDA 2YQ8A 3LCAA 2LXLA 5G04C 4G23A 2WMNA 4U8VD 3AAAC 2IFUA 2R59A 2B0OE 2H6HA 1BI8B 4YVQC 3RSEG 4TUMA 2VSXE 3HXFA 3FTSA 4XZ4A 2DZOA 2YHEA 4U07A 2KCVA 4QFVA 3ZIMA 2IQCA 5ANRA 2WXMA 1BI7B 3ZVVA 3LY7A 1MX6A 4BTAA 3TWQA 1S63A 2AXUA 3S7FA 1TR4A 4CDRA 4LNBA 3PEVB 3ZW3A 2YHCA 2P9PG 1OUVA 4MLPA 3D9KA 5CRVA 4KMOA 3FULA 3LEWA 5KCMA 4GZ6A 4B8AA 3E34A 1QNFA 3L82A 2BEDA 4UI9K 2WMOA 3S2AA 4FADA 4EBAA 4JZYA 3V2OA 2WM9A 1DC2A 3DEPA 3TXMA 2A4ZA 4KZCA 3DSXA 1E8WA 1SW6A 1OWOA 5KNHD 4UWLA 4A3VA 3EJNA 3MA5A 5CBNA 1Z6TA 3FH8A 2XGSA 4UQYA 5FWQA 4GTTA 1H2VC 4BSZB 4GZCA 1IXVA 4FJZA 5AIJA 4AEZC 1DVPA 1FT1A 4TXQA 3FH5A 2VSYA 2LAHA 3N71A 4RG6A 2Y0BG 3G2UA 3ZUVB 2L0IA 3G2TA 3VLEA 4WUYA 4CEMA 4TXPA 2IO3C 3SQVA 3LY8A 1OCZE 3D9PA 1TJCA 4N39A 1AWCB 1D9SA 4PH4B 3KS2A 2KATA 3EHNA 2I1JA 1N4PA 1XNFA 2V4LA 4I2ZA 4L2YA 4XE0A 2JLBA 5FT9A 3CVPA 2CHWA 5B1BE 3EIQC 3CR3A 3E30A 3QNKA 3PZ2A 1IQRA 3KAEA 4JW1A 4RLYA 4DUIA 1KZOA 2C0LA 4CZ2D 1HH8A 3T8KA 2WPVA 2X6KA 1MQSA 4EECA 4HRMB 3ISMC 3AU5A 5DIZA 3T5XA 4FU3A 3JXJA 3BUAA 4N2SA 1IKND 3AG2E 4I17A 5AAOA 3T9KA 3MGBA 5LX8A 3FTWA 4C0MA 4PS3A 4G24A 4HB5A 4KYOB 4OVUA 4C9BB 2AXVA 4WNDA 1A5EA 4AY6A 2IEJA 4CT4A 2LSVA 3IBEA 5EX3A 2MYOA 5LP0A 3AG1E 4B8CB 3RO3A 3ZRHA 2JABA 3QC1A 2IU1A 3PUKA 3ZPJA 3CHQA 1H19A 4I6EA 2CFUA 3MX3A 4PUCA 3ASDA 4UWFA 3FDHA 1UN8A 3L54A 3R7QA 5BXUA 2X6FA 1RZ4A 5HS0A 2XZDG 5AJDA 5EIDA 1SVXA 5E75A 1QYMA 2A5UA 5BPPA 3CIAA 1N0QA 4HI8A 1HX8A 3OXGA 3IXEA 1HG5A 3B7TA 4P29A 5HRYA 3E4BA 4ILGA 2XRYA 2WXKA 1Z5SC 1YA0A 2RFMA 3L6AA 3FU0A 2YNQA 3B7RL 3HXBA 4GMJA 4CYMD 3HVEA 2QZAA 3VLDA 4EHMA 4JEUA 4U0UA 4U0ZA 3B7UX 3UMVA 2ZISA 5B3SE 1N9AA 3GZ2A 4LG6A 4PDXA 3LJ3A 4UUCA 3DXMG 3IHVA 3MV3B 2X6JA 4XI0A 3QK0A 2NSZA 3TWSA 4Q94A 5ARGA 4DX1A 1MJ0A 5EYLA 4BWRA 4ANUA 2CG2A 4HOSA 4GTVA 1EDUA 2AVPA 3HVEB 1HXIA 1TNOA 1SQMA 3FTVA 4L23A 5G55A 3TWWA 2LXMA 2B6CA 5ENSD 4X8QA 5JJ6A 1TEZA 4ANVA 3MV2B 5LOZA 2ZXWE 4L2LA 3PS6A 2IOSA 4F1PA 3ZGQA 5JMND 5EX0A 3TG4A 3W9GA 5AQ7A 4ILHB 2OCCE 1MHQA 2A5EA 3L16A 2DBAA 2EINE 2H6FA 4YDYA 5CECB 4B93B 2GRPB 1O1SA 1BLXB 4AJWA 3LVQE 4GYOA 4CT0A 1KT1A 4EBAG 3E32A 3VTYA 1JWFA 4FA6A 4JB8P 1IQUA 4G1TA 2BKGA 3TGOA 3T8MA 3X2QE 3MJWA 4DPRA 3RJVA 4GCNA 3NF1A 4TV3A 2Y1LE 4FP7A 4JHKA 3ASHA 2LO6A 3FUDA 3FU3A 4BSXA 5C2YA 3ZYLA 4HNAD 2I2OA 2WVIA 2XEVA 3ZXPA 2KBXA 4N3BA 4GZ3A 2V4HC 2IO2C 2IY0C 4ILIA 2ZGDA 1OCOE 3R7RA 3DSVA 3MEKA 4NURA 4I6JA 2BKKB 3ZYKA 1ELWA 3PVLA 1NP7A 4WNGA 1O1TA 4N2QA 2FO7A 5D0OD 4AY5A 3CVYA 3MKQA 1WAO1 3JCKC 4MBGA 4J7WA 3U3WA 4J8DA 4K5AB 2RG8A 1H6OA 1JCSA 4I9CA 1Y6IA 5KWDA 3SBSA 3C98A 3EUVA 2AW6A 4ATGA 2MHKA 3ML9A 3ZKJA 1V54E 4L7TA 1YCSB 3FHEA 4YDWA 5FQ7A 1BD8A 3F6QA 3FH7A 4XEIG 2LNIA 1E96B 3FUFA 4KBQA 4IULA 1OXJA 1UJJA 1V55E 2NC9A 3EHMA 4M3OA 2R02A 2VGEA 2WXQA 4GTOA 3IEGA 2PL2A 3MKQB 3ONLA 4KVOA 2P2CP 5BW8C 2EIJE 2GRNB 4JHRA 3VLFA 1HU3A 2DCPA 5CHEE 3APFA 2GW1A 1FT2A 1NZNA 1OY3D 4NQ0A 5LCWC 4O60A 3NQPA 3G2WA 3RO2A 4C0EA 1KPSB 3IHYA 4UQZA 4GPMA 4GU5A 5CEDB 4GPKA 4D10C 3MZLB 3KD7A 3L22A 4RSYA 3UUXA 3RRMB 2OVBA 1U2VG 3SGHA 1QZ2A 3V2XA 4MKTA 4JVSA 3SHFA 4BT9A 5JHBA 2KCKA 3SO8A 1JPLA 3PUJA 4RG9A 1OWMA 4WNFA 2ZIRA 3SF4A 1WM5A 3Q7AA 4CRWA 2HO1A 2ETBA 5ANLA 1FVHA 1W3BA 4XI9A 5A6CA 3NZSA 5E76A 4EPZA 1G3NB 3LY9A 4WAFA 3L13A 2P9LG 3I4GA 3CVQA 2EIKE 4G8KA 2P9NG 4GMRA 4B94A 2KXPC 2KM4A 4ME2A 1IYGA 3PZ4A 5CCMA 3U64A 2NXPA
chains in the Genus database with same CATH topology
5LX8A 3FTWA 4C0MA 1E8YA 2GRMA 3FFLA 5KJMA 4PS3A 4ACKA 4APOA 4ANWA 4G24A 4KYOB 3RK6A 4HXIA 4OVUA 1ZBPA 4C9BB 4XX5A 2AXVA 4WNDA 3AU4A 1EYHA 1HF8A 4HOUA 4AM9A 4FULA 4J8FA 5FQ4A 4AY6A 1EPUA 2VQ2A 2KZTA 3URZA 4CT4A 1PC2A 2CHZA 2LSVA 3IBEA 5EX3A 3QDNA 1ELKA 4F3VA 1H6KA 5LP0A 3CK9A 3CKCA 4B8CB 3GYZA 3PZDA 3RO3A 3ZRHA 4BFRA 3RU0A 2YINA 3QC1A 2IU1A 4FHJA 4B89A 2VGYA 3PE3A 3LDZA 3FTXA 3PUKA 3B13A 4LUNU 3NZUA 3Q5MA 2WQHA 5FZSA 3O48A 3ZHEA 1P5QA 3ZPJA 3T5VA 3FEYA 3PRZA 3CHQA 3FWVA 5D0QD 2LAIA 5AENA 4G25A 4BY6A 2J9QA 3VTXA 3JUIA 1H19A 2XPZA 4I6EA 2CFUA 3MX3A 3D9MA 4PUCA 2PQRA 4FJYA 3ASDA 4UWFA 3FDHA 1UN8A 4DI4A 5G05C 3D3MA 3MCXA 3ML8A 1DNPA 3LPZA 4JHJA 4U8HA 1HG2A 4KXKB 3L54A 3R7QA 4K03A 1N52A 2J07A 2X6FA 4FLHA 3JYSA 4GYWA 2VTBA 3CVVA 4GA2A 1OWNA 4EZKA 2KZTB 2XQ0A 5AJDA 4IN3B 2C2LA 4ANXA 4CDMA 1XGWA 5EKQD 4BTBA 3G2SA 3D9OA 3CVLA 1UW4B 4Q69A 2CFZA 3Q4AB 2VYIA 3D9JA 3ESKA 5E75A 4EQFA 1ZU2A 4UI9J 2CHXA 3WXXA 2A5UA 5BPPA 3CIAA 5BNWA 3CK8A 2AWIA 3CVNA 2X6IA 5KJLA 2WQ7A 1HX8A 3I5PA 3LXUX 3OXGA 1QQEA 3CVUA 2AXZA 1HG5A 2HYZA 4K0RA 3B7TA 5FTPA 4P29A 3ZHEB 3FUNA 4I2WA 2XPYA 2R5SA 3I3NA 3G2VA 3E4BA 4A3TA 4NRHB 4F7AA 3FUHA 1Z3XA 4ILGA 3APDA 3QOUA 2XRYA 2WXKA 3QARA 1YA0A 3ZYMA 3RKVA 1Z3YA 3L6AA 3DBSA 4FLBA 3FU0A 3UT7A 2YNQA 4URKA 4XIFA 3B7RL 3K9IA 5BV1A 2E0IA 2X3MA 3OAWA 2IOLA 4UWGA 4KVMA 3QAQA 2GGFA 4GMJA 5BV0A 2VTBB 1E8XA 2JEKA 5G04J 4CDNA 5EDSA 5JJ7A 2WXHA 5FQ6A 2ILRA 3CKBA 3TXNA 2IJGX 3FEXA 3HVEA 4JC8A 3U9WA 4APFA 4AXHA 3S7DA 1UJKA 2XGOA 3VLDA 5CCLA 4LRZA 4RVBA 3PEUB 2HR2A 3CGHA 2L6JA 3MYVA 3PREA 4JEUA 4U0UA 2FBNA 4MRUA 4U0ZA 3B7UX 3UMVA 1JUQA 4Y6CA 4HORA 3P1UA 4PS8A 4AOFA 3FTZA 2J09A 4BT8A 4MS6A 4GMLA 2XCCA 3UX4A 2MRIA 4TUUA 3AS4A 3TAXA 4U0SA 3CHRA 4KZ0A 5LCWJ 4O6FA 3GZ2A 3Q49B 4GB9A 3TG5A 3RRUA 1OWLA 3LJ3A 4PDXA 2IF4A 3FTUA 2IONA 4CGVA 3IHVA 4F53A 4CGWA 3MV3B 4FC8A 4JPSA 2J08A 3ZXSA 4OVVA 2X6JA 4DJAA 4XI0A 3CSTA 3FUIA 3QK0A 3CK7A 4PS7A 5KJKA 1EF1C 2NSZA 2X6HA 4EZLA 4A1GA 4Q94A 5ARGA 3APCA 3QWVA 4BWRA 4ANUA 2CG2A 1UG3A 5HQ8A 1S0PA 4I6GA 4I43A 4AVXA 4HOSA 4JL0A 5AJLA 2UWJG 1EDUA 2AVPA 3HVEB 1H0AA 3ENEA 1HXIA 4L23A 1SQMA 3FTVA 5G55A 4BX9A 3ASFA 1A17A 1SZ9A 1WY6A 2PM7A 2WXRA 4ACLA 5A7DB 1E90A 5JJ6A 1BPOA 3CHSA 3FUEA 3UPVA 5KJNA 4J8SA 3BG0B 4HS2A 3B7SA 2FULA 2L0TB 3SNXA 1TEZA 4ANVA 3MV2B 1H2TC 3AS8A 2ONDA 5LOZA 3ZYQA 4E85A 5C1DA 4F1SA 2LSUA 1N54A 2V8SE 2ZU6B 4L2LA 5AYWD 2XGMA 3GZSA 1H2UA 3PS6A 3L17A 2IOSA 4H7XA 4HOQA 4AV7A 3HIZA 3ZGQA 2VJ8A 2V0PA 3PNLB 3HHMA 3JQ1A 5EX0A 3U66A 3QKYA 3ULQA 5CMWA 3PDNA 3FY4A 3Q15A 5HI7A 3TG4A 5M72A 3U4TA 4YNDA 2YQ8A 3LCAA 4ILHB 3Q47B 1MHQA 3L16A 4G23A 5G04C 2DBAA 3CV0A 3ZEFA 2WMNA 4J8EA 2I1KA 4XKBA 4HLEA 2IFUA 2R59A 1JWGA 4GA1A 4FHKA 4J6IA 3L08A 4YVQC 2CG3A 4U04A 2BTDA 2VSXE 4E6HA 4AJWA 4DK5A 3FTSA 4XZ4A 1E8ZA 1U3CA 3LVQE 4GYOA 3PH0C 4JXTA 2WXLA 4CT0A 1KT1A 2YHEA 3LYAA 4EBAG 4U07A 2KCVA 4QFVA 1HZ4A 2QY7A 3VTYA 1JWFA 3ZIMA 2IQCA 3OXLA 4FA6A 5ANRA 2WXMA 4Q96A 3ZVVA 3LY7A 2Y4TA 3TL5A 1IQUA 4BTAA 1INZA 4G1TA 3LS8A 3UT4A 1IHGA 1TJFA 3TGOA 1HFAA 3IKOB 4WWNA 3T8MA 4N3CA 3MJWA 4N5CA 4DPRA 4JEHA 2AXUA 4TRQA 3S7FA 1LF8A 3RJVA 4GCNA 3NF1A 4CDRA 4TV3A 2KCLA 3CVWA 1OWPA 2P58C 4I1MA 3TJPA 4FP7A 4JHKA 3ASHA 3PEVB 2XPIA 2FI7A 2J49A 3ZW3A 2Y4UA 2LO6A 2YHCA 4I1AA 3UT8A 1OUVA 3FUDA 5G05J 3FU3A 2WQ6A 4UWHA 4MLPA 3D9KA 4BSXA 4G11A 5C2YA 3GW4A 3ZYLA 4HFGA 4XKCA 4KMOA 3FULA 3SZ7A 3HDXA 3LEWA 2I2OA 2Q7FA 5KCMA 2WVIA 4KT6B 2XEVA 2KC7A 4N3BA 4GZ6A 2OVFA 4LERA 4B8AA 2UY1A 3QJZA 4GZ3A 4V3IA 1QNFA 1KLXA 4ILIA 3JQ0A 4I1OB 5JJTA 3SI5A 4UI9K 2WMOA 3MKRA 3S2AA 2J4DA 2BF0X 3SFZA 5ARFA 1L5JA 3CHMA 3IV0A 3R7RA 1PY1A 3OTNA 4EBAA 4FADA 4Y6WA 3CQGB 4EZJA 3MEKA 3ESLA 3BEEA 3CEQA 4NURA 4I6JA 4JZYA 5DBKA 2WB2A 2WM9A 1E7VA 4WNEA 3ZYKA 1ELWA 3PVLA 1NP7A 3FU6A 3TXMA 1E7UA 3FP3A 4WNGA 4N3AA 2A4ZA 2FO7A 5D0OD 4KZCA 3S7JA 4A1SA 4N2QA 2M63A 2MOWA 2VGXA 2WXOA 2Y3AA 3D9NA 4AY5A 3CVYA 4LCTA 1E8WA 3PE4A 3MKQA 1WAO1 3AS5A 4AP2A 1OWOA 3JCKC 1PAQA 4UWLA 4DLOA 3U3WA 4J8DA 2OV8A 3QB2A 2RG8A 4UI9C 3LVRE 2BUGA 4JA7A 3GZ1A 4A3VA 2PQNA 1GW6A 3EJNA 3I4RB 4NACA 3MA5A 1Z6TA 1SZAA 2E2EA 3FH8A 2XGSA 4GCOA 4UQYA 5ENNA 5FWQA 4I9CA 1Y6IA 3SBSA 4A55A 2UY1B 1H2VC 4G2VA 3C98A 4DLQA 4GZCA 5AIJA 4FJZA 2J4BA 4AEZC 1DVPA 2AW6A 5FZRA 4ATGA 2MHKA 3ML9A 3FH5A 2VSYA 3O4ZA 3LKUA 3CVXA 4L7TA 3FHEA 2WXIA 1ELRA 4G26A 3ASGA 3CHPA 2LAHA 3N71A 4RG6A 5FQ7A 3G2UA 3RRNB 4LEUA 3FH7A 2L0IA 3SD5A 2LNIA 1E96B 3G2TA 3FUFA 5J08A 4L1BA 4GAAA 4IULA 4KBQA 3VLEA 1KT0A 5BUZA 2I6HA 2R17C 2VSNA 4GZDA 1UJJA 4WUYA 1X5BA 4CEMA 2NC9A 3EHMA 4GYYA 4H7YA 4M3OA 4OYSA 2VGXB 2WXQA 3LY8A 3IEGA 3D9PA 5FZQA 4YVOA 1TJCA 4N39A 2PL2A 5LFAA 3FTYA 1FCHA 3MKQB 3ONLA 5BT1A 4KVOA 1Y8MA 3UQ3A 3QWPA 1HE8A 3KS2A 4PH4B 5BW8C 2KATA 3EHNA 1HS6A 5T4YA 4JHRA 4UWKA 1HU3A 2I1JA 3VLFA 1U3DA 2DCPA 4IRUA 5CHEE 5FJYA 4CCAA 3APFA 2PZIA 2GW1A 5LCWC 1NZNA 1XNFA 2WXJA 3CHOA 4NQ0A 5JHAA 4U63A 3EDTB 3NQPA 3G2WA 4GA0A 4HVBA 5CMYA 2V4LA 3HYMB 4I2ZA 4L2YA 3RO2A 4XE0A 2JLBA 5FT9A 3CVPA 5FQ8A 2CHWA 4C0EA 3IHYA 4UQZA 3CLJA 4GU5A 4GPKA 2FEZA 1UN9A 3D9LA 3EIQC 3KD7A 3MZLB 4D10C 4HOTA 4J0UA 3L22A 3CR3A 4RSYA 3UUXA 1NA3A 3FUMA 5T3RA 3RRMB 2X38A 3QNKA 2OVBA 4WWPA 2WXPA 1IQRA 3KAEA 2RD0A 4JW1A 5T8IA 3SGHA 1QZ2A 3RIBA 1HO8A 2WXNA 4MKTA 3R9AB 3DPDA 3D9IA 2V5FA 4JVSA 3QWWA 4I9EA 5J90A 4JA9A 4ABNA 2C0LA 3SHFA 4BT9A 1HH8A 5JHBA 2KCKA 4R7LA 3S7BA 2XCBA 1JPLA 3PUJA 3ZN3A 3ONKA 3OXFA 4RG9A 1OWMA 4WNFA 3CSFA 3SF4A 2WPVA 3KEZA 2X6KA 1WM5A 4GZ5A 4WWOA 1MQSA 4CRWA 2HO1A 2I9CA 2XRZA 1VDYA 5ANLA 1NA0A 2WXFA 1FVHA 1W3BA 2QFCA 4XI9A 5A6CA 3NZSA 5E76A 5A23A 3CQCB 4W9RA 4EECA 4EPZA 2XHEA 2WXGA 2PM6A 2L9BA 4UQXA 2OOEA 3LY9A 2DIWA 3AU5A 3L13A 2VSOE 1FVFA 3P2BA 4WAFA 5DIZA 2HM8A 3I4GA 3FUKA 3T5XA 3CVQA 2C0MA 2EQXA 4FU3A 3PNTB 3ZFWA 4B0ZA 4B94A 4N2SA 3EIJA 2KM4A 1B89A 2GRLA 4ME2A 4BX8A 4DI3A 5CCMA 1IYGA 3FUJA 4I17A 4AIFA 3U64A 3FU5A 4IYPA 3BG1B 2FF4A 2NXPA 3MGBA 5G2NA 3SBTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T3R A;  3CK8 A;  3JQ0 A;  3QNK A;  3JQ1 A;  5E76 A;  5LX8 A;  4L7T A;  3EHN A;  3SGH A;  5FQ6 A;  5T4Y A;  3CKB A;  3JYS A;  4F53 A;  5FQ7 A;  3IV0 A;  3I4G A;  3OTN A;  5J90 A;  3EJN A;  5FQ4 A;  3NQP A;  3CK7 A;  4F7A A;  3CGH A;  3MYV A;  4MRU A;  3HDX A;  3LEW A;  5FQ8 A;  3EHM A;  3SNX A;  4Q69 A;  3MX3 A;  3KEZ A;  4PUC A;  3P1U A;  5E75 A;  3FDH A;  4LER A;  3MCX A;  3GZS A;  3CK9 A;  3CKC A;  3L22 A; 
#chains in the Genus database with same CATH topology
 4YDO A;  2DVW A;  3SFY A;  4HRN A;  4ACK A;  4ANW A;  1K8K G;  3D9H A;  2R2L A;  3AU4 A;  4HOU A;  5FQ4 A;  1EPU A;  2VQ2 A;  1PC2 A;  3QDN A;  3RAU A;  1ELK A;  4F3V A;  5CBO A;  3CKC A;  3RU0 A;  3C3R A;  2YIN A;  4B89 A;  3FTX A;  4LUN U;  3Q5M A;  1P5Q A;  3FWV A;  5D0Q D;  4G25 A;  3VTX A;  3JUI A;  2XPZ A;  3DEO A;  5ENP D;  1MX2 A;  5G05 C;  4KXK B;  1YYH A;  4FLH A;  2VTB A;  1OWN A;  4IN3 B;  3KSQ A;  5H7P A;  4ANX A;  4BTB A;  3G2S A;  3D9O A;  1UW4 B;  4EQF A;  1DCQ A;  2CHX A;  5BNW A;  3V31 A;  2AWI A;  3CVN A;  2WQ7 A;  3LXU X;  4K0R A;  2GRR B;  2XPY A;  3UIO C;  3I3N A;  3G2V A;  3APD A;  3RKV A;  1Z3Y A;  3B95 A;  3HXE A;  3K9I A;  2X3M A;  1OT8 A;  3QAQ A;  4DX6 D;  2GGF A;  5BV0 A;  2VTB B;  5JJ7 A;  5FQ6 A;  3CKB A;  3TXN A;  3JXI A;  4APF A;  4AXH A;  3ABL E;  2XGO A;  3TWR A;  3E37 A;  2DWZ A;  3PEU B;  2L6J A;  2FBN A;  4MRU A;  3V79 K;  2HE0 A;  4HOR A;  2P9S G;  4PS8 A;  4GML A;  3UX4 A;  1N4R A;  3AS4 A;  4U0S A;  4O6F A;  3Q49 B;  3RRU A;  4F6R D;  3FTU A;  4CGW A;  3ZXS A;  3CST A;  3CK7 A;  4PS7 A;  1EF1 C;  4EZL A;  3HXD A;  3QWV A;  4O1P A;  5D66 A;  4I43 A;  3BU8 A;  4LSZ E;  1N95 A;  2PM7 A;  2WXR A;  1E90 A;  2EIL E;  3CHS A;  3UPV A;  5KJN A;  4J8S A;  2OND A;  4E85 A;  2LSU A;  1N54 A;  2V8S E;  5AYW D;  4H7X A;  2R05 A;  3HIZ A;  2ETA A;  3ULQ A;  5CMW A;  3PDN A;  3FY4 A;  2XEH A;  3U4T A;  3Q47 B;  1MX4 A;  3ZEF A;  3PZ3 A;  1JWG A;  4GA1 A;  4FHK A;  2CG3 A;  3C3Q A;  4DK5 A;  1E8Z A;  5ENQ D;  3PH0 C;  3LYA A;  2ETC A;  5EYP F;  3Q7F A;  3NOC D;  2F8X K;  1INZ A;  2XS1 A;  2PNN A;  3LS8 A;  3UT4 A;  3V30 A;  1IHG A;  1TJF A;  1HFA A;  3IKO B;  5EIL A;  4N3C A;  4JEH A;  4TRQ A;  5AQA A;  3DSW A;  3EHR A;  2DYR E;  1OWP A;  2P58 C;  4I1M A;  3NB2 A;  3C3O A;  2XPI A;  2FI7 A;  4I1A A;  1DCE A;  3UT8 A;  2WQ6 A;  3GW4 A;  3KEA A;  2KC7 A;  4V3I A;  1N4S A;  2NYJ A;  1BU9 A;  4I1O B;  5JJT A;  3MKR A;  2J4D A;  2BF0 X;  3SFZ A;  5ARF A;  1L5J A;  1LD7 A;  1PY1 A;  3OTN A;  4Y6W A;  4EZJ A;  3Q79 A;  1E7V A;  1O1R A;  3DST A;  4N3A A;  4LCT A;  3J5Q B;  3PE4 A;  4AP2 A;  2OEV A;  4DLO A;  1D8D A;  5ENR D;  3QB2 A;  4UI9 C;  3LVR E;  4JA7 A;  4U96 D;  3GZ1 A;  3I4R B;  3ABK E;  2E2E A;  4GCO A;  1KZP A;  5ENN A;  4DLQ A;  4OAU C;  1NFI E;  5FZR A;  3O4Z A;  3CVX A;  2WXI A;  1ELR A;  3Q9N C;  5B1A E;  3ASG A;  3NBN B;  4LEU A;  4L1B A;  1N0R A;  2RKK A;  5BUZ A;  2I6H A;  2R17 C;  4GZD A;  5FZQ A;  4YVO A;  5LFA A;  1JCR A;  3FTY A;  5BT1 A;  5EIB E;  1Y8M A;  4HBD A;  1U3D A;  5FJY A;  4CCA A;  4BER A;  2F37 A;  2WXJ A;  5JHA A;  4GA0 A;  2R03 A;  4BES A;  4U95 D;  3ULE G;  1NL4 A;  2H6G A;  2FEZ A;  1UN9 A;  3D9L A;  3Q78 A;  4J0U A;  1NA3 A;  5T3R A;  4U8Y D;  4WWP A;  5T8I A;  4DX2 A;  2OEW A;  3R9A B;  3DPD A;  4I9E A;  3DXK G;  1S64 A;  1N4Q A;  3S7B A;  1IHB A;  3ZN3 A;  2F0Y A;  3OXF A;  4BET A;  3AG4 E;  3CSF A;  3KEZ A;  3TWT A;  1VDY A;  3SFX A;  1UOH A;  3J5P A;  2QYJ A;  2XHE A;  2WXG A;  4G8L A;  3P2B A;  2VSO E;  3LJN A;  4HI9 A;  2HM8 A;  3FUK A;  3PNT B;  3ZFW A;  4B0Z A;  1Q2Z A;  3EIJ A;  1B89 A;  2GRL A;  4DI3 A;  3FUJ A;  3FU5 A;  4G26 A;  1TNY A;  3UM2 A;  3SBT B;  5KJM A;  1ZB1 A;  2F8Y A;  4HXI A;  1EYH A;  3DSU A;  4FUL A;  4AM9 A;  1OCR E;  2CHZ A;  1YMP A;  4BFR A;  3UKR G;  2ZGG A;  3LDZ A;  4JD2 G;  4YDE A;  3FEY A;  3PRZ A;  5AEN A;  1QBQ A;  3D9M A;  4FJY A;  3NOG D;  4DI4 A;  3D3M A;  3MCX A;  3AJI A;  1DNP A;  3LPZ A;  4U8H A;  1HG2 A;  2J07 A;  3CVV A;  3UM0 A;  2XQ0 A;  2C2L A;  4CDM A;  1XGW A;  5EKQ D;  3CVL A;  4Q69 A;  3EHQ A;  2VYI A;  1ZU2 A;  4ATZ D;  4DX7 D;  3UTM A;  2X6I A;  3CVU A;  2AXZ A;  2HYZ A;  5FTP A;  1K1A A;  2V5Q C;  3FUN A;  5ENT D;  2R5S A;  2GRO B;  3FUH A;  1Z3X A;  4LNG A;  3QOU A;  3ZYM A;  5KNG A;  4FLB A;  3UT7 A;  3DPY A;  5BV1 A;  1O5M A;  4KVM A;  2JEK A;  5G04 J;  4CDN A;  1WG0 A;  3U9W A;  4JC8 A;  3S7D A;  1UJK A;  5EN5 D;  3EU5 A;  4LRZ A;  4RVB A;  3PRE A;  4N5Q A;  4BT8 A;  2J09 A;  3UI2 A;  2XCC A;  5LCW J;  2Y69 E;  3TG5 A;  4Z68 A;  1OWL A;  2IF4 A;  2ION A;  3W9F A;  4OVV A;  3NAW A;  3FUI A;  2X6H A;  2XZT G;  2DYS E;  5HKP A;  5HQ8 A;  1S0P A;  4AVX A;  4JL0 A;  2UWJ G;  3C5R A;  3ENE A;  4BX9 A;  3ASF A;  1A17 A;  1BPO A;  3BG0 B;  3B7S A;  1TN6 A;  5AQ9 A;  2L0T B;  1H2T C;  3ZYQ A;  5C1D A;  4F1S A;  3ZU7 B;  2ZU6 B;  1NI1 A;  3GZS A;  1H2U A;  3PZ1 A;  2VJ8 A;  2V0P A;  3JQ1 A;  3U66 A;  2QYU A;  3QKY A;  4M7C A;  1K1B A;  3TWV A;  4U7E B;  5D2M C;  3CV0 A;  4J8E A;  2I1K A;  4XKB A;  4HLE A;  1K3Z D;  2H6I A;  4J6I A;  2XS8 A;  3L08 A;  3JUE A;  4U04 A;  2BTD A;  4E6H A;  3SY2 A;  1U3C A;  4JXT A;  2WXL A;  4GTP A;  1HZ4 A;  2QY7 A;  1TYQ G;  3OXL A;  4Q96 A;  2Y4T A;  3TL5 A;  2LUH A;  5CRU A;  5AN8 A;  2QC9 A;  4HQD A;  4WWN A;  4N5C A;  3EU9 A;  1LF8 A;  3E33 A;  1TNZ A;  5AAR A;  2KCL A;  3CVW A;  3TJP A;  2J49 A;  2Y4U A;  1TN7 A;  5G05 J;  4UWH A;  4G11 A;  4HFG A;  4XKC A;  3SZ7 A;  1SA5 A;  3HDX A;  2Q7F A;  4L9P A;  4KT6 B;  2OVF A;  4LER A;  2UY1 A;  3QJZ A;  1N11 A;  1TNU A;  1KLX A;  4A63 B;  3HRA A;  3JQ0 A;  3SI5 A;  3CHM A;  3IV0 A;  3CQG B;  3ESL A;  3BEE A;  3CEQ A;  4GTM A;  2WB2 A;  5DBK A;  4WNE A;  3KSL A;  3FU6 A;  1E7U A;  3FP3 A;  1FPP A;  4A1S A;  3S7J A;  2M63 A;  2MOW A;  1S70 B;  2VGX A;  2WXO A;  2Y3A A;  3D9N A;  4RQI A;  3AS5 A;  4HLL A;  1PAQ A;  2OV8 A;  2BUG A;  5IY5 E;  2XEN A;  2PQN A;  1GW6 A;  4NAC A;  1SZA A;  1N94 A;  4A55 A;  2UY1 B;  1SA4 A;  4G2V A;  2AJA A;  2J4B A;  4ZHB A;  3HG0 D;  4ZFH A;  3LKU A;  1RW2 A;  3CHP A;  3RRN B;  3SD5 A;  3R9M A;  5J08 A;  4GAA A;  1JCQ A;  1KT0 A;  4DX5 D;  2VSN A;  1X5B A;  4GYY A;  4H7Y A;  4OYS A;  2VGX B;  4O1O A;  1FCH A;  4QQI A;  3UQ3 A;  3QWP A;  1HE8 A;  1HS6 A;  5T4Y A;  4UWK A;  4IRU A;  2PZI A;  3CHO A;  4U63 A;  3EDT B;  4HVB A;  5CMY A;  3TWX A;  3C72 A;  3HYM B;  4LNU D;  5FQ8 A;  2FO1 E;  3CLJ A;  5BXO A;  3HXC A;  4HOT A;  2J8S D;  3UM1 A;  3UKU G;  3FUM A;  2X38 A;  2WXP A;  2RD0 A;  3RIB A;  1HO8 A;  2WXN A;  3UIP C;  3D9I A;  2V5F A;  3QWW A;  5FIO A;  5J90 A;  4JA9 A;  4ABN A;  1TNB A;  4R7L A;  2XCB A;  3UIN C;  3ONK A;  4WWO A;  4GZ5 A;  2I9C A;  2XRZ A;  1NA0 A;  3ABM E;  2WXF A;  3UXG A;  2QFC A;  5A23 A;  3CQC B;  4W9R A;  2GRQ B;  2L6B A;  2PM6 A;  2L9B A;  4UQX A;  2OOE A;  2DIW A;  1FVF A;  5JA4 D;  3ASN E;  3Q9U C;  2C0M A;  2EQX A;  3ZNG A;  1X81 A;  4BX8 A;  4HRL A;  4AIF A;  4IYP A;  3BG1 B;  3L9T A;  2FF4 A;  5G2N A;  1E8Y A;  2GRM A;  3FFL A;  4GTR A;  3Q73 A;  4APO A;  3RK6 A;  3DSS A;  1ZBP A;  4XX5 A;  1HF8 A;  4J8F A;  2KZT A;  3WG7 E;  3URZ A;  1MYO A;  1H6K A;  2EIM E;  3CK9 A;  3GYZ A;  3PZD A;  4GTS A;  1D8E A;  3ASO E;  3ULY A;  4FHJ A;  2VGY A;  3PE3 A;  3B13 A;  3NZU A;  2WQH A;  5FZS A;  3O48 A;  3ZHE A;  3T5V A;  1AP7 A;  2LAI A;  4BY6 A;  2J9Q A;  5ENO D;  2PQR A;  5KBA A;  4OAV B;  3AG3 E;  3ML8 A;  4JHJ A;  1TN8 A;  2P9I G;  1H6P A;  4K03 A;  5FIN A;  1N52 A;  4BEP A;  3JYS A;  4GYW A;  3UM3 A;  4GA2 A;  4EZK A;  2KZT B;  2CFZ A;  3Q4A B;  3D9J A;  3ESK A;  4UI9 J;  3WXX A;  4DRX E;  3CK8 A;  2RFA A;  5KJL A;  3I5P A;  1QQE A;  3ZHE B;  4I2W A;  5AQB A;  4A3T A;  4NRH B;  4F7A A;  3QAR A;  3DBS A;  1LTX A;  4URK A;  4XIF A;  2E0I A;  5CEA A;  3OAW A;  2IOL A;  4UWG A;  3TWU A;  1E8X A;  1WDY A;  5EDS A;  2WXH A;  2ILR A;  2IJG X;  3FEX A;  1OCC E;  5CCL A;  3DWL G;  2HR2 A;  3CGH A;  3MYV A;  2XEE A;  1JUQ A;  4Y6C A;  3P1U A;  4AOF A;  3FTZ A;  4MS6 A;  2MRI A;  4TUU A;  3TAX A;  3CHR A;  4KZ0 A;  4GB9 A;  4CGV A;  4F53 A;  4FC8 A;  4JPS A;  2J08 A;  4DJA A;  5KJK A;  4K5C A;  3Q75 A;  4A1G A;  3APC A;  1MZC A;  1UG3 A;  1LD8 A;  4I6G A;  5AJL A;  4GTQ A;  1H0A A;  4NIK A;  1SZ9 A;  3B7B A;  1WY6 A;  4ACL A;  3DRA A;  5A7D B;  4K5B A;  4TXR A;  3FUE A;  4C48 B;  4HS2 A;  5CER B;  2FUL A;  3SNX A;  4J8Y A;  3AS8 A;  2P9U G;  5ITZ F;  2XGM A;  2P9K G;  3L17 A;  4HOQ A;  4AV7 A;  3BQO A;  3PNL B;  2DZN A;  3HHM A;  3Q15 A;  5HI7 A;  5M72 A;  4YND A;  2YQ8 A;  3LCA A;  2LXL A;  5G04 C;  4G23 A;  2WMN A;  4U8V D;  3AAA C;  2IFU A;  2R59 A;  2B0O E;  2H6H A;  1BI8 B;  4YVQ C;  3RSE G;  4TUM A;  2VSX E;  3HXF A;  3FTS A;  4XZ4 A;  2DZO A;  2YHE A;  4U07 A;  2KCV A;  4QFV A;  3ZIM A;  2IQC A;  5ANR A;  2WXM A;  1BI7 B;  3ZVV A;  3LY7 A;  1MX6 A;  4BTA A;  3TWQ A;  1S63 A;  2AXU A;  3S7F A;  1TR4 A;  4CDR A;  4LNB A;  3PEV B;  3ZW3 A;  2YHC A;  2P9P G;  1OUV A;  4MLP A;  3D9K A;  5CRV A;  4KMO A;  3FUL A;  3LEW A;  5KCM A;  4GZ6 A;  4B8A A;  3E34 A;  1QNF A;  3L82 A;  2BED A;  4UI9 K;  2WMO A;  3S2A A;  4FAD A;  4EBA A;  4JZY A;  3V2O A;  2WM9 A;  1DC2 A;  3DEP A;  3TXM A;  2A4Z A;  4KZC A;  3DSX A;  1E8W A;  1SW6 A;  1OWO A;  5KNH D;  4UWL A;  4A3V A;  3EJN A;  3MA5 A;  5CBN A;  1Z6T A;  3FH8 A;  2XGS A;  4UQY A;  5FWQ A;  4GTT A;  1H2V C;  4BSZ B;  4GZC A;  1IXV A;  4FJZ A;  5AIJ A;  4AEZ C;  1DVP A;  1FT1 A;  4TXQ A;  3FH5 A;  2VSY A;  2LAH A;  3N71 A;  4RG6 A;  2Y0B G;  3G2U A;  3ZUV B;  2L0I A;  3G2T A;  3VLE A;  4WUY A;  4CEM A;  4TXP A;  2IO3 C;  3SQV A;  3LY8 A;  1OCZ E;  3D9P A;  1TJC A;  4N39 A;  1AWC B;  1D9S A;  4PH4 B;  3KS2 A;  2KAT A;  3EHN A;  2I1J A;  1N4P A;  1XNF A;  2V4L A;  4I2Z A;  4L2Y A;  4XE0 A;  2JLB A;  5FT9 A;  3CVP A;  2CHW A;  5B1B E;  3EIQ C;  3CR3 A;  3E30 A;  3QNK A;  3PZ2 A;  1IQR A;  3KAE A;  4JW1 A;  4RLY A;  4DUI A;  1KZO A;  2C0L A;  4CZ2 D;  1HH8 A;  3T8K A;  2WPV A;  2X6K A;  1MQS A;  4EEC A;  4HRM B;  3ISM C;  3AU5 A;  5DIZ A;  3T5X A;  4FU3 A;  3JXJ A;  3BUA A;  4N2S A;  1IKN D;  3AG2 E;  4I17 A;  5AAO A;  3T9K A;  3MGB A;  5LX8 A;  3FTW A;  4C0M A;  4PS3 A;  4G24 A;  4HB5 A;  4KYO B;  4OVU A;  4C9B B;  2AXV A;  4WND A;  1A5E A;  4AY6 A;  2IEJ A;  4CT4 A;  2LSV A;  3IBE A;  5EX3 A;  2MYO A;  5LP0 A;  3AG1 E;  4B8C B;  3RO3 A;  3ZRH A;  2JAB A;  3QC1 A;  2IU1 A;  3PUK A;  3ZPJ A;  3CHQ A;  1H19 A;  4I6E A;  2CFU A;  3MX3 A;  4PUC A;  3ASD A;  4UWF A;  3FDH A;  1UN8 A;  3L54 A;  3R7Q A;  5BXU A;  2X6F A;  1RZ4 A;  5HS0 A;  2XZD G;  5AJD A;  5EID A;  1SVX A;  5E75 A;  1QYM A;  2A5U A;  5BPP A;  3CIA A;  1N0Q A;  4HI8 A;  1HX8 A;  3OXG A;  3IXE A;  1HG5 A;  3B7T A;  4P29 A;  5HRY A;  3E4B A;  4ILG A;  2XRY A;  2WXK A;  1Z5S C;  1YA0 A;  2RFM A;  3L6A A;  3FU0 A;  2YNQ A;  3B7R L;  3HXB A;  4GMJ A;  4CYM D;  3HVE A;  2QZA A;  3VLD A;  4EHM A;  4JEU A;  4U0U A;  4U0Z A;  3B7U X;  3UMV A;  2ZIS A;  5B3S E;  1N9A A;  3GZ2 A;  4LG6 A;  4PDX A;  3LJ3 A;  4UUC A;  3DXM G;  3IHV A;  3MV3 B;  2X6J A;  4XI0 A;  3QK0 A;  2NSZ A;  3TWS A;  4Q94 A;  5ARG A;  4DX1 A;  1MJ0 A;  5EYL A;  4BWR A;  4ANU A;  2CG2 A;  4HOS A;  4GTV A;  1EDU A;  2AVP A;  3HVE B;  1HXI A;  1TNO A;  1SQM A;  3FTV A;  4L23 A;  5G55 A;  3TWW A;  2LXM A;  2B6C A;  5ENS D;  4X8Q A;  5JJ6 A;  1TEZ A;  4ANV A;  3MV2 B;  5LOZ A;  2ZXW E;  4L2L A;  3PS6 A;  2IOS A;  4F1P A;  3ZGQ A;  5JMN D;  5EX0 A;  3TG4 A;  3W9G A;  5AQ7 A;  4ILH B;  2OCC E;  1MHQ A;  2A5E A;  3L16 A;  2DBA A;  2EIN E;  2H6F A;  4YDY A;  5CEC B;  4B93 B;  2GRP B;  1O1S A;  1BLX B;  4AJW A;  3LVQ E;  4GYO A;  4CT0 A;  1KT1 A;  4EBA G;  3E32 A;  3VTY A;  1JWF A;  4FA6 A;  4JB8 P;  1IQU A;  4G1T A;  2BKG A;  3TGO A;  3T8M A;  3X2Q E;  3MJW A;  4DPR A;  3RJV A;  4GCN A;  3NF1 A;  4TV3 A;  2Y1L E;  4FP7 A;  4JHK A;  3ASH A;  2LO6 A;  3FUD A;  3FU3 A;  4BSX A;  5C2Y A;  3ZYL A;  4HNA D;  2I2O A;  2WVI A;  2XEV A;  3ZXP A;  2KBX A;  4N3B A;  4GZ3 A;  2V4H C;  2IO2 C;  2IY0 C;  4ILI A;  2ZGD A;  1OCO E;  3R7R A;  3DSV A;  3MEK A;  4NUR A;  4I6J A;  2BKK B;  3ZYK A;  1ELW A;  3PVL A;  1NP7 A;  4WNG A;  1O1T A;  4N2Q A;  2FO7 A;  5D0O D;  4AY5 A;  3CVY A;  3MKQ A;  1WAO 1;  3JCK C;  4MBG A;  4J7W A;  3U3W A;  4J8D A;  4K5A B;  2RG8 A;  1H6O A;  1JCS A;  4I9C A;  1Y6I A;  5KWD A;  3SBS A;  3C98 A;  3EUV A;  2AW6 A;  4ATG A;  2MHK A;  3ML9 A;  3ZKJ A;  1V54 E;  4L7T A;  1YCS B;  3FHE A;  4YDW A;  5FQ7 A;  1BD8 A;  3F6Q A;  3FH7 A;  4XEI G;  2LNI A;  1E96 B;  3FUF A;  4KBQ A;  4IUL A;  1OXJ A;  1UJJ A;  1V55 E;  2NC9 A;  3EHM A;  4M3O A;  2R02 A;  2VGE A;  2WXQ A;  4GTO A;  3IEG A;  2PL2 A;  3MKQ B;  3ONL A;  4KVO A;  2P2C P;  5BW8 C;  2EIJ E;  2GRN B;  4JHR A;  3VLF A;  1HU3 A;  2DCP A;  5CHE E;  3APF A;  2GW1 A;  1FT2 A;  1NZN A;  1OY3 D;  4NQ0 A;  5LCW C;  4O60 A;  3NQP A;  3G2W A;  3RO2 A;  4C0E A;  1KPS B;  3IHY A;  4UQZ A;  4GPM A;  4GU5 A;  5CED B;  4GPK A;  4D10 C;  3MZL B;  3KD7 A;  3L22 A;  4RSY A;  3UUX A;  3RRM B;  2OVB A;  1U2V G;  3SGH A;  1QZ2 A;  3V2X A;  4MKT A;  4JVS A;  3SHF A;  4BT9 A;  5JHB A;  2KCK A;  3SO8 A;  1JPL A;  3PUJ A;  4RG9 A;  1OWM A;  4WNF A;  2ZIR A;  3SF4 A;  1WM5 A;  3Q7A A;  4CRW A;  2HO1 A;  2ETB A;  5ANL A;  1FVH A;  1W3B A;  4XI9 A;  5A6C A;  3NZS A;  5E76 A;  4EPZ A;  1G3N B;  3LY9 A;  4WAF A;  3L13 A;  2P9L G;  3I4G A;  3CVQ A;  2EIK E;  4G8K A;  2P9N G;  4GMR A;  4B94 A;  2KXP C;  2KM4 A;  4ME2 A;  1IYG A;  3PZ4 A;  5CCM A;  3U64 A;  2NXP A; 
#chains in the Genus database with same CATH homology
 5LX8 A;  3FTW A;  4C0M A;  1E8Y A;  2GRM A;  3FFL A;  5KJM A;  4PS3 A;  4ACK A;  4APO A;  4ANW A;  4G24 A;  4KYO B;  3RK6 A;  4HXI A;  4OVU A;  1ZBP A;  4C9B B;  4XX5 A;  2AXV A;  4WND A;  3AU4 A;  1EYH A;  1HF8 A;  4HOU A;  4AM9 A;  4FUL A;  4J8F A;  5FQ4 A;  4AY6 A;  1EPU A;  2VQ2 A;  2KZT A;  3URZ A;  4CT4 A;  1PC2 A;  2CHZ A;  2LSV A;  3IBE A;  5EX3 A;  3QDN A;  1ELK A;  4F3V A;  1H6K A;  5LP0 A;  3CK9 A;  3CKC A;  4B8C B;  3GYZ A;  3PZD A;  3RO3 A;  3ZRH A;  4BFR A;  3RU0 A;  2YIN A;  3QC1 A;  2IU1 A;  4FHJ A;  4B89 A;  2VGY A;  3PE3 A;  3LDZ A;  3FTX A;  3PUK A;  3B13 A;  4LUN U;  3NZU A;  3Q5M A;  2WQH A;  5FZS A;  3O48 A;  3ZHE A;  1P5Q A;  3ZPJ A;  3T5V A;  3FEY A;  3PRZ A;  3CHQ A;  3FWV A;  5D0Q D;  2LAI A;  5AEN A;  4G25 A;  4BY6 A;  2J9Q A;  3VTX A;  3JUI A;  1H19 A;  2XPZ A;  4I6E A;  2CFU A;  3MX3 A;  3D9M A;  4PUC A;  2PQR A;  4FJY A;  3ASD A;  4UWF A;  3FDH A;  1UN8 A;  4DI4 A;  5G05 C;  3D3M A;  3MCX A;  3ML8 A;  1DNP A;  3LPZ A;  4JHJ A;  4U8H A;  1HG2 A;  4KXK B;  3L54 A;  3R7Q A;  4K03 A;  1N52 A;  2J07 A;  2X6F A;  4FLH A;  3JYS A;  4GYW A;  2VTB A;  3CVV A;  4GA2 A;  1OWN A;  4EZK A;  2KZT B;  2XQ0 A;  5AJD A;  4IN3 B;  2C2L A;  4ANX A;  4CDM A;  1XGW A;  5EKQ D;  4BTB A;  3G2S A;  3D9O A;  3CVL A;  1UW4 B;  4Q69 A;  2CFZ A;  3Q4A B;  2VYI A;  3D9J A;  3ESK A;  5E75 A;  4EQF A;  1ZU2 A;  4UI9 J;  2CHX A;  3WXX A;  2A5U A;  5BPP A;  3CIA A;  5BNW A;  3CK8 A;  2AWI A;  3CVN A;  2X6I A;  5KJL A;  2WQ7 A;  1HX8 A;  3I5P A;  3LXU X;  3OXG A;  1QQE A;  3CVU A;  2AXZ A;  1HG5 A;  2HYZ A;  4K0R A;  3B7T A;  5FTP A;  4P29 A;  3ZHE B;  3FUN A;  4I2W A;  2XPY A;  2R5S A;  3I3N A;  3G2V A;  3E4B A;  4A3T A;  4NRH B;  4F7A A;  3FUH A;  1Z3X A;  4ILG A;  3APD A;  3QOU A;  2XRY A;  2WXK A;  3QAR A;  1YA0 A;  3ZYM A;  3RKV A;  1Z3Y A;  3L6A A;  3DBS A;  4FLB A;  3FU0 A;  3UT7 A;  2YNQ A;  4URK A;  4XIF A;  3B7R L;  3K9I A;  5BV1 A;  2E0I A;  2X3M A;  3OAW A;  2IOL A;  4UWG A;  4KVM A;  3QAQ A;  2GGF A;  4GMJ A;  5BV0 A;  2VTB B;  1E8X A;  2JEK A;  5G04 J;  4CDN A;  5EDS A;  5JJ7 A;  2WXH A;  5FQ6 A;  2ILR A;  3CKB A;  3TXN A;  2IJG X;  3FEX A;  3HVE A;  4JC8 A;  3U9W A;  4APF A;  4AXH A;  3S7D A;  1UJK A;  2XGO A;  3VLD A;  5CCL A;  4LRZ A;  4RVB A;  3PEU B;  2HR2 A;  3CGH A;  2L6J A;  3MYV A;  3PRE A;  4JEU A;  4U0U A;  2FBN A;  4MRU A;  4U0Z A;  3B7U X;  3UMV A;  1JUQ A;  4Y6C A;  4HOR A;  3P1U A;  4PS8 A;  4AOF A;  3FTZ A;  2J09 A;  4BT8 A;  4MS6 A;  4GML A;  2XCC A;  3UX4 A;  2MRI A;  4TUU A;  3AS4 A;  3TAX A;  4U0S A;  3CHR A;  4KZ0 A;  5LCW J;  4O6F A;  3GZ2 A;  3Q49 B;  4GB9 A;  3TG5 A;  3RRU A;  1OWL A;  3LJ3 A;  4PDX A;  2IF4 A;  3FTU A;  2ION A;  4CGV A;  3IHV A;  4F53 A;  4CGW A;  3MV3 B;  4FC8 A;  4JPS A;  2J08 A;  3ZXS A;  4OVV A;  2X6J A;  4DJA A;  4XI0 A;  3CST A;  3FUI A;  3QK0 A;  3CK7 A;  4PS7 A;  5KJK A;  1EF1 C;  2NSZ A;  2X6H A;  4EZL A;  4A1G A;  4Q94 A;  5ARG A;  3APC A;  3QWV A;  4BWR A;  4ANU A;  2CG2 A;  1UG3 A;  5HQ8 A;  1S0P A;  4I6G A;  4I43 A;  4AVX A;  4HOS A;  4JL0 A;  5AJL A;  2UWJ G;  1EDU A;  2AVP A;  3HVE B;  1H0A A;  3ENE A;  1HXI A;  4L23 A;  1SQM A;  3FTV A;  5G55 A;  4BX9 A;  3ASF A;  1A17 A;  1SZ9 A;  1WY6 A;  2PM7 A;  2WXR A;  4ACL A;  5A7D B;  1E90 A;  5JJ6 A;  1BPO A;  3CHS A;  3FUE A;  3UPV A;  5KJN A;  4J8S A;  3BG0 B;  4HS2 A;  3B7S A;  2FUL A;  2L0T B;  3SNX A;  1TEZ A;  4ANV A;  3MV2 B;  1H2T C;  3AS8 A;  2OND A;  5LOZ A;  3ZYQ A;  4E85 A;  5C1D A;  4F1S A;  2LSU A;  1N54 A;  2V8S E;  2ZU6 B;  4L2L A;  5AYW D;  2XGM A;  3GZS A;  1H2U A;  3PS6 A;  3L17 A;  2IOS A;  4H7X A;  4HOQ A;  4AV7 A;  3HIZ A;  3ZGQ A;  2VJ8 A;  2V0P A;  3PNL B;  3HHM A;  3JQ1 A;  5EX0 A;  3U66 A;  3QKY A;  3ULQ A;  5CMW A;  3PDN A;  3FY4 A;  3Q15 A;  5HI7 A;  3TG4 A;  5M72 A;  3U4T A;  4YND A;  2YQ8 A;  3LCA A;  4ILH B;  3Q47 B;  1MHQ A;  3L16 A;  4G23 A;  5G04 C;  2DBA A;  3CV0 A;  3ZEF A;  2WMN A;  4J8E A;  2I1K A;  4XKB A;  4HLE A;  2IFU A;  2R59 A;  1JWG A;  4GA1 A;  4FHK A;  4J6I A;  3L08 A;  4YVQ C;  2CG3 A;  4U04 A;  2BTD A;  2VSX E;  4E6H A;  4AJW A;  4DK5 A;  3FTS A;  4XZ4 A;  1E8Z A;  1U3C A;  3LVQ E;  4GYO A;  3PH0 C;  4JXT A;  2WXL A;  4CT0 A;  1KT1 A;  2YHE A;  3LYA A;  4EBA G;  4U07 A;  2KCV A;  4QFV A;  1HZ4 A;  2QY7 A;  3VTY A;  1JWF A;  3ZIM A;  2IQC A;  3OXL A;  4FA6 A;  5ANR A;  2WXM A;  4Q96 A;  3ZVV A;  3LY7 A;  2Y4T A;  3TL5 A;  1IQU A;  4BTA A;  1INZ A;  4G1T A;  3LS8 A;  3UT4 A;  1IHG A;  1TJF A;  3TGO A;  1HFA A;  3IKO B;  4WWN A;  3T8M A;  4N3C A;  3MJW A;  4N5C A;  4DPR A;  4JEH A;  2AXU A;  4TRQ A;  3S7F A;  1LF8 A;  3RJV A;  4GCN A;  3NF1 A;  4CDR A;  4TV3 A;  2KCL A;  3CVW A;  1OWP A;  2P58 C;  4I1M A;  3TJP A;  4FP7 A;  4JHK A;  3ASH A;  3PEV B;  2XPI A;  2FI7 A;  2J49 A;  3ZW3 A;  2Y4U A;  2LO6 A;  2YHC A;  4I1A A;  3UT8 A;  1OUV A;  3FUD A;  5G05 J;  3FU3 A;  2WQ6 A;  4UWH A;  4MLP A;  3D9K A;  4BSX A;  4G11 A;  5C2Y A;  3GW4 A;  3ZYL A;  4HFG A;  4XKC A;  4KMO A;  3FUL A;  3SZ7 A;  3HDX A;  3LEW A;  2I2O A;  2Q7F A;  5KCM A;  2WVI A;  4KT6 B;  2XEV A;  2KC7 A;  4N3B A;  4GZ6 A;  2OVF A;  4LER A;  4B8A A;  2UY1 A;  3QJZ A;  4GZ3 A;  4V3I A;  1QNF A;  1KLX A;  4ILI A;  3JQ0 A;  4I1O B;  5JJT A;  3SI5 A;  4UI9 K;  2WMO A;  3MKR A;  3S2A A;  2J4D A;  2BF0 X;  3SFZ A;  5ARF A;  1L5J A;  3CHM A;  3IV0 A;  3R7R A;  1PY1 A;  3OTN A;  4EBA A;  4FAD A;  4Y6W A;  3CQG B;  4EZJ A;  3MEK A;  3ESL A;  3BEE A;  3CEQ A;  4NUR A;  4I6J A;  4JZY A;  5DBK A;  2WB2 A;  2WM9 A;  1E7V A;  4WNE A;  3ZYK A;  1ELW A;  3PVL A;  1NP7 A;  3FU6 A;  3TXM A;  1E7U A;  3FP3 A;  4WNG A;  4N3A A;  2A4Z A;  2FO7 A;  5D0O D;  4KZC A;  3S7J A;  4A1S A;  4N2Q A;  2M63 A;  2MOW A;  2VGX A;  2WXO A;  2Y3A A;  3D9N A;  4AY5 A;  3CVY A;  4LCT A;  1E8W A;  3PE4 A;  3MKQ A;  1WAO 1;  3AS5 A;  4AP2 A;  1OWO A;  3JCK C;  1PAQ A;  4UWL A;  4DLO A;  3U3W A;  4J8D A;  2OV8 A;  3QB2 A;  2RG8 A;  4UI9 C;  3LVR E;  2BUG A;  4JA7 A;  3GZ1 A;  4A3V A;  2PQN A;  1GW6 A;  3EJN A;  3I4R B;  4NAC A;  3MA5 A;  1Z6T A;  1SZA A;  2E2E A;  3FH8 A;  2XGS A;  4GCO A;  4UQY A;  5ENN A;  5FWQ A;  4I9C A;  1Y6I A;  3SBS A;  4A55 A;  2UY1 B;  1H2V C;  4G2V A;  3C98 A;  4DLQ A;  4GZC A;  5AIJ A;  4FJZ A;  2J4B A;  4AEZ C;  1DVP A;  2AW6 A;  5FZR A;  4ATG A;  2MHK A;  3ML9 A;  3FH5 A;  2VSY A;  3O4Z A;  3LKU A;  3CVX A;  4L7T A;  3FHE A;  2WXI A;  1ELR A;  4G26 A;  3ASG A;  3CHP A;  2LAH A;  3N71 A;  4RG6 A;  5FQ7 A;  3G2U A;  3RRN B;  4LEU A;  3FH7 A;  2L0I A;  3SD5 A;  2LNI A;  1E96 B;  3G2T A;  3FUF A;  5J08 A;  4L1B A;  4GAA A;  4IUL A;  4KBQ A;  3VLE A;  1KT0 A;  5BUZ A;  2I6H A;  2R17 C;  2VSN A;  4GZD A;  1UJJ A;  4WUY A;  1X5B A;  4CEM A;  2NC9 A;  3EHM A;  4GYY A;  4H7Y A;  4M3O A;  4OYS A;  2VGX B;  2WXQ A;  3LY8 A;  3IEG A;  3D9P A;  5FZQ A;  4YVO A;  1TJC A;  4N39 A;  2PL2 A;  5LFA A;  3FTY A;  1FCH A;  3MKQ B;  3ONL A;  5BT1 A;  4KVO A;  1Y8M A;  3UQ3 A;  3QWP A;  1HE8 A;  3KS2 A;  4PH4 B;  5BW8 C;  2KAT A;  3EHN A;  1HS6 A;  5T4Y A;  4JHR A;  4UWK A;  1HU3 A;  2I1J A;  3VLF A;  1U3D A;  2DCP A;  4IRU A;  5CHE E;  5FJY A;  4CCA A;  3APF A;  2PZI A;  2GW1 A;  5LCW C;  1NZN A;  1XNF A;  2WXJ A;  3CHO A;  4NQ0 A;  5JHA A;  4U63 A;  3EDT B;  3NQP A;  3G2W A;  4GA0 A;  4HVB A;  5CMY A;  2V4L A;  3HYM B;  4I2Z A;  4L2Y A;  3RO2 A;  4XE0 A;  2JLB A;  5FT9 A;  3CVP A;  5FQ8 A;  2CHW A;  4C0E A;  3IHY A;  4UQZ A;  3CLJ A;  4GU5 A;  4GPK A;  2FEZ A;  1UN9 A;  3D9L A;  3EIQ C;  3KD7 A;  3MZL B;  4D10 C;  4HOT A;  4J0U A;  3L22 A;  3CR3 A;  4RSY A;  3UUX A;  1NA3 A;  3FUM A;  5T3R A;  3RRM B;  2X38 A;  3QNK A;  2OVB A;  4WWP A;  2WXP A;  1IQR A;  3KAE A;  2RD0 A;  4JW1 A;  5T8I A;  3SGH A;  1QZ2 A;  3RIB A;  1HO8 A;  2WXN A;  4MKT A;  3R9A B;  3DPD A;  3D9I A;  2V5F A;  4JVS A;  3QWW A;  4I9E A;  5J90 A;  4JA9 A;  4ABN A;  2C0L A;  3SHF A;  4BT9 A;  1HH8 A;  5JHB A;  2KCK A;  4R7L A;  3S7B A;  2XCB A;  1JPL A;  3PUJ A;  3ZN3 A;  3ONK A;  3OXF A;  4RG9 A;  1OWM A;  4WNF A;  3CSF A;  3SF4 A;  2WPV A;  3KEZ A;  2X6K A;  1WM5 A;  4GZ5 A;  4WWO A;  1MQS A;  4CRW A;  2HO1 A;  2I9C A;  2XRZ A;  1VDY A;  5ANL A;  1NA0 A;  2WXF A;  1FVH A;  1W3B A;  2QFC A;  4XI9 A;  5A6C A;  3NZS A;  5E76 A;  5A23 A;  3CQC B;  4W9R A;  4EEC A;  4EPZ A;  2XHE A;  2WXG A;  2PM6 A;  2L9B A;  4UQX A;  2OOE A;  3LY9 A;  2DIW A;  3AU5 A;  3L13 A;  2VSO E;  1FVF A;  3P2B A;  4WAF A;  5DIZ A;  2HM8 A;  3I4G A;  3FUK A;  3T5X A;  3CVQ A;  2C0M A;  2EQX A;  4FU3 A;  3PNT B;  3ZFW A;  4B0Z A;  4B94 A;  4N2S A;  3EIJ A;  2KM4 A;  1B89 A;  2GRL A;  4ME2 A;  4BX8 A;  4DI3 A;  5CCM A;  1IYG A;  3FUJ A;  4I17 A;  4AIF A;  3U64 A;  3FU5 A;  4IYP A;  3BG1 B;  2FF4 A;  2NXP A;  3MGB A;  5G2N A;  3SBT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...