4L7TA

B. fragilis nanu
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
499
structure length
490
Chain Sequence
b'IDPTSSIADSNYWKTEAQFSTFNVGLHALLRECSFNFFLLGEPRADIYGDVPFGGEATQGMERLPFNTINKENTGISNFAGMYKVINQINLMIAKTKETTVLSEAGKNYYLGEAYGMRAYLYFHLLRSWGDVILYLDYTNSKAASPAEEVMKQIKEDITASEKGFGSDYSFKYGRYYWSMAATQMLKGEVYLWSGRQMGGGTADYTTAKTALQSIVSNANVSLQDDFSKVFAYNNKDNSEIIFSIRNAKDEYNMWDDRFRQNLVPQQAYMTSTYCNKEGVSFKDLPEGQLNGLIRLQIRYDLYNKAFRDGDTRKDASMTAVYQKQQDGTVKYIAPFCNKYQGVLLDGASQRSFLNDYPIYRYADCLLLLAEAKALLGEDPTAEINQVRERAYGKEFFEANKATLAYPNDKGDFYTDNKYMSGDEDPLEAILKERMREFMFEGKRWYDLRLLGADYVTKRTSAVATRLLWPINESVLTDNPALKQTPGYQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NanU sialic acid binding protein
publication title Structural and functional characterization of NanU, a novel high-affinity sialic acid-inducible binding protein of oral and gut-dwelling Bacteroidetes species.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Sialic acid-binding protein
total genus 181
structure length 490
sequence length 499
ec nomenclature
pdb deposition date 2013-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
A PF14322 SusD-like_3 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4l7tA00
5T4YA 3NQPA 3JQ0A 3IV0A 4LERA 3EHNA 4L7TA 5FQ4A 4PUCA 5FQ8A 3JQ1A 4Q69A 3FDHA 5J90A 3MX3A 3SGHA 5E76A 5FQ7A 3CKCA 3OTNA 3I4GA 3CK8A 3CKBA 3MYVA 5T3RA 3MCXA 4MRUA 3CK9A 3CGHA 3HDXA 3EHMA 3CK7A 3LEWA 4F53A 3KEZA 5LX8A 4F7AA 3GZSA 3L22A 3SNXA 5FQ6A 3EJNA 3JYSA 3P1UA 5E75A 3QNKA
chains in the Genus database with same CATH superfamily
3BUAA 4OVVA 3FTYA 5EKQD 5ENQD 5BNWA 1JCQA 3ZXPA 3KAEA 1HXIA 5FZSA 4N3BA 1NI1A 4PH4B 3NOGD 1LD8A 2OEVA 3IBEA 3L6AA 3RRUA 3W9GA 2XRZA 3ML9A 3QARA 3LS8A 2LAHA 4WNFA 1XNFA 4XIFA 3FU3A 4N39A 3V31A 3MCXA 3GYZA 3CK7A 2Y0BG 2GRPB 2KCLA 1DVPA 3RO2A 3ZVVA 1OXJA 1JWFA 3U4TA 4L2LA 3VTYA 3TG4A 2R59A 2KXPC 1TN8A 4HLEA 4R7LA 4DJAA 2A5EA 4TXQA 4NIKA 3FUIA 2KATA 2JEKA 3ZRHA 3IHVA 3V30A 1OUVA 4JA9A 2VSNA 2P9UG 2DVWA 4YVQC 2WXFA 4W9RA 4FHJA 3AAAC 5KJNA 3FHEA 3D9OA 1TNOA 4F1SA 5BW8C 2WM9A 3PZ4A 2AW6A 3E37A 5ENNA 5AQAA 3AJIA 4LSZE 2I2OA 4GPKA 4KMOA 2I1JA 5CBNA 1OY3D 2I6HA 2OVBA 4E6HA 2ZGDA 3FU5A 5EYLA 3TGOA 5ANLA 1HS6A 2L0TB 2GRNB 3SNXA 5H7PA 3PEUB 4BTBA 4BT9A 2QFCA 5BPPA 1H6KA 3L16A 2J49A 2KC7A 3VLDA 4N2QA 4K03A 4GZ5A 3VLEA 2P9LG 2YHCA 2XEHA 2Y3AA 1WDYA 4CRWA 2HYZA 1E8ZA 3JCKC 5KNHD 1Z5SC 2PM6A 3JQ1A 2VGYA 2DYRE 4GMRA 3CKBA 4JA7A 2QYJA 3CK9A 1LTXA 2FO7A 3D9HA 3ASHA 5FQ6A 4G8KA 1VDYA 3CSTA 1H0AA 2X6HA 4UI9J 3QB2A 2L6JA 4A1GA 3CVXA 4ZFHA 4FLHA 5D0QD 3T8MA 1K8KG 4I2ZA 4CT0A 2LSVA 2LSUA 4OVUA 1E7UA 2PL2A 1S64A 3UUXA 1N4QA 3E34A 3SO8A 2JLBA 4DI4A 2QYUA 2ILRA 4PS8A 3L17A 4CGWA 5ENSD 4K5CA 2VJ8A 4OAUC 4N5CA 3NAWA 4I6JA 5B1BE 3CIAA 3ZYLA 2R05A 1KPSB 2RKKA 4KVMA 2GGFA 3BEEA 3BQOA 3QAQA 1QQEA 3B7BA 5EILA 3UTMA 3GZSA 3S7DA 4GA0A 3D9KA 4GMLA 3MGBA 3JQ0A 3APDA 3UPVA 4AXHA 2QZAA 2XCCA 4G2VA 1PY1A 3AG4E 4K0RA 4TUMA 5AQ7A 3ZGQA 3S7BA 3DSSA 3LXUX 3N71A 2WPVA 5ENOD 2XPZA 3TWRA 2XQ0A 4BTAA 2CFZA 4A3TA 4LRZA 3FU0A 2YQ8A 1P5QA 2P2CP 3UT7A 4JEHA 4FADA 4HLLA 3ASFA 2F8XK 4G1TA 4UI9K 1H6PA 1RZ4A 4CYMD 1DC2A 2VSOE 3B95A 4GAAA 4QFVA 2OOEA 3TG5A 4I6EA 2EQXA 5JHBA 2WXKA 4ILGA 3PRZA 3UM3A 4UI9C 4EZKA 3TWUA 3MKRA 3FU6A 4LG6A 3MKQB 3FTZA 3Q79A 5ARFA 2F37A 4UWKA 5BV1A 3PS6A 4WAFA 4L7TA 3CVVA 2FO1E 5IY5E 4FU3A 3E32A 5DIZA 4ATGA 4I43A 1U3CA 1WM5A 4J8FA 3QWVA 4DX5D 5FTPA 4WWPA 3RSEG 3PUJA 1HX8A 5CERB 2IQCA 4A55A 4FLBA 1IQUA 3UX4A 2WXLA 2XHEA 3NZSA 4ANXA 4I2WA 4DPRA 3KSQA 3CVWA 1WG0A 2WXJA 2ZIRA 3UM2A 5FQ8A 1OT8A 4IULA 5BUZA 4UQXA 4EBAG 2X6FA 4LNBA 5EIDA 4XKCA 4DK5A 4GPMA 3CLJA 2R2LA 4O1PA 2KZTA 1N54A 2XPYA 3SFZA 1N4RA 3P1UA 4CZ2D 3ZKJA 5FT9A 3LKUA 1MX4A 4UWHA 4XE0A 4L9PA 4LUNU 2R5SA 3MX3A 3PNTB 4C0MA 2WVIA 2GRLA 3IXEA 5CCLA 2ZGGA 3IKOB 4J7WA 2PNNA 1XGWA 3PREA 4LERA 3APCA 3TWTA 2XPIA 3Q15A 4I9CA 4U96D 2V8SE 1JUQA 5EX3A 4HVBA 3URZA 5ENRD 2GROB 2MYOA 5JA4D 2IOLA 2P9SG 1FPPA 2P9KG 3ZIMA 3QWPA 2YNQA 4EZLA 1BU9A 4IYPA 1ZU2A 3AS5A 2EIJE 1N94A 5G2NA 4NRHB 4XI0A 3CVLA 3SBSA 3ZHEB 1OCCE 4GTRA 3DXMG 4JB8P 4GZ3A 4JEUA 5AYWD 4YDOA 1TNBA 2XENA 3G2TA 4TXRA 4BESA 4ANUA 3ZHEA 4BX8A 4DLQA 5HRYA 3L08A 3QWWA 1MX6A 3WXXA 1NFIE 2DIWA 5AENA 4F1PA 1TNYA 4AM9A 2IONA 3PZ3A 3QKYA 1NZNA 4ACLA 2VSYA 3CHMA 2XGSA 3D9LA 2ETAA 1HH8A 3HVEB 1QZ2A 4BSZB 3CEQA 1K1AA 2P9PG 4KVOA 3DBSA 4B89A 4F53A 3PUKA 4WNGA 4EPZA 3J5QB 4B94A 4JD2G 4HS2A 2CG3A 1OWLA 4IN3B 3DSXA 3AG3E 3HVEA 3PZ2A 2EILE 3EHQA 4WNDA 3SGHA 4DX7D 5LCWJ 3FUKA 2UY1A 3Q9UC 3LEWA 3P2BA 4JVSA 2UWJG 4YDYA 1SW6A 2J9QA 2H6FA 2XGMA 4GA1A 3RAUA 3SBTB 1N9AA 3EU9A 3FFLA 3ASNE 3LY9A 4EHMA 4HORA 5JJ6A 5HQ8A 5KJKA 3PZ1A 4HRMB 3NZUA 3BG1B 3HG0D 4N3AA 3RU0A 2EIME 4DLOA 1NP7A 2IO3C 3JUEA 3MV2B 4U0UA 1AWCB 1NL4A 2I9CA 2V5QC 3HXEA 4APOA 1ZB1A 3PE3A 4RSYA 4Z68A 3C3QA 4N5QA 3CK8A 5CRUA 4YNDA 3FUMA 4GTQA 3CHOA 5BXUA 4UQYA 3HXCA 2A5UA 3ESLA 2DYSE 4YDEA 2L0IA 2DZOA 3AU4A 1IQRA 2KCVA 4TV3A 3FTWA 5J90A 1IKND 4C48B 4B8CB 5ANRA 3L22A 3ZUVB 4UUCA 3Q9NC 3NBNB 4XKBA 3IV0A 3L82A 4H7YA 3RK6A 3ZU7B 4UWGA 5FIOA 4APFA 1TR4A 3MYVA 5LCWC 3C72A 4JZYA 1KT0A 4B0ZA 2WQHA 3SFXA 2XS8A 3CVYA 2C0LA 4QQIA 3JUIA 2FULA 1E8YA 1UW4B 4RVBA 4HOSA 1LF8A 3AS4A 1DCEA 3G2VA 5ENTD 1OWNA 3NF1A 3PNLB 3RJVA 3TXMA 1TN6A 4E85A 2P9IG 3O4ZA 3KEAA 3W9FA 3V2OA 1JPLA 3V79K 3DPDA 2LXMA 2J07A 3ML8A 3Q4AB 1NA0A 4DRXE 4HOQA 2E0IA 2AJAA 1JCRA 2WXNA 4OYSA 3LJ3A 4HOTA 2NSZA 2C0MA 4MBGA 4AY5A 4A63B 5CCMA 5CMYA 3CQGB 1X5BA 2BUGA 5CRVA 4BSXA 4I6GA 4U8VD 2Y4UA 3ENEA 2VTBB 4NACA 2WQ7A 5KJMA 2CHZA 3SQVA 1H6OA 2P9NG 3S7JA 3QNKA 4YDWA 1E8XA 3NQPA 3ESKA 4RG6A 1BI7B 1E90A 3R7QA 1UN8A 4U04A 3I5PA 2VTBA 2RFMA 5AJDA 5J08A 2HE0A 3UIPC 3CVUA 1TJFA 2WMOA 4FA6A 3SY2A 4C9BB 4GTOA 3UT8A 5ARGA 4F3VA 2QC9A 3SHFA 3CHQA 4G8LA 4ZHBA 1SA4A 3ASOE 2AXZA 1UJKA 1QNFA 4HRNA 2YINA 4C0EA 2FEZA 2L6BA 1NA3A 5FINA 4WUYA 2QY7A 4JHKA 2WQ6A 5FQ4A 4JHRA 2DBAA 3FTXA 4RLYA 3X2QE 3G2SA 3EIJA 3Q49B 4J8YA 4GMJA 2F0YA 1WAO1 3ULQA 3VTXA 2ETCA 3SZ7A 5KBAA 5M72A 3BU8A 1MJ0A 3CHRA 3R9AB 2Y69E 3G2UA 1DCQA 1MQSA 5AN8A 5LFAA 3ZYMA 1TNZA 4RQIA 3ISMC 4GYYA 5EDSA 4BWRA 1O1SA 2DZNA 5CBOA 5T4YA 3U9WA 4FJZA 3FUNA 5KJLA 1E96B 4RG9A 1IHBA 2DCPA 2E2EA 3T9KA 1H2TC 1BD8A 4PDXA 3DPYA 4KBQA 3LVQE 3DSTA 3FULA 3D9NA 3HXBA 4NURA 1HU3A 3RKVA 3ZFWA 4EQFA 1UG3A 3BG0B 3I3NA 1YA0A 2VGEA 4KT6B 5AQBA 3EUVA 2R17C 3HXFA 2J09A 3U64A 5AARA 2KZTB 2XEEA 2RD0A 3UI2A 5BT1A 5JJTA 2ETBA 1OWPA 3FTSA 3OXGA 1FVFA 5ENPD 3RRMB 4U8YD 1TN7A 4G24A 3OXFA 4BETA 2RFAA 3B7RL 2JABA 1H19A 3DEPA 1N52A 1QBQA 1Y6IA 1Q2ZA 2MHKA 3FUDA 5EN5D 3UXGA 2AWIA 3IHYA 1MHQA 2PM7A 3PEVB 4O60A 2IOSA 3E4BA 2X6KA 2IFUA 4HFGA 2CFUA 3D9IA 1N4PA 2I1KA 2WXRA 4HI9A 4ANWA 4MLPA 4F6RD 2WXOA 3L54A 3UT4A 5CECB 4ANVA 5KWDA 1L5JA 2X6JA 2BKGA 3CVNA 3ASGA 1MZCA 1ELKA 1UOHA 4CCAA 4TXPA 4XZ4A 1FCHA 5AJLA 3S7FA 3Q75A 1Z3YA 4N2SA 4J8EA 3TXNA 1O1TA 3ONKA 3AG1E 3KD7A 5B3SE 5KCMA 1TEZA 2R03A 3B7TA 2YHEA 3Q7AA 3R7RA 3VLFA 2GRQB 5G55A 4U63A 4MS6A 5CHEE 1U2VG 1S70B 1HFAA 3CQCB 5FJYA 1QYMA 2HO1A 5T3RA 4ME2A 3LPZA 4GCOA 4J8DA 3OAWA 3FWVA 4F7AA 3CVQA 4U95D 5JMND 3J5PA 3JYSA 2P58C 3UMVA 1DNPA 1D8DA 3CV0A 3ULEG 3GW4A 1SZ9A 1A5EA 4FP7A 4UWLA 4U7EB 4G23A 3NOCD 4UQZA 2OCCE 2WXMA 4O6FA 1MX2A 1O1RA 3SD5A 4HB5A 2IJGX 3Q73A 2UY1B 4G25A 2AVPA 3Q7FA 1EDUA 3G2WA 4LNUD 4TUUA 4HI8A 5HI7A 4GTPA 2EINE 1KZPA 1H2UA 2WXHA 1GW6A 3HRAA 3EHMA 4HNAD 4GZCA 3FH7A 1H2VC 4KXKB 3L9TA 4L2YA 3PDNA 3EHRA 5FZQA 5AAOA 1BPOA 3PVLA 4JW1A 3ZYQA 2OEWA 4X8QA 2A4ZA 4U0ZA 4H7XA 3HYMB 3F6QA 3UM0A 2MOWA 2NC9A 4I17A 4CEMA 3SFYA 2H6GA 3EJNA 3IEGA 1IYGA 1ZBPA 3ABKE 4AIFA 2AXVA 4GTSA 4URKA 2BF0X 4CT4A 5FZRA 5A6CA 1V55E 5BXOA 4UWFA 3KEZA 1V54E 3UKRG 2LXLA 2NXPA 3AS8A 5G04J 3UINC 3KS2A 3TJPA 4DX1A 2ZISA 1JWGA 3RRNB 5HKPA 3O48A 1HF8A 5DBKA 1MYOA 1O5MA 1RW2A 3TWVA 3MEKA 4I1MA 5LX8A 4M3OA 2V4LA 4HXIA 3B13A 2LUHA 2B6CA 1YMPA 3ZW3A 4AY6A 3FH8A 2IF4A 2CHXA 4HQDA 2WXGA 2IY0C 1A17A 3TWWA 3FEXA 4AVXA 2KM4A 4AV7A 4DX6D 5A7DB 2B0OE 1E8WA 3U3WA 3T5VA 5FQ7A 3MJWA 1Z3XA 2WB2A 1YYHA 2FF4A 4BT8A 2EIKE 4CDNA 4JXTA 5JHAA 4BFRA 4V3IA 2VQ2A 4CDMA 4DI3A 1X81A 3EU5A 4O1OA 4BERA 2IO2C 3OTNA 5HS0A 3E33A 4ABNA 3HIZA 5CMWA 4EZJA 4HBDA 2J4BA 1G3NB 3FP3A 2XEVA 1TNUA 1SVXA 4GA2A 4A3VA 1SA5A 3TWSA 5T8IA 3L13A 2XGOA 3DWLG 4AEZC 4PUCA 2H6HA 4FC8A 1IXVA 2Q7FA 4I1OB 4WNEA 1ELWA 1JCSA 3UKUG 3C98A 3K9IA 3FUEA 2J8SD 4J6IA 1INZA 2J08A 3ZN3A 5G04C 3CVPA 2BKKB 2KCKA 4Q69A 2RG8A 2IU1A 3GZ2A 5A23A 2X38A 4DX2A 2H6IA 3AG2E 1W3BA 2KBXA 3UM1A 2R02A 5D2MC 2X3MA 4BX9A 3D9MA 3RO3A 3CR3A 4LNGA 4MKTA 4LCTA 3TWQA 4L1BA 3E30A 3B7UX 2HR2A 3V2XA 2PQNA 3QDNA 4M7CA 3CKCA 3DEOA 3MA5A 4GZ6A 2DWZA 4Q96A 1Y8MA 2V4HC 3WG7E 5CEDB 2IEJA 4ILHB 3FUJA 1FT2A 3LYAA 2Y4TA 3ABLE 2FBNA 3KSLA 4GYOA 3PE4A 3ONLA 2LNIA 1EYHA 4AP2A 4XI9A 3APFA 4G26A 3ZYKA 3T8KA 3MV3B 4JHJA 3ZXSA 5E75A 2WXQA 4EBAA 3UQ3A 5BV0A 4EECA 2OVFA 4J8SA 2NYJA 4WWNA 1PAQA 5D66A 2V5FA 3JXJA 5FWQA 3I4GA 3ASDA 1S0PA 4XX5A 1N4SA 2LAIA 2BEDA 2XCBA 3HXDA 3FUHA 4FJYA 5G05J 2LO6A 2WXIA 4I9EA 4KZ0A 3FTVA 3LY8A 1UN9A 5ITZF 4FULA 1HO8A 4ACKA 3LDZA 3MZLB 3LCAA 2Y1LE 1HZ4A 4A1SA 4U0SA 4XEIG 1FT1A 5JJ7A 5C2YA 4K5AB 3C3RA 1N0QA 2HM8A 4K5BA 4NQ0A 3Q5MA 4ATZD 3U66A 3RIBA 4CGVA 4L23A 2ZXWE 3B7SA 4AJWA 1U3DA 5LOZA 3C3OA 1OCZE 2J4DA 2VGXB 1UJJA 4TRQA 3TWXA 3MKQA 2C2LA 1TYQG 4GTVA 2ONDA 3ABME 2PQRA 4GB9A 2WXPA 3QOUA 4G11A 4HOUA 4KZCA 1OWOA 4DUIA 4WWOA 2GW1A 2VGXA 4PS3A 4P29A 5EYPF 3DRAA 3FDHA 2MRIA 3NB2A 1HG5A 2XS1A 4GTTA 2PZIA 5EIBE 3Q78A 1Z6TA 3D9PA 3HDXA 3FH5A 5LP0A 1D8EA 1YCSB 1OWMA 1BLXB 1N95A 3DSWA 1EPUA 3CHSA 4U07A 3DXKG 3CHPA 2GRMA 4AOFA 3ULYA 5KNGA 3AU5A 3QJZA 1OCOE 1IHGA 4BEPA 4U8HA 4GCNA 4FHKA 5G05C 2OV8A 3S2AA 2FI7A 3DSVA 1FVHA 3GZ1A 1K1BA 5E76A 3QK0A 3OXLA 4N3CA 5B1AE 4Y6CA 1TJCA 4YVOA 4D10C 1SZAA 1HE8A 2ZU6B 4Y6WA 1ELRA 3ZPJA 3R9MA 3CSFA 1N0RA 3PH0C 3D9JA 3LVRE 3DSUA 3EDTB 4B8AA 2M63A 3JXIA 1D9SA 4JPSA 4GTMA 2BTDA 4BY6A 4Q94A 2GRRB 1AP7A 2X6IA 1WY6A 2L9BA 4GU5A 4GYWA 4ILIA 5D0OD 1OCRE 4JL0A 3EHNA 2CG2A 1BI8B 1SQMA 3D3MA 3ZNGA 1B89A 3FEYA 2CHWA 3HHMA 5EX0A 3FY4A 3Q47B 3FTUA 2AXUA 1E7VA 3FUFA 5C1DA 3QC1A 3T5XA 3LY7A 4LEUA 3SF4A 2WMNA 2VSXE 3TL5A 1S63A 1KT1A 2VYIA 5AIJA 4CDRA 4PS7A 3ZEFA 1EF1C 3I4RB 3EIQC 2F8YA 1KLXA 2V0PA 3LJNA 4B93B 5AQ9A 4GZDA 2XZDG 4J0UA 1N11A 3C5RA 4I1AA 4OAVB 4JC8A 2XZTG 1K3ZD 1LD7A 4MRUA 2XRYA 3SI5A 3CGHA 3PZDA 4IRUA 1PC2A 4HRLA 4KYOB 1KZOA 3TAXA 5CEAA 1HG2A 3UIOC
chains in the Genus database with same CATH topology
4BFRA 2QY7A 4JHKA 4V3IA 2WQ6A 5FQ4A 4OVVA 2VQ2A 4JHRA 2DBAA 3FTXA 4UWHA 4CDMA 4DI3A 4XE0A 3FTYA 5EKQD 4LUNU 2R5SA 3MX3A 3G2SA 3EIJA 3PNTB 4C0MA 5BNWA 3Q49B 4GMJA 3OTNA 2WVIA 1WAO1 3KAEA 1HXIA 5FZSA 3ULQA 4N3BA 2GRLA 4ABNA 3HIZA 5CMWA 3VTXA 4EZJA 4PH4B 2J4BA 5CCLA 3SZ7A 5M72A 3FP3A 3IKOB 3IBEA 3L6AA 3RRUA 2XRZA 2XEVA 3ML9A 4GA2A 4A3VA 3CHRA 3R9AB 3QARA 5T8IA 1XGWA 3L13A 3PREA 4LERA 3APCA 2XGOA 3LS8A 2LAHA 3G2UA 4PUCA 1MQSA 4WNFA 4AEZC 5LFAA 3ZYMA 4FC8A 1XNFA 2XPIA 3Q15A 4I9CA 2Q7FA 2V8SE 4I1OB 4WNEA 1JUQA 4XIFA 5EX3A 3FU3A 3URZA 4N39A 4HVBA 1ELWA 2IOLA 3MCXA 3GYZA 3C98A 3CK7A 4GYYA 5EDSA 2KCLA 3K9IA 1DVPA 3FUEA 4BWRA 3RO2A 3ZIMA 3ZVVA 4J6IA 1INZA 1JWFA 2J08A 3QWPA 2YNQA 4EZLA 3ZN3A 5G04C 4IYPA 5T4YA 3U9WA 4FJZA 2VTBA 1ZU2A 3U4TA 4L2LA 3CVPA 3FUNA 2KCKA 3VTYA 3TG4A 3AS5A 2R59A 4Q69A 2RG8A 2IU1A 5KJLA 3GZ2A 5A23A 5G2NA 2X38A 4HLEA 1E96B 4NRHB 4RG9A 4XI0A 2DCPA 2E2EA 3CVLA 4R7LA 1W3BA 4DJAA 3SBSA 3ZHEB 1H2TC 2X3MA 4BX9A 3D9MA 4PDXA 4KBQA 3FUIA 3RO3A 2KATA 3LVQE 2JEKA 3ZRHA 3IHVA 3FULA 3D9NA 4GZ3A 4JEUA 3CR3A 4NURA 5AYWD 1OUVA 4MKTA 1HU3A 3RKVA 4LCTA 4JA9A 2VSNA 4L1BA 3ZFWA 4EQFA 1UG3A 3BG0B 4YVQC 3G2TA 2WXFA 3B7UX 3I3NA 4W9RA 4ANUA 3ZHEA 4FHJA 2HR2A 4BX8A 4DLQA 2PQNA 1YA0A 3QDNA 3FHEA 5KJNA 3D9OA 3L08A 3QWWA 3CKCA 4F1SA 5BW8C 2WM9A 3WXXA 2DIWA 3MA5A 4KT6B 4GZ6A 5AENA 2AW6A 4Q96A 1Y8MA 4ILHB 2R17C 2J09A 4AM9A 3U64A 5ENNA 3FUJA 2KZTB 2IONA 2RD0A 3QKYA 5BT1A 1NZNA 3LYAA 2Y4TA 4ACLA 5JJTA 2VSYA 3CHMA 2XGSA 2FBNA 1OWPA 3FTSA 3OXGA 4GYOA 3D9LA 1FVFA 3PE4A 1HH8A 2I2OA 4GPKA 3ONLA 4KMOA 2I1JA 3HVEB 1QZ2A 2I6HA 2OVBA 3CEQA 3RRMB 2LNIA 4E6HA 3FU5A 1EYHA 4G24A 3TGOA 3OXFA 4AP2A 4KVOA 3DBSA 4XI9A 5ANLA 3APFA 4B89A 4F53A 4G26A 1HS6A 3PUKA 3ZYKA 2L0TB 3B7RL 4WNGA 3SNXA 3MV3B 1H19A 4JHJA 4EPZA 3ZXSA 4B94A 3PEUB 5E75A 2WXQA 2CG3A 4HS2A 4EBAA 3UQ3A 5BV0A 4EECA 1OWLA 1N52A 1Y6IA 2MHKA 2OVFA 3FUDA 4IN3B 4J8SA 4BTBA 4BT9A 2QFCA 5BPPA 3HVEA 1H6KA 2AWIA 3L16A 2J49A 3IHYA 2KC7A 1MHQA 4WNDA 1PAQA 4WWNA 3SGHA 3VLDA 4N2QA 2PM7A 4K03A 2V5FA 4GZ5A 5FWQA 3VLEA 5LCWJ 3PEVB 3I4GA 2IOSA 3E4BA 2X6KA 2YHCA 3ASDA 3FUKA 1S0PA 2UY1A 4XX5A 2IFUA 2Y3AA 2LAIA 2XCBA 2CFUA 3LEWA 4HFGA 3D9IA 3P2BA 4JVSA 4CRWA 2HYZA 2UWJG 3FUHA 2J9QA 4FJYA 1E8ZA 3JCKC 5G05J 2I1KA 2LO6A 2WXIA 2WXRA 4I9EA 2PM6A 3JQ1A 4ANWA 4KZ0A 4MLPA 3FTVA 2XGMA 3LY8A 4GA1A 1UN9A 4FULA 2WXOA 3SBTB 3L54A 1HO8A 2VGYA 4ACKA 3LDZA 3UT4A 3MZLB 4ANVA 3CKBA 4JA7A 3LCAA 1L5JA 2X6JA 3CK9A 3CVNA 1HZ4A 3ASGA 2FO7A 1ELKA 4A1SA 3FFLA 4U0SA 3ASHA 3LY9A 5FQ6A 4CCAA 4HORA 4XZ4A 5JJ6A 5JJ7A 5C2YA 1FCHA 5HQ8A 5KJKA 1VDYA 5AJLA 3CSTA 3S7FA 2HM8A 4NQ0A 3Q5MA 1Z3YA 1H0AA 4N2SA 3U66A 2X6HA 3NZUA 4UI9J 3RIBA 3QB2A 4J8EA 4L23A 2L6JA 4CGVA 4A1GA 3CVXA 3TXNA 3BG1B 4N3AA 3RU0A 4FLHA 3ONKA 4DLOA 3KD7A 5KCMA 5D0QD 3T8MA 3B7SA 1NP7A 3MV2B 4AJWA 1U3DA 3B7TA 1TEZA 2YHEA 4U0UA 2I9CA 5LOZA 4I2ZA 3R7RA 4APOA 4CT0A 3VLFA 5G55A 2LSVA 4U63A 2LSUA 4MS6A 5CHEE 4OVUA 1E7UA 2PL2A 2J4DA 2VGXB 1HFAA 1UJJA 4TRQA 3PE3A 3MKQA 2C2LA 3UUXA 4RSYA 2JLBA 3CQCB 4DI4A 5FJYA 2ILRA 3CK8A 4PS8A 2HO1A 2ONDA 4YNDA 5T3RA 2PQRA 4GB9A 2WXPA 3FUMA 3QOUA 3CHOA 4ME2A 4G11A 4HOUA 3LPZA 4GCOA 4J8DA 3L17A 3OAWA 4KZCA 4CGWA 1OWOA 2VJ8A 3FWVA 4UQYA 3CVQA 4F7AA 4N5CA 2A5UA 3JYSA 2P58C 3ESLA 4WWOA 2GW1A 3UMVA 1DNPA 4I6JA 2VGXA 4PS3A 3CIAA 3ZYLA 3CV0A 4P29A 2L0IA 3GW4A 3AU4A 1IQRA 1SZ9A 2KCVA 4TV3A 3FDHA 2MRIA 1HG5A 3FTWA 5J90A 4KVMA 2PZIA 4FP7A 4UWLA 2GGFA 4G23A 3BEEA 1Z6TA 3QAQA 3D9PA 3HDXA 1QQEA 4UQZA 3FH5A 5LP0A 2WXMA 4O6FA 3SD5A 4B8CB 3GZSA 5ANRA 3L22A 1OWMA 2IJGX 3S7DA 4GA0A 3D9KA 4GMLA 2UY1B 1EPUA 4G25A 3MGBA 2AVPA 3CHSA 4U07A 4XKBA 1EDUA 3JQ0A 3IV0A 3G2WA 3APDA 4TUUA 3UPVA 5HI7A 4H7YA 3RK6A 4AXHA 3CHPA 2XCCA 2GRMA 4G2VA 4UWGA 4AOFA 1PY1A 4K0RA 4APFA 1H2UA 2WXHA 1GW6A 3MYVA 3ZGQA 5LCWC 4JZYA 3AU5A 1KT0A 3EHMA 4B0ZA 2WQHA 4GZCA 3QJZA 3S7BA 3LXUX 3CVYA 2C0LA 3FH7A 3N71A 2WPVA 3JUIA 2XPZA 1H2VC 2XQ0A 4KXKB 2FULA 4BTAA 4L2YA 1E8YA 2CFZA 1IHGA 4A3TA 1UW4B 3PDNA 3FU0A 2YQ8A 1P5QA 4LRZA 4U8HA 4RVBA 3UT7A 4GCNA 4HOSA 4FHKA 1LF8A 5G05C 4JEHA 2OV8A 5FZQA 3S2AA 3AS4A 4FADA 3G2VA 2FI7A 1OWNA 1FVHA 3ASFA 1BPOA 3NF1A 3PNLB 3RJVA 3GZ1A 3PVLA 4JW1A 3ZYQA 2A4ZA 5E76A 3TXMA 4U0ZA 4G1TA 3HYMB 4H7XA 4UI9K 4E85A 3O4ZA 3QK0A 3OXLA 2MOWA 4N3CA 2NC9A 4I17A 1JPLA 4CEMA 3DPDA 2VSOE 4GAAA 3IEGA 3EJNA 1TJCA 4QFVA 4Y6CA 3ML8A 2J07A 1IYGA 2OOEA 4YVOA 1ZBPA 1SZAA 4D10C 3Q4AB 1HE8A 3TG5A 2ZU6B 4I6EA 1NA0A 4Y6WA 1ELRA 3ZPJA 4AIFA 2EQXA 4HOQA 2AXVA 4URKA 2BF0X 3CSFA 3PH0C 3D9JA 3LVRE 2E0IA 2WXKA 5FZRA 4CT4A 3EDTB 5JHBA 4ILGA 4B8AA 2M63A 2WXNA 5A6CA 4OYSA 3LJ3A 3PRZA 4JPSA 4UI9C 4EZKA 3MKRA 3FU6A 2BTDA 2NSZA 4BY6A 4HOTA 2C0MA 4UWFA 4Q94A 3MKQB 3FTZA 4AY5A 2X6IA 5ARFA 1WY6A 3KEZA 2L9BA 5CCMA 5CMYA 2NXPA 3AS8A 4GU5A 4UWKA 3KS2A 4GYWA 4ILIA 5D0OD 5G04J 3TJPA 1JWGA 3CQGB 5BV1A 3RRNB 3PS6A 1X5BA 3EHNA 2BUGA 4JL0A 4WAFA 4L7TA 2CG2A 1SQMA 3D3MA 4BSXA 3CVVA 3O48A 1B89A 4I6GA 4FU3A 1HF8A 2Y4UA 5DIZA 4ATGA 4I43A 3FEYA 3ENEA 5DBKA 2VTBB 2CHWA 3HHMA 4NACA 2WQ7A 1U3CA 5KJMA 2CHZA 1WM5A 3MEKA 4I1MA 4J8FA 5EX0A 3QWVA 4M3OA 3FY4A 5LX8A 3Q47B 3S7JA 5FTPA 3FTUA 2V4LA 4HXIA 2AXUA 1E7VA 3QNKA 3B13A 4WWPA 1E8XA 3FUFA 3NQPA 5C1DA 3QC1A 3ESKA 4RG6A 3PUJA 1E90A 3ZW3A 1HX8A 3R7QA 1UN8A 3FH8A 4U04A 2IQCA 3T5XA 4A55A 4AY6A 2IF4A 1IQUA 2WXLA 3I5PA 2CHXA 3LY7A 2WXGA 4FLBA 4LEUA 5AJDA 3UX4A 5J08A 3CVUA 1TJFA 2WMNA 2WMOA 3SF4A 2XHEA 4FA6A 1A17A 2VSXE 3TL5A 3NZSA 4C9BB 1KT1A 3FEXA 4ANXA 2VYIA 4I2WA 3UT8A 5AIJA 4CDRA 4DPRA 5ARGA 4PS7A 4AVXA 3ZEFA 4F3VA 2KM4A 1EF1C 3I4RB 3CVWA 3EIQC 3SHFA 1KLXA 4AV7A 2V0PA 3CHQA 2WXJA 4GZDA 4J0UA 5FQ8A 5A7DB 4I1AA 1E8WA 4IULA 5BUZA 4UQXA 4EBAG 2X6FA 3U3WA 4JC8A 4XKCA 3T5VA 4DK5A 5FQ7A 3CLJA 2AXZA 3MJWA 1UJKA 4MRUA 1QNFA 2KZTA 2XRYA 3SI5A 1N54A 3CGHA 3PZDA 2XPYA 4IRUA 1PC2A 2YINA 4C0EA 4KYOB 1Z3XA 2FEZA 3SFZA 2WB2A 2FF4A 3TAXA 4BT8A 1NA3A 3P1UA 1HG2A 4CDNA 4JXTA 5JHAA 5FT9A 4WUYA 3LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T4Y A;  3NQP A;  3JQ0 A;  3IV0 A;  4LER A;  3EHN A;  4L7T A;  5FQ4 A;  4PUC A;  5FQ8 A;  3JQ1 A;  4Q69 A;  3FDH A;  5J90 A;  3MX3 A;  3SGH A;  5E76 A;  5FQ7 A;  3CKC A;  3OTN A;  3I4G A;  3CK8 A;  3CKB A;  3MYV A;  5T3R A;  3MCX A;  4MRU A;  3CK9 A;  3CGH A;  3HDX A;  3EHM A;  3CK7 A;  3LEW A;  4F53 A;  3KEZ A;  5LX8 A;  4F7A A;  3GZS A;  3L22 A;  3SNX A;  5FQ6 A;  3EJN A;  3JYS A;  3P1U A;  5E75 A;  3QNK A; 
#chains in the Genus database with same CATH topology
 3BUA A;  4OVV A;  3FTY A;  5EKQ D;  5ENQ D;  5BNW A;  1JCQ A;  3ZXP A;  3KAE A;  1HXI A;  5FZS A;  4N3B A;  1NI1 A;  4PH4 B;  3NOG D;  1LD8 A;  2OEV A;  3IBE A;  3L6A A;  3RRU A;  3W9G A;  2XRZ A;  3ML9 A;  3QAR A;  3LS8 A;  2LAH A;  4WNF A;  1XNF A;  4XIF A;  3FU3 A;  4N39 A;  3V31 A;  3MCX A;  3GYZ A;  3CK7 A;  2Y0B G;  2GRP B;  2KCL A;  1DVP A;  3RO2 A;  3ZVV A;  1OXJ A;  1JWF A;  3U4T A;  4L2L A;  3VTY A;  3TG4 A;  2R59 A;  2KXP C;  1TN8 A;  4HLE A;  4R7L A;  4DJA A;  2A5E A;  4TXQ A;  4NIK A;  3FUI A;  2KAT A;  2JEK A;  3ZRH A;  3IHV A;  3V30 A;  1OUV A;  4JA9 A;  2VSN A;  2P9U G;  2DVW A;  4YVQ C;  2WXF A;  4W9R A;  4FHJ A;  3AAA C;  5KJN A;  3FHE A;  3D9O A;  1TNO A;  4F1S A;  5BW8 C;  2WM9 A;  3PZ4 A;  2AW6 A;  3E37 A;  5ENN A;  5AQA A;  3AJI A;  4LSZ E;  2I2O A;  4GPK A;  4KMO A;  2I1J A;  5CBN A;  1OY3 D;  2I6H A;  2OVB A;  4E6H A;  2ZGD A;  3FU5 A;  5EYL A;  3TGO A;  5ANL A;  1HS6 A;  2L0T B;  2GRN B;  3SNX A;  5H7P A;  3PEU B;  4BTB A;  4BT9 A;  2QFC A;  5BPP A;  1H6K A;  3L16 A;  2J49 A;  2KC7 A;  3VLD A;  4N2Q A;  4K03 A;  4GZ5 A;  3VLE A;  2P9L G;  2YHC A;  2XEH A;  2Y3A A;  1WDY A;  4CRW A;  2HYZ A;  1E8Z A;  3JCK C;  5KNH D;  1Z5S C;  2PM6 A;  3JQ1 A;  2VGY A;  2DYR E;  4GMR A;  3CKB A;  4JA7 A;  2QYJ A;  3CK9 A;  1LTX A;  2FO7 A;  3D9H A;  3ASH A;  5FQ6 A;  4G8K A;  1VDY A;  3CST A;  1H0A A;  2X6H A;  4UI9 J;  3QB2 A;  2L6J A;  4A1G A;  3CVX A;  4ZFH A;  4FLH A;  5D0Q D;  3T8M A;  1K8K G;  4I2Z A;  4CT0 A;  2LSV A;  2LSU A;  4OVU A;  1E7U A;  2PL2 A;  1S64 A;  3UUX A;  1N4Q A;  3E34 A;  3SO8 A;  2JLB A;  4DI4 A;  2QYU A;  2ILR A;  4PS8 A;  3L17 A;  4CGW A;  5ENS D;  4K5C A;  2VJ8 A;  4OAU C;  4N5C A;  3NAW A;  4I6J A;  5B1B E;  3CIA A;  3ZYL A;  2R05 A;  1KPS B;  2RKK A;  4KVM A;  2GGF A;  3BEE A;  3BQO A;  3QAQ A;  1QQE A;  3B7B A;  5EIL A;  3UTM A;  3GZS A;  3S7D A;  4GA0 A;  3D9K A;  4GML A;  3MGB A;  3JQ0 A;  3APD A;  3UPV A;  4AXH A;  2QZA A;  2XCC A;  4G2V A;  1PY1 A;  3AG4 E;  4K0R A;  4TUM A;  5AQ7 A;  3ZGQ A;  3S7B A;  3DSS A;  3LXU X;  3N71 A;  2WPV A;  5ENO D;  2XPZ A;  3TWR A;  2XQ0 A;  4BTA A;  2CFZ A;  4A3T A;  4LRZ A;  3FU0 A;  2YQ8 A;  1P5Q A;  2P2C P;  3UT7 A;  4JEH A;  4FAD A;  4HLL A;  3ASF A;  2F8X K;  4G1T A;  4UI9 K;  1H6P A;  1RZ4 A;  4CYM D;  1DC2 A;  2VSO E;  3B95 A;  4GAA A;  4QFV A;  2OOE A;  3TG5 A;  4I6E A;  2EQX A;  5JHB A;  2WXK A;  4ILG A;  3PRZ A;  3UM3 A;  4UI9 C;  4EZK A;  3TWU A;  3MKR A;  3FU6 A;  4LG6 A;  3MKQ B;  3FTZ A;  3Q79 A;  5ARF A;  2F37 A;  4UWK A;  5BV1 A;  3PS6 A;  4WAF A;  4L7T A;  3CVV A;  2FO1 E;  5IY5 E;  4FU3 A;  3E32 A;  5DIZ A;  4ATG A;  4I43 A;  1U3C A;  1WM5 A;  4J8F A;  3QWV A;  4DX5 D;  5FTP A;  4WWP A;  3RSE G;  3PUJ A;  1HX8 A;  5CER B;  2IQC A;  4A55 A;  4FLB A;  1IQU A;  3UX4 A;  2WXL A;  2XHE A;  3NZS A;  4ANX A;  4I2W A;  4DPR A;  3KSQ A;  3CVW A;  1WG0 A;  2WXJ A;  2ZIR A;  3UM2 A;  5FQ8 A;  1OT8 A;  4IUL A;  5BUZ A;  4UQX A;  4EBA G;  2X6F A;  4LNB A;  5EID A;  4XKC A;  4DK5 A;  4GPM A;  3CLJ A;  2R2L A;  4O1P A;  2KZT A;  1N54 A;  2XPY A;  3SFZ A;  1N4R A;  3P1U A;  4CZ2 D;  3ZKJ A;  5FT9 A;  3LKU A;  1MX4 A;  4UWH A;  4XE0 A;  4L9P A;  4LUN U;  2R5S A;  3MX3 A;  3PNT B;  4C0M A;  2WVI A;  2GRL A;  3IXE A;  5CCL A;  2ZGG A;  3IKO B;  4J7W A;  2PNN A;  1XGW A;  3PRE A;  4LER A;  3APC A;  3TWT A;  2XPI A;  3Q15 A;  4I9C A;  4U96 D;  2V8S E;  1JUQ A;  5EX3 A;  4HVB A;  3URZ A;  5ENR D;  2GRO B;  2MYO A;  5JA4 D;  2IOL A;  2P9S G;  1FPP A;  2P9K G;  3ZIM A;  3QWP A;  2YNQ A;  4EZL A;  1BU9 A;  4IYP A;  1ZU2 A;  3AS5 A;  2EIJ E;  1N94 A;  5G2N A;  4NRH B;  4XI0 A;  3CVL A;  3SBS A;  3ZHE B;  1OCC E;  4GTR A;  3DXM G;  4JB8 P;  4GZ3 A;  4JEU A;  5AYW D;  4YDO A;  1TNB A;  2XEN A;  3G2T A;  4TXR A;  4BES A;  4ANU A;  3ZHE A;  4BX8 A;  4DLQ A;  5HRY A;  3L08 A;  3QWW A;  1MX6 A;  3WXX A;  1NFI E;  2DIW A;  5AEN A;  4F1P A;  1TNY A;  4AM9 A;  2ION A;  3PZ3 A;  3QKY A;  1NZN A;  4ACL A;  2VSY A;  3CHM A;  2XGS A;  3D9L A;  2ETA A;  1HH8 A;  3HVE B;  1QZ2 A;  4BSZ B;  3CEQ A;  1K1A A;  2P9P G;  4KVO A;  3DBS A;  4B89 A;  4F53 A;  3PUK A;  4WNG A;  4EPZ A;  3J5Q B;  4B94 A;  4JD2 G;  4HS2 A;  2CG3 A;  1OWL A;  4IN3 B;  3DSX A;  3AG3 E;  3HVE A;  3PZ2 A;  2EIL E;  3EHQ A;  4WND A;  3SGH A;  4DX7 D;  5LCW J;  3FUK A;  2UY1 A;  3Q9U C;  3LEW A;  3P2B A;  4JVS A;  2UWJ G;  4YDY A;  1SW6 A;  2J9Q A;  2H6F A;  2XGM A;  4GA1 A;  3RAU A;  3SBT B;  1N9A A;  3EU9 A;  3FFL A;  3ASN E;  3LY9 A;  4EHM A;  4HOR A;  5JJ6 A;  5HQ8 A;  5KJK A;  3PZ1 A;  4HRM B;  3NZU A;  3BG1 B;  3HG0 D;  4N3A A;  3RU0 A;  2EIM E;  4DLO A;  1NP7 A;  2IO3 C;  3JUE A;  3MV2 B;  4U0U A;  1AWC B;  1NL4 A;  2I9C A;  2V5Q C;  3HXE A;  4APO A;  1ZB1 A;  3PE3 A;  4RSY A;  4Z68 A;  3C3Q A;  4N5Q A;  3CK8 A;  5CRU A;  4YND A;  3FUM A;  4GTQ A;  3CHO A;  5BXU A;  4UQY A;  3HXC A;  2A5U A;  3ESL A;  2DYS E;  4YDE A;  2L0I A;  2DZO A;  3AU4 A;  1IQR A;  2KCV A;  4TV3 A;  3FTW A;  5J90 A;  1IKN D;  4C48 B;  4B8C B;  5ANR A;  3L22 A;  3ZUV B;  4UUC A;  3Q9N C;  3NBN B;  4XKB A;  3IV0 A;  3L82 A;  4H7Y A;  3RK6 A;  3ZU7 B;  4UWG A;  5FIO A;  4APF A;  1TR4 A;  3MYV A;  5LCW C;  3C72 A;  4JZY A;  1KT0 A;  4B0Z A;  2WQH A;  3SFX A;  2XS8 A;  3CVY A;  2C0L A;  4QQI A;  3JUI A;  2FUL A;  1E8Y A;  1UW4 B;  4RVB A;  4HOS A;  1LF8 A;  3AS4 A;  1DCE A;  3G2V A;  5ENT D;  1OWN A;  3NF1 A;  3PNL B;  3RJV A;  3TXM A;  1TN6 A;  4E85 A;  2P9I G;  3O4Z A;  3KEA A;  3W9F A;  3V2O A;  1JPL A;  3V79 K;  3DPD A;  2LXM A;  2J07 A;  3ML8 A;  3Q4A B;  1NA0 A;  4DRX E;  4HOQ A;  2E0I A;  2AJA A;  1JCR A;  2WXN A;  4OYS A;  3LJ3 A;  4HOT A;  2NSZ A;  2C0M A;  4MBG A;  4AY5 A;  4A63 B;  5CCM A;  5CMY A;  3CQG B;  1X5B A;  2BUG A;  5CRV A;  4BSX A;  4I6G A;  4U8V D;  2Y4U A;  3ENE A;  2VTB B;  4NAC A;  2WQ7 A;  5KJM A;  2CHZ A;  3SQV A;  1H6O A;  2P9N G;  3S7J A;  3QNK A;  4YDW A;  1E8X A;  3NQP A;  3ESK A;  4RG6 A;  1BI7 B;  1E90 A;  3R7Q A;  1UN8 A;  4U04 A;  3I5P A;  2VTB A;  2RFM A;  5AJD A;  5J08 A;  2HE0 A;  3UIP C;  3CVU A;  1TJF A;  2WMO A;  4FA6 A;  3SY2 A;  4C9B B;  4GTO A;  3UT8 A;  5ARG A;  4F3V A;  2QC9 A;  3SHF A;  3CHQ A;  4G8L A;  4ZHB A;  1SA4 A;  3ASO E;  2AXZ A;  1UJK A;  1QNF A;  4HRN A;  2YIN A;  4C0E A;  2FEZ A;  2L6B A;  1NA3 A;  5FIN A;  4WUY A;  2QY7 A;  4JHK A;  2WQ6 A;  5FQ4 A;  4JHR A;  2DBA A;  3FTX A;  4RLY A;  3X2Q E;  3G2S A;  3EIJ A;  3Q49 B;  4J8Y A;  4GMJ A;  2F0Y A;  1WAO 1;  3ULQ A;  3VTX A;  2ETC A;  3SZ7 A;  5KBA A;  5M72 A;  3BU8 A;  1MJ0 A;  3CHR A;  3R9A B;  2Y69 E;  3G2U A;  1DCQ A;  1MQS A;  5AN8 A;  5LFA A;  3ZYM A;  1TNZ A;  4RQI A;  3ISM C;  4GYY A;  5EDS A;  4BWR A;  1O1S A;  2DZN A;  5CBO A;  5T4Y A;  3U9W A;  4FJZ A;  3FUN A;  5KJL A;  1E96 B;  4RG9 A;  1IHB A;  2DCP A;  2E2E A;  3T9K A;  1H2T C;  1BD8 A;  4PDX A;  3DPY A;  4KBQ A;  3LVQ E;  3DST A;  3FUL A;  3D9N A;  3HXB A;  4NUR A;  1HU3 A;  3RKV A;  3ZFW A;  4EQF A;  1UG3 A;  3BG0 B;  3I3N A;  1YA0 A;  2VGE A;  4KT6 B;  5AQB A;  3EUV A;  2R17 C;  3HXF A;  2J09 A;  3U64 A;  5AAR A;  2KZT B;  2XEE A;  2RD0 A;  3UI2 A;  5BT1 A;  5JJT A;  2ETB A;  1OWP A;  3FTS A;  3OXG A;  1FVF A;  5ENP D;  3RRM B;  4U8Y D;  1TN7 A;  4G24 A;  3OXF A;  4BET A;  2RFA A;  3B7R L;  2JAB A;  1H19 A;  3DEP A;  1N52 A;  1QBQ A;  1Y6I A;  1Q2Z A;  2MHK A;  3FUD A;  5EN5 D;  3UXG A;  2AWI A;  3IHY A;  1MHQ A;  2PM7 A;  3PEV B;  4O60 A;  2IOS A;  3E4B A;  2X6K A;  2IFU A;  4HFG A;  2CFU A;  3D9I A;  1N4P A;  2I1K A;  2WXR A;  4HI9 A;  4ANW A;  4MLP A;  4F6R D;  2WXO A;  3L54 A;  3UT4 A;  5CEC B;  4ANV A;  5KWD A;  1L5J A;  2X6J A;  2BKG A;  3CVN A;  3ASG A;  1MZC A;  1ELK A;  1UOH A;  4CCA A;  4TXP A;  4XZ4 A;  1FCH A;  5AJL A;  3S7F A;  3Q75 A;  1Z3Y A;  4N2S A;  4J8E A;  3TXN A;  1O1T A;  3ONK A;  3AG1 E;  3KD7 A;  5B3S E;  5KCM A;  1TEZ A;  2R03 A;  3B7T A;  2YHE A;  3Q7A A;  3R7R A;  3VLF A;  2GRQ B;  5G55 A;  4U63 A;  4MS6 A;  5CHE E;  1U2V G;  1S70 B;  1HFA A;  3CQC B;  5FJY A;  1QYM A;  2HO1 A;  5T3R A;  4ME2 A;  3LPZ A;  4GCO A;  4J8D A;  3OAW A;  3FWV A;  4F7A A;  3CVQ A;  4U95 D;  5JMN D;  3J5P A;  3JYS A;  2P58 C;  3UMV A;  1DNP A;  1D8D A;  3CV0 A;  3ULE G;  3GW4 A;  1SZ9 A;  1A5E A;  4FP7 A;  4UWL A;  4U7E B;  4G23 A;  3NOC D;  4UQZ A;  2OCC E;  2WXM A;  4O6F A;  1MX2 A;  1O1R A;  3SD5 A;  4HB5 A;  2IJG X;  3Q73 A;  2UY1 B;  4G25 A;  2AVP A;  3Q7F A;  1EDU A;  3G2W A;  4LNU D;  4TUU A;  4HI8 A;  5HI7 A;  4GTP A;  2EIN E;  1KZP A;  1H2U A;  2WXH A;  1GW6 A;  3HRA A;  3EHM A;  4HNA D;  4GZC A;  3FH7 A;  1H2V C;  4KXK B;  3L9T A;  4L2Y A;  3PDN A;  3EHR A;  5FZQ A;  5AAO A;  1BPO A;  3PVL A;  4JW1 A;  3ZYQ A;  2OEW A;  4X8Q A;  2A4Z A;  4U0Z A;  4H7X A;  3HYM B;  3F6Q A;  3UM0 A;  2MOW A;  2NC9 A;  4I17 A;  4CEM A;  3SFY A;  2H6G A;  3EJN A;  3IEG A;  1IYG A;  1ZBP A;  3ABK E;  4AIF A;  2AXV A;  4GTS A;  4URK A;  2BF0 X;  4CT4 A;  5FZR A;  5A6C A;  1V55 E;  5BXO A;  4UWF A;  3KEZ A;  1V54 E;  3UKR G;  2LXL A;  2NXP A;  3AS8 A;  5G04 J;  3UIN C;  3KS2 A;  3TJP A;  4DX1 A;  2ZIS A;  1JWG A;  3RRN B;  5HKP A;  3O48 A;  1HF8 A;  5DBK A;  1MYO A;  1O5M A;  1RW2 A;  3TWV A;  3MEK A;  4I1M A;  5LX8 A;  4M3O A;  2V4L A;  4HXI A;  3B13 A;  2LUH A;  2B6C A;  1YMP A;  3ZW3 A;  4AY6 A;  3FH8 A;  2IF4 A;  2CHX A;  4HQD A;  2WXG A;  2IY0 C;  1A17 A;  3TWW A;  3FEX A;  4AVX A;  2KM4 A;  4AV7 A;  4DX6 D;  5A7D B;  2B0O E;  1E8W A;  3U3W A;  3T5V A;  5FQ7 A;  3MJW A;  1Z3X A;  2WB2 A;  1YYH A;  2FF4 A;  4BT8 A;  2EIK E;  4CDN A;  4JXT A;  5JHA A;  4BFR A;  4V3I A;  2VQ2 A;  4CDM A;  4DI3 A;  1X81 A;  3EU5 A;  4O1O A;  4BER A;  2IO2 C;  3OTN A;  5HS0 A;  3E33 A;  4ABN A;  3HIZ A;  5CMW A;  4EZJ A;  4HBD A;  2J4B A;  1G3N B;  3FP3 A;  2XEV A;  1TNU A;  1SVX A;  4GA2 A;  4A3V A;  1SA5 A;  3TWS A;  5T8I A;  3L13 A;  2XGO A;  3DWL G;  4AEZ C;  4PUC A;  2H6H A;  4FC8 A;  1IXV A;  2Q7F A;  4I1O B;  4WNE A;  1ELW A;  1JCS A;  3UKU G;  3C98 A;  3K9I A;  3FUE A;  2J8S D;  4J6I A;  1INZ A;  2J08 A;  3ZN3 A;  5G04 C;  3CVP A;  2BKK B;  2KCK A;  4Q69 A;  2RG8 A;  2IU1 A;  3GZ2 A;  5A23 A;  2X38 A;  4DX2 A;  2H6I A;  3AG2 E;  1W3B A;  2KBX A;  3UM1 A;  2R02 A;  5D2M C;  2X3M A;  4BX9 A;  3D9M A;  3RO3 A;  3CR3 A;  4LNG A;  4MKT A;  4LCT A;  3TWQ A;  4L1B A;  3E30 A;  3B7U X;  2HR2 A;  3V2X A;  2PQN A;  3QDN A;  4M7C A;  3CKC A;  3DEO A;  3MA5 A;  4GZ6 A;  2DWZ A;  4Q96 A;  1Y8M A;  2V4H C;  3WG7 E;  5CED B;  2IEJ A;  4ILH B;  3FUJ A;  1FT2 A;  3LYA A;  2Y4T A;  3ABL E;  2FBN A;  3KSL A;  4GYO A;  3PE4 A;  3ONL A;  2LNI A;  1EYH A;  4AP2 A;  4XI9 A;  3APF A;  4G26 A;  3ZYK A;  3T8K A;  3MV3 B;  4JHJ A;  3ZXS A;  5E75 A;  2WXQ A;  4EBA A;  3UQ3 A;  5BV0 A;  4EEC A;  2OVF A;  4J8S A;  2NYJ A;  4WWN A;  1PAQ A;  5D66 A;  2V5F A;  3JXJ A;  5FWQ A;  3I4G A;  3ASD A;  1S0P A;  4XX5 A;  1N4S A;  2LAI A;  2BED A;  2XCB A;  3HXD A;  3FUH A;  4FJY A;  5G05 J;  2LO6 A;  2WXI A;  4I9E A;  4KZ0 A;  3FTV A;  3LY8 A;  1UN9 A;  5ITZ F;  4FUL A;  1HO8 A;  4ACK A;  3LDZ A;  3MZL B;  3LCA A;  2Y1L E;  1HZ4 A;  4A1S A;  4U0S A;  4XEI G;  1FT1 A;  5JJ7 A;  5C2Y A;  4K5A B;  3C3R A;  1N0Q A;  2HM8 A;  4K5B A;  4NQ0 A;  3Q5M A;  4ATZ D;  3U66 A;  3RIB A;  4CGV A;  4L23 A;  2ZXW E;  3B7S A;  4AJW A;  1U3D A;  5LOZ A;  3C3O A;  1OCZ E;  2J4D A;  2VGX B;  1UJJ A;  4TRQ A;  3TWX A;  3MKQ A;  2C2L A;  1TYQ G;  4GTV A;  2OND A;  3ABM E;  2PQR A;  4GB9 A;  2WXP A;  3QOU A;  4G11 A;  4HOU A;  4KZC A;  1OWO A;  4DUI A;  4WWO A;  2GW1 A;  2VGX A;  4PS3 A;  4P29 A;  5EYP F;  3DRA A;  3FDH A;  2MRI A;  3NB2 A;  1HG5 A;  2XS1 A;  4GTT A;  2PZI A;  5EIB E;  3Q78 A;  1Z6T A;  3D9P A;  3HDX A;  3FH5 A;  5LP0 A;  1D8E A;  1YCS B;  1OWM A;  1BLX B;  1N95 A;  3DSW A;  1EPU A;  3CHS A;  4U07 A;  3DXK G;  3CHP A;  2GRM A;  4AOF A;  3ULY A;  5KNG A;  3AU5 A;  3QJZ A;  1OCO E;  1IHG A;  4BEP A;  4U8H A;  4GCN A;  4FHK A;  5G05 C;  2OV8 A;  3S2A A;  2FI7 A;  3DSV A;  1FVH A;  3GZ1 A;  1K1B A;  5E76 A;  3QK0 A;  3OXL A;  4N3C A;  5B1A E;  4Y6C A;  1TJC A;  4YVO A;  4D10 C;  1SZA A;  1HE8 A;  2ZU6 B;  4Y6W A;  1ELR A;  3ZPJ A;  3R9M A;  3CSF A;  1N0R A;  3PH0 C;  3D9J A;  3LVR E;  3DSU A;  3EDT B;  4B8A A;  2M63 A;  3JXI A;  1D9S A;  4JPS A;  4GTM A;  2BTD A;  4BY6 A;  4Q94 A;  2GRR B;  1AP7 A;  2X6I A;  1WY6 A;  2L9B A;  4GU5 A;  4GYW A;  4ILI A;  5D0O D;  1OCR E;  4JL0 A;  3EHN A;  2CG2 A;  1BI8 B;  1SQM A;  3D3M A;  3ZNG A;  1B89 A;  3FEY A;  2CHW A;  3HHM A;  5EX0 A;  3FY4 A;  3Q47 B;  3FTU A;  2AXU A;  1E7V A;  3FUF A;  5C1D A;  3QC1 A;  3T5X A;  3LY7 A;  4LEU A;  3SF4 A;  2WMN A;  2VSX E;  3TL5 A;  1S63 A;  1KT1 A;  2VYI A;  5AIJ A;  4CDR A;  4PS7 A;  3ZEF A;  1EF1 C;  3I4R B;  3EIQ C;  2F8Y A;  1KLX A;  2V0P A;  3LJN A;  4B93 B;  5AQ9 A;  4GZD A;  2XZD G;  4J0U A;  1N11 A;  3C5R A;  4I1A A;  4OAV B;  4JC8 A;  2XZT G;  1K3Z D;  1LD7 A;  4MRU A;  2XRY A;  3SI5 A;  3CGH A;  3PZD A;  4IRU A;  1PC2 A;  4HRL A;  4KYO B;  1KZO A;  3TAX A;  5CEA A;  1HG2 A;  3UIO C; 
#chains in the Genus database with same CATH homology
 4BFR A;  2QY7 A;  4JHK A;  4V3I A;  2WQ6 A;  5FQ4 A;  4OVV A;  2VQ2 A;  4JHR A;  2DBA A;  3FTX A;  4UWH A;  4CDM A;  4DI3 A;  4XE0 A;  3FTY A;  5EKQ D;  4LUN U;  2R5S A;  3MX3 A;  3G2S A;  3EIJ A;  3PNT B;  4C0M A;  5BNW A;  3Q49 B;  4GMJ A;  3OTN A;  2WVI A;  1WAO 1;  3KAE A;  1HXI A;  5FZS A;  3ULQ A;  4N3B A;  2GRL A;  4ABN A;  3HIZ A;  5CMW A;  3VTX A;  4EZJ A;  4PH4 B;  2J4B A;  5CCL A;  3SZ7 A;  5M72 A;  3FP3 A;  3IKO B;  3IBE A;  3L6A A;  3RRU A;  2XRZ A;  2XEV A;  3ML9 A;  4GA2 A;  4A3V A;  3CHR A;  3R9A B;  3QAR A;  5T8I A;  1XGW A;  3L13 A;  3PRE A;  4LER A;  3APC A;  2XGO A;  3LS8 A;  2LAH A;  3G2U A;  4PUC A;  1MQS A;  4WNF A;  4AEZ C;  5LFA A;  3ZYM A;  4FC8 A;  1XNF A;  2XPI A;  3Q15 A;  4I9C A;  2Q7F A;  2V8S E;  4I1O B;  4WNE A;  1JUQ A;  4XIF A;  5EX3 A;  3FU3 A;  3URZ A;  4N39 A;  4HVB A;  1ELW A;  2IOL A;  3MCX A;  3GYZ A;  3C98 A;  3CK7 A;  4GYY A;  5EDS A;  2KCL A;  3K9I A;  1DVP A;  3FUE A;  4BWR A;  3RO2 A;  3ZIM A;  3ZVV A;  4J6I A;  1INZ A;  1JWF A;  2J08 A;  3QWP A;  2YNQ A;  4EZL A;  3ZN3 A;  5G04 C;  4IYP A;  5T4Y A;  3U9W A;  4FJZ A;  2VTB A;  1ZU2 A;  3U4T A;  4L2L A;  3CVP A;  3FUN A;  2KCK A;  3VTY A;  3TG4 A;  3AS5 A;  2R59 A;  4Q69 A;  2RG8 A;  2IU1 A;  5KJL A;  3GZ2 A;  5A23 A;  5G2N A;  2X38 A;  4HLE A;  1E96 B;  4NRH B;  4RG9 A;  4XI0 A;  2DCP A;  2E2E A;  3CVL A;  4R7L A;  1W3B A;  4DJA A;  3SBS A;  3ZHE B;  1H2T C;  2X3M A;  4BX9 A;  3D9M A;  4PDX A;  4KBQ A;  3FUI A;  3RO3 A;  2KAT A;  3LVQ E;  2JEK A;  3ZRH A;  3IHV A;  3FUL A;  3D9N A;  4GZ3 A;  4JEU A;  3CR3 A;  4NUR A;  5AYW D;  1OUV A;  4MKT A;  1HU3 A;  3RKV A;  4LCT A;  4JA9 A;  2VSN A;  4L1B A;  3ZFW A;  4EQF A;  1UG3 A;  3BG0 B;  4YVQ C;  3G2T A;  2WXF A;  3B7U X;  3I3N A;  4W9R A;  4ANU A;  3ZHE A;  4FHJ A;  2HR2 A;  4BX8 A;  4DLQ A;  2PQN A;  1YA0 A;  3QDN A;  3FHE A;  5KJN A;  3D9O A;  3L08 A;  3QWW A;  3CKC A;  4F1S A;  5BW8 C;  2WM9 A;  3WXX A;  2DIW A;  3MA5 A;  4KT6 B;  4GZ6 A;  5AEN A;  2AW6 A;  4Q96 A;  1Y8M A;  4ILH B;  2R17 C;  2J09 A;  4AM9 A;  3U64 A;  5ENN A;  3FUJ A;  2KZT B;  2ION A;  2RD0 A;  3QKY A;  5BT1 A;  1NZN A;  3LYA A;  2Y4T A;  4ACL A;  5JJT A;  2VSY A;  3CHM A;  2XGS A;  2FBN A;  1OWP A;  3FTS A;  3OXG A;  4GYO A;  3D9L A;  1FVF A;  3PE4 A;  1HH8 A;  2I2O A;  4GPK A;  3ONL A;  4KMO A;  2I1J A;  3HVE B;  1QZ2 A;  2I6H A;  2OVB A;  3CEQ A;  3RRM B;  2LNI A;  4E6H A;  3FU5 A;  1EYH A;  4G24 A;  3TGO A;  3OXF A;  4AP2 A;  4KVO A;  3DBS A;  4XI9 A;  5ANL A;  3APF A;  4B89 A;  4F53 A;  4G26 A;  1HS6 A;  3PUK A;  3ZYK A;  2L0T B;  3B7R L;  4WNG A;  3SNX A;  3MV3 B;  1H19 A;  4JHJ A;  4EPZ A;  3ZXS A;  4B94 A;  3PEU B;  5E75 A;  2WXQ A;  2CG3 A;  4HS2 A;  4EBA A;  3UQ3 A;  5BV0 A;  4EEC A;  1OWL A;  1N52 A;  1Y6I A;  2MHK A;  2OVF A;  3FUD A;  4IN3 B;  4J8S A;  4BTB A;  4BT9 A;  2QFC A;  5BPP A;  3HVE A;  1H6K A;  2AWI A;  3L16 A;  2J49 A;  3IHY A;  2KC7 A;  1MHQ A;  4WND A;  1PAQ A;  4WWN A;  3SGH A;  3VLD A;  4N2Q A;  2PM7 A;  4K03 A;  2V5F A;  4GZ5 A;  5FWQ A;  3VLE A;  5LCW J;  3PEV B;  3I4G A;  2IOS A;  3E4B A;  2X6K A;  2YHC A;  3ASD A;  3FUK A;  1S0P A;  2UY1 A;  4XX5 A;  2IFU A;  2Y3A A;  2LAI A;  2XCB A;  2CFU A;  3LEW A;  4HFG A;  3D9I A;  3P2B A;  4JVS A;  4CRW A;  2HYZ A;  2UWJ G;  3FUH A;  2J9Q A;  4FJY A;  1E8Z A;  3JCK C;  5G05 J;  2I1K A;  2LO6 A;  2WXI A;  2WXR A;  4I9E A;  2PM6 A;  3JQ1 A;  4ANW A;  4KZ0 A;  4MLP A;  3FTV A;  2XGM A;  3LY8 A;  4GA1 A;  1UN9 A;  4FUL A;  2WXO A;  3SBT B;  3L54 A;  1HO8 A;  2VGY A;  4ACK A;  3LDZ A;  3UT4 A;  3MZL B;  4ANV A;  3CKB A;  4JA7 A;  3LCA A;  1L5J A;  2X6J A;  3CK9 A;  3CVN A;  1HZ4 A;  3ASG A;  2FO7 A;  1ELK A;  4A1S A;  3FFL A;  4U0S A;  3ASH A;  3LY9 A;  5FQ6 A;  4CCA A;  4HOR A;  4XZ4 A;  5JJ6 A;  5JJ7 A;  5C2Y A;  1FCH A;  5HQ8 A;  5KJK A;  1VDY A;  5AJL A;  3CST A;  3S7F A;  2HM8 A;  4NQ0 A;  3Q5M A;  1Z3Y A;  1H0A A;  4N2S A;  3U66 A;  2X6H A;  3NZU A;  4UI9 J;  3RIB A;  3QB2 A;  4J8E A;  4L23 A;  2L6J A;  4CGV A;  4A1G A;  3CVX A;  3TXN A;  3BG1 B;  4N3A A;  3RU0 A;  4FLH A;  3ONK A;  4DLO A;  3KD7 A;  5KCM A;  5D0Q D;  3T8M A;  3B7S A;  1NP7 A;  3MV2 B;  4AJW A;  1U3D A;  3B7T A;  1TEZ A;  2YHE A;  4U0U A;  2I9C A;  5LOZ A;  4I2Z A;  3R7R A;  4APO A;  4CT0 A;  3VLF A;  5G55 A;  2LSV A;  4U63 A;  2LSU A;  4MS6 A;  5CHE E;  4OVU A;  1E7U A;  2PL2 A;  2J4D A;  2VGX B;  1HFA A;  1UJJ A;  4TRQ A;  3PE3 A;  3MKQ A;  2C2L A;  3UUX A;  4RSY A;  2JLB A;  3CQC B;  4DI4 A;  5FJY A;  2ILR A;  3CK8 A;  4PS8 A;  2HO1 A;  2OND A;  4YND A;  5T3R A;  2PQR A;  4GB9 A;  2WXP A;  3FUM A;  3QOU A;  3CHO A;  4ME2 A;  4G11 A;  4HOU A;  3LPZ A;  4GCO A;  4J8D A;  3L17 A;  3OAW A;  4KZC A;  4CGW A;  1OWO A;  2VJ8 A;  3FWV A;  4UQY A;  3CVQ A;  4F7A A;  4N5C A;  2A5U A;  3JYS A;  2P58 C;  3ESL A;  4WWO A;  2GW1 A;  3UMV A;  1DNP A;  4I6J A;  2VGX A;  4PS3 A;  3CIA A;  3ZYL A;  3CV0 A;  4P29 A;  2L0I A;  3GW4 A;  3AU4 A;  1IQR A;  1SZ9 A;  2KCV A;  4TV3 A;  3FDH A;  2MRI A;  1HG5 A;  3FTW A;  5J90 A;  4KVM A;  2PZI A;  4FP7 A;  4UWL A;  2GGF A;  4G23 A;  3BEE A;  1Z6T A;  3QAQ A;  3D9P A;  3HDX A;  1QQE A;  4UQZ A;  3FH5 A;  5LP0 A;  2WXM A;  4O6F A;  3SD5 A;  4B8C B;  3GZS A;  5ANR A;  3L22 A;  1OWM A;  2IJG X;  3S7D A;  4GA0 A;  3D9K A;  4GML A;  2UY1 B;  1EPU A;  4G25 A;  3MGB A;  2AVP A;  3CHS A;  4U07 A;  4XKB A;  1EDU A;  3JQ0 A;  3IV0 A;  3G2W A;  3APD A;  4TUU A;  3UPV A;  5HI7 A;  4H7Y A;  3RK6 A;  4AXH A;  3CHP A;  2XCC A;  2GRM A;  4G2V A;  4UWG A;  4AOF A;  1PY1 A;  4K0R A;  4APF A;  1H2U A;  2WXH A;  1GW6 A;  3MYV A;  3ZGQ A;  5LCW C;  4JZY A;  3AU5 A;  1KT0 A;  3EHM A;  4B0Z A;  2WQH A;  4GZC A;  3QJZ A;  3S7B A;  3LXU X;  3CVY A;  2C0L A;  3FH7 A;  3N71 A;  2WPV A;  3JUI A;  2XPZ A;  1H2V C;  2XQ0 A;  4KXK B;  2FUL A;  4BTA A;  4L2Y A;  1E8Y A;  2CFZ A;  1IHG A;  4A3T A;  1UW4 B;  3PDN A;  3FU0 A;  2YQ8 A;  1P5Q A;  4LRZ A;  4U8H A;  4RVB A;  3UT7 A;  4GCN A;  4HOS A;  4FHK A;  1LF8 A;  5G05 C;  4JEH A;  2OV8 A;  5FZQ A;  3S2A A;  3AS4 A;  4FAD A;  3G2V A;  2FI7 A;  1OWN A;  1FVH A;  3ASF A;  1BPO A;  3NF1 A;  3PNL B;  3RJV A;  3GZ1 A;  3PVL A;  4JW1 A;  3ZYQ A;  2A4Z A;  5E76 A;  3TXM A;  4U0Z A;  4G1T A;  3HYM B;  4H7X A;  4UI9 K;  4E85 A;  3O4Z A;  3QK0 A;  3OXL A;  2MOW A;  4N3C A;  2NC9 A;  4I17 A;  1JPL A;  4CEM A;  3DPD A;  2VSO E;  4GAA A;  3IEG A;  3EJN A;  1TJC A;  4QFV A;  4Y6C A;  3ML8 A;  2J07 A;  1IYG A;  2OOE A;  4YVO A;  1ZBP A;  1SZA A;  4D10 C;  3Q4A B;  1HE8 A;  3TG5 A;  2ZU6 B;  4I6E A;  1NA0 A;  4Y6W A;  1ELR A;  3ZPJ A;  4AIF A;  2EQX A;  4HOQ A;  2AXV A;  4URK A;  2BF0 X;  3CSF A;  3PH0 C;  3D9J A;  3LVR E;  2E0I A;  2WXK A;  5FZR A;  4CT4 A;  3EDT B;  5JHB A;  4ILG A;  4B8A A;  2M63 A;  2WXN A;  5A6C A;  4OYS A;  3LJ3 A;  3PRZ A;  4JPS A;  4UI9 C;  4EZK A;  3MKR A;  3FU6 A;  2BTD A;  2NSZ A;  4BY6 A;  4HOT A;  2C0M A;  4UWF A;  4Q94 A;  3MKQ B;  3FTZ A;  4AY5 A;  2X6I A;  5ARF A;  1WY6 A;  3KEZ A;  2L9B A;  5CCM A;  5CMY A;  2NXP A;  3AS8 A;  4GU5 A;  4UWK A;  3KS2 A;  4GYW A;  4ILI A;  5D0O D;  5G04 J;  3TJP A;  1JWG A;  3CQG B;  5BV1 A;  3RRN B;  3PS6 A;  1X5B A;  3EHN A;  2BUG A;  4JL0 A;  4WAF A;  4L7T A;  2CG2 A;  1SQM A;  3D3M A;  4BSX A;  3CVV A;  3O48 A;  1B89 A;  4I6G A;  4FU3 A;  1HF8 A;  2Y4U A;  5DIZ A;  4ATG A;  4I43 A;  3FEY A;  3ENE A;  5DBK A;  2VTB B;  2CHW A;  3HHM A;  4NAC A;  2WQ7 A;  1U3C A;  5KJM A;  2CHZ A;  1WM5 A;  3MEK A;  4I1M A;  4J8F A;  5EX0 A;  3QWV A;  4M3O A;  3FY4 A;  5LX8 A;  3Q47 B;  3S7J A;  5FTP A;  3FTU A;  2V4L A;  4HXI A;  2AXU A;  1E7V A;  3QNK A;  3B13 A;  4WWP A;  1E8X A;  3FUF A;  3NQP A;  5C1D A;  3QC1 A;  3ESK A;  4RG6 A;  3PUJ A;  1E90 A;  3ZW3 A;  1HX8 A;  3R7Q A;  1UN8 A;  3FH8 A;  4U04 A;  2IQC A;  3T5X A;  4A55 A;  4AY6 A;  2IF4 A;  1IQU A;  2WXL A;  3I5P A;  2CHX A;  3LY7 A;  2WXG A;  4FLB A;  4LEU A;  5AJD A;  3UX4 A;  5J08 A;  3CVU A;  1TJF A;  2WMN A;  2WMO A;  3SF4 A;  2XHE A;  4FA6 A;  1A17 A;  2VSX E;  3TL5 A;  3NZS A;  4C9B B;  1KT1 A;  3FEX A;  4ANX A;  2VYI A;  4I2W A;  3UT8 A;  5AIJ A;  4CDR A;  4DPR A;  5ARG A;  4PS7 A;  4AVX A;  3ZEF A;  4F3V A;  2KM4 A;  1EF1 C;  3I4R B;  3CVW A;  3EIQ C;  3SHF A;  1KLX A;  4AV7 A;  2V0P A;  3CHQ A;  2WXJ A;  4GZD A;  4J0U A;  5FQ8 A;  5A7D B;  4I1A A;  1E8W A;  4IUL A;  5BUZ A;  4UQX A;  4EBA G;  2X6F A;  3U3W A;  4JC8 A;  4XKC A;  3T5V A;  4DK5 A;  5FQ7 A;  3CLJ A;  2AXZ A;  3MJW A;  1UJK A;  4MRU A;  1QNF A;  2KZT A;  2XRY A;  3SI5 A;  1N54 A;  3CGH A;  3PZD A;  2XPY A;  4IRU A;  1PC2 A;  2YIN A;  4C0E A;  4KYO B;  1Z3X A;  2FEZ A;  3SFZ A;  2WB2 A;  2FF4 A;  3TAX A;  4BT8 A;  1NA3 A;  3P1U A;  1HG2 A;  4CDN A;  4JXT A;  5JHA A;  5FT9 A;  4WUY A;  3LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...