4L85A

Crystal structure of receiver domain of kdpe d52a mutant from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
116
Chain Sequence
GAMANVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILALGGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asymmetric heterodomain interface stabilizes a response regulator-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords KDP operon transcriptional regulatory protein KdpE
total genus 38
structure length 116
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l85A00
2FMIA 4RDCA 3K9CA 3VNAA 2E4UA 3KS9A 5KQPA 3QLUA 5B3JA 2WWVD 2FN8A 2NT4A 1UDRA 2L17A 3FGZA 4GNRA 1J56A 1T34A 2FLWA 4P98A 2E4WA 3O1IC 4S04A 4YV7A 3MA0A 1P8AA 2FEKA 4LRQA 1OXBB 4N41A 4GPAA 4PEVA 5EWJA 2JCGA 3KJXA 4WXMA 1URPA 2WMYA 4IGAA 4IRXA 3DLHA 5IEJA 5DLEA 4O5AA 2IYNA 3H6GA 5KWSA 3LTEA 3O2JA 1YTUA 1A0OA 4NQRA 3T6KA 1CYEA 4Z4FA 3NHZA 2FMKA 3GA5A 4O1IA 3EQZA 4RWEA 3BRSA 4KPYA 4ZPJA 2H3HA 2RJNA 2XDYA 1M5UA 2JBAA 5HKOA 5JNVA 4JAVC 3HJFA 4P1ZA 1JFVA 1M2FA 4EVQA 2PE5A 4XXHA 5KC9A 1PHRA 2ZAYA 1JLKA 3NHMA 4MS1A 3TO5A 2M1ZA 1JYFA 2L19A 3RVQA 3SM9A 3OO1A 5KQGA 1W9HA 3QLTA 1DBWA 2QW1A 3EQ2A 3GYBA 1VLZA 4KK4A 3H5WA 4UHJA 2NZUG 3RVJA 2E4VA 1P6UA 1U2QA 1FFSA 2P4UA 1D2AA 5EWMA 1ZVVA 1Z2EA 3N8IA 5E3JA 4RY0A 4N47A 5FBKA 3HV2A 2HQBA 3H5LA 1LJUA 2FQXA 4WXEA 5GOTA 1DCFA 3H5OA 4LDZA 4NCBA 3LFTA 3VNBA 1CHNA 4Y9TA 2V0NA 3E61A 3JTEA 4RK4A 4Z4HA 2JRLA 3LUKA 4XARA 3HXMA 1QQAA 4JB0A 2DRIA 5EWMB 5IC5A 2L2QA 3ROTA 4B09A 1DBQA 4DADA 2CWDA 3N0RA 3Q41A 1GUDA 4HYEA 4E7OA 3O2QB 2CD7A 2WRZA 1SXHA 4KRFA 3DZDA 2BGGA 2CHEA 3JPYA 2F8SA 4RK5A 3QEMA 4EY3A 5FWYB 4MR8B 4PICA 5TPZD 1Z16A 2F8TA 1DZ3A 2R4QA 3URMA 3N75A 4EGSA 4ZMRA 1DC7A 1A2OA 2FMFA 1KMIY 2LIVA 4S05A 3T8YA 1D5WA 3IPCA 4MR8A 4OG2A 4QPJC 1AB6A 5FWXA 1SXGA 2E4ZA 3NBMA 4ZJPA 1QNLA 2R48A 3C3KA 2YHAA 1Z15A 3KCNA 3KHTA 3QX9A 4XASA 1KGSA 1JX6A 2P9HA 4RK7A 2L18A 3GWGA 3ILHA 1ZH4A 5JNSA 2LP4Y 3CNBA 3H1GA 3Q7TA 4H60A 2FTKE 4DQDA 2NUBA 3ILYA 1EAYA 3HVRA 1VRVA 1JL3A 3CLKA 1DC8A 2FSPA 4YRZA 2FEWB 3JPWA 5C5EA 3O21A 5CHYA 4YP9A 2VUIB 1CEYA 1SD5A 3B2NA 3H75A 4OTZA 2MSKA 3OO0A 3I5AA 3RVPA 3RH0A 3F73A 5I4CA 4D6XA 3LKVA 1Z12A 2JK1A 4DN6A 1XHFA 5CNMA 1A04A 3ROFA 4EYGA 1NXWA 4YGXB 4OLBA 1YS7A 4RU1A 5C5CA 4Z9AA 3RVLA 3N0XA 3HZHA 5JS2A 4MRMA 1ZGZA 1ZGGA 4MPTA 1ISRA 1ZITA 5IX8A 5FWXB 4KK3A 4ETIA 4PYRA 1P6QA 4MS1B 3HS3A 4H3HB 1TLFA 1ZN2A 1QO0A 2JVJA 2MYPA 3QLVC 5PNTA 4EVSA 4EUKA 5JS1A 1U0SY 5F64A 1DBPA 5FWYA 3GT7A 2VYCA 3KLOA 3RVMA 4RXMA 2GKGA 1JDNA 3Q9SA 1TVMA 4Z0NA 2QZJA 3JS5A 1ZDMA 4Z4IA 2FN9A 4KQCA 5D2CA 2AYZA 4O1HA 3OQMA 2IKSA 3CZCA 4FE4A 4L85A 1MB3A 3OLYA 4MQEB 5IBQA 2FVYA 3OLWA 3OQOA 5T3YA 4IILA 5BR1A 5IUNC 4TN5A 3HEBA 4IMJB 3OLVA 4ETMA 2ID7A 4LX8A 2JVKA 5KQLA 1ABFA 1BAPA 1D1PA 4LDAA 3O1HB 5JNWA 1EWKA 4RK0A 4F8JA 1LJLA 4M88A 3FFTA 1BDJA 3LUCA 1BVHA 1LBHA 1I3CA 3C3WA 4KZKA 4NICA 1TMYA 2FW0A 3S99A 3SY8A 2IPMA 3SQNA 5JNUA 3MMNA 1H9CA 4NCAA 3R0JA 4XLTA 3Q7RA 5IUKC 2NT3A 3LUAA 4MQEA 5KC8A 2HPHA 3RVNA 1AB5A 1PEAA 1QO0D 2MSLA 3Q15C 3RVRA 1GCAA 2X7XA 1JYEA 3BBLA 1U04A 3UUGA 4LE1A 1D4ZA 4JP1A 4YCSA 3TD9A 2FKAA 5IULC 3HCWA 1TM2A 2PUAA 3OMWA 1MB0A 1R8JA 1Z13A 2IDMA 3H5VA 3CS3A 2B4AA 3EAFA 1YMUA 1KRXA 3KYJB 2E4XA 2WJAA 3H6HA 3LUJA 1FFGA 4Z4GA 4LE2A 2Q5CA 3MM4A 4MLDA 4EYKA 2FQYA 2PAFA 4MYRA 4TLLB 2GBPA 1NXVA 2WY2D 1JWLA 4KNYA 4G0QA 1BDIA 3DLBA 1XWWA 1F4VA 1GLGA 5KI6A 3HM9A 1QPZA 3I09A 4L4UA 3Q7SA 3F6CA 4N03A 2VK2A 4HNSA 1PUXA 3NNNA 4Z99A 3CTPA 1GCGA 3SNKA 1FQWA 1YVUA 2LPMA 2PUEA 5KQMA 2CHFA 3CRNA 4MGEA 4RXUA 3LUFA 5DGCA 1JHZA 2PUFA 1NXOA 1E6LA 5TQ2A 4RKQA 4Z4CA 3HUTA 2A9QA 2HQOA 1QP0A 1QMPA 4FE7A 2MYTA 4RK1A 3H5IA 5TE9A 3JVIA 2RDMA 2OENG 1YS6A 2R25B 3LUDA 4TMYA 3QELB 3BREA 4N76A 1Z25A 3CZ5A 2H0AA 4W5TA 4RY8A 4RK6A 3SG0A 3OLXA 3MQ4A 4G97A 4ETNA 2MSWA 1VPWA 1BDHA 4UHKA 5HQJA 1QQBA 1JF8A 1NATA 3HDGA 3RVKA 3KLNA 4G0XA 5TPZA 3UK0A 5HSGA 3N53A 4RV5A 1LBIA 4KV7A 1FSPA 1SXIA 3F7NA 4D6YA 5ABPA 5ED4A 2RJOA 1RZRA 1Z17A 1ZH2A 3O2SB 5BRAA 1NTRA 1SRRA 3BILA 4MLCA 4NV3A 5DTEA 4MRMB 2J48A 2ZWMA 1ZESA 2KYRA 4YO7A 5JNTA 2A9OA 1QKKA 4XFKA 4Q7EA 4MS4A 3FFWA 1E2BA 3G85A 1ZHHA 4N0PA 4F3TA 2R47A 5DCLA 1Z18A 2QXYA 4TLMB 1D1QA 4OBBA 1YMVA 4MR7A 3GL9A 4EYOA 3KSMA 2TMYA 4FB4A 4XAQA 2PL9A 4N0QA 4W5QA 2PUDA 1RPJA 1DRKA 3DBIA 4G0ZA 6CHYA 3QELA 4OLAA 3E3MA 4RKRA 4KREA 2I6FA 4RSMA 8ABPA 3IP5A 3KKEA 2YHBA 1NXTA 3CHYA 5CNKA 5TPWB 3MYYA 4ZYLA 5CNIA 1QP4A 4KFCA 3MF4A 4OATA 4QICA 4ML3A 4WZZA 3G1WA 1BA2A 3LOPA 1YIOA 2FXIA 5TPWA 3T38A 1YK1A 3CU5A 3CFYA 4MS3B 4MQFB 2MYNA 3C3MA 4YS6A 3M9XA 4Z4EA 3A10A 3LMKA 4LZLA 2IPLA 4MR9A 4PE5B 3RVOA 3HUUA 3FFXA 1MIHA 3CG0A 2IOYA 3CKMA 4Q6BA 5TQ0A 2LUOA 2QSJA 1JBEA 4RS3A 1USKA 4E7PA 1JFSA 3HO1A 3EGCA 2FLKA 1PNTA 3O1JC 1JH9A 1DCKA 1U8TA 4KMRA 4Z9BA 2W42A 1NXXA 3KTOA 1ISSA 5JNRA 2E4YA 1MVOA 4QYMA 3QLUC 5B3JC 3UKJA 1RXEA 3JY6A 3L6UA 1EHCA 3GBVA 3GBPA 3D8UA 3GV0A 1RNLA 2GWRA 3A0UA 3KYIB 3M6MD 3OLZA 3QEMB 1APBA 1PNRA 3HSYA 3O74A 4LE0A 1TJYA 2PUBA 6ABPA 1L5ZA 1USGA 3BRQA 3I45A 3OMXA 3QLVA 4IF4A 5TQ0B 1FFWA 3KG2A 1QP7A 4YLEA 1Y1LA 4HNRA 1ZY2A 2NZVG 3F6PA 4H3KB 3P9YA 1L5YA 3GRCA 3NNSA 4WWHA 4PZ0A 2PMCA 4QYWA 1EFAA 5TQJA 4MAAA 1JDPA 1IIBA 4G0OA 1NY5A 4JASB 1DRJA 1XHEA 1DG9A 3CG4A 4EYQA 3K4HA 3LUGA 4G86A 1RXIA 1EWTA 3OM0A 3W9SA 3SAJA 3QEKA 2HJ9A 1C4WA 3LKBA 2VUHB 3FDFA 3EODA 3HDVA 4KVFA 9ABPA 1F51E 3DGFC 1B00A 3EDCA 3A0RB 3IP9A 4JA2A 4MQFA 4MS3A 2FMHA 3D02A 1EWVA 5BQ3A 3RQIA 1M5TA 3IDOA 7ABPA 1GUBA 1E6MA 3O75A 2GX6A 5GQSA 3H5TA 5TQ2B 5CNJA 1E6KA 1K68A 2QV0A 1C0EA 4F12A 3JVDA 2HQRA 1NXPA 1M2EA 3H1FA 2PL1A 4G0YA 3NNDA 3EULA 2QU7A 3H1EA 2AYXA 3IPAA 3EJWA 5EWJB 2B1JA 5EWLA 3TX6A 4YR7A 4CBVA 1OXKB 2PLNA 2O20A 4F06A 2ID9A 2FEPA 2OQRA 1P2FA 2A9RA 4W5NA 3OM1A 4YWHA 5BRJA 4RXTA 1YK0A 3HK2A 4G0MA 2M98A 5FBHA 1DP4A 2WB4A 4MR9B 2RGYA 2IPNA 4W5RA 2JB9A 4IMIB 3IP7A 4RZSA 2A9PA 1K66A 3OQNA 2PUGA 1USIA 4HNQA 1ABEA 4RY9A 2FQWA 2PJUA 3TMYA 5IEBA 5T7BA 4WT7A 4MS4B 1JFTA 2GI4A 1NXSA 5IUJC 4Q6WA 1PEYA 3DGEC 4KQ9A 4ZMSA 1VKRA 3QK7A 3MIZA 3N0WA 2QR3A 4WUTA 3T95A 3FMVA 4JOQA 1DCMA 1WETA 2PKXA 1HEYA 1Z2DA 1Z26A 3LUHA 4MR7B 3A3KA 2LBPA 2QVCA 3IP6A 4D74A 4EVRA 2IPAB 3TB6A 1RZRD 3I42A 1DJMA 1W25A 3C6QA 1KRWA 1LK0A 2N9UA 2JVIA 3QX8A 1U2PA 5DKFA 5EWLB 3RVSA 2PUCA 2WJWA 3C97A 4W5OA 4JB2A 3N6VA 5HM6A 1ZAYA 1S8NA 2HSGA 4F11A 2JBAB 2QVGA 4G0PA 2MYUA 3M9WA 3L49A 1MAVA
chains in the Genus database with same CATH superfamily
1BEUB 4YBZA 5K8LA 2OXEA 3WMXA 1NNUA 3MJCA 1QLJA 2Z8ZA 4HSEA 5DYTA 4BFZA 1V9CA 5KQPA 1W76A 4PC7A 4LWPA 2HPZA 2CCKA 2WWVD 3RYIA 1IQPA 2VXCA 1KARA 4LJ4A 4UDXX 4X24A 5I9MA 3VGJA 3FRJA 3FIUA 4WZBA 3VYVA 4CM1A 4R7ZA 3I05A 2QD3A 3RAPR 1MN6A 4UNRA 1PSZA 2VT2A 4NAUA 5I9SA 3RAGA 2ZAOA 1IVSA 3O1IC 1D6JA 3A7DA 1REQA 3O8OB 3U3JA 1BJKA 3H2JA 1M1NA 4GXTA 1R88A 5FI0B 1B26A 1HQKA 3LPNA 5C37A 1C80A 2GZSA 3C4VA 4AJNA 4DTIA 4DIMA 2C4HA 3TW6A 3FTDA 2DPXA 3ZIDA 1B8OA 2XT6A 1XEWY 1DOHA 1YE3A 2X15A 2BI4A 5FB3A 5A4IS 3EDRA 3K0SA 3P27A 1EFRA 4LJSA 3EQ9A 1I1NA 3KAKA 1R8SA 2VEDA 2OHJA 3ISTA 4UREA 3SZMA 1YTUA 3EFEA 3FSRA 5BWLA 4GMXA 4H7HA 4Z4FA 2GK7A 3PK0A 1V47A 3EX7C 4ZZ2A 3I5YA 1BEZA 3OUTA 1ZMXA 4E03A 1G20B 4M0KA 3V5NA 4B79A 2AI3A 2W2PA 3OFNA 2EARA 1DADA 1VIMA 4EVQA 2PE5A 1CJSA 4QTUB 2ZAYA 4BCCA 4Z54A 3V33A 1F5NA 4UOQA 1WLSA 3WQSB 1MVNA 3EMVA 1X77A 2JFBA 1Z35A 2QLNA 4LAFA 4QM6A 5D86A 4US0R 4PZPA 1GPAA 3OO1A 5EZYF 3VKVA 1VMDA 5H68A 4I3HA 3H9QA 3O3NB 4ZXFA 2J3LA 2OZLB 2GXQA 4DZRA 1T8YA 5KVCA 3CZMA 1P6UA 4FOOA 2WV7A 4R6WA 4G3XA 3ROKA 1W5FA 5IJ9A 4PN3A 4RHEA 4PN7A 2FP3A 3PZBA 1M6HA 3G6KA 5DU2A 4LRXA 4WA7A 1XXLA 1JR3E 1E2KA 4FQ7A 4HUQA 5B2EA 3HV2A 3ICEA 4OQDA 4EY7A 4KSBA 2Q6LA 4UHDA 3T9EA 3NFRA 5JYCA 1M54A 2Z4SA 3SS7X 3A26A 4RH1A 2P79A 3NG1A 1F60A 5AVVA 2XWBF 1NFFA 2YXBA 1UFOA 3N05A 4FFDA 2IXAA 1B1AA 5HK8A 3T7DA 1BDMA 4QKQA 5DHPA 2W6CX 3PVCA 3UMFA 4CIWA 2V3VA 1RJDA 2B9EA 3ZGOA 2XKJE 3HXMA 3ZGYA 2VDNB 5FKJA 3CB4A 2AUMA 3RV4A 3W3AD 1P9WA 3QFFA 1DBQA 3I0ZA 4M0EA 1YDMA 3L41A 3WGTA 1ZCBA 2XXAB 3A1TA 3AEYA 5E6UB 3LZDA 4M0DA 3TCXB 2R84A 3VZRA 3PEFA 3TBKA 2O6HA 2I4RA 4PY2A 5HKAA 3JYHA 1K9VF 5CVDA 2FCRA 3T1HB 2XQGA 5NLLA 3HDJA 5L7YA 3MLEA 3IDQA 2ZE8A 4ZI7F 5JATA 1YRQA 1RS0A 3O82A 3CX7A 4RELA 3KE8A 4PFKA 4IQFA 2CGEA 2PDAA 2FP4A 4NZZA 4NFLA 1DJLA 1DEAA 4HFMA 4BJ5A 1VDMA 4XASA 1KGSA 3K5IA 4WACA 2V9ZA 4BXOA 5MFZA 2IIPA 3TIVA 5ELXA 1BXKA 3QLEA 4C3OB 2GAIA 1EAMA 1P8JA 1MX1A 1QQ6A 2PRSA 3K9NA 3LT2A 3OD5A 3CNBA 3DDNA 1K89A 3EPHA 5AHKA 3MWYW 2Y1EA 4MCJA 1CDDA 2W37A 4X3OA 3UM9A 4EQZA 2O0KA 1OXMA 1G20E 1RRFA 5FBVB 3EXG2 5CH5A 1O94C 3V4VB 1SOWA 2OCXA 4A82A 4OPMA 5AOBA 3HDTA 3UJ6A 1EBFA 3VRHA 4BV8A 2VT3A 3L4EA 1J42A 1YT5A 4J3NA 4CLDA 3L8YA 3NTOA 5EP4A 2HN9A 2Y76A 1I2CA 4R1MA 1GPJA 1MQSA 3K2EA 4NSNA 5J4YA 4DA4A 5BT8A 2VSFA 1OXUA 1QYVA 4BFXA 4BECA 1P29A 1YBFA 2DBZA 2GCOB 2OOSA 5C5CA 2Y4NA 3Q1LA 1V39A 1X7WB 1ZG3A 2EHDA 4LXXA 5I9BA 3GUHA 1GAJA 3C3PA 2PXAA 2ATCA 2FP4B 4PPGA 1U8XX 3VKHA 2FFBA 4MW1A 2FG6C 1WOYA 4US2R 5JCJA 3U3OA 1T4DA 1YU6A 2C4NA 4G63A 3S2IA 5FWXB 2ZCVA 3D3QA 2B36A 3EAGA 2XGOA 4NBRA 1ZKMA 2DY0A 1RLUA 4IHKA 4GVLA 3OFJA 1QTNA 4M1KA 4F9FA 5A3QA 3RFUA 1QIHA 4BNVA 1DBPA 5K8IA 4TROA 4D3ZA 2IXDA 2P67A 2FGKA 4QOJA 2WKPA 4Q24A 4B3XA 1JSLA 1LQTA 4XQEA 2ZR0A 3L1UA 4ZOLA 2UU9B 3OT1B 4PTLA 2QTCA 1N6PA 2YNMC 1KAGA 1R5BA 4KQWA 3OQMA 2BHSA 1L4GA 2ZBGA 4JGGA 2Q8QA 5ALRA 2GJSA 3ZU4A 1RTKA 2DHCA 3MCAA 1HK7A 2O0LA 3QKRA 3B38A 1KH1A 5K20A 2ANCA 1T6ZA 2UZ3A 3Q8WA 5T3YA 1EX7A 2DLDA 2CB9A 3VNAA 5AVSA 5I7OA 5J47A 4ETMA 2A92A 1M1YA 4ARUA 2R6CA 2D3WA 4H17A 4RK0A 5DI9A 1SXJC 1T26A 5BR7A 2Z2YA 3OIDA 5BXYA 3A9SA 2IODA 4NI5A 1XCOA 5KVQA 4A8HA 1LBHA 4KZKA 5E3IA 4L9RA 4OGFA 3AF6A 2EG5A 4M0LA 1F3LA 3CUSA 2IPMA 4Q3KA 1TKAA 5A5DA 3CVXA 2ZRJA 2AUNA 4M0PA 3WOHA 1L8XA 4MUGA 2VYNA 3IKMB 1DLJA 3GQBA 1KI4A 5EMLA 1CQJB 4I1OA 1QB7A 2OHOA 1A9XB 2BJHA 3N86A 3Q15C 4M37A 3RVRA 3TVTA 1GCAA 4FZJA 3ESDA 1BE1A 1WDLA 5BWOA 5JWOA 3UC5A 1IBRA 1QYRA 4X7MA 1U04A 2PKCA 4MIYA 1O6FA 2OPHA 5CCEA 1JEJA 1DEXA 2W7TA 1BMDA 3L0IB 5IULC 3R3VA 2K6GA 1GG9A 1S4QA 1YWGO 2IRWA 1EP3B 2IT1A 2ZRCA 2WFMA 1B0PA 3DUFA 3CS3A 3EVBA 3KSUA 1OWPA 3DZBA 5DRYA 2XQIA 3ZD8A 3M70A 3E05A 3LYAA 1NC3A 6REQA 4EYEA 4KGDA 1WXDA 2OP1A 3AHDA 2OC9A 3JQAD 3KYJB 4GNKA 1O08A 4X92A 2FPLA 5EFOA 2WWWA 1L7PA 1OI3A 3KPUA 2E4AA 3E7WA 3ZZMA 2Z2JA 4AN1A 5BN4B 3OJOA 1TTQB 1A1VA 1G98A 2VAXA 1K2VN 3OESA 3L18A 1QK5A 2ZXFA 1GQOA 3LHIA 5ADWA 3NR2A 1KO7A 1TB4A 2UYGA 3ME5A 4WEQA 5EVJA 3OVMA 3R5KA 3TAUA 3REGA 6PFKA 1Z38A 4NYJQ 3MJTA 4Y2TA 4IIUA 1Z75A 4C0LA 1E79A 4XIIA 3BSWA 2LPMA 2ZUVA 3Q6IA 1CY6A 1ZM4A 3IMGA 2FEOA 2CHFA 3C3CA 4IXWA 5IYZF 3I4LA 3WLIA 4ZJUA 3VNRA 2B69A 2CE7A 4OKIA 1RRKA 3X1DA 4LI3X 1TMGE 9ATCA 5TE9A 1YTLA 5BPHA 2JIPA 1HE4A 3GLQA 1CS0A 1I9CA 1WHSA 5EKTA 1OZGA 1E7RA 3L9XA 3VC3A 3ZDCA 2Q3HA 3TZLA 3KQLA 2Q27A 1PX2A 4O2AB 4P8RA 2P4HX 1OTYA 4ETNA 4IG4A 3CNNA 1WDKA 1SIOA 4JEIA 2VA8A 3X2EA 3CZ9A 4URFA 2GTHA 2V1XA 2QT9A 1V7ZA 2M1XA 4H7IA 4IJMA 5EJ4A 4BJ3A 4NE2A 4RE5A 3G3EA 3L0BA 2IV2X 4PYQA 1OJLA 1Z37A 5DE3A 2H17A 1WTAA 2GPSA 1JEAA 4XB2A 3VUEA 4FM9A 1L7RA 1RCFA 2O7QA 1QH1A 5FUXA 4F1WA 1IPEA 2HJRA 3NBQA 1H2AS 1T0UA 1N5KA 1QH9A 1U31A 3KQYA 3DF7A 3MK31 2NU8A 4IDOA 2EP5A 3HCPA 4MRSA 1WSBA 3OX2A 2PFGA 2COKA 1PVOA 5DW0A 5JJ5A 3SVLA 2NQ8A 4NU5A 1DEKA 5U1PA 1JQJC 2Y0CA 5DX0A 3BCRA 4BX0A 3M49A 2DPMA 4R68A 5FPYA 5JAQA 4DLNA 5K6AA 1AV6A 2I4NA 3B60A 5JZBA 4G0ZA 1LQUA 4X3CA 4N01A 1Y5IA 3U4DA 4F9TA 3ZU5A 1H3FA 2X9VA 3MYYA 4YV1A 5BQOA 1HZZA 3ZN2A 2HMUA 3IX7A 2G6TA 4B6FA 1RWPA 3VPAA 4ML3A 4FHFA 3UJ3X 3RNOA 4AU1A 3H1TA 4BGIA 1XVUA 3U62A 4W5JA 4YMGA 3INGA 2H18A 3CBQA 3LT1A 1WB5A 2W00A 3FNQA 5GMOA 1K88A 3U3DA 1M2GA 3BTOA 3KLMX 4IQ4A 5JXWA 1N5RA 1P44A 5B12A 1ZFNA 2ZRLA 3KOMA 3HJCA 1P3DA 3JATB 4D45A 4R6XA 2QD2A 2ONKA 5TGZA 2PGAA 2H08A 5G3ZA 1W0KD 2BDUA 4A8PA 4E1AA 1FP1D 3CKMA 1ZX1A 2QSJA 5D5PA 2ACWA 3FKSA 4P83A 3TXXA 2JIDA 1NJFA 4DABA 5JHGB 2PYDA 1TF7A 4BV2A 1BE0A 1NFQA 1E0SA 1U8TA 3O1JC 4DF3A 1XMPA 4BB5A 1MC5A 4JUDX 2WC1A 3ZHBA 5B3JC 4WTOA 3L6UA 4HVAA 1KZ9A 2VC2B 3LA6A 3PRYA 1X7HA 4R2HA 4E11A 2AXPA 3G2NA 1T2FA 1UM8A 4RD2A 1TJYA 3QNUA 3W3AH 1QIJA 1RM5A 3D1JA 1J1ZA 1GYQA 1NVKA 2AIRA 2HO5A 1OWMA 3OMXA 3QLVA 3K5WA 2IDZA 2WJJA 4W4TA 4F21A 1M2OB 4YLEA 1YV9A 4J29A 1TVKA 1PQUA 1R74A 5LXTF 4E4TA 4R3NA 1OFIA 4F2HA 3K9BA 5TS3A 4CM4A 3QHQA 2DFNA 4KLNA 2GRJA 2PMCA 1U3WA 4JT2A 4Y9SA 1W29A 2VS1A 1T8WA 1TGVA 2FLVA 2QN2A 1ORDA 1LNQA 2EKPA 3N2EA 1IIBA 1WJGA 2ATXA 2BUBA 4PANA 4PHTA 1FSZA 3GJ4A 3WLQA 5AUNB 3L5KA 3ZGLA 5H0IA 4L0CA 3EZ2A 4ZI3A 2O2CA 4IV0A 2YW2A 3PGMA 2ZB8A 2J7PD 3BGWA 4GYJA 1G6HA 4N5NA 3LUGA 1COWA 1FVXA 2V3CC 4TRNA 5AJVB 4CKWB 3LP6A 3DQZA 4KXXA 2BMVA 1H93A 2J41A 1KJJA 3SAJA 4RPJA 3NHSA 1VHDA 3E3NA 3HDVA 3SDBA 1T0IA 2I80A 4F72A 3MS2A 2FHPA 1CFJA 3ZX4A 7REQB 3PQ8A 4HWPA 3UKDA 4EB0A 4E14A 4F5YA 4F92B 2RH5A 1Q1EA 5G0UA 5K0FA 4RFSA 3QI7A 5LMUB 1PJAA 4HADA 3UJHA 2QAGB 2XYQA 2Z09A 3KVOA 2PU7A 3MQFA 4KW7A 5AVZA 4CL2A 2A86A 1C9DB 2CB0A 1KJ9A 1LUAA 3E0XA 2IZ6A 5CYOA 4KXNA 2LCFA 2A5LA 2CNNA 5DV9A 5IJXA 2GKOA 3LZ6A 2GD1O 3IEKA 2AX4A 5M7EA 5BVHA 2YXPX 2B1JA 3EVCA 1CQZA 4JUCA 4MUIA 2OGWA 1BCSB 1QVRA 4U9UA 2C3YA 1NIPA 3SEQA 4NPHA 3V8BA 2FMXA 2XDWA 4P58A 3GPLA 1II8A 4HWKA 4B0OA 1ZGBA 1AZWA 3GX1A 5KNDA 1FNSA 4Q47A 2HJHA 3PX7A 1LTQA 2C7OA 1T25A 4IZ6A 3PFWO 3PRJA 3AFIA 2YWFA 5IUJC 1BWSA 3OFVA 4XQ9A 1BA3A 1EGHA 3RS2A 4ZIRA 1DUVG 1E1QA 5KWEA 3DV0A 3ZPXA 1F2UB 2C3OA 3TXYA 4YEDA 3UMJA 4DCGA 5BP7A 3QV2A 3DXXA 1QPGA 1T5HX 4DOMA 3KJHA 2XZLA 1KP9A 1Z26A 3LUHA 4R8MA 4QHTA 3FNEA 4GKBA 3G17A 3QY0A 1QDEA 3OKPA 4ZJZA 1EXWA 2XBMA 1N9GA 3CH6A 1QVWA 2E1RA 5IFLA 2ZZNA 2B21A 2JKZA 1V1MB 3U9SA 4X7PA 1MENA 5B2FA 3THYA 3QVVA 3WP0A 3P71T 3MELA 1I51A 1YCFA 2ZWIA 2R7KA 4B6QA 4W5OA 3HVIA 2WU3A 1H0KA 4HB2A 4I3FA 3ZQUA 1YU9A 1OROA 5BWBA 1ZWLA 3RK4A 2HSGA 3TLKA 4ZMBA 2QVGA 1LNSA 1VL6A 3DLBA 1T2UA 4ATNA 1QK3A 5IAEA 3HYLA 1RKQA 3KUUA 5CK5A 4RVDA 4DMCA 2Q4DA 4MV4A 2E4UA 2NXNA 4QJ4A 5GGXA 3F3SA 1KEEB 3TGLA 3E2IA 2GPTA 2BE9A 2CCGA 3SN6A 3KUCA 4G5HA 3R9XB 1UDRA 1P60A 4Q18A 4M8IA 4R2JA 4PX5A 3OPNA 1NRXA 4AJPA 4BEBA 3FCXA 2AFHA 4ZU3A 4QU5A 5K3CA 4TKUB 4Q4AB 4WLVA 1DFGA 1QHHA 1IAVA 4JYZA 2EZ9A 5TXGA 4EA6A 2IH2A 1Q16A 4HGPA 5BSKA 3A1SA 2JJ2A 1Q0QA 1ULAA 1VLMA 1WMDA 4V0OA 4TYNA 2QTTA 5EOVA 4YRJA 2SKEA 2OO5C 4AROA 3KB2A 4TSFD 4R8SA 2BZ0A 4BCBA 1S02A 2AFVA 3S4YA 1R5OA 1H65A 1I6LA 2Z6QA 1F2VA 1J99A 1UBMS 3H2ZA 4PF1A 4U8HA 3LLUA 2WSSD 1QHFA 2HIMA 3C45A 3DMNA 1W19A 2IPXA 3DLPX 1PJ4A 4N5LA 3SC6A 5E6UA 3WK4A 3GEGA 4RGBA 1BGWA 3D3WB 1JXOA 1UM9A 1M66A 5JTUA 6ADHA 2VHYA 13PKA 2Q2OA 5K3FA 3JQ7A 3UQYS 4LHWA 2P3SA 5JAPA 2CDCA 3ZCSA 4QSMA 4K28A 3L1HA 3MJSA 2WU1A 3EVGA 4GXQA 1BFKA 1U3UA 1M5UA 2JBAA 3GCZA 4PS0A 8OHMA 2WD9A 1NXQA 2HQ1A 3HBNA 4OA5A 4X62B 1D6NA 1FPQA 3GFFA 1QIFA 4C6TB 1SBZA 4QM7A 4UM8B 1YJXA 1YZGA 3VMMA 4YO8A 3RRFA 3C7CB 3GH1A 2FSVA 1CD5A 1COWD 2PL3A 2D0IA 3TTSA 1D4AA 3CW2A 1RBMA 3C8ZA 3BKXA 3H9GA 3R20A 1BMFD 4C43A 4D97A 2AD5A 3GFRA 3VNUA 3OECA 3T5MA 3BULA 1JVSA 1Z3CA 2GCOA 3GBSA 3JTMA 3LQKA 3QXHA 4H3SA 4KDRA 1MV8A 2Q07A 1D2AA 4D9HA 1SY7A 2PRZA 3QITA 4I8XA 3B53X 1ZVVA 4L6IA 2EJBA 1O5TA 1TRHA 2G8NA 1HL7A 4Z8YA 4YYZA 4MW6A 4EUFA 3M6VA 3UUFA 5CFRA 2H1IA 1T0HB 1ZA1A 1LI5A 2G40A 4OL9A 3B6EA 2YXDA 4ZOBA 2DBYA 4EFLA 5FHRA 1GQQA 4ZVMA 4V1CI 2CYBA 4GXNA 3K73O 5EYPB 2PUVA 4UE6A 1XMXA 5IYZB 1G16A 1EA7A 4LMAA 3UMSA 4UU8A 3JTEA 3B5JA 1ZNYA 1SNYA 3I8SA 2EEZA 2QG4A 5G3YA 1Z5ZA 2GGSA 4INPA 3BXPA 1SU8A 1PFVA 2OORC 1XVLA 2GCNA 1Z82A 5FUVA 2CWDA 2Q0QA 2WJZB 3Q41A 2PXCA 4KQEA 5F1YA 4QEDA 3BZBA 4QHYA 3HMKA 3OU7A 3BCUA 1TA9A 3OOWA 2F8SA 1J9GA 1O9HA 4RZHA 3EUAA 4KH0A 4GI5A 3WS7A 3Q8KA 2J4DA 1Z6GA 1N1MA 4TVOA 1A2OA 1CQPA 2EL7A 3K20A 3CEPB 1ORRA 1QANA 2LIVA 2C5SA 3ETCA 3I1IA 2ZJ2A 4MQLA 4MR8A 3R7LA 3KZMA 2B30A 3N2GB 4GD3Q 1Y34E 5E95A 3TDMA 3L7OA 1JNXX 2GSWA 2NTYC 1ORVA 3L0ZA 3AUXA 4UVIA 3KHTA 1XLWA 1SD1A 2FU5C 3GCGA 3F3YA 4ZVTA 5K0JA 2VWQA 3QQPA 2QROA 2GWHA 4LSWA 3LH5A 4U7GA 4WBSA 1YCHA 1ODSA 5JMTA 4QUIA 1KEKA 2DPYA 4GAEA 3HP4A 2XVXA 5REQB 2HDHA 3STYA 2HLDA 1GQFA 1L4YA 3D6AA 2FFQA 3I2YX 4EG7A 1ECPA 2AN5A 1TMKA 1UJCA 3CUWA 4C03A 4TXHA 4YPVA 4AKTA 3S8EA 1CEYA 4H9GA 2ZRKA 3K6RA 3QVKA 2KE5A 5DNAA 3RSQA 4CDGA 1U8UA 3CLHA 1XA3A 3TQCA 2BKEA 4HFRA 4OSPA 2VH2A 3PPYA 4GQBA 4JX8A 3G13A 3UJ8A 2PV7A 1F2TB 1NXWA 3HYNA 4HGQA 3K0FA 2GDJA 2ILTA 1PEKE 3K2BA 3PFHA 3F6BX 4KP7A 2VF2A 4UBNA 3TOCA 3C7TA 5IAJA 1VSQA 4HDRB 2B94A 2IUYA 2ZJ3A 2YW9A 4MI3A 3P4YA 4JVSB 3L7BA 1TLFA 1N2EA 2O06A 1Z4JA 4JL8A 4Y0VA 3WNDA 4CM3A 1IZ8A 2X4LA 3W6UA 4ID9A 1L6RA 4DV3B 2QUZA 4DDUA 2QE7D 4NE9A 4QOHA 4RXMA 3IJEB 3OLCX 3Q9SA 4OXYA 3RUPA 3U49A 1NW6A 2CFIA 3WYAA 3IS3A 4QGFA 3WFJA 1C7EA 1AS2A 3I58A 4OXIA 4N5HX 5LBIA 2JGNA 1LLUA 3K1TA 3G23A 3K05A 4XQ0A 3C1TA 4YRDA 5EE5B 1HC7A 3UJBA 4U7WA 4CLOB 2IS2A 4NBTA 4Y7CA 3SSNA 4F4UA 2PIDA 3ZR4B 3DFFA 3RJMA 3HEBA 4TWAA 4U2KA 3VOSA 3CJRA 1BAPA 4FFSA 4UBMA 2PLFA 3O1HB 3NASA 2GYYA 3OOJA 4BN0A 6GPBA 5HZKA 4BN4A 1EWKA 1SVIA 4CW7A 2RG1A 1XU7A 4HGRA 4LY0A 1CF9A 3A1WA 1JQBA 3AYXB 3CUYA 4H6WA 2ZYSA 4TL7A 4TXMA 4D3SA 4EP1A 1DUIA 2FW0A 1XEXB 3CLTC 3JAKA 1DT3A 3K96A 4ICIA 4P0TA 4GEKA 3MMNA 4L9AA 4F6CA 1Z45A 1BSVA 1UANA 1GNQA 3KKZA 4HAXA 1ZP6A 4LZOA 3D6TB 3U56A 1ACJA 1DUSA 3R3WA 3K3PA 1RJGA 2RGBA 4G5YA 4OAPA 1O94A 3ZNNA 1N6OA 2FW1A 2Z4TA 3NT4A 4YRFA 5K99A 5CXQA 1JFLA 2CY0A 4GOND 1FS6A 2IDKA 4Y2HA 3ODPA 1D4ZA 4JK3A 2JFHA 2J31A 1JP7A 1R8JA 2WJ6A 3SZGA 3PYMA 5FADA 3DHWC 3UOAB 3EZXA 1ODFA 1R6XA 3A1CA 5IARA 4BEWA 2RHOA 3CSDA 4BUCA 4IHAA 1XQ9A 2ORYA 4EG1A 1GRVA 1HPLA 2O2GA 4IKEA 4LDPA 1N1GA 2ATVA 4RE6A 3MM4A 2AT1A 2GD6A 3OKAA 4BNDA 4RTKA 1EM6A 3SVZA 4I1UA 3T9AA 2J6HA 2FPGA 1P9NA 2UZ1A 4FONA 2PUWA 4EF5A 3C43A 4G8JA 4YRPA 3VAZA 1HZZC 3MUOA 2BELA 2FUG1 1F8GA 2BFBB 2N46A 2V7XA 3Q2OA 4RZ3A 2XECA 3H2GA 2QPOA 1A2KC 2JLUA 1ILWA 4P3XA 5DM60 2WIJA 1IHUA 2OHFA 1OR8A 1T1IA 3NWPA 4CL0A 4HT3B 1DOAA 2BKLA 2HXYA 5LQCA 2XUPA 2JGIA 3ECAA 3SNKA 2IEYA 3EXEA 1SWWA 5D51S 4RXUA 2PUFA 3LUFA 1HQYE 4B3GA 2ONYA 5LDDC 2R8PA 3C5WP 2X4GA 5G1PA 1E2QA 3WDSA 4MYTA 5T4HA 2I66A 4OJKA 3KEMA 1GA1A 1D7OA 2OENG 1RE0A 2JGDA 1S8FA 2R25B 1M2JA 3TOXA 3EUFA 2FWAA 3BPSA 3NUZA 3I62A 3Q10A 4DUGA 2FR8A 5A5VA 5J23A 4LV6A 4MKZA 2B5OA 3ENKA 1VC2A 4MULA 4GZ3A 3BB1A 3SI7A 4EO4A 2XWPA 3ZGNA 3E5NA 3IALA 3MT0A 3RPEA 1JALA 3LK6A 3KUDA 4Y67A 2ST1A 1UAYA 1WSAA 5AVQA 4IS3A 1IHDA 1BC5A 3N53A 2NP7A 1C8LA 1JTEA 1U7HA 2OQ2A 2ABWA 3AP2A 1VJ0A 3LVFO 4J91A 5K1ZA 3DV2A 4PLZA 2Z4RA 3UWMA 2WF8A 4UAVA 4BMYA 4EKYA 5K4GA 3WXMA 2CZCA 1XMVA 3V7YA 5K0EA 3KETA 2PXXA 4B83A 1RLJA 1P2DA 1ISGA 1D0SA 4WI1A 4LZJA 4MRMB 4FDTA 5HBRA 4EI8A 5IJ9B 2DT5A 1CUHA 2WU0A 3I2KA 1R15A 1RYZA 4PGFA 3CJTA 2PS0A 4HLQB 4YO7A 3BJIC 1JDBB 4JP2A 5C1IA 3IUNA 3WGGA 1ZKDA 4QXMA 5CDFA 2O7NA 3HMQA 4RWZA 4WUVA 4E5KA 4BJ6A 4QA9A 4AMZA 2JGLA 3EH1A 4EHFA 3UXHA 4GMHA 3FTEA 1JS1X 4JI6B 2NO9A 1PJ2A 2JIRA 3IE0A 1C8VB 2C07A 3HO8A 3AEUA 1XCMA 3QBTA 4PQGA 2Q9CA 5FPTA 3VBEA 4X7BA 3M1YA 4F7WA 4NEQA 3RT1A 3PTZA 1NKTA 4E2ZA 4K6MA 2RHWA 4D9KA 1NV9A 4OI0A 8ADHA 4MV0A 4MWTA 3BBPA 4OK6A 2FPPB 1CUJA 2WAYA 3INRA 4Q4HA 1VP9A 4OATA 3GVXA 4QICA 2H31A 1SCDA 1ZUHA 2C4VA 3G1WA 2HRBA 4BAZA 2FXIA 1VG1A 1BXGA 3AKCA 3H11B 1MJHA 3NEAA 4Q9AA 1II0A 1YK1A 4A16A 1AQIA 3M6LA 4AT1A 1Z2NX 2VQ6A 2GESA 5LYJF 1KKUA 1WP4A 1NYTA 3AGQA 3LC2O 2WMDA 1DV1A 3EUWA 3EY4A 3JQ9C 3K6SA 3KQTA 1P4SA 3NC1C 3MS7A 2BFFB 2QRGA 2Y92A 4TTSA 1J33A 4IR7A 1PW5A 3FR8A 3D3WA 2P0EA 2EKDA 4M0UA 4BNXA 3G9ZA 2W6ZA 2EL9A 3HE3A 2BFCB 5A3SA 3GJZA 4RS3A 2JLAA 1OVGA 3HDQA 3JAWB 3WSVA 3BF7A 1GPDG 3BD8A 3NWOA 1NTOA 4HB0A 3TEMA 4Q4CA 3G1UA 1ESZA 3TQQA 4E70A 1SUSA 3K09A 5CFQA 4YQEA 121PA 3CQ9A 2UZIR 4C0XA 3U4QA 1HI9A 1WY7A 4U3JB 5CDSA 4EKIA 1WDWB 5F7JA 2H0QA 3TZQA 2C2WA 3A4MA 3P0FA 3E1GA 1LS6A 4J9UE 4LE0A 2XUJA 1ZAKA 3A25A 2PX5A 3FRIA 4MTLA 3WNZA 3BRQA 4IF4A 3LBNA 1ZL0A 2PGNA 1ARZA 3FA2A 1PZEA 4MROA 2FX5A 1L4EA 1T29A 1IAQA 3RWBA 5EJ6A 1UJ6A 4UJ5A 1ES9A 3MPUA 3QXXA 4MICA 3GA0A 1FU7A 3B9PA 1KC3A 2DVMA 4PZ0A 2QMHA 3LE8A 3U17A 1OH8A 1MHTA 2W0SA 2I22A 1OJ7A 2Y6VA 3LF1A 4X20B 5FNVF 4UTVA 2AOTB 2FXVA 3D3JA 4G0OA 1CZKA 2TYSB 3NHUA 5JH7A 1NVAA 1DG9A 4WKNA 3RS9A 3TNDA 3THRA 4B3CA 1VKZA 5D5QA 4EJ6A 1CZUA 3MGCA 4Y2SA 2IOFA 4KXUA 3RWMB 3AY6A 1NHGA 1NYLA 3UW3A 3UJ9A 2QX7A 2ZS9A 3IUBA 4EH1A 3BE4A 3ZY3A 4KH1A 2H4XA 3TZKA 5EJ9A 3FMIA 3RUAA 2VAVA 2OLKA 3O90A 4QD3A 2JAHA 4ZYUA 5KYGA 5J2TB 3ND6A 3IQZA 3OCJA 2G70A 1RDFA 2OFOA 2RC5A 3AOEC 3C6MA 4KAFA 2IVZA 1M6YA 2FDRA 2W71A 1QGOA 3H2BA 1KJWA 4PCUA 3KSRA 4FMBB 1KGDA 1M2EA 3UPDA 2X0JA 2B8EA 3CWCA 4L8GA 3LGSA 4JHXA 3ICPA 1E2LA 2FZGA 3DWFA 3DV0B 3WIUA 2H1CA 2BP7B 5TJHA 3O8CA 1UEXC 1PJQA 4D96A 2K2QB 2JIZA 5LLSA 3KU4A 1XA0A 4G0MA 3LXMA 3M8KA 4JI7B 4K0RA 4W5RA 5A9SA 3TQSA 3OF2A 1A88A 5CX1B 2RHGB 2E1PA 3A9UA 2PUGA 3BXGA 4PZCA 3PWTA 3AVYA 2C88A 4DC9A 3L46A 5DEOA 5CCDA 3FFAA 2DTDA 1OVMA 3CONA 2PX0A 1E6UA 4IBOA 1BYIA 4ZU6X 3O5AA 1PEYA 3KFXA 1E3EA 3MRTA 4HOYA 3R23A 3PQ7A 3UH0A 1H85A 3C5EA 5CYPA 5HMMA 2IS6A 3VHLB 3W7AA 2D06A 1E9DA 4F3KA 4FSHA 2CF5A 3FYCA 4BKUA 3GR6A 3ZLTA 2O1XA 3DMDA 2D2EA 1ECLA 1K6EA 4UCQA 3ZWQA 5ADVA 1AXRA 1WBBA 3ZOZA 3TIGA 4ZC1A 1A9RA 1G5TA 1HV8A 1KOJA 2FPSA 2WUGA 1I13A 2A57A 1PR3A 1UP4A 5FTJA 2IYVA 1J8YF 1WXQA 2AGVA 5TRTA 4PO1A 3PEVA 4C0QC 3LKDA 3DMGA 1SHUX 1ZZGA 3K0AA 4L0QA 1PEDA 3O4IA 3KT6A 5I9TA 1TAUA 1JDTA 2VNAA 2XD9A 5ENDA 3BE6A 1CIVA 2QNBA 1L1FA 4M98A 4EVRA 5KPDA 1KO5A 3A2LA 4DA6A 4GP9A 2CFTA 2A5GA 4FDAA 1ECGA 1NVBA 1RRPA 4RH0A 2SCUA 3GRRA 3LX6A 4V0NA 5A6VA 1J23A 4JB2A 1NVMB 2QVYX 4WDQA 1CETA 1KZGB 5CVCA 4ZQCB 3P4UA 3SBXA 4LRSB 3I04A 4CI0B 1GTJ1 1L4LA 3GMIA 2I4TA 2NP6A 2QD4A 5FUYA 3R8CA 1IC6A 3JAMA 1Q21A 2WFZA 1NM5A 1MW8X 3S28A 1U0RA 1KYTA 2R1TA 3SHFA 4FWBA 2EVWX 2PMBA 4W99A 2Q9BA 5T64A 3TPFA 4OHPA 4E4YA 1DWUA 1THGA 3DKPA 2EX1A 5BOVA 4CG3A 3T5BA 5AVYA 2DMRA 4ZAFA 3RFCA 2GM3A 2OWEA 1E1RA 4K05A 1A77A 1SGWA 2Z6VA 2AJLI 5G0TA 4GNRA 3OC0A 2CMDA 4BNMA 2QM0A 4MPJA 4P98A 2ZXEA 1RVDA 2B4TO 2IWRA 2XEDA 2Z5VA 4RVHA 2BISA 1YOVA 1MZPA 1PJTA 3V00A 4UNNA 2F8MA 2FEKA 2HZ7A 5KTOA 1CEQA 2QD1A 4R51A 4BNLA 3LQQA 2OR3A 1NLFA 5AW6A 3OWOA 5LOVB 4JV5B 3DOJA 2WPDD 4X60A 1P1BA 2QF7A 4P4SB 2X13A 5FL7A 3M4JA 4G2TA 1A8UA 1TC2A 3BM5A 3QKRB 3NPMA 1RCUA 3H0CA 1UKCA 4KO8A 2IYNA 4E5PA 2H1VA 5AVTA 4Y1FA 2JZOA 3ZVNA 2HFKA 1BOFA 2JD0A 4DJAA 3CWZA 2CLIB 3C2QA 3D5EA 3WIDA 1JDZA 1DARA 3ELDA 1MO4A 3OZFA 1UJ4A 1WKVA 3A8TA 4UM5A 2NUTB 4V39A 4X41A 1HG1A 4ZCLA 5LQNA 2VZ0A 3DVLA 2YZ2A 1E6CA 4IXNA 5I8PA 3A36A 1WUJS 3ABIA 4HEQA 2AXQA 1HUQA 4DJEC 4UE2A 2QP9X 5E4JA 1V37A 3KZVA 3V8EA 2XCIA 4UPEA 3RARA 3PC8C 4RSGA 1JKXA 4BWGA 3NM6B 4NBSA 2D1FA 3CR7A 3ND7A 2AI2A 5L3QA 4I4TF 1P72A 2NSDA 3O9MA 1CQIA 1Z88A 1HL3A 3UWPA 1IMJA 4ZRNA 3IQDB 2YOHA 3NC4A 3ZJ5A 4MW7A 4IEFB 1XU9A 4L16A 3H8WA 4YT8A 2XZTA 3HXKA 1RI1A 1EIZA 2D1QA 3GLFA 2YHIA 1H2XA 1JG7A 3B36A 3K9GA 5BSHA 1AQUA 3I73A 1GNVA 3IOBA 2C3MA 2VHZA 4II2A 6REQB 4GI1A 1AZSC 4F1JA 2COEA 2Z04A 2ZRQA 4O4HF 4AIIA 2UYCA 1PG0A 2OQVA 1XROA 1XTBA 2G07A 3IEVA 1NN0A 3K32A 4EW3A 5BQXA 1QV9A 2Q2NA 3AX6A 2ZTHA 2VYND 3P2YA 5TMDA 3FLAA 5EIAA 1DC6A 4DUZB 3CX3A 3T1VA 3CPHA 1OZ0A 2FZCA 4OBEA 1NNEA 1JQ5A 4JIGA 3GIDA 5DDIP 1X1CA 1SOUA 4F46A 1IZ0A 2CVQA 4FFBA 1BJRE 5D3MB 1X8JA 3A6ZA 3KJIA 3WNCA 2XTZA 2MSEB 3LY8A 1RWKA 1K27A 3V97A 3A31A 3JALA 4LC9A 4ZYZA 2O8EA 4W9RA 4GM0A 3TE7A 4GKJB 4N5DA 4GMKA 2VSQA 1Z16A 3DNMA 1COZA 1SKYE 5IN4A 1FTQA 4XR4A 2WSBA 4JSRA 5FOUA 2JFXA 1Q95A 3NETA 3ONNA 3QVSA 1O8BA 2KQUA 5JCPA 4NZYA 4MV1A 3VKGA 2WV9A 4DR4B 3CRVA 1DDIA 4NARA 4DV0B 1FRFS 3AUJB 3QX9A 1K8QA 1JX6A 1EFVA 2J9XB 4E13A 1QMGA 2PPLA 4A6EA 3QTLA 1JE1A 3AFGA 4F9EA 4FFWA 2PG3A 2SKDA 1JI0A 3O6VA 3N74A 3WB2A 1H4VB 4UC0A 5JCJD 1SXPA 2LKCA 3GHHA 1EE9A 1OBOA 1G21B 1OYOA 1W4AA 2ZJ4A 4GR9A 1P4AA 3OZTA 4OKNA 1TQHA 4P3YA 4PBTA 1YASA 3IEXA 4GLOA 3WGUA 3MCWA 3FSEA 2YR0A 5FPHA 5BYAA 3L4SO 4O4JF 4DKJA 3QENA 3HGTA 3U0VA 2NO1A 3B3GA 4YV2A 1CNFA 1D2MA 1MG5A 4FDLA 2GA9A 3FDZA 3V32A 2F4VB 1RAHA 4QUDA 5KBYA 4HSGA 2IK8A 5J3JA 1RM0A 3BTUA 3R6TA 4GZMA 5AXAA 4YAKA 2WZDA 3V8MA 3WJAA 3LI2A 5I7AA 2WZCA 3H97A 2AFIA 1GZ7A 4JYAB 2GZ1A 1IL0A 3CSUA 1K7FB 1Z4LA 1KVQA 1J70A 1VPTA 3GAMA 2O07A 4HTAA 4AF6A 2OMEA 2G7MC 3HZHA 1UWKA 4DBVO 4ER5A 3PFKA 5CDHA 1VL5A 1ZGZA 2D5LA 2PWZA 1XGKA 3TXAA 4R5MA 1LU9A 1U7OA 4ZANA 2TMDA 2QJWA 4UUBA 1XDZA 5AMXA 4DC0A 4PYRA 5E3HA 1PL6A 1Q12A 1KQ3A 2ZUUA 5FLEX 4PZAA 1PK7A 5FNZA 5F64A 1LA2A 4GZLA 4ZO7A 1NJGA 2WABA 3P26A 3FGPA 3BT7A 2BI8A 3F74A 3CUKA 3VJRA 1E62A 1JR4A 1XZLA 1SBNE 2AOUB 3P9QA 5D2CA 3USCS 1BKDR 3PDCA 3GVHA 2HU5A 3KE9A 5HHTA 3HP1A 4QVGA 5DXAA 4N5MA 3YASA 4KFSA 3B9RA 4YJ3B 3MB8A 3OQOA 2XX3A 4WZBE 1KY4A 4B3MB 1DPFA 2OHVA 4J90A 3ZWCA 1ZH0A 2Y77A 2CCJA 4P4LA 4KO2S 4MIEA 3CPEA 3L7CA 3CEJA 4TZ0A 1Q20A 4YCMA 5JNWA 3MBKA 3ANXA 3WWEA 5M3BA 2NMVA 1YR1A 2XKBA 2Q0SA 4GSYA 3MUFA 2WQ6A 3ZWMA 1KO8A 2J3KA 4IM7A 3ESZA 3RIEA 4JVMA 4CHGA 3W6NA 5LP6A 1H1LA 3SHTA 1GG5A 4JVOA 1TJNA 2YXLA 4PTZA 1IZ7A 2A1TR 1XRJA 3ZLVA 5JAUA 3TMAA 3U9LA 2HPHA 2JIQA 5HP4A 3RVNA 3HCOA 4DIOA 1RI4A 3WQQA 2XIJA 3W78A 4GQIA 1MJFA 2VQ3A 3TFQA 4DV2B 4UHCA 3R9KA 3GEEA 3KTAB 2ZIGA 4J2OA 3RSGA 4HEHA 3D3EA 4PPNA 1XDGA 3AW8A 2EW8A 4LE1A 4OHZA 3JQRA 1QAMA 5CB8A 1KA9H 1ZCFA 2YYYA 1NX6A 1QOPB 2UAGA 1ISHA 1PG2A 2XV1A 2CZGA 3QBVA 3I1YA 1R12A 5DNUA 1YBAA 1S1CA 3U1BA 1FY2A 1OX4A 1FFGA 4PZZA 1OAAA 3IT0A 3K0HA 2YY7A 5A5EA 4IYJA 5DOZA 1U0OC 5FTLA 1JMYA 1HF3A 2C3PA 3DHEA 3IT2A 4NCHA 3WB9A 3ANNA 3KKNA 1QHXA 4I4NA 4DDTA 5K3FB 1TIKA 4MYDA 3T99A 2GHTA 4Y2XA 1XWWA 3ZZUA 4DNQA 5J5CA 3BIWA 4FEAA 4AJOA 2AOUA 1JHVA 4QU8A 4ZQIA 4M1TA 2QWXA 4RTRA 2JBWA 3QVTA 1RJEA 1BCSA 2Y1XA 3LQ1A 1GT91 1PGOA 2LGJA 2X8JA 1VL8A 3WRXC 5DNYB 4OLBA 4MGEA 3KOWA 4NCIA 2I6XA 3WQBA 1S3IA 1T1SA 3EB9A 3O7WA 4KQ1A 4D5GA 4XE5A 2A9QA 4XIYA 1XXHA 4L02A 4GSKA 1AKNA 4MVJG 3DZHA 2BPOA 4DIBA 1EVYA 2CL6X 1EZZA 1HT1E 3X0DA 1M34B 1FDUA 4U9HS 1D2NA 1EDBA 2C78A 5CB0A 3L7MA 2OZPA 4PLTA 3DAFA 4BL5A 3OLXA 5EP2A 4BX2A 3FOZA 2PMDA 3K70C 1VPWA 1NATA 4GL4A 3H2YA 2X5JO 4YAWA 1TTTA 1GUAA 2O0JA 2W9XA 2CJWA 5ESRA 5CVJA 5KS2A 1OZHA 3ZXYA 5FEUA 4D6YA 1GN8A 1VXOA 2PVSA 1IG0A 1N9ZA 3BMOA 5ENZA 4YNBA 1JG2A 3NXSA 2FNAA 3RM3A 4C7KA 1NDQA 2ZJAA 4R1TA 4I50A 4ZZIA 4GKAA 3ZH2A 1QKKA 1ZWKA 3OCYA 4UNSA 1E2BA 4URVR 3UH1A 2D5CA 1MP0A 3L6DA 5DCUA 5DWDA 4COKA 2R47A 3OJXA 3EA4A 3GJSA 3R6DA 2CK3D 2AR0A 4IDDA 1D1QA 3NHJA 4IJ6A 5LD2C 4N3NA 2EXXA 1SZJG 3ICCA 1WCIA 3RSZA 3WRXA 4AFNA 3KQHA 3G0CA 1DAMA 3ORFA 1L7MA 2PLWA 4OLAA 2ZIVB 2Y2UA 1JI3A 3E3MA 4RKRA 3QG1A 4WDRA 1N7GA 5CEFA 3PSAA 4DGQA 4YMHA 5A3JA 1H1TA 1YB4A 3AJ8A 2FR1A 1ZOPA 1CXZA 5GGYA 4DMMA 3L7YA 1XLVA 1BA2A 3DF9A 2YQZA 2H8KA 3FYTA 2G9RA 5A7HA 3TD2A 1LKZA 3GLIA 3CFYA 5CA0A 3LS2A 1VCOA 4YS6A 3ST7A 4D99A 1E0DA 1X38A 4IX9A 1PJZA 3W77A 1E2NA 4WCFB 2RKBA 5JYDA 4TL8A 2V5AA 4F4IA 1FK8A 2JF0A 3T5CA 3HJRA 4CHTA 5KDOA 5D84A 3G0HA 1J00A 4PQRA 1Q1AA 1ONPA 1WMFA 3WE7A 4ZKDA 4KG7A 3TD6A 3FFXA 2H7VA 2ZTUA 2P3OA 2GLUA 2NIPA 2R4TA 3B7PA 1R5NA 1J49A 3JWGA 4I08A 3TLGB 4BRSA 1RACA 4WA8A 3ZDZB 1PNTA 4J1TC 3UK1A 2D62A 1DQYA 4OMCA 1AC5A 2WKSA 2HV9A 3II6X 3U3XA 1HNWB 1JXQA 1G3RA 4OGWA 2WUDA 1O6CA 4YMWA 3D8UA 1GAEO 1Y80A 2X2FA 2JLWA 3LHFA 3KYIB 3ORYA 4PCAA 4BLSA 1E0JA 1QVAA 1ZOLA 3AM5A 1T13A 2NACA 2FI1A 1L1QA 2ZTMA 3QEMB 4G2NA 5HF5A 4D56A 1IN8A 2Y93A 3E1KA 3FPSA 5CJ2A 5EKXA 3DLAA 3ASUA 5TQ0B 2PZLA 3WA6A 3MTBA 4CETA 4HNRA 1FE8A 4JS0A 1FDVA 5C18A 1VKOA 4KQMA 1N57A 1VJ1A 1USUA 2ZI5A 3VOBA 4O4LA 4TTIA 4CL3A 1W36C 2ZK7A 4OHBA 4R8KA 4EENA 1EFAA 1V7CA 4OCZA 3E9DA 4Q3OA 1KSGA 3IQEA 1BW9A 3PXEA 3ADPA 1QOQB 2P27A 2IYTA 3D8SA 3PE6A 4HH3C 3W2IA 1NY5A 2SCUB 3FHTA 1G2IA 1MB4A 1T6XA 3B3QA 5FAXA 3WGYA 2QUIA 4LXIA 1Z6XA 2IIBA 2JLRA 4NS4A 5BURA 3X1YA 2VPTA 2OK8A 2RAPA 4QXPA 1XTTA 4ZALA 1BH2A 8MHTA 3P8ZA 3ONDA 4GOJA 3NUGA 2ICAA 1XJ0A 1J5PA 2UVPB 5LQDA 3U19A 1Y3FE 4HWSA 3U5ZB 4JZYA 2CLMB 5HOQA 3G9TA 2EFDB 4KEAA 4MYCA 4WK0B 3ERCA 1IN7A 1EFVB 3MJHA 3WYEA 3CMMA 3TSWA 1FNCA 5FV4A 3INNA 4CQJA 4CXMA 3LPMA 4YP7A 2NVBA 1GQSA 4BFLA 1OLSA 2CXPA 4Z3OA 3EOBI 5DP1A 4QOFA 3QVWA 2YYZA 1MDBA 1V0JA 2CVPA 1C9KA 4M1WA 1SCJA 1DXHA 2O5RA 4Q37A 1DTSA 3RFTA 2YRXA 2OM6A 3R0IA 3IVXA 4C7MA 1ML3A 2VJMA 2C2HA 2GN6A 2Y1DA 4HJRA 4JYCA 1VCIA 1NVFA 3NEYA 4RXTA 4GPD1 3TNJA 3VOAA 2CFRA 4K8OA 2O48X 3WISA 1YB2A 1EBUA 2C57A 1M0EA 3TINA 2V6BA 3CLVA 3W2EA 1K66A 2JPDA 1BS9A 1U3FA 3I6BA 1RPAA 2L69A 1KXZA 1ABEA 3A3OA 3DZCA 3O3OB 4OGLA 3A4YA 4J9VA 4BBJA 2FAXA 2UVPA 3A04A 1ADYA 4BAGA 5LLTA 2AUTA 3KR1A 3RADC 1Y4AE 3NGLA 1K5HA 4B2YA 1FUUA 3OTQA 5DF1A 4C7VA 1YACA 3M6IA 4E32A 1PR0A 1LF0A 4J0EA 3AP3A 2ALJA 5JEDA 3VZDA 4L28A 1E0KA 2IXEA 4J43A 4TOIA 1G4HA 1XD8A 5CK4A 1NDUA 3AIIA 3Q0TA 3K2IA 3KSZO 3O47A 4L8VA 1FFEA 2GSDA 2GVDC 4TTVA 5EZ6B 1GZ3A 2Z8XA 3K9HA 3EZFA 2HWXA 4QOSA 1ZHOA 4K6FA 4RV9A 2GF9A 1CX9B 2JGKA 4JC8A 1GZUA 2IUEA 4BBPA 3DLTA 5JZVA 4X8HA 3E7XA 1SZDA 4DCOA 3SKVA 1CBUA 3C6QA 3W8DA 5FT9A 4O2RA 3AEXA 4UPVA 2IXTA 5AKLA 3URKA 4YAUA 3RAEC 1KBOA 4ZQEA 1NUHA 2IP1A 3IBYA 2KM1A 5HKLA 4Y3UA 3T7KA 2GFHA 4FEEA 4G0VA 1ZJ5A 4XR9A 1OPXA 2AMFA 2OMKA 2RHDA 3HI4A 4JT8A 4EMTA 1GDDA 5BV2P 1BMFA 4FOSA 3OT4A 3GFQA 4QDJA 4NJEA 1NZFA 1YQWA 1SOVA 1AA9A 4BMNA 5KTSA 1JEYA 2AK2A 4K6HA 1R6UA 2DG2A 4NQZA 4IIJB 5CYFA 1U2ZA 4URYR 3LK7A 2I76A 9GPBA 1V5GA 3JD0A 4C05A 4M1EA 2BT4A 1Y9EA 2X58A 5A04A 3FLBA 2NT4A 2B83A 3PQ4A 4II7A 4OQQA 5ITZA 2ADOA 1TX4B 3MINA 5ALLA 5M5BA 5H80A 4DR5B 1EESA 4MRAA 4OFWA 4XJSA 4H18A 5C8DA 2FB9A 2I33A 3T12A 2C9BA 4U3JA 3QMMA 3GLFE 2O23A 1TZCA 1C1DA 2ZI6A 3KD3A 1L5WA 4FMDB 4K03A 4LRQA 1E32A 1B3BA 2I2XB 3PHCA 2J0QA 5CD1A 3Q5EA 1Z6PA 3OIVA 1DXOA 1XAHA 1UFVA 3P4XA 3QU5A 2G83A 4G5QA 5G4LA 2UUCB 5E8RA 3KALA 4L4SA 3OEYA 3A1UA 1IXZA 1SZCA 1DFIA 1G63A 3V7UA 2H52A 3KPWA 4LJ8A 3PLNA 3R24A 3K6SB 5BW8A 2P1ZA 3PQ5A 5IDYA 5K0LA 3UXYA 4ZCTA 4IGEA 3PI7A 2G9ZA 4LOKA 4IY1A 1VE3A 2GM9A 1FXUA 4NMMA 2I1VB 2F3UA 4LCEA 4OMUA 3PC3A 1WRBA 1I9GA 2AC2A 4MWOA 2WOOA 4PTYA 4NJEB 3TIXB 7MDHA 4ER7A 4I14A 4RIFA 5G1OA 4ZVRA 4C1NA 2O8NA 1GL9B 4YRKA 3WLSA 3DVQX 2XCSB 1R9MA 1U2DA 4QL3A 4YN3A 3JZDA 1M2FA 1E9RA 3K15A 3NATA 4RA9A 3CGWA 3L7NA 4K86A 3K5HA 1ICEA 1QGED 2ZJFA 1JKMA 3TO5A 4CTOA 3T4EA 2V5VA 3NBUA 1CR1A 3S5JA 3SP1A 3PWSA 4FCCA 1TK2A 4ZI7A 1ISJA 1XMSA 3WYDA 1YF3A 4EY5A 4JODA 2LXNA 3ESCA 4TTPA 3WBBA 3AINA 4YRIA 3OZCA 1UMKA 4LNUA 1FFSA 4KHZA 3UJPA 4ECEA 2XHZA 2DQ4A 3C8HA 2ENUA 3AEKA 3QIAA 4M9UA 1RSZA 1C3JA 3NC0C 1ZK2A 2PZBA 3MSCA 4WKPA 1VJGA 2VFAA 2ZIZA 4BNWA 1LJUA 2HDNB 2POCA 5IS2A 3EH2A 2WZQA 4BO3A 1EDEA 2P4SA 4R01A 1I3NA 4XOUA 4BMSA 3LDAA 1JBKA 4MV9A 3L05A 2H0RA 3MMZA 4GECA 4TSFA 3V9PA 4X1YB 3JQDA 5C1DA 4I55B 1NULA 2ETVA 2L82A 3KK0A 1N0WA 3KHUA 4AJ9A 3RJTA 5IC5A 4I5IA 2QTFA 4UOEA 2BBTA 3OCXA 1J1IA 3CLRD 3A4NA 3EW7A 5I9NA 3EGWA 3NIFB 1GUDA 5DTIA 4HYEA 4U39A 5CT5A 4EPWA 1E2DA 1U7XA 4ENRA 1SXHA 1RPZA 1NDHA 4TKMA 1RHKA 4J7UA 4XM2A 5KSPA 5HM8A 1EXVA 1A5AB 2C1ZA 1HT3A 1UPFA 2NZWA 3AIKA 4PNPA 3TPCA 2VL7A 3ZXXA 2V3WA 3BAZA 5C5DA 2F55A 3UY4A 1HEIA 3AL0C 2H4WA 5FWXA 5EE1A 5KNCH 2CNWA 5TVKA 1V8DA 2BL4A 2ZREA 2ZSDA 3PR3A 4R2MA 4B8YA 5C7IO 4BVLA 3VU1A 2XH8A 3U09A 2PHZA 2G4VA 5BR8B 2UYOA 4NU0A 2ZVDA 4LOLA 2OXTA 2P9HA 4CR7A 1D8TA 3M2PA 1DRWA 5MHTA 2VCEA 4YFYA 1XRLA 2C31A 4Q66C 4BO4A 1DX6A 3L93A 1TAQA 2EBWA 4WOBA 2SHKA 3AOEA 2J0EA 3BL5A 3RVMA 4LQ4A 4EMBA 1YZTA 4YAJA 5IK2D 2DQZA 1EAYA 1R6DA 1CKEA 1KFJB 1YR2A 2HLDD 1VLVA 3BWXA 3HVRA 4U1RA 1SKBA 2DPLA 1GSAA 3L7DA 1NMYA 1XD2B 3C3AA 2O0HA 3KYCA 4KMSA 4D02A 1E4OA 1RTTA 4FDMA 1I0IA 5IVHA 1N3IA 1PVDA 1C30B 4KIWA 4OTZA 5JMPA 5LZ9A 2P9EA 3KXKA 3KC2A 1BQ4A 4Z0HO 1G5QA 2PVPA 1G5PA 4DPLA 4XVUA 2XMSA 4Q4LA 1W94A 4BE7B 5JZ9A 3W5BA 1XP5A 3KSAC 1ZU5A 2AQIA 3KR0A 4TTAA 1BOOA 3ZY4A 1C0LA 4ENVA 5LA6A 1EJ0A 1RP1A 2JLXA 2D6FA 4QUEA 4Q1BA 3T1QA 3BL6A 3FJOA 4LECA 4YHHB 4Z9AA 1TQ4A 3N3AC 3BJMA 5KMGA 4HEJA 1U1EA 3DHVA 4DR7B 2WWFA 4Q7LA 4X1KB 2VJLA 3EPRA 2W6QA 4YXFA 1JPUA 2V7BA 3DZIA 4JENA 1PE0A 4JU8A 4DC1A 4YCNA 3ZG6A 5IX8A 4JSYA 3OT5A 3MWDA 4O63O 1QSGA 4ILEA 3F71A 4F3RA 1KL7A 1M74A 1Z5VA 1Z5NA 1VBNA 3C1AA 3FZYA 3OCUA 3L8HA 5JS6A 4UBKA 2GBGA 2IZ1A 4I5FA 1NN1A 3SVTA 2FSVC 2VYCA 4Z1MD 2WM8A 3MGAA 1YQUA 5F7ZA 5IH7A 1F8FA 4WY5A 3V9AA 1PT6A 3ONEA 3THXB 1XF9A 4WNAA 4LIPD 1WZCA 1Q0RA 2C8KA 2IKSA 4FE4A 1XZAA 3A70A 2H5IA 5IBQA 5BNWA 5I45A 3ZIUA 5A62A 4UTZA 2UXDB 2HA7A 3T0IA 4BNDB 5K45A 4HDQB 5CLHA 6ABPA 3GO4A 3V7FA 5IBCA 1XJWA 1JUDA 1VJTA 1TDJA 2NV6A 1T91A 2ZJ5A 4NICA 1TMYA 1A9SA 3SQNA 2WR8A 1M2VA 5A0VA 1JIQA 4QBKA 4N9QA 4LYDA 2RK6A 3AEUB 3LUAA 5H1YA 2JZCA 3WWYA 1E9VA 5AW7A 2ZSHA 1W7AA 2YHSA 1BD3A 4N7BA 2JCYA 1QO0D 2MSLA 4YI3A 3TSAA 1AZTA 1M6EX 4AZ0B 2X7XA 5ARDA 3WO1A 5K09A 2G72A 2H2WA 3WLFA 2XB6A 3GWZA 1G0NA 5LVAA 5AR1A 4Z3KA 5HRAA 4FK8A 2FKAA 3E22A 1BN7A 1LCIA 2CMHA 4WE3A 3VU9B 4RDHA 1DGQA 2J85A 5EJ8A 2NYUA 2FRDA 5H83A 4ARZB 4QTTB 3VVCA 1XDWA 4F5WA 4D57A 4EJSC 1B15A 2QJRA 4YRCA 2B4RO 3AHCA 5MN4A 3TF5A 3DNFA 3O4VA 1IHYA 4FN5A 3H6HA 1ZO8A 2BTQA 3LUJA 2XYGA 4PSAA 4ZICA 3W8NA 1PKEA 4MLDA 2I87A 3QIVA 4COOA 1VKHA 3F5DA 2ZYTX 1WHTB 3KSBC 3VPDA 5MGNA 4JT4A 4PO9A 4OHYA 4E4RA 1KQGA 4BB6A 5FUWA 4B47A 3EF1A 4OU4A 3D2LA 4WCVA 3VISA 1U2SA 3WRYA 3NH9A 4ZVKA 4BX3A 1CZHA 4M22A 1NVDA 3B48A 1JAHA 5ALJA 5BXQC 3AHGA 4N03A 3FTCA 3O38A 5JRJA 1AMNA 1TA0A 1OFHA 2XTAA 4OP3A 2BTQB 3AP1A 3Q4GA 1TTHA 4ER6A 3CRNA 4F5ZA 5DYYA 2HK7A 3DZ8A 1CCWA 1EVLA 1M1YB 1XZMA 3A6HA 4O29A 5AFSA 3S2UA 1SG0A 5HJEA 4RK1A 3DL4A 3FCSB 4GMFA 1Z0UA 4AWAA 1XTSA 5DTMA 3TR6A 2H0AA 2Q3DA 2YIJA 3E5RA 2O14A 4GG1A 4UM9D 3F6RA 3NWEA 3SG0A 4BQOA 3THWA 1KAEA 2R11A 1IEVA 5PGMA 1YBHA 2QMEA 2AD1A 1JF8A 3HDGA 4MZDA 3SYMA 2GEVA 3AY0A 5HSGA 2VK1A 4RV5A 1MQAA 3G2LA 1L9KA 1WUYA 5G40A 4BBZA 4DIUA 1YS4A 4CMHA 5HZGA 1UP6A 4RKYA 4WZ6A 2KB0A 3D7RA 1BCRB 2R00A 1Z17A 2QGZA 2ENWA 3OBIA 4LG1A 5T8KA 5B30A 1GPUA 3KL2A 3RC9A 4QAJA 3GDFA 3QUTA 4NJMB 3FPAA 3PGXA 1DC5A 1R27A 4DAEA 1TO6A 4D80A 5LQJA 1Y1TA 2B8TA 4K9PA 5LR6A 4Z86A 1O4VA 3ENWA 4N12A 5JNTA 1D2HA 1YRYE 2WP8J 2XQJA 3DBRB 1U3VA 2WT4A 4H4CA 5D1NA 1TZKA 2FDXA 3KCQA 1GPLA 1G8HA 1EVZA 4PYNA 4QBIA 5I7UA 2V0GA 2IOHA 4BPBA 5CTAA 1MU0A 1KJYA 4PAQA 3DO8A 2V8OA 2AK3A 1RHJA 2I4OA 2IHYA 4YRRA 3T0GA 5C8YF 5HTOA 2J5XA 5AOVA 2DWOA 3KAPA 1VSBA 5E0KB 3PHHA 4V0SA 3COJA 4GX1A 4ECAA 3EIUA 1U2TA 5CNIA 1BH6A 1U9IC 2WAOA 4CQLB 1W2WB 1A71A 1DIGA 1KDPA 1MOZA 1ONSA 1S1MA 1CQWA 4WN9A 5A2GA 2DUUA 3F8SA 4K87A 4FLFA 1PJBA 3CU5A 4MQFB 3C3MA 5KJFA 4P84A 3ZXUB 4RHYA 2ZAGA 1V4VA 3KKLA 1DAEA 2OXIA 3LMKA 4LRUA 1IRIA 4GVPA 3BA6A 4X91A 4JUIA 3TH5A 2O8VA 1RI3A 4UFNA 2HMWA 2B4KA 2LUOA 2WM9B 3TG2A 4PG7A 1XXHE 1PV2A 1Z3IX 3H8JA 4EHBA 5A02A 1RWXA 2IX3A 2FFAA 4KMRA 2CXTA 3T3EA 5ITVA 2W6PA 2VN8A 1PT8A 4Q4AA 3QLUC 5LN1A 1JR3A 3E03A 4IDHA 3B2QA 4U7HA 5EXXA 1X7YB 2EFGA 4F8YA 3HFRA 3DKIA 1M76A 2NYVA 2Q5IA 4UVGA 3H7IA 4QEZA 4DR1B 3P20A 2BMWA 4BDTA 3WO0A 1N8TA 1A7UA 3AR5A 3EG9A 2ILVA 4HXGA 4M2LA 5DW3A 1L5ZA 1TEXA 4BMZA 4BCDA 3HZOA 4DCSA 4EATA 4EPXA 4YUWA 1RAEA 4K9MA 5IXJA 3EHEA 1R3UA 1NRIA 2HJVA 1XZCA 5JE8A 3OETA 3RR2A 1E7WA 5BMOA 2WFLA 1PTJC 3AUSA 3IQFA 2R86A 1X2BA 4KLAA 1TM3E 4QBGB 3S40A 1E1DA 1GTG1 3UVEA 2DBQA 1EUDB 2QRJA 2IEGA 4LYFA 4OJQA 4HRYA 4BFSA 4QWWA 1FOEB 3H0KA 4B44A 1EK5A 5FBWB 1R4NA 2ZLBA 3SQDA 1EFLA 4EI9A 1HR0B 4Q9HA 3ZWVA 2GETA 3DJFA 3G7UA 4HTFB 5A4JA 3WGNA 2VRNA 3KEOA 5GIPE 1BFUA 2F9LA 4HQ6A 3AF3A 2A0WA 3OE7A 5D87A 3SC2A 1PFWA 2VUHB 3NHWA 1Q0PA 2A5DA 1T35A 2C9DA 2DX7A 2IIVA 2G63A 5C4IA 1F51E 1Y7PA 3UHFA 1GKIA 5A06A 4RMGA 1U9CA 4C5CA 4RANA 2A8YA 2ZBVA 1N8KA 1L5HB 4F56A 1IULA 1JKIA 2WTXA 1XTKA 2JCSA 4DEYA 3JWEA 1NP3A 4TN1A 1PZHA 3GLHE 4B4WA 1Y6GA 3C85A 3NAMA 2CT8A 1R7RA 4MYSA 1MFZA 1DLIA 2P6NA 2G17A 4CEJB 2W2TA 1TLLA 3H1FA 4LVUA 4PLHA 5JECA 1LV8A 3FOAA 3MTDA 1GRQA 4DIKA 3G0IA 4DNXA 1AGYA 5E9QA 1MPTA 4KR6A 4RHFA 3SIRA 5DNEA 5HPYB 4J4HA 1AGRA 3RUHA 4IL5A 1VG9B 1P33A 1SBIA 3I9KA 3QA3E 4CT0A 2W8BA 3DG9A 2CV2A 4IMIB 4DSZA 4UEOA 1AN0A 1EP2B 1GJRA 2AN4A 2NM0A 4Y9RA 4YMLA 5JLJA 1FYXA 3V4ZA 1XWIA 4RY9A 3OZIA 1KIAA 3CSSA 2OBMA 3VKUA 3DH0A 4EHHA 4I4CA 2QR2A 2V4MA 3DO6A 4DSNA 1G1AA 5BVGA 1Z9BA 4B3HA 2JBHA 5JXGA 3NEJA 4KQ9A 3DE6X 4IVNA 3IIJA 2OCDA 3FUVA 5J5VA 2PZAA 2KX7A 3SKYA 2FG7C 3SZRA 5K8VA 3D54D 1U8AA 2YS6A 1CP3A 1XRNA 1A7JA 4JOQA 5KNCA 1NONA 4HAIA 3BXXA 1N3LA 3PEEA 5LJLA 2ZUTA 4AJ1A 4DWOA 2VYFA 2YHIB 3W5AA 1DCTA 1FQOA 1H6DA 2H4FA 5H70A 5DISB 3TVYA 1JW9B 4DEXA 5C8VA 2ISSD 5ARCA 2FOXA 3AGPA 3N6XA 5FR2A 4JLPA 3H87A 1MAWA 4WOPA 5DYGA 1QIEA 4GX5A 2YHUA 3R6WA 1E3WA 2XOKD 1AUXA 3FDZB 1H69A 1OKKA 3U4CA 2QPAA 3ESYA 4IJVA 1SC4A 5EWLB 1OV4A 3WRYC 2DOKA 1P91A 2DHRA 2YBDA 4L2IB 3QU2A 4OH7A 4B3FX 4BWFB 1CVRA 1YKGA 3C3EA 5EJ7A 4HYTA 1QQ5A 4Q9LA 1ZAYA 2Z3VA 2QLTA 4XWAA 4HL6A 1DTEA 4ARVA 1JIVA 4JI2B 3T54A 4OYLA 3ESRA 2QGNA 1OFUX 2B7LA 2UVQA 4QTXA 4BE4A 4DIFA 4KUEA 2NUTA 2CSUA 5AQ1A 2QI9F 3BRWA 3DKVA 1M2OA 3FWZA 1KK3A 3Q3GE 5IVDA 1X9GA 2CXUA 1N7HA 1NRWA 3FROA 4D82A 4FFNA 1PSWA 3J7AC 5ADHA 1E5QA 3K6JA 4CG0A 3ZI0A 3B70A 1GCUA 3I2JA 1P75A 3MWLA 2CVOA 1E9SA 2ODPA 2FPUA 1FLNA 4D43A 3IT3A 2X0KA 2PN1A 4S04A 3P94A 3NMUF 1TAHA 1XR3A 1P8AA 1Z4PX 1JHYA 2SICE 2Y1WA 5ER6A 1UADA 4L76A 5CRIA 3OF3A 5H5JA 5FDFA 4G01B 4DRZA 1YOVB 2AMYA 1SN7A 1TZJA 1VA4A 2SKCA 4ITUA 4WXMA 3U44A 1TECE 4O4IA 1HG0A 1I1QB 1NQTA 2O7RA 3D43A 1UCFA 2HMAA 4L6CA 4DZTA 4YP0A 3CNHA 4EI7A 1S01A 1ECBA 5ALWA 4BVGA 2MJLA 2QX9A 3NVDA 1WHTA 5COBA 5DSTA 1VFNA 3DOUA 1GFWA 1HYEA 1CHDA 2PV0A 3PRHA 3ZE6A 5BNFA 2HTEA 4CQNA 1KVRA 1TM7E 2HDOA 1NBHA 1SM4A 1V3VA 4Y6GB 4ZPJA 2RJNA 3MHPA 4A8JC 3V80A 1N34B 2BBOA 2Y0BA 1U6KA 1CW2B 2J9GA 2IW1A 4NMLA 2FQ1A 3NYIA 3ZDFA 5A4AA 4PQYA 2A9JA 3ZJYA 3V7NA 2Q0XA 3DEYX 2HRRA 4CF3A 1CUVA 4NL4H 3FGOA 2XE7A 2FFRA 5LZ2A 4EHAA 1G5RA 2QJTA 3CA8A 1RPTA 4IZOA 3RVQA 3IXQA 2OO3A 4BLRA 1IHPA 1F3OA 1QYIA 2QW1A 3QUQA 1HQDA 1DDGA 1PBNA 3KLBA 4Y6QA 3V8PA 4AY3A 5F9HA 2A3NA 3QFTA 4DCMA 1QTQA 2V9CA 1I32A 2QA5A 3QU9A 1Z8HA 3G5TA 3STUA 4CKBB 5CW2A 3T1TA 1YL7A 4MI1A 2ET6A 1Z2EA 3KEQA 3VBCA 2WHPA 4CIYA 4U9IS 4DCCA 3QUBA 3EPLA 3IA2A 3WL6A 4XA8A 3ZLJA 4IGKA 1QF7A 2WE8A 4ROTA 2I67A 3KPYA 2JLQA 4NIMA 1O96A 2NNLD 1R6VA 2VG8A 4XQGA 2Q2QA 1TYEB 4QULA 5ALEA 3LX5A 4U0KA 3TKLA 3R8FA 5LQSA 1CHNA 1V71A 3LXUX 1KP2A 1REQB 2YV5A 3AUAA 3E61A 1QHIA 2J9YB 3RU2A 2FK8A 2C9MA 1G41A 2XGGA 3DONA 2X2PA 3P2IA 4JH0A 2AWOA 4Z4HA 2BSXA 4O4JB 3VKWA 5JFOA 3C8UA 4ARSA 4A92A 4JB0A 2VQEB 3HKCA 5IKXA 1QCYA 1L2TA 2BF7A 5ITZB 3THXA 5FPKA 4P5DA 1BFDA 2CHUA 4IDBA 3PQDA 4C5AA 3HRIA 4HQLA 4E7OA 3BK7A 3F67A 2QRMA 1I2DA 1XUOA 3V4LA 5F2NA 2I1QA 3RRXA 4C6HA 1KMNA 2CHEA 2QX8A 4W5HA 1X19A 1I10A 1VI2A 2REQB 4JBIA 5FWYB 5AI9A 1QRAA 3SXJA 4DWVA 3QNMA 3SXPA 3OQVA 3N75A 3BFKA 4FYPA 2YS7A 4Y9UA 2PNJA 3VR3D 4FOTA 3WAJA 2BLNA 1MOQA 2FR8C 2ZT7A 3IAFA 1DWQA 4POAA 1IWPB 3O31A 1PL0A 2DE0X 1ZVKA 1OB2A 2R751 1M10A 3IV6A 2E4ZA 3LYUA 1HDRA 4REQB 4ZJPA 3DE5X 1BS2A 2G1UA 2YZGA 1AVTA 1OA0A 4RCYA 5E1OA 3OAAD 2JFYA 3U7RA 1J0AA 1VMEA 5KAMA 1YJ5A 1UWCA 2LP4Y 3TWOA 1UWLA 2R6DA 1SO8A 4L07A 3FGNA 1KO1A 3CE6A 3LVQE 5HS6A 4BEVA 4K9LA 3ZKWA 2R79A 4PHFA 2OGSA 2QRVA 1RPNA 5GPBA 3GZJA 5FBZA 1VG0B 4BNJA 3ZTYA 4QNNA 2FEWB 3JPWA 4Z7OB 1UBLS 1C29B 1NW5A 1AX9A 4YP9A 4DR6B 1ITZA 3B2NA 3H75A 4R83A 3RVPA 1GNPA 2NW6A 3I5AA 4D0RA 3MWJA 2BW0A 2DWUA 3OZGA 1ODCA 1Q22A 5F51A 2Q45A 2G6BA 3H1BA 3W5DA 1PQWA 3DMRA 2J7KA 4E5NA 4M87A 1G55A 1NY6A 2HV8A 1YS7A 3OQHA 4GMGA 4DUYB 4YJFB 4E51A 1NG9A 1U9YA 3OJCA 3VQTA 5FA6A 1O58A 2GFQA 2O9JA 4CCYA 3LGXA 4LJ7A 3NIGB 3OA2A 3HKCB 3AI7A 4K9DA 1T8TA 3MCZA 3OIYA 3AUFA 5BN3B 3C6YA 1MORA 4ASUD 5JT1A 2Y6UA 4KHPB 1O54A 4WFKA 5CDYA 1UOOA 5AOAA 3IVRA 2QRLA 4NFYA 4IIYA 4H3HB 4NZMA 4OLFA 4X61A 4JYPA 3HY3A 3P97A 3ZU2A 4FGZA 1LPNA 2LE0A 5HGJA 3ANYB 2BEWB 2FA9A 2Q2WA 3RRZA 1ZK1A 2P1DA 2Q8NA 2QN6A 1QNFA 5HCUA 1FMFA 2WPDA 3AQ4A 5TF0A 1LD3A 1L7QA 2JFQA 4JJFA 3PJRA 1QO9A 2JK0A 2PSEA 4A6XA 3D7SA 2V03A 1NBME 1SBTA 3PC4A 2QHXA 2N75A 4ZGWA 1L5MA 4JR0A 2ZANA 4MQEB 5DGIA 5ARBA 1I2BA 5LM3A 4ZI2A 3WK6A 2R97A 1DTWB 1JEOA 1RWMA 4D9FA 3OLVA 5KQLA 4D5EA 2WWTA 1FYEA 4IV5A 4KRFA 4ZT7A 3OPQA 5HJ2A 2RHMA 4XUCA 2HK8A 4MB6A 2PJZA 3JX9A 4QTZA 3KD2A 4KNYA 3FFTA 1EKXA 4GOXA 5JROA 1C7ZA 3MILA 1B8VA 1KEWA 1YUMA 4A91A 1GL7A 5LP6B 2O2IA 3GEMA 5JNUA 1J7JA 3JQEA 4QPDA 5ESDA 2JIOA 1QE3A 1U9IA 2WWRA 2YIMA 4TT3D 3D4NA 3UIEA 4F45A 1X74A 3K0BA 5ILGA 1AB5A 1YKSA 4NABA 1NNSA 2ES4A 1NW9B 2WZBA 5C3UA 1G2PA 1P18A 2DU8A 1BXZA 5K6AC 3DBLA 1TM5E 4KSCA 4TRJA 1CDEA 1TM2A 3I37X 3A27A 2V98A 2IDJA 2VZEA 2JFOA 4UTXA 2ETXA 4US1R 3RVBA 4G1VA 4LJAA 3PFIA 2J4FA 3MFYA 2QTGA 1SU4A 1AIPA 2O2XA 2P9BA 2E4XA 1YQDA 2YIVX 4IHJF 4U5QA 4RULA 3FZGA 5G53C 4N54A 5FCDA 1R18A 5JSHA 1X8XA 3L8DA 4ZEWA 4LTDA 1GZ5A 4L9WA 3ZNQA 4KO1S 1U0NA 5CDGA 2HI0A 2P2DA 1NURA 4XVHA 5KI6A 4JI4B 3M2TA 1V45E 1MO2A 1P1CA 1YI0A 3ITKA 3LZCA 4L4ZA 4P2BA 4DM4A 5MDHA 2AKEA 4O4JA 5CG1A 4BLPA 3KOXA 3BUSA 5L8VA 3KYDA 1ZUWA 3F6CA 3O92A 1NW4A 1T3TA 2ECKA 3NNNA 4K46A 4R9VA 1LNZA 3UMMA 1PG5A 2HIGA