4L89A

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with covalently bound coa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l89A00
1YREA 4KVXA 3EXNA 1IB1E 3GY9A 3JUWA 5J8CA 4LX9A 5HMNA 1S7FA 3SXOA 5DWNA 4AG9A 3P2HA 2VZYA 4CAXA 1Q2CA 1OZPA 1J4JA 5I0CA 3R9GA 2Q04A 2QIRA 1YX0A 2GANA 5IX3A 2OZGA 3DSBA 4RI1A 1Y9WA 3DNSA 4R87A 2ZPAA 1GHEA 1K4JA 2P0WA 1RO5A 4JLYA 4U5YA 4KLVA 4IUSA 4ONUA 4F6AA 2QECA 2D4OA 3TOBA 2CNTA 3PGPA 3R95A 1IICA 4QC6A 1XEBA 3TO7A 2EUIA 2HV2A 2OH1A 2G3TA 4PK2A 2ZW5A 1CJWA 1I21A 2R7HA 3T9YA 2P6GA 4XNHB 4UWIA 4UWJA 4XNHC 3FYNA 3F0AA 1M44A 4DNCA 1L0CA 2OZUA 4JXRA 1TIQA 5FVJA 4II9A 5EBVA 1ON0A 4AVCA 2D4PA 3FIXA 3QAHA 1S60A 2GE3A 2OB0A 4PK3A 2R1IA 2PRBA 1NSLA 2PDOA 3W91A 4CS0B 2VI7A 4XPKA 3P2FA 1V0CA 1QSTA 3NE7A 4QUSA 1M4IA 5F49A 4M85A 4Y49B 4YRHA 4Y49C 5EC4A 3FB3A 2JDCA 2AJ6A 2Z0ZA 2ZXVA 5C82A 4UBRA 2ZW6A 1RXTA 5J8FA 1I1DA 4HNXB 4M3SA 1YK3A 2Z10A 2A4NA 4I49A 4OLLA 1VHSA 1N71A 2GIVA 4UA3A 3R96A 2Q44A 3TTHA 2JLMA 3S6GA 3TFYA 3RYOA 1MJAA 3V8IA 4JJXA 3K9UA 1UFHA 2R98A 4LUAA 1LRZA 4QBJA 4R3LA 3S6KA 4B5PB 2B4BA 1PUAA 4KLWA 4B5PA 4KOUA 3D2PA 4KVOE 4AVAA 4CRZB 1QSNA 2BL1A 1Q2DA 3EO4A 1YVKA 1YGHA 3EY5A 1U6MA 3VWEA 3W6XA 4H89A 2REFA 1Y9KA 3S6FA 1CM0A 4FD5A 1IYLA 2H5MA 1WK4A 2OU2A 2AE6A 4QVTA 2HUZA 4NF1A 2Q7BA 3G3SA 4MY0A 4U9YA 4NCZA 4RS2A 3E0KA 2VQYA 1P0HA 2VZZA 2I79A 2FT0A 3I9SA 2PSWA 3CXSA 3D8PA 4KOXA 4KOWA 2BEIA 1KUXA 2FIAA 3FBUA 2B4DB 4KOTA 1XIXA 2OZHA 4KUAA 1I12A 2B4DA 4HNYB 1MJ9A 4KVME 5DWMA 1YLEA 1Y7RA 3DR8A 4NSQA 5H84A 2X7BA 4E2AA 4ORFA 3BLNA 2G0BA 2PC1A 1R57A 2FIWA 5H86A 4XPLA 4CAVA 4AG7A 3TE4A 5F46A 5CNPA 2O28A 5IV0A 2Q4VA 4JWPA 5F47A 2J8MA 1NMTA 4L8AA 1KUVA 4KORA 1Z4RA 2ARHA 3QB8A 4YFJA 4R9MA 3VWDA 4KOSA 3W6SA 3B8GA 2ATRA 1QSMA 4KZTA 4MY3A 4CRYB 1Z9UA 3TOAA 5KTCA 2QMLA 3EFAA 3TO9A 5JQ4A 4HKFA 4J3GA 4OAEA 4EVYA 2VBQA 3D3SA 3R9EA 4PSWA 3TO6A 4JD6A 3JVNA 5F48A 2WPWA 3LODA 4MHDA 4CAWA 3TT2A 4PV6A 1FY7A 2HQYA 2G3AA 1BOBA 3CXQA 2IL4A 4R3KA 1M4GA 2F5IA 4NXYA 2FS5A 4KOVA 2KCWA 3DR6A 2B3VA 3ZZIA 4E8OA 3SXNA 3H4QA 3PZJA 2PR1A 5IB0A 3DDDA 2PQ8A 2JDDA 1YVOA 3MGDA 1YR0A 1S5KA 4L89A 1S7LA 4XPDB 1WWZA 3CXPA 4XPDC 3PP9A 3BJ7A 4MI4A 4OADA 4QB9A 5KTAA 2JEVA 3T90A 3GKRA 2J8RA 2B5GB 4BMHA 5JPHA 4PSXA 1Z4EA 4U9ZA 3TCVA 5HH1A 2B5GA 1XF8A 2NMTA 1M1DA 1SQHA 4K30A 1PU9A 4YGOA 2J8NA 4MBUA 2C27A 3F5BA 3I3GA 3F8KA 2FL4A 1KUYA 2REEA 1M4DA 2FXFA 2FCKA 4FD6A 2I00A 1Q2YA 4AB7A 2P6FA 2Q4YA 3FXTA 2R8VA 1NE9A 1IIDA 2RC4A 5ISVA 3WR7A 4X5KA 4B5OA 4KOYA 3G8WA 1S7NA 2BSWA 1B6BA 3SHPA 3IGRA 3S6HA 1KZFA 1VKCA 2ZW4A 4NEXA 1MJBA 3D2MA 4ZBGA 3N7ZA 2CY2A 2FE7A 2B3UA 1S3ZA 1XMTA 3FRMA 4IF5A 2P6EA 1QSRA 1S7KA 3BJ8A 2VEZA 2EVNA 5E96A 2VXKA 3EC4A 3UY5A 3OWCA 2ZW7A 4JXQA 2Y0MA 2CNMA 4H6UA 5GCNA 4E0AA 1P4NA 2WPXA 4MJ8A 1QSOA 3C26A 2Q0YA 3R1KA 4GS4A 3ZJ0A 5KTDA 1MK4A 2FSRA 4FD4A 3KKWA 3GYAA 4F0YA 3IWGA 4R57A 3LD2A 2DXQA 2Z11A 2K5TA 2CNSA 4FD7A 3R9FA 2PR8A 4KUBA 2BUEA 3FNCA 4HNWB 1B87A 1BO4A 5C88A 1XE4A 2B58A 4AVBA 1IYKA 4H6ZA
chains in the Genus database with same CATH superfamily
4B13A 1Q7LA 1YREA 2C6PA 4KVXA 3SJFA 3JRUA 3EXNA 3SI1A 4DUKA 4R7MA 2Z3OA 2YGWA 5LYDA 1IB1E 3NH5A 3GY9A 3JUWA 4MHYA 1YW4A 3A9LA 5J8CA 3KQXA 3PB7X 3FF3A 4LX9A 1CPSA 4NGRA 2CF4A 4DJLA 5HMNA 1VHOA 2CTCA 1S7FA 2AFZA 1F2PA 3S9MA 3SXOA 5HXDA 3CPXA 1CX8A 3FECA 5DWNA 4X2TA 1BAVA 4AG9A 3P2HA 2VZYA 2POKA 4CAXA 1Q2CA 1OZPA 4A32A 1J4JA 3D7FA 3GIUA 4CYQA 5I0CA 2BCOA 3CT9A 4MFZA 4IAVA 3IFEA 4PXCA 3R9GA 4CGMA 2Q04A 3CPAA 5HVGA 2QIRA 3PEIA 4UIAA 1YX0A 1BLLE 2GANA 4C2ZA 5IX3A 2OZGA 3DSBA 4RI1A 4UCPA 2PJBA 1NSAA 3KASA 2EO8A 1TKJA 1Y9WA 3DNSA 4MCSA 4R87A 1IOFA 5G20A 3GB0A 2ZPAA 1GHEA 5D8NA 1K4JA 3SI0A 4PPZA 2P0WA 5F09A 1RO5A 2ZEFA 4ZY2A 1BPNA 1LFWA 2NYQA 4HPSA 4JLYA 2YNCC 2PE3A 4A95A 4RUHA 2PRQA 3S9NA 4U5YA 1Y7EA 4KLVA 2YNCA 4JYWA 5LRGA 4IUSA 4ONUA 4M6IA 4MHPA 1ZLHA 1YLOA 3PB8X 3V7ZA 4F6AA 1HDQA 2QECA 2D4OA 3TOBA 4FUUA 2CNTA 4ZX9A 3WC7A 3PGPA 4F8ZA 3R95A 1IICA 4QC6A 1XEBA 2CTBA 3TO7A 4A94A 1ARLA 2EUIA 2HV2A 2O4HA 4PXDA 3FX6A 2ZOGA 2OH1A 2G3TA 4P6YA 4PK2A 2ZW5A 1Z2LA 2GLFA 1CJWA 3WT4A 1I21A 2R7HA 3T9YA 4JZ0A 4ZI6A 2AFXA 2P6GA 1BPMA 4P4JA 3IC1A 4OC0A 2Z3KA 4XNHB 2DF5A 4UWIA 4UWJA 1FT7A 4NGNA 4XNHC 3FYNA 4OKOA 3JTKA 3F0AA 1M44A 4DNCA 1L0CA 2PJ9A 3GUXA 1HEEA 2OZUA 1CPXA 4JXRA 1TIQA 5CPAA 5FVJA 4B11A 4II9A 4KSFA 4CPAA 3FEDA 2QYVA 5EBVA 1DTDA 3CZXA 1ON0A 4AVCA 3MRUA 2D4PA 5AG6A 3B3VA 2PJ0A 3FIXA 4WJBA 4R6TA 1AUGA 2ZEPA 1FNOA 3N5FA 3QAHA 1S60A 2GE3A 2OB0A 4OP4A 2R1IA 1M4LA 4PK3A 4FAIA 2PRBA 3LWUA 2PDOA 1NSLA 3W91A 4CS0B 2VI7A 4XPKA 3P2FA 1V0CA 2RB7A 4R76A 1QSTA 3NE7A 1YQEA 2C1CA 4QUSA 1M4IA 3BI1A 5F49A 1TXRA 2ANPA 3ISXA 4F0XA 4M85A 5K8NA 3D66A 1ZO0A 2WYRA 3HUVA 4Y49B 4YRHA 5I4MA 4Y49C 3NE8A 5EC4A 5G1ZA 2PJAA 3FB3A 3QAYA 2JDCA 3WC6A 2AJ6A 2Z0ZA 2ZXVA 3SJXA 5C82A 1ELLP 4MCRA 3VARA 4UBRA 5K8OA 4P4IA 2ZW6A 4H2KA 1RXTA 1CG2A 5J8FA 2AFUA 3H8FA 1I1DA 1GYTA 3GLJA 2YNEA 2EWBA 4HNXB 3PRTA 4B14A 3B3CA 5LYLA 4NGPA 2ZEGA 4M3SA 4P4BA 1YK3A 5AGEA 2Z10A 2A4NA 1YMEA 1ZG9A 4I49A 4OLLA 2ABZA 1VHSA 3KQZA 1N71A 1XMBA 3D67A 4CYOA 2GIVA 2QVPA 3WABA 2NSMA 2ZELA 4MCPA 4UA3A 3R96A 2Q44A 5DS0A 4A33A 3TTHA 2JLMA 3S6GA 1HDUA 3TFYA 4EFDA 3RYOA 1MJAA 3V8IA 2AFWA 4JJXA 1PYTB 3K9UA 1X10A 1UFHA 3IWEA 2R98A 1Z8LA 4LUAA 1LRZA 4QBJA 3D7HA 4R3LA 3S6KA 4B5PB 4C68A 1A2ZA 4TNUA 2B4BA 1PUAA 4R8FA 8CPAA 2RFHA 2PVVA 4KSIA 4KLWA 5K8PA 2CIJA 2ZOFA 4KOUA 4B5PA 3D2PA 1IOIA 1XFOA 4KVOE 4Q36A 4AVAA 4CRZB 4AVBA 1Z5RA 1QSNA 2Z3NA 3NFZA 2BL1A 4NJRA 1Q2DA 4ZX8A 5JGFA 1TKHA 1CP6A 3EO4A 3SJEA 2PJ8A 4IHMA 1YVKA 1YGHA 2O53A 4OC2A 3FJUA 4BINA 1XJOA 3EY5A 1U6MA 3BI0A 3VWEA 4KSAA 5JM6A 3NH4A 3W6XA 2AFMA 4H89A 3RO0A 4MFKA 2REFA 2Q4ZA 1Y9KA 2IJZA 2PJ2A 3S6FA 4GXHA 7CPAA 1CM0A 4FD5A 1IYLA 2ZENA 2H5MA 1WK4A 1JWQA 5K8MA 2HC9A 2OU2A 1YW6A 3FEEA 2AE6A 2Z3LA 4QVTA 2ZEOA 1LAMA 2HUZA 3K2KA 4NF1A 3SI2A 3KR5A 5A28A 2Q7BA 3G3SA 4MY0A 4U9YA 1VHEA 1PCAA 4NCZA 3E0KA 4RS2A 4A38A 2VQYA 1P0HA 2VZZA 1IGBA 2GU2A 4X3RA 2I79A 3SJGA 2FT0A 3I9SA 5HVHA 2VL1A 2PSWA 3CXSA 3D8PA 4KOXA 4TWEA 2PJ1A 4UCMA 4KOWA 3PFEA 1QMUA 3KHXA 4H6ZA 2BEIA 4C2YA 4Z65A 1KUXA 1TF8A 2FIAA 3FBUA 2B4DB 4KOTA 3D68A 4OC1A 2DPTA 2OOTA 3L2NA 3KGQA 1XIXA 2OZHA 4KUAA 1I12A 2B4DA 4OIWA 4HNYB 4CYNA 4EMEA 1MJ9A 2J9AA 1ARMA 2CXAA 3PB9X 1ELMP 4KVME 5DWMA 4B6ZA 1YLEA 1IU8A 1Y7RA 4FWUA 5LYIA 3DR8A 2Q43A 4NSQA 2X7BA 5H84A 3IU1A 4NGMA 4E2AA 4ORFA 4AXVA 3BLNA 1UWYA 2G0BA 1ZLIA 2PC1A 4OIDA 1R57A 2FIWA 1LOKA 5H86A 4XPLA 4CAVA 4AG7A 3TE4A 5F46A 5CNPA 2O28A 2ZEMA 5IB9A 1R3NA 2Q4VA 5IV0A 3B3WA 2ZEHA 4JWPA 1TF9A 2XEFA 3PBEA 5F47A 2J8MA 1ZG7A 1XOVA 4ONWA 4MHNA 4K3NA 1NMTA 4C7IA 2ODFA 1VGYA 2OR4A 4L8AA 4UF4A 1F57A 1KUVA 4KORA 5C88A 1VIXA 3IIBA 1Z4RA 2ARHA 3QB8A 4FBEA 4YFJA 4O23A 4MFJA 4R9MA 3VWDA 4OC4A 4KOSA 2F8HA 4BBHA 3W6SA 3B8GA 2ATRA 1QSMA 4UFWA 3S9LA 1Z8XA 2PJ4A 4KZTA 4Q38A 4UIBA 4CYPA 4MY3A 4CRYB 1Z9UA 2C6CA 2FVGA 3D7GA 3TOAA 5KTCA 2QMLA 4A39A 3B35A 3EFAA 2XEGA 5D29A 3TO9A 3ISZA 3PBBA 4UEFA 4HKFA 4A2ZA 5JQ4A 4J3GA 2WUUA 4OAEA 4EVYA 2PJ5A 2VBQA 3D3SA 1LANA 4NGQA 3R9EA 4PSWA 3TO6A 1AYEA 4JD6A 3JVNA 5F48A 2WPWA 3RNZA 3LODA 1F2OA 4A31A 3LMSA 1LCPA 2JEWA 4ZY0A 4MHDA 4CAWA 4LQGA 4X8IA 1X12A 3TT2A 3WC5A 4P45A 4PV6A 1FY7A 3RZAA 3IWWA 2HQYA 3RAMA 2G3AA 4MFPA 4EWTA 1TKFA 1BOBA 2Q7SA 3CXQA 2XEJA 2IL4A 5AG4A 4R3KA 2F5IA 4NXYA 3IU2A 2FS5A 2I3CA 4KOVA 4MFLA 3CDXA 4CAEA 1OBRA 2KCWA 2B3VA 2QJ8A 2V8VA 3DR6A 5EMIA 3ZZIA 4E8OA 4ZY1A 4UEZA 3SXNA 3H4QA 3PZJA 2PR1A 5IB0A 4WWVA 2BOAA 3DDDA 1RTQA 2PQ8A 2JDDA 5THWA 1YVOA 3KR4A 3MGDA 1YR0A 3D7DA 3BHXA 1S5KA 4L89A 4F9UA 2AFSA 4UCNA 2AFOA 1S7LA 4KS9A 4XPDB 5AG5A 1WWZA 4OC3A 3I1UA 3CXPA 4XPDC 4CGLA 3PP9A 5J1QA 4LQ6A 3BJ7A 4MI4A 4OADA 4QB9A 5HVFA 2JEVA 1Z8WA 3V38A 3T90A 5KTAA 5LYFA 3FVLA 5LRKA 4UFXA 3GKRA 4P4DA 2J8RA 2B5GB 4BMHA 6CPAA 5JPHA 2Z3PA 4PSXA 1Z4EA 2WSAA 2ZEDA 4BD9A 4U9ZA 2PIZA 4P10A 3TCVA 5HH1A 2B5GA 1XF8A 2Z3MA 2NMTA 1M1DA 1SQHA 5CBMA 5A27A 4K30A 1PU9A 2IMOA 4OC5A 2J8NA 4MBUA 4YGOA 2C27A 3F5BA 3I3GA 4A37A 3T8WA 3F8KA 5AG7A 2ZEEA 4W9YA 2FL4A 1KUYA 2REEA 4CGPA 1M4DA 2FXFA 4IK2A 5G22A 2FCKA 4FD6A 2GLJA 1R43A 2I00A 2IQ6A 5LRJA 1Q2YA 2Q51A 4NFRA 4AB7A 3DGVA 4B12A 4F9VA 2P6FA 2PIYA 2Q4YA 3FXTA 4C2XA 2R8VA 2DPSA 1NE9A 4P4EA 4YU9A 3TC8A 1IIDA 2EK9A 4C7HA 3DLJA 3HLPA 2RC4A 5ISVA 3WR7A 1YSJA 4X5KA 2YNDA 4B5OA 1H8LA 4UFVA 4ZGYB 4KOYA 3G8WA 4P4FA 1S7NA 2BSWA 4MRIA 3KHZA 2HB6A 1B6BA 3SHPA 1DE4C 3B3SA 2PVWA 3K9TA 3IGRA 4CGNA 4PQAA 5JH9A 1AMPA 3KL9A 2PJCA 1KZFA 3PB4X 1VKCA 4NJQA 3S6HA 3RBUA 1EE3P 4NGTA 4MMOA 3TX8A 3IEHA 2ZW4A 4CAFA 4NEXA 1MJBA 3D2MA 4ZBGA 2DEAA 3N7ZA 1XRYA 2CY2A 2FE7A 2B3UA 3PB6X 4MXUA 4A30A 4OMEA 1S3ZA 1XBUA 1XMTA 3FRMA 4IF5A 2BO9A 2P6EA 1QSRA 1S7KA 3BJ8A 2VEZA 2EVNA 4UEEA 3H5ZA 2VXKA 3B3TA 3EC4A 3PFOA 1KWMA 5E96A 3FH4A 3UY5A 1CBXA 3OWCA 2V8DA 2ZW7A 4JXQA 2PJ6A 1CP7A 3H8GA 3NH8A 3BXMA 1JQGA 3KI9A 4PXBA 2WZNA 2G9DA 3IJ3A 2Y0MA 4NGSA 2XEIA 2CNMA 2PCUA 4H6UA 4CGOA 5GCNA 3NA6A 1P4NA 1QQ9A 2V8HA 4G1PA 3QNVA 4E0AA 3FMCA 1Y0RA 2WPXA 3KZWA 2EBJA 4MJ8A 1QSOA 3C26A 4M6HA 2Q0YA 1Z8TA 4Q7AA 4PXEA 3MN8A 4MHZA 1ZG8A 3R1KA 2C6GA 4GS4A 5G21A 3ZJ0A 5KTDA 1MK4A 2FSRA 2V77A 4FD4A 4M6GA 3KKWA 2EK8A 5ELYA 3GYAA 4YWYA 4F0YA 4ZYQA 3IWGA 4R57A 3LD2A 3B7IA 3D4UA 2DXQA 2Z11A 4P44A 2K5TA 4RN7A 4B10A 2CNSA 5BWAB 4MCQA 4FD7A 3VATA 1IY7A 3R9FA 4GM5A 1Y0YA 2JBJA 2PR8A 3IO1A 2PJ3A 4KUBA 2BUEA 3FNCA 4HNWB 1B87A 3H8EA 3VH9A 2PJ7A 2JBKA 1BO4A 2GFQA 3LACA 4DYOA 1LAPA 2GREA 2V8GA 1XE4A 2B58A 2F7VA 3B2YA 1IYKA 4MFQA 1M4GA
chains in the Genus database with same CATH topology
4B13A 1YREA 4KVXA 3EXNA 2Z3OA 2YGWA 1IB1E 3GY9A 3JUWA 5J8CA 3A9LA 4LX9A 5HMNA 1S7FA 3SXOA 5DWNA 4AG9A 3P2HA 2VZYA 4CAXA 1Q2CA 1OZPA 4A32A 1J4JA 4CYQA 5I0CA 4MFZA 3R9GA 4CGMA 2Q04A 2QIRA 1YX0A 2GANA 4C2ZA 5IX3A 2OZGA 3DSBA 4RI1A 4UCPA 1Y9WA 3DNSA 4R87A 5G20A 2ZPAA 1GHEA 1K4JA 2P0WA 1RO5A 4JLYA 2YNCC 4A95A 4U5YA 4KLVA 2YNCA 4IUSA 4ONUA 4F6AA 2QECA 2D4OA 3TOBA 2CNTA 3PGPA 3R95A 1IICA 4QC6A 1XEBA 3TO7A 2EUIA 2HV2A 2OH1A 2G3TA 4PK2A 2ZW5A 1CJWA 1I21A 2R7HA 3T9YA 2P6GA 2Z3KA 4XNHB 4UWIA 4UWJA 4XNHC 3FYNA 3JTKA 3F0AA 1M44A 4DNCA 1L0CA 2OZUA 4JXRA 1TIQA 5FVJA 4B11A 4II9A 4KSFA 5EBVA 1ON0A 4AVCA 2D4PA 5AG6A 3FIXA 3QAHA 1S60A 2GE3A 2OB0A 4PK3A 2R1IA 2PRBA 1NSLA 2PDOA 3W91A 4CS0B 2VI7A 4XPKA 3P2FA 1V0CA 1QSTA 3NE7A 4QUSA 1M4IA 5F49A 4F0XA 4M85A 1ZO0A 4Y49B 4YRHA 4Y49C 5EC4A 5G1ZA 3FB3A 2JDCA 2AJ6A 2Z0ZA 2ZXVA 5C82A 4UBRA 2ZW6A 1RXTA 5J8FA 1I1DA 2YNEA 4HNXB 4B14A 4M3SA 1YK3A 5AGEA 2Z10A 2A4NA 4I49A 4OLLA 4CYOA 1VHSA 1N71A 2GIVA 4UA3A 3R96A 2Q44A 4A33A 3TTHA 2JLMA 3S6GA 3TFYA 3RYOA 1MJAA 3V8IA 4JJXA 3K9UA 1UFHA 3IWEA 2R98A 4LUAA 1LRZA 4QBJA 4R3LA 3S6KA 4B5PB 4C68A 2B4BA 1PUAA 4KLWA 4B5PA 4KOUA 3D2PA 4KVOE 4Q36A 4AVAA 4CRZB 1QSNA 2Z3NA 2BL1A 1Q2DA 3EO4A 1YVKA 1YGHA 3EY5A 1U6MA 3VWEA 4KSAA 3W6XA 4H89A 4MFKA 2REFA 1Y9KA 3S6FA 1CM0A 4FD5A 1IYLA 2H5MA 1WK4A 2OU2A 2AE6A 2Z3LA 4QVTA 2HUZA 4NF1A 5A28A 2Q7BA 3G3SA 4MY0A 4U9YA 4NCZA 4RS2A 3E0KA 2VQYA 1P0HA 2VZZA 2I79A 2FT0A 3I9SA 2PSWA 3CXSA 3D8PA 4KOXA 4UCMA 4KOWA 4C2YA 2BEIA 1KUXA 2FIAA 3FBUA 2B4DB 4KOTA 2DPTA 1XIXA 2OZHA 4KUAA 1I12A 2B4DA 4HNYB 4CYNA 1MJ9A 4KVME 2CXAA 5DWMA 1YLEA 1Y7RA 3DR8A 4NSQA 5H84A 2X7BA 3IU1A 4E2AA 4ORFA 3BLNA 2G0BA 2PC1A 1R57A 2FIWA 5H86A 4XPLA 4CAVA 4AG7A 3TE4A 5F46A 5CNPA 2O28A 5IV0A 2Q4VA 4JWPA 5F47A 2J8MA 1NMTA 4C7IA 4L8AA 1KUVA 4KORA 1Z4RA 2ARHA 3QB8A 4YFJA 4R9MA 4MFJA 3VWDA 4KOSA 4BBHA 3W6SA 3B8GA 2ATRA 1QSMA 4UFWA 4KZTA 4Q38A 4CYPA 4MY3A 4CRYB 1Z9UA 3TOAA 5KTCA 2QMLA 3EFAA 3TO9A 5JQ4A 4A2ZA 4HKFA 4J3GA 2WUUA 4OAEA 4EVYA 2VBQA 3D3SA 3R9EA 4PSWA 3TO6A 4JD6A 3JVNA 5F48A 2WPWA 3LODA 4A31A 4MHDA 4CAWA 3TT2A 4PV6A 1FY7A 2HQYA 2G3AA 4MFPA 1BOBA 3CXQA 2IL4A 5AG4A 4R3KA 1M4GA 2F5IA 4NXYA 3IU2A 2FS5A 4KOVA 4MFLA 4CAEA 2KCWA 3DR6A 2B3VA 3ZZIA 4E8OA 3SXNA 3H4QA 3PZJA 2PR1A 5IB0A 3DDDA 2PQ8A 2JDDA 1YVOA 3MGDA 1YR0A 1S5KA 4L89A 4UCNA 1S7LA 4KS9A 4XPDB 5AG5A 1WWZA 4CGLA 3CXPA 4XPDC 3PP9A 3BJ7A 4MI4A 4OADA 4QB9A 5KTAA 2JEVA 3T90A 4UFXA 3GKRA 2J8RA 2B5GB 4BMHA 5JPHA 2Z3PA 4PSXA 1Z4EA 2WSAA 4U9ZA 3TCVA 5HH1A 2B5GA 1XF8A 2Z3MA 2NMTA 1M1DA 1SQHA 5A27A 4K30A 1PU9A 4YGOA 2J8NA 4MBUA 2C27A 3F5BA 3I3GA 3F8KA 5AG7A 4CGPA 2FL4A 1KUYA 2REEA 1M4DA 2FXFA 5G22A 2FCKA 4FD6A 2I00A 1Q2YA 4AB7A 4B12A 2P6FA 2Q4YA 3FXTA 4C2XA 2R8VA 2DPSA 1NE9A 1IIDA 4C7HA 2RC4A 5ISVA 3WR7A 4X5KA 2YNDA 4B5OA 4UFVA 4ZGYB 4KOYA 3G8WA 1S7NA 2BSWA 1B6BA 3SHPA 3IGRA 4CGNA 3S6HA 1KZFA 1VKCA 2ZW4A 4CAFA 4NEXA 1MJBA 3D2MA 4ZBGA 3N7ZA 2CY2A 2FE7A 2B3UA 4A30A 1S3ZA 1XMTA 3FRMA 4IF5A 2P6EA 1QSRA 1S7KA 3BJ8A 2VEZA 2EVNA 5E96A 3H5ZA 2VXKA 3EC4A 3UY5A 3OWCA 2ZW7A 4JXQA 2Y0MA 2CNMA 4H6UA 4CGOA 5GCNA 4E0AA 1P4NA 2WPXA 4MJ8A 1QSOA 3C26A 2Q0YA 3R1KA 4GS4A 5G21A 3ZJ0A 5KTDA 1MK4A 2FSRA 4FD4A 3KKWA 3GYAA 4F0YA 3IWGA 4R57A 3LD2A 2DXQA 2Z11A 2K5TA 5BWAB 4B10A 2CNSA 4FD7A 3R9FA 2PR8A 4KUBA 2BUEA 3FNCA 4HNWB 1B87A 1BO4A 5C88A 1XE4A 2B58A 4AVBA 1IYKA 4MFQA 4H6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRE A;  4KVX A;  3EXN A;  1IB1 E;  3GY9 A;  3JUW A;  5J8C A;  4LX9 A;  5HMN A;  1S7F A;  3SXO A;  5DWN A;  4AG9 A;  3P2H A;  2VZY A;  4CAX A;  1Q2C A;  1OZP A;  1J4J A;  5I0C A;  3R9G A;  2Q04 A;  2QIR A;  1YX0 A;  2GAN A;  5IX3 A;  2OZG A;  3DSB A;  4RI1 A;  1Y9W A;  3DNS A;  4R87 A;  2ZPA A;  1GHE A;  1K4J A;  2P0W A;  1RO5 A;  4JLY A;  4U5Y A;  4KLV A;  4IUS A;  4ONU A;  4F6A A;  2QEC A;  2D4O A;  3TOB A;  2CNT A;  3PGP A;  3R95 A;  1IIC A;  4QC6 A;  1XEB A;  3TO7 A;  2EUI A;  2HV2 A;  2OH1 A;  2G3T A;  4PK2 A;  2ZW5 A;  1CJW A;  1I21 A;  2R7H A;  3T9Y A;  2P6G A;  4XNH B;  4UWI A;  4UWJ A;  4XNH C;  3FYN A;  3F0A A;  1M44 A;  4DNC A;  1L0C A;  2OZU A;  4JXR A;  1TIQ A;  5FVJ A;  4II9 A;  5EBV A;  1ON0 A;  4AVC A;  2D4P A;  3FIX A;  3QAH A;  1S60 A;  2GE3 A;  2OB0 A;  4PK3 A;  2R1I A;  2PRB A;  1NSL A;  2PDO A;  3W91 A;  4CS0 B;  2VI7 A;  4XPK A;  3P2F A;  1V0C A;  1QST A;  3NE7 A;  4QUS A;  1M4I A;  5F49 A;  4M85 A;  4Y49 B;  4YRH A;  4Y49 C;  5EC4 A;  3FB3 A;  2JDC A;  2AJ6 A;  2Z0Z A;  2ZXV A;  5C82 A;  4UBR A;  2ZW6 A;  1RXT A;  5J8F A;  1I1D A;  4HNX B;  4M3S A;  1YK3 A;  2Z10 A;  2A4N A;  4I49 A;  4OLL A;  1VHS A;  1N71 A;  2GIV A;  4UA3 A;  3R96 A;  2Q44 A;  3TTH A;  2JLM A;  3S6G A;  3TFY A;  3RYO A;  1MJA A;  3V8I A;  4JJX A;  3K9U A;  1UFH A;  2R98 A;  4LUA A;  1LRZ A;  4QBJ A;  4R3L A;  3S6K A;  4B5P B;  2B4B A;  1PUA A;  4KLW A;  4B5P A;  4KOU A;  3D2P A;  4KVO E;  4AVA A;  4CRZ B;  1QSN A;  2BL1 A;  1Q2D A;  3EO4 A;  1YVK A;  1YGH A;  3EY5 A;  1U6M A;  3VWE A;  3W6X A;  4H89 A;  2REF A;  1Y9K A;  3S6F A;  1CM0 A;  4FD5 A;  1IYL A;  2H5M A;  1WK4 A;  2OU2 A;  2AE6 A;  4QVT A;  2HUZ A;  4NF1 A;  2Q7B A;  3G3S A;  4MY0 A;  4U9Y A;  4NCZ A;  4RS2 A;  3E0K A;  2VQY A;  1P0H A;  2VZZ A;  2I79 A;  2FT0 A;  3I9S A;  2PSW A;  3CXS A;  3D8P A;  4KOX A;  4KOW A;  2BEI A;  1KUX A;  2FIA A;  3FBU A;  2B4D B;  4KOT A;  1XIX A;  2OZH A;  4KUA A;  1I12 A;  2B4D A;  4HNY B;  1MJ9 A;  4KVM E;  5DWM A;  1YLE A;  1Y7R A;  3DR8 A;  4NSQ A;  5H84 A;  2X7B A;  4E2A A;  4ORF A;  3BLN A;  2G0B A;  2PC1 A;  1R57 A;  2FIW A;  5H86 A;  4XPL A;  4CAV A;  4AG7 A;  3TE4 A;  5F46 A;  5CNP A;  2O28 A;  5IV0 A;  2Q4V A;  4JWP A;  5F47 A;  2J8M A;  1NMT A;  4L8A A;  1KUV A;  4KOR A;  1Z4R A;  2ARH A;  3QB8 A;  4YFJ A;  4R9M A;  3VWD A;  4KOS A;  3W6S A;  3B8G A;  2ATR A;  1QSM A;  4KZT A;  4MY3 A;  4CRY B;  1Z9U A;  3TOA A;  5KTC A;  2QML A;  3EFA A;  3TO9 A;  5JQ4 A;  4HKF A;  4J3G A;  4OAE A;  4EVY A;  2VBQ A;  3D3S A;  3R9E A;  4PSW A;  3TO6 A;  4JD6 A;  3JVN A;  5F48 A;  2WPW A;  3LOD A;  4MHD A;  4CAW A;  3TT2 A;  4PV6 A;  1FY7 A;  2HQY A;  2G3A A;  1BOB A;  3CXQ A;  2IL4 A;  4R3K A;  1M4G A;  2F5I A;  4NXY A;  2FS5 A;  4KOV A;  2KCW A;  3DR6 A;  2B3V A;  3ZZI A;  4E8O A;  3SXN A;  3H4Q A;  3PZJ A;  2PR1 A;  5IB0 A;  3DDD A;  2PQ8 A;  2JDD A;  1YVO A;  3MGD A;  1YR0 A;  1S5K A;  4L89 A;  1S7L A;  4XPD B;  1WWZ A;  3CXP A;  4XPD C;  3PP9 A;  3BJ7 A;  4MI4 A;  4OAD A;  4QB9 A;  5KTA A;  2JEV A;  3T90 A;  3GKR A;  2J8R A;  2B5G B;  4BMH A;  5JPH A;  4PSX A;  1Z4E A;  4U9Z A;  3TCV A;  5HH1 A;  2B5G A;  1XF8 A;  2NMT A;  1M1D A;  1SQH A;  4K30 A;  1PU9 A;  4YGO A;  2J8N A;  4MBU A;  2C27 A;  3F5B A;  3I3G A;  3F8K A;  2FL4 A;  1KUY A;  2REE A;  1M4D A;  2FXF A;  2FCK A;  4FD6 A;  2I00 A;  1Q2Y A;  4AB7 A;  2P6F A;  2Q4Y A;  3FXT A;  2R8V A;  1NE9 A;  1IID A;  2RC4 A;  5ISV A;  3WR7 A;  4X5K A;  4B5O A;  4KOY A;  3G8W A;  1S7N A;  2BSW A;  1B6B A;  3SHP A;  3IGR A;  3S6H A;  1KZF A;  1VKC A;  2ZW4 A;  4NEX A;  1MJB A;  3D2M A;  4ZBG A;  3N7Z A;  2CY2 A;  2FE7 A;  2B3U A;  1S3Z A;  1XMT A;  3FRM A;  4IF5 A;  2P6E A;  1QSR A;  1S7K A;  3BJ8 A;  2VEZ A;  2EVN A;  5E96 A;  2VXK A;  3EC4 A;  3UY5 A;  3OWC A;  2ZW7 A;  4JXQ A;  2Y0M A;  2CNM A;  4H6U A;  5GCN A;  4E0A A;  1P4N A;  2WPX A;  4MJ8 A;  1QSO A;  3C26 A;  2Q0Y A;  3R1K A;  4GS4 A;  3ZJ0 A;  5KTD A;  1MK4 A;  2FSR A;  4FD4 A;  3KKW A;  3GYA A;  4F0Y A;  3IWG A;  4R57 A;  3LD2 A;  2DXQ A;  2Z11 A;  2K5T A;  2CNS A;  4FD7 A;  3R9F A;  2PR8 A;  4KUB A;  2BUE A;  3FNC A;  4HNW B;  1B87 A;  1BO4 A;  5C88 A;  1XE4 A;  2B58 A;  4AVB A;  1IYK A;  4H6Z A; 
#chains in the Genus database with same CATH topology
 4B13 A;  1Q7L A;  1YRE A;  2C6P A;  4KVX A;  3SJF A;  3JRU A;  3EXN A;  3SI1 A;  4DUK A;  4R7M A;  2Z3O A;  2YGW A;  5LYD A;  1IB1 E;  3NH5 A;  3GY9 A;  3JUW A;  4MHY A;  1YW4 A;  3A9L A;  5J8C A;  3KQX A;  3PB7 X;  3FF3 A;  4LX9 A;  1CPS A;  4NGR A;  2CF4 A;  4DJL A;  5HMN A;  1VHO A;  2CTC A;  1S7F A;  2AFZ A;  1F2P A;  3S9M A;  3SXO A;  5HXD A;  3CPX A;  1CX8 A;  3FEC A;  5DWN A;  4X2T A;  1BAV A;  4AG9 A;  3P2H A;  2VZY A;  2POK A;  4CAX A;  1Q2C A;  1OZP A;  4A32 A;  1J4J A;  3D7F A;  3GIU A;  4CYQ A;  5I0C A;  2BCO A;  3CT9 A;  4MFZ A;  4IAV A;  3IFE A;  4PXC A;  3R9G A;  4CGM A;  2Q04 A;  3CPA A;  5HVG A;  2QIR A;  3PEI A;  4UIA A;  1YX0 A;  1BLL E;  2GAN A;  4C2Z A;  5IX3 A;  2OZG A;  3DSB A;  4RI1 A;  4UCP A;  2PJB A;  1NSA A;  3KAS A;  2EO8 A;  1TKJ A;  1Y9W A;  3DNS A;  4MCS A;  4R87 A;  1IOF A;  5G20 A;  3GB0 A;  2ZPA A;  1GHE A;  5D8N A;  1K4J A;  3SI0 A;  4PPZ A;  2P0W A;  5F09 A;  1RO5 A;  2ZEF A;  4ZY2 A;  1BPN A;  1LFW A;  2NYQ A;  4HPS A;  4JLY A;  2YNC C;  2PE3 A;  4A95 A;  4RUH A;  2PRQ A;  3S9N A;  4U5Y A;  1Y7E A;  4KLV A;  2YNC A;  4JYW A;  5LRG A;  4IUS A;  4ONU A;  4M6I A;  4MHP A;  1ZLH A;  1YLO A;  3PB8 X;  3V7Z A;  4F6A A;  1HDQ A;  2QEC A;  2D4O A;  3TOB A;  4FUU A;  2CNT A;  4ZX9 A;  3WC7 A;  3PGP A;  4F8Z A;  3R95 A;  1IIC A;  4QC6 A;  1XEB A;  2CTB A;  3TO7 A;  4A94 A;  1ARL A;  2EUI A;  2HV2 A;  2O4H A;  4PXD A;  3FX6 A;  2ZOG A;  2OH1 A;  2G3T A;  4P6Y A;  4PK2 A;  2ZW5 A;  1Z2L A;  2GLF A;  1CJW A;  3WT4 A;  1I21 A;  2R7H A;  3T9Y A;  4JZ0 A;  4ZI6 A;  2AFX A;  2P6G A;  1BPM A;  4P4J A;  3IC1 A;  4OC0 A;  2Z3K A;  4XNH B;  2DF5 A;  4UWI A;  4UWJ A;  1FT7 A;  4NGN A;  4XNH C;  3FYN A;  4OKO A;  3JTK A;  3F0A A;  1M44 A;  4DNC A;  1L0C A;  2PJ9 A;  3GUX A;  1HEE A;  2OZU A;  1CPX A;  4JXR A;  1TIQ A;  5CPA A;  5FVJ A;  4B11 A;  4II9 A;  4KSF A;  4CPA A;  3FED A;  2QYV A;  5EBV A;  1DTD A;  3CZX A;  1ON0 A;  4AVC A;  3MRU A;  2D4P A;  5AG6 A;  3B3V A;  2PJ0 A;  3FIX A;  4WJB A;  4R6T A;  1AUG A;  2ZEP A;  1FNO A;  3N5F A;  3QAH A;  1S60 A;  2GE3 A;  2OB0 A;  4OP4 A;  2R1I A;  1M4L A;  4PK3 A;  4FAI A;  2PRB A;  3LWU A;  2PDO A;  1NSL A;  3W91 A;  4CS0 B;  2VI7 A;  4XPK A;  3P2F A;  1V0C A;  2RB7 A;  4R76 A;  1QST A;  3NE7 A;  1YQE A;  2C1C A;  4QUS A;  1M4I A;  3BI1 A;  5F49 A;  1TXR A;  2ANP A;  3ISX A;  4F0X A;  4M85 A;  5K8N A;  3D66 A;  1ZO0 A;  2WYR A;  3HUV A;  4Y49 B;  4YRH A;  5I4M A;  4Y49 C;  3NE8 A;  5EC4 A;  5G1Z A;  2PJA A;  3FB3 A;  3QAY A;  2JDC A;  3WC6 A;  2AJ6 A;  2Z0Z A;  2ZXV A;  3SJX A;  5C82 A;  1ELL P;  4MCR A;  3VAR A;  4UBR A;  5K8O A;  4P4I A;  2ZW6 A;  4H2K A;  1RXT A;  1CG2 A;  5J8F A;  2AFU A;  3H8F A;  1I1D A;  1GYT A;  3GLJ A;  2YNE A;  2EWB A;  4HNX B;  3PRT A;  4B14 A;  3B3C A;  5LYL A;  4NGP A;  2ZEG A;  4M3S A;  4P4B A;  1YK3 A;  5AGE A;  2Z10 A;  2A4N A;  1YME A;  1ZG9 A;  4I49 A;  4OLL A;  2ABZ A;  1VHS A;  3KQZ A;  1N71 A;  1XMB A;  3D67 A;  4CYO A;  2GIV A;  2QVP A;  3WAB A;  2NSM A;  2ZEL A;  4MCP A;  4UA3 A;  3R96 A;  2Q44 A;  5DS0 A;  4A33 A;  3TTH A;  2JLM A;  3S6G A;  1HDU A;  3TFY A;  4EFD A;  3RYO A;  1MJA A;  3V8I A;  2AFW A;  4JJX A;  1PYT B;  3K9U A;  1X10 A;  1UFH A;  3IWE A;  2R98 A;  1Z8L A;  4LUA A;  1LRZ A;  4QBJ A;  3D7H A;  4R3L A;  3S6K A;  4B5P B;  4C68 A;  1A2Z A;  4TNU A;  2B4B A;  1PUA A;  4R8F A;  8CPA A;  2RFH A;  2PVV A;  4KSI A;  4KLW A;  5K8P A;  2CIJ A;  2ZOF A;  4KOU A;  4B5P A;  3D2P A;  1IOI A;  1XFO A;  4KVO E;  4Q36 A;  4AVA A;  4CRZ B;  4AVB A;  1Z5R A;  1QSN A;  2Z3N A;  3NFZ A;  2BL1 A;  4NJR A;  1Q2D A;  4ZX8 A;  5JGF A;  1TKH A;  1CP6 A;  3EO4 A;  3SJE A;  2PJ8 A;  4IHM A;  1YVK A;  1YGH A;  2O53 A;  4OC2 A;  3FJU A;  4BIN A;  1XJO A;  3EY5 A;  1U6M A;  3BI0 A;  3VWE A;  4KSA A;  5JM6 A;  3NH4 A;  3W6X A;  2AFM A;  4H89 A;  3RO0 A;  4MFK A;  2REF A;  2Q4Z A;  1Y9K A;  2IJZ A;  2PJ2 A;  3S6F A;  4GXH A;  7CPA A;  1CM0 A;  4FD5 A;  1IYL A;  2ZEN A;  2H5M A;  1WK4 A;  1JWQ A;  5K8M A;  2HC9 A;  2OU2 A;  1YW6 A;  3FEE A;  2AE6 A;  2Z3L A;  4QVT A;  2ZEO A;  1LAM A;  2HUZ A;  3K2K A;  4NF1 A;  3SI2 A;  3KR5 A;  5A28 A;  2Q7B A;  3G3S A;  4MY0 A;  4U9Y A;  1VHE A;  1PCA A;  4NCZ A;  3E0K A;  4RS2 A;  4A38 A;  2VQY A;  1P0H A;  2VZZ A;  1IGB A;  2GU2 A;  4X3R A;  2I79 A;  3SJG A;  2FT0 A;  3I9S A;  5HVH A;  2VL1 A;  2PSW A;  3CXS A;  3D8P A;  4KOX A;  4TWE A;  2PJ1 A;  4UCM A;  4KOW A;  3PFE A;  1QMU A;  3KHX A;  4H6Z A;  2BEI A;  4C2Y A;  4Z65 A;  1KUX A;  1TF8 A;  2FIA A;  3FBU A;  2B4D B;  4KOT A;  3D68 A;  4OC1 A;  2DPT A;  2OOT A;  3L2N A;  3KGQ A;  1XIX A;  2OZH A;  4KUA A;  1I12 A;  2B4D A;  4OIW A;  4HNY B;  4CYN A;  4EME A;  1MJ9 A;  2J9A A;  1ARM A;  2CXA A;  3PB9 X;  1ELM P;  4KVM E;  5DWM A;  4B6Z A;  1YLE A;  1IU8 A;  1Y7R A;  4FWU A;  5LYI A;  3DR8 A;  2Q43 A;  4NSQ A;  2X7B A;  5H84 A;  3IU1 A;  4NGM A;  4E2A A;  4ORF A;  4AXV A;  3BLN A;  1UWY A;  2G0B A;  1ZLI A;  2PC1 A;  4OID A;  1R57 A;  2FIW A;  1LOK A;  5H86 A;  4XPL A;  4CAV A;  4AG7 A;  3TE4 A;  5F46 A;  5CNP A;  2O28 A;  2ZEM A;  5IB9 A;  1R3N A;  2Q4V A;  5IV0 A;  3B3W A;  2ZEH A;  4JWP A;  1TF9 A;  2XEF A;  3PBE A;  5F47 A;  2J8M A;  1ZG7 A;  1XOV A;  4ONW A;  4MHN A;  4K3N A;  1NMT A;  4C7I A;  2ODF A;  1VGY A;  2OR4 A;  4L8A A;  4UF4 A;  1F57 A;  1KUV A;  4KOR A;  5C88 A;  1VIX A;  3IIB A;  1Z4R A;  2ARH A;  3QB8 A;  4FBE A;  4YFJ A;  4O23 A;  4MFJ A;  4R9M A;  3VWD A;  4OC4 A;  4KOS A;  2F8H A;  4BBH A;  3W6S A;  3B8G A;  2ATR A;  1QSM A;  4UFW A;  3S9L A;  1Z8X A;  2PJ4 A;  4KZT A;  4Q38 A;  4UIB A;  4CYP A;  4MY3 A;  4CRY B;  1Z9U A;  2C6C A;  2FVG A;  3D7G A;  3TOA A;  5KTC A;  2QML A;  4A39 A;  3B35 A;  3EFA A;  2XEG A;  5D29 A;  3TO9 A;  3ISZ A;  3PBB A;  4UEF A;  4HKF A;  4A2Z A;  5JQ4 A;  4J3G A;  2WUU A;  4OAE A;  4EVY A;  2PJ5 A;  2VBQ A;  3D3S A;  1LAN A;  4NGQ A;  3R9E A;  4PSW A;  3TO6 A;  1AYE A;  4JD6 A;  3JVN A;  5F48 A;  2WPW A;  3RNZ A;  3LOD A;  1F2O A;  4A31 A;  3LMS A;  1LCP A;  2JEW A;  4ZY0 A;  4MHD A;  4CAW A;  4LQG A;  4X8I A;  1X12 A;  3TT2 A;  3WC5 A;  4P45 A;  4PV6 A;  1FY7 A;  3RZA A;  3IWW A;  2HQY A;  3RAM A;  2G3A A;  4MFP A;  4EWT A;  1TKF A;  1BOB A;  2Q7S A;  3CXQ A;  2XEJ A;  2IL4 A;  5AG4 A;  4R3K A;  2F5I A;  4NXY A;  3IU2 A;  2FS5 A;  2I3C A;  4KOV A;  4MFL A;  3CDX A;  4CAE A;  1OBR A;  2KCW A;  2B3V A;  2QJ8 A;  2V8V A;  3DR6 A;  5EMI A;  3ZZI A;  4E8O A;  4ZY1 A;  4UEZ A;  3SXN A;  3H4Q A;  3PZJ A;  2PR1 A;  5IB0 A;  4WWV A;  2BOA A;  3DDD A;  1RTQ A;  2PQ8 A;  2JDD A;  5THW A;  1YVO A;  3KR4 A;  3MGD A;  1YR0 A;  3D7D A;  3BHX A;  1S5K A;  4L89 A;  4F9U A;  2AFS A;  4UCN A;  2AFO A;  1S7L A;  4KS9 A;  4XPD B;  5AG5 A;  1WWZ A;  4OC3 A;  3I1U A;  3CXP A;  4XPD C;  4CGL A;  3PP9 A;  5J1Q A;  4LQ6 A;  3BJ7 A;  4MI4 A;  4OAD A;  4QB9 A;  5HVF A;  2JEV A;  1Z8W A;  3V38 A;  3T90 A;  5KTA A;  5LYF A;  3FVL A;  5LRK A;  4UFX A;  3GKR A;  4P4D A;  2J8R A;  2B5G B;  4BMH A;  6CPA A;  5JPH A;  2Z3P A;  4PSX A;  1Z4E A;  2WSA A;  2ZED A;  4BD9 A;  4U9Z A;  2PIZ A;  4P10 A;  3TCV A;  5HH1 A;  2B5G A;  1XF8 A;  2Z3M A;  2NMT A;  1M1D A;  1SQH A;  5CBM A;  5A27 A;  4K30 A;  1PU9 A;  2IMO A;  4OC5 A;  2J8N A;  4MBU A;  4YGO A;  2C27 A;  3F5B A;  3I3G A;  4A37 A;  3T8W A;  3F8K A;  5AG7 A;  2ZEE A;  4W9Y A;  2FL4 A;  1KUY A;  2REE A;  4CGP A;  1M4D A;  2FXF A;  4IK2 A;  5G22 A;  2FCK A;  4FD6 A;  2GLJ A;  1R43 A;  2I00 A;  2IQ6 A;  5LRJ A;  1Q2Y A;  2Q51 A;  4NFR A;  4AB7 A;  3DGV A;  4B12 A;  4F9V A;  2P6F A;  2PIY A;  2Q4Y A;  3FXT A;  4C2X A;  2R8V A;  2DPS A;  1NE9 A;  4P4E A;  4YU9 A;  3TC8 A;  1IID A;  2EK9 A;  4C7H A;  3DLJ A;  3HLP A;  2RC4 A;  5ISV A;  3WR7 A;  1YSJ A;  4X5K A;  2YND A;  4B5O A;  1H8L A;  4UFV A;  4ZGY B;  4KOY A;  3G8W A;  4P4F A;  1S7N A;  2BSW A;  4MRI A;  3KHZ A;  2HB6 A;  1B6B A;  3SHP A;  1DE4 C;  3B3S A;  2PVW A;  3K9T A;  3IGR A;  4CGN A;  4PQA A;  5JH9 A;  1AMP A;  3KL9 A;  2PJC A;  1KZF A;  3PB4 X;  1VKC A;  4NJQ A;  3S6H A;  3RBU A;  1EE3 P;  4NGT A;  4MMO A;  3TX8 A;  3IEH A;  2ZW4 A;  4CAF A;  4NEX A;  1MJB A;  3D2M A;  4ZBG A;  2DEA A;  3N7Z A;  1XRY A;  2CY2 A;  2FE7 A;  2B3U A;  3PB6 X;  4MXU A;  4A30 A;  4OME A;  1S3Z A;  1XBU A;  1XMT A;  3FRM A;  4IF5 A;  2BO9 A;  2P6E A;  1QSR A;  1S7K A;  3BJ8 A;  2VEZ A;  2EVN A;  4UEE A;  3H5Z A;  2VXK A;  3B3T A;  3EC4 A;  3PFO A;  1KWM A;  5E96 A;  3FH4 A;  3UY5 A;  1CBX A;  3OWC A;  2V8D A;  2ZW7 A;  4JXQ A;  2PJ6 A;  1CP7 A;  3H8G A;  3NH8 A;  3BXM A;  1JQG A;  3KI9 A;  4PXB A;  2WZN A;  2G9D A;  3IJ3 A;  2Y0M A;  4NGS A;  2XEI A;  2CNM A;  2PCU A;  4H6U A;  4CGO A;  5GCN A;  3NA6 A;  1P4N A;  1QQ9 A;  2V8H A;  4G1P A;  3QNV A;  4E0A A;  3FMC A;  1Y0R A;  2WPX A;  3KZW A;  2EBJ A;  4MJ8 A;  1QSO A;  3C26 A;  4M6H A;  2Q0Y A;  1Z8T A;  4Q7A A;  4PXE A;  3MN8 A;  4MHZ A;  1ZG8 A;  3R1K A;  2C6G A;  4GS4 A;  5G21 A;  3ZJ0 A;  5KTD A;  1MK4 A;  2FSR A;  2V77 A;  4FD4 A;  4M6G A;  3KKW A;  2EK8 A;  5ELY A;  3GYA A;  4YWY A;  4F0Y A;  4ZYQ A;  3IWG A;  4R57 A;  3LD2 A;  3B7I A;  3D4U A;  2DXQ A;  2Z11 A;  4P44 A;  2K5T A;  4RN7 A;  4B10 A;  2CNS A;  5BWA B;  4MCQ A;  4FD7 A;  3VAT A;  1IY7 A;  3R9F A;  4GM5 A;  1Y0Y A;  2JBJ A;  2PR8 A;  3IO1 A;  2PJ3 A;  4KUB A;  2BUE A;  3FNC A;  4HNW B;  1B87 A;  3H8E A;  3VH9 A;  2PJ7 A;  2JBK A;  1BO4 A;  2GFQ A;  3LAC A;  4DYO A;  1LAP A;  2GRE A;  2V8G A;  1XE4 A;  2B58 A;  2F7V A;  3B2Y A;  1IYK A;  4MFQ A;  1M4G A; 
#chains in the Genus database with same CATH homology
 4B13 A;  1YRE A;  4KVX A;  3EXN A;  2Z3O A;  2YGW A;  1IB1 E;  3GY9 A;  3JUW A;  5J8C A;  3A9L A;  4LX9 A;  5HMN A;  1S7F A;  3SXO A;  5DWN A;  4AG9 A;  3P2H A;  2VZY A;  4CAX A;  1Q2C A;  1OZP A;  4A32 A;  1J4J A;  4CYQ A;  5I0C A;  4MFZ A;  3R9G A;  4CGM A;  2Q04 A;  2QIR A;  1YX0 A;  2GAN A;  4C2Z A;  5IX3 A;  2OZG A;  3DSB A;  4RI1 A;  4UCP A;  1Y9W A;  3DNS A;  4R87 A;  5G20 A;  2ZPA A;  1GHE A;  1K4J A;  2P0W A;  1RO5 A;  4JLY A;  2YNC C;  4A95 A;  4U5Y A;  4KLV A;  2YNC A;  4IUS A;  4ONU A;  4F6A A;  2QEC A;  2D4O A;  3TOB A;  2CNT A;  3PGP A;  3R95 A;  1IIC A;  4QC6 A;  1XEB A;  3TO7 A;  2EUI A;  2HV2 A;  2OH1 A;  2G3T A;  4PK2 A;  2ZW5 A;  1CJW A;  1I21 A;  2R7H A;  3T9Y A;  2P6G A;  2Z3K A;  4XNH B;  4UWI A;  4UWJ A;  4XNH C;  3FYN A;  3JTK A;  3F0A A;  1M44 A;  4DNC A;  1L0C A;  2OZU A;  4JXR A;  1TIQ A;  5FVJ A;  4B11 A;  4II9 A;  4KSF A;  5EBV A;  1ON0 A;  4AVC A;  2D4P A;  5AG6 A;  3FIX A;  3QAH A;  1S60 A;  2GE3 A;  2OB0 A;  4PK3 A;  2R1I A;  2PRB A;  1NSL A;  2PDO A;  3W91 A;  4CS0 B;  2VI7 A;  4XPK A;  3P2F A;  1V0C A;  1QST A;  3NE7 A;  4QUS A;  1M4I A;  5F49 A;  4F0X A;  4M85 A;  1ZO0 A;  4Y49 B;  4YRH A;  4Y49 C;  5EC4 A;  5G1Z A;  3FB3 A;  2JDC A;  2AJ6 A;  2Z0Z A;  2ZXV A;  5C82 A;  4UBR A;  2ZW6 A;  1RXT A;  5J8F A;  1I1D A;  2YNE A;  4HNX B;  4B14 A;  4M3S A;  1YK3 A;  5AGE A;  2Z10 A;  2A4N A;  4I49 A;  4OLL A;  4CYO A;  1VHS A;  1N71 A;  2GIV A;  4UA3 A;  3R96 A;  2Q44 A;  4A33 A;  3TTH A;  2JLM A;  3S6G A;  3TFY A;  3RYO A;  1MJA A;  3V8I A;  4JJX A;  3K9U A;  1UFH A;  3IWE A;  2R98 A;  4LUA A;  1LRZ A;  4QBJ A;  4R3L A;  3S6K A;  4B5P B;  4C68 A;  2B4B A;  1PUA A;  4KLW A;  4B5P A;  4KOU A;  3D2P A;  4KVO E;  4Q36 A;  4AVA A;  4CRZ B;  1QSN A;  2Z3N A;  2BL1 A;  1Q2D A;  3EO4 A;  1YVK A;  1YGH A;  3EY5 A;  1U6M A;  3VWE A;  4KSA A;  3W6X A;  4H89 A;  4MFK A;  2REF A;  1Y9K A;  3S6F A;  1CM0 A;  4FD5 A;  1IYL A;  2H5M A;  1WK4 A;  2OU2 A;  2AE6 A;  2Z3L A;  4QVT A;  2HUZ A;  4NF1 A;  5A28 A;  2Q7B A;  3G3S A;  4MY0 A;  4U9Y A;  4NCZ A;  4RS2 A;  3E0K A;  2VQY A;  1P0H A;  2VZZ A;  2I79 A;  2FT0 A;  3I9S A;  2PSW A;  3CXS A;  3D8P A;  4KOX A;  4UCM A;  4KOW A;  4C2Y A;  2BEI A;  1KUX A;  2FIA A;  3FBU A;  2B4D B;  4KOT A;  2DPT A;  1XIX A;  2OZH A;  4KUA A;  1I12 A;  2B4D A;  4HNY B;  4CYN A;  1MJ9 A;  4KVM E;  2CXA A;  5DWM A;  1YLE A;  1Y7R A;  3DR8 A;  4NSQ A;  5H84 A;  2X7B A;  3IU1 A;  4E2A A;  4ORF A;  3BLN A;  2G0B A;  2PC1 A;  1R57 A;  2FIW A;  5H86 A;  4XPL A;  4CAV A;  4AG7 A;  3TE4 A;  5F46 A;  5CNP A;  2O28 A;  5IV0 A;  2Q4V A;  4JWP A;  5F47 A;  2J8M A;  1NMT A;  4C7I A;  4L8A A;  1KUV A;  4KOR A;  1Z4R A;  2ARH A;  3QB8 A;  4YFJ A;  4R9M A;  4MFJ A;  3VWD A;  4KOS A;  4BBH A;  3W6S A;  3B8G A;  2ATR A;  1QSM A;  4UFW A;  4KZT A;  4Q38 A;  4CYP A;  4MY3 A;  4CRY B;  1Z9U A;  3TOA A;  5KTC A;  2QML A;  3EFA A;  3TO9 A;  5JQ4 A;  4A2Z A;  4HKF A;  4J3G A;  2WUU A;  4OAE A;  4EVY A;  2VBQ A;  3D3S A;  3R9E A;  4PSW A;  3TO6 A;  4JD6 A;  3JVN A;  5F48 A;  2WPW A;  3LOD A;  4A31 A;  4MHD A;  4CAW A;  3TT2 A;  4PV6 A;  1FY7 A;  2HQY A;  2G3A A;  4MFP A;  1BOB A;  3CXQ A;  2IL4 A;  5AG4 A;  4R3K A;  1M4G A;  2F5I A;  4NXY A;  3IU2 A;  2FS5 A;  4KOV A;  4MFL A;  4CAE A;  2KCW A;  3DR6 A;  2B3V A;  3ZZI A;  4E8O A;  3SXN A;  3H4Q A;  3PZJ A;  2PR1 A;  5IB0 A;  3DDD A;  2PQ8 A;  2JDD A;  1YVO A;  3MGD A;  1YR0 A;  1S5K A;  4L89 A;  4UCN A;  1S7L A;  4KS9 A;  4XPD B;  5AG5 A;  1WWZ A;  4CGL A;  3CXP A;  4XPD C;  3PP9 A;  3BJ7 A;  4MI4 A;  4OAD A;  4QB9 A;  5KTA A;  2JEV A;  3T90 A;  4UFX A;  3GKR A;  2J8R A;  2B5G B;  4BMH A;  5JPH A;  2Z3P A;  4PSX A;  1Z4E A;  2WSA A;  4U9Z A;  3TCV A;  5HH1 A;  2B5G A;  1XF8 A;  2Z3M A;  2NMT A;  1M1D A;  1SQH A;  5A27 A;  4K30 A;  1PU9 A;  4YGO A;  2J8N A;  4MBU A;  2C27 A;  3F5B A;  3I3G A;  3F8K A;  5AG7 A;  4CGP A;  2FL4 A;  1KUY A;  2REE A;  1M4D A;  2FXF A;  5G22 A;  2FCK A;  4FD6 A;  2I00 A;  1Q2Y A;  4AB7 A;  4B12 A;  2P6F A;  2Q4Y A;  3FXT A;  4C2X A;  2R8V A;  2DPS A;  1NE9 A;  1IID A;  4C7H A;  2RC4 A;  5ISV A;  3WR7 A;  4X5K A;  2YND A;  4B5O A;  4UFV A;  4ZGY B;  4KOY A;  3G8W A;  1S7N A;  2BSW A;  1B6B A;  3SHP A;  3IGR A;  4CGN A;  3S6H A;  1KZF A;  1VKC A;  2ZW4 A;  4CAF A;  4NEX A;  1MJB A;  3D2M A;  4ZBG A;  3N7Z A;  2CY2 A;  2FE7 A;  2B3U A;  4A30 A;  1S3Z A;  1XMT A;  3FRM A;  4IF5 A;  2P6E A;  1QSR A;  1S7K A;  3BJ8 A;  2VEZ A;  2EVN A;  5E96 A;  3H5Z A;  2VXK A;  3EC4 A;  3UY5 A;  3OWC A;  2ZW7 A;  4JXQ A;  2Y0M A;  2CNM A;  4H6U A;  4CGO A;  5GCN A;  4E0A A;  1P4N A;  2WPX A;  4MJ8 A;  1QSO A;  3C26 A;  2Q0Y A;  3R1K A;  4GS4 A;  5G21 A;  3ZJ0 A;  5KTD A;  1MK4 A;  2FSR A;  4FD4 A;  3KKW A;  3GYA A;  4F0Y A;  3IWG A;  4R57 A;  3LD2 A;  2DXQ A;  2Z11 A;  2K5T A;  5BWA B;  4B10 A;  2CNS A;  4FD7 A;  3R9F A;  2PR8 A;  4KUB A;  2BUE A;  3FNC A;  4HNW B;  1B87 A;  1BO4 A;  5C88 A;  1XE4 A;  2B58 A;  4AVB A;  1IYK A;  4MFQ A;  4H6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...