4L89A

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with covalently bound coa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
b'MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l89A00
2QMLA 2VBQA 4XPLA 1CJWA 4NSQA 5GCNA 3GYAA 2FE7A 2G3AA 2JEVA 2VZYA 4L89A 2B5GA 4AVCA 1WK4A 4NCZA 5CNPA 3DR8A 3FYNA 3B8GA 3IGRA 4FD5A 3RYOA 2AJ6A 4HKFA 2VI7A 2F5IA 2EVNA 4FD7A 1MK4A 2I00A 1IB1E 3SXNA 4JJXA 4OAEA 3S6FA 3DDDA 3BJ8A 3F0AA 1TIQA 5I0CA 1BOBA 2H5MA 1I12A 2GE3A 1QSNA 1YR0A 2PSWA 2PQ8A 3JVNA 4B5OA 3EY5A 4MHDA 1FY7A 2R8VA 5H84A 1CM0A 2BSWA 2JLMA 1IIDA 1UFHA 1Y9KA 4II9A 1SQHA 3OWCA 2NMTA 3D8PA 5HMNA 3DSBA 4X5KA 2B5GB 2D4PA 2C27A 2QIRA 4EVYA 3I9SA 5JQ4A 1Q2YA 2GIVA 2KCWA 2B4DA 4R57A 3G3SA 2ZW4A 5KTCA 3CXSA 3KKWA 3I3GA 2BUEA 3W6XA 3JUWA 3PP9A 2PRBA 2WPWA 4LX9A 2HUZA 2B3VA 2Y0MA 2OB0A 2P6EA 4PK2A 1S7NA 2IL4A 4E0AA 3F8KA 3TFYA 1S7KA 3G8WA 3R9GA 2BL1A 2JDCA 4MY0A 3GKRA 4BMHA 1VKCA 4KVOE 2Q7BA 2ATRA 3CXPA 4R87A 1L0CA 1XF8A 2G3TA 3BJ7A 4KOUA 5IB0A 1ON0A 3R9EA 1YX0A 3R1KA 4IF5A 4HNXB 4U5YA 5J8CA 2ZW5A 3BLNA 1RXTA 4NF1A 4B5PA 4FD6A 3T9YA 3EXNA 4CAXA 1M4DA 2FL4A 4R3LA 2R7HA 4CRZB 2VQYA 1Z4RA 3GY9A 4XPKA 1S7FA 3W91A 4QC6A 2OZGA 2R98A 2PR1A 4HNWB 1QSTA 1YREA 1OZPA 1XEBA 4FD4A 4R3KA 4PSWA 4AVBA 1P0HA 2ARHA 4XPDB 3F5BA 5F48A 3PGPA 4ONUA 4QB9A 4QBJA 3QAHA 1MJBA 3R96A 2D4OA 2I79A 3EFAA 4KORA 3TO6A 4AB7A 3VWEA 2HV2A 4ZBGA 3WR7A 1P4NA 2JDDA 3FNCA 4ORFA 4KOXA 4Y49B 4YRHA 2Q4YA 1M1DA 2Z10A 4PK3A 2ZPAA 2R1IA 3UY5A 1YVOA 4U9YA 1IYLA 4YGOA 4PSXA 4KOTA 1PUAA 1RO5A 2Q44A 4B5PB 3TT2A 4RI1A 3TOAA 1Q2DA 1XIXA 1WWZA 3LODA 4J3GA 2OH1A 1B6BA 4Y49C 3C26A 3P2HA 2O28A 3D2MA 1QSMA 3V8IA 2OU2A 3TO7A 3ZJ0A 1KZFA 4XNHB 1NMTA 4M3SA 4E2AA 4GS4A 2BEIA 2FS5A 4JXRA 3NE7A 1PU9A 2HQYA 2VZZA 3H4QA 4LUAA 2CNTA 3FXTA 2K5TA 1YVKA 1I1DA 2G0BA 3CXQA 4H6UA 3PZJA 4KOYA 3W6SA 4JXQA 1Y9WA 2X7BA 4KZTA 4AG9A 4XNHC 2GANA 2REEA 4JLYA 5F49A 1S5KA 2QECA 2ZXVA 3P2FA 1Z4EA 4F6AA 1IICA 3E0KA 3FRMA 1KUVA 4M85A 1XE4A 4AVAA 1J4JA 1VHSA 5EBVA 5C82A 5E96A 4UWIA 2P6FA 3EC4A 4UWJA 1R57A 1QSRA 1QSOA 3EO4A 3R95A 1Y7RA 2Z0ZA 4MJ8A 2B4DB 2AE6A 4QVTA 1GHEA 3QB8A 2FXFA 4E8OA 3DNSA 3D2PA 3FIXA 2B3UA 4UBRA 3TCVA 5C88A 1KUXA 1MJ9A 4JWPA 5ISVA 1YLEA 3TTHA 2DXQA 4OLLA 3TO9A 2J8MA 2FIAA 3R9FA 3TE4A 5FVJA 4HNYB 1YK3A 4PV6A 4YFJA 5EC4A 1YGHA 2Q0YA 3SXOA 5JPHA 1N71A 2VXKA 3VWDA 1U6MA 4K30A 1B87A 3S6KA 1Q2CA 4CRYB 2REFA 4QUSA 4XPDC 2A4NA 2ZW6A 2EUIA 4KVXA 1BO4A 4R9MA 4H89A 2RC4A 5HH1A 4NEXA 4U9ZA 4KOVA 4IUSA 4NXYA 5DWNA 3ZZIA 4F0YA 3LD2A 4KLVA 5DWMA 5KTDA 2CNMA 3FB3A 1M4GA 1M44A 1KUYA 2PR8A 1S60A 2P6GA 3K9UA 3SHPA 5IV0A 4MY3A 4CAWA 1M4IA 2FSRA 4RS2A 4KLWA 5KTAA 2OZHA 1Z9UA 2CNSA 4DNCA 1S3ZA 5H86A 2P0WA 2B58A 1XMTA 4I49A 5J8FA 4UA3A 3MGDA 5F47A 3T90A 4CAVA 3FBUA 2PC1A 1LRZA 3TOBA 4MBUA 4L8AA 4AG7A 3IWGA 4H6ZA 4KOWA 5IX3A 3S6GA 2OZUA 2B4BA 1V0CA 2WPXA 2FIWA 3N7ZA 2J8RA 2Q4VA 5F46A 4KUBA 2Z11A 2FT0A 4OADA 4MI4A 2PDOA 1IYKA 1NE9A 2VEZA 2Q04A 2FCKA 4KOSA 1K4JA 2CY2A 2J8NA 1I21A 4KVME 3S6HA 3DR6A 1MJAA 2ZW7A 4JD6A 1NSLA 3D3SA 4CS0B 4KUAA 1S7LA
chains in the Genus database with same CATH superfamily
2EWBA 2QMLA 2VBQA 4XPLA 1CJWA 2IQ6A 2PJ9A 4NSQA 5GCNA 3GYAA 2FE7A 2G3AA 2JEVA 2VZYA 4L89A 4F8ZA 4ZY1A 2B5GA 3FEEA 3WC7A 4P6YA 4AVCA 1WK4A 4NCZA 3IIBA 5CNPA 3DR8A 3FYNA 3B8GA 3V7ZA 1ELLP 2PJBA 2CTBA 2PJ0A 3IGRA 1ARLA 4FD5A 3KZWA 3RYOA 4P4EA 3S9NA 2AJ6A 2C6CA 4HKFA 3NH5A 2VI7A 2F5IA 3PRTA 3D68A 2EVNA 2WZNA 4FD7A 4P44A 4NFRA 1MK4A 2I00A 1IB1E 3PB4X 3SXNA 4R8FA 4JJXA 4OAEA 4A39A 4P4IA 2WUUA 3S6FA 3DDDA 3BJ8A 2OR4A 3F0AA 4CAEA 5LYIA 2EO8A 2G9DA 1TIQA 5I0CA 4C2XA 1BOBA 1F57A 2H5MA 3H5ZA 1I12A 1LAPA 2GFQA 2GE3A 3FJUA 1QSNA 3RNZA 2ZEPA 1YR0A 2V8DA 4LQGA 2PSWA 4MHYA 5HVGA 2YNCC 1ZG9A 1PYTB 2PIYA 2RB7A 2PQ8A 3B35A 3JVNA 4MCPA 4B5OA 3EY5A 4MHDA 2PJ7A 2F7VA 4B6ZA 1FY7A 4IK2A 3IJ3A 5K8OA 2HC9A 3VATA 1Y0RA 2R8VA 3RBUA 3D67A 1NSAA 4OC2A 5H84A 4NGNA 4ZYQA 3SI0A 4C68A 2PJ6A 1CM0A 2BSWA 2JLMA 1IGBA 1IIDA 1UFHA 4ZX9A 1Y9KA 2CIJA 3DLJA 4NGMA 3BXMA 4II9A 5JH9A 1SQHA 4OC4A 1A2ZA 3KL9A 3OWCA 2NMTA 3D8PA 3H8FA 5HMNA 3DSBA 4HPSA 4X5KA 2B5GB 2D4PA 2C27A 2Z3KA 4MHPA 4MXUA 3B3TA 5CPAA 2GU2A 1Y7EA 5J1QA 2YNDA 2QIRA 4EVYA 3I9SA 3FX6A 2HB6A 1IU8A 3NE8A 5JQ4A 4UFXA 2DF5A 1Q2YA 4CYPA 2GIVA 2KCWA 2B4DA 1ARMA 4R57A 3G3SA 3NH4A 4OP4A 1R43A 3MN8A 1BPMA 1AYEA 2YNEA 2ZW4A 5G20A 1PCAA 4CYNA 1YSJA 2PJAA 4UCPA 5KTCA 3CXSA 3GUXA 2PJ5A 4M6GA 3KHXA 3KKWA 3I3GA 5HXDA 2BUEA 3W6XA 1YW6A 5JGFA 3JUWA 2PJ2A 3PP9A 3BI0A 3FEDA 4OKOA 2PRBA 2WPWA 4LX9A 2HUZA 3FH4A 4C7HA 3B3WA 2B3VA 2Y0MA 4C2YA 2OB0A 1GYTA 2P6EA 2ZEDA 4PK2A 1S7NA 2IL4A 2GLFA 2VL1A 5D29A 3SI2A 4E0AA 3F8KA 4UCMA 3TFYA 2C1CA 4FBEA 1S7KA 3G8WA 3R9GA 3TC8A 2BL1A 4UIAA 3IU1A 2NYQA 1H8LA 2JDCA 1M4LA 4ZGYB 4MY0A 1Z8WA 3GKRA 1YQEA 2AFMA 1YMEA 1VKCA 3JRUA 4KVOE 4IAVA 4MMOA 4O23A 2ZELA 2ATRA 3CXPA 2Q7BA 8CPAA 4R87A 1VHOA 2FVGA 1L0CA 1XF8A 2G3TA 3BJ7A 1BAVA 4KOUA 3PEIA 1ON0A 2ZEOA 4Q7AA 3R9EA 3RAMA 4CGNA 5IB0A 3GIUA 1YX0A 4OIWA 1JWQA 3R1KA 1XFOA 1HEEA 4IF5A 4HNXB 3IU2A 4U5YA 2C6PA 5J8CA 4MCQA 3KGQA 2ZW5A 3BLNA 1RXTA 4NF1A 2Z3OA 4P4JA 4B5PA 4FD6A 4P4DA 3JTKA 3T9YA 4NJQA 3EXNA 4CAXA 2ZEMA 5I4MA 1M4DA 2Z3PA 3CT9A 3KR4A 5JM6A 4KSAA 2FL4A 4R3LA 2R7HA 2PJ8A 3KQXA 4CRZB 4G1PA 2VQYA 1AMPA 1Z4RA 3GY9A 4A32A 4PQAA 4XPKA 4CPAA 2ZEFA 2PRQA 1S7FA 3W91A 4QC6A 4X3RA 2OZGA 3PBBA 2R98A 3PFEA 2PR1A 4HNWB 2ZENA 4PXCA 4CGOA 4RN7A 1BLLE 1QSTA 1YREA 2GREA 1IOIA 1Q7LA 3NH8A 1OZPA 1XEBA 4FD4A 4R3KA 4PSWA 4AVBA 3BHXA 1TKFA 4Z65A 1P0HA 2ARHA 3VARA 4XPDB 3VH9A 3L2NA 4A95A 3F5BA 3LWUA 5F48A 2AFSA 3PGPA 1CP6A 1TF9A 4ONUA 4QB9A 4QBJA 2ZEEA 3PB9X 3QAHA 1MJBA 3MRUA 4UIBA 3R96A 2D4OA 2I79A 5EMIA 4R7MA 3EFAA 3IFEA 3KR5A 5HVFA 3PB7X 4KORA 2AFWA 3TO6A 1OBRA 4AB7A 4OMEA 3VWEA 3D66A 2EBJA 4ZY2A 3KQZA 2DPTA 3ISXA 1QQ9A 2HV2A 4ZBGA 4P4BA 4PXEA 3WR7A 1P4NA 2JDDA 3CZXA 3FNCA 1HDUA 2EK9A 4ORFA 4KOXA 1VIXA 4Y49B 4YRHA 3IWWA 2Q4YA 1Z8XA 2BO9A 3B3SA 3D7GA 1M1DA 2PJ1A 2Z10A 4PPZA 4PK3A 2ZPAA 3PFOA 5K8PA 2QVPA 2R1IA 5AG5A 2Q43A 3UY5A 1YVOA 4U9YA 4LQ6A 1IYLA 3WC6A 4X2TA 5AG7A 4YGOA 4PSXA 4KOTA 4TNUA 1XOVA 4F9VA 1PUAA 1RO5A 3SJEA 4UFWA 1XRYA 2Q44A 4B5PB 2ZEGA 3TT2A 3NFZA 1Z8TA 2PIZA 2YGWA 4RI1A 3B7IA 3I1UA 4KS9A 3TOAA 1Q2DA 3SJFA 1RTQA 3CPAA 1XIXA 1WWZA 2EK8A 2WSAA 3LODA 4A33A 5BWAB 4J3GA 1LOKA 1B6BA 2OH1A 4Y49C 3C26A 2CXAA 4CAFA 1ZG8A 2O28A 3P2HA 4UFVA 2XEIA 3D2MA 1QSMA 4M6IA 3V8IA 1QMUA 2OU2A 4A2ZA 3TO7A 3ZJ0A 1KZFA 4XNHB 1NMTA 1LANA 4M3SA 3IWEA 4C7IA 4E2AA 3K2KA 2C6GA 4JYWA 1TXRA 4UEZA 3QNVA 1Y0YA 4GS4A 2BEIA 2IMOA 3FVLA 4MFJA 4CGLA 3PB8X 2F8HA 4UEFA 4P4FA 4GM5A 4WWVA 4A30A 3BI1A 3IEHA 2FS5A 4NGRA 4CYQA 2XEFA 4JXRA 1ZG7A 3NE7A 1PU9A 2HQYA 4ONWA 1TKJA 2VZZA 3HLPA 2Z3LA 3H4QA 4LUAA 2CNTA 3FXTA 4B10A 2K5TA 1YVKA 1I1DA 1IOFA 3D7DA 2ODFA 4NGQA 2G0BA 3CXQA 5G21A 3S9MA 1TKHA 4H6UA 3PZJA 4MCRA 3FMCA 4KOYA 4NGSA 4OIDA 4UEEA 4JXQA 3W6SA 1Y9WA 3GB0A 2X7BA 5AGEA 4KZTA 4AG9A 4XNHC 2GANA 3TX8A 2REEA 3D4UA 3SI1A 1VHEA 2JEWA 1S5KA 2QECA 2ZXVA 3PB6X 3P2FA 4JLYA 5F49A 2PE3A 1Z4EA 2Q4ZA 1LFWA 2BOAA 4F6AA 1IICA 3E0KA 3H8GA 2ZEHA 3FRMA 1KUVA 3NA6A 4M85A 5LYFA 1XE4A 3SJXA 4AVAA 1J4JA 2ANPA 1VHSA 2QYVA 5EBVA 5C82A 5E96A 4P45A 4YWYA 3GLJA 4MFZA 4UWIA 4A37A 4R6TA 1X10A 2OOTA 4CGMA 1CPSA 2P6FA 3EC4A 4UWJA 1R57A 2Q7SA 4FWUA 2PJ3A 1QSRA 4EWTA 1QSOA 3QAYA 1FT7A 4EFDA 3LACA 4P10A 1DE4C 2O4HA 5THWA 3EO4A 3H8EA 3R95A 1Y7RA 2RFHA 3D7HA 2Z0ZA 4MJ8A 5G1ZA 2B4DB 2AE6A 4X8IA 2O53A 4MCSA 4QVTA 1GHEA 4A31A 1TF8A 3QB8A 2FXFA 4NGPA 1XMBA 4PXBA 4E8OA 5AG4A 3DNSA 5LRGA 3D2PA 2ABZA 3RZAA 2V8HA 3FIXA 2B3UA 4UBRA 3TCVA 5A28A 1KUXA 1MJ9A 4JWPA 5C88A 5ISVA 1YLEA 4A38A 4MHZA 1CPXA 2XEGA 2DXQA 3TTHA 3WABA 4BMHA 3KASA 2V8VA 4KSFA 4OLLA 2I3CA 3TO9A 1AUGA 2J8MA 2FIAA 4K3NA 5AG6A 3R9FA 4M6HA 4BINA 3LMSA 3TE4A 3CDXA 2PJCA 7CPAA 1ZLHA 2AFOA 4BD9A 5F09A 5FVJA 4CGPA 4HNYB 1YK3A 1YLOA 2POKA 3B2YA 4PV6A 4UCNA 1CG2A 2V77A 4YFJA 5EC4A 4MHNA 2AFXA 2AFUA 4ZI6A 1LAMA 1YGHA 2Q0YA 3SXOA 4B12A 5JPHA 1N71A 2VXKA 4OC1A 1CP7A 3VWDA 2JBJA 4FAIA 2XEJA 3D7FA 1U6MA 4K30A 1B87A 3S6KA 2BCOA 4NGTA 1Q2CA 1XJOA 4CRYB 2REFA 3T8WA 5LYDA 1VGYA 4QUSA 4XPDC 3SJGA 2A4NA 3B3VA 3FF3A 2ZW6A 2EUIA 4KVXA 3K9TA 1BO4A 1R3NA 4H89A 1XBUA 3ISZA 4R9MA 4W9YA 2RC4A 5HH1A 4NEXA 4U9ZA 4KOVA 4DJLA 4IUSA 4NXYA 4NJRA 3DGVA 2IJZA 5LRJA 5DWNA 3ZZIA 4F0YA 4RUHA 3LD2A 4ZX8A 4KLVA 5DWMA 2DEAA 5KTDA 2CNMA 3KI9A 3FB3A 1M4GA 1M44A 1KUYA 2PR8A 5LRKA 1S60A 2P6GA 3K9UA 4KSIA 3SHPA 4ZY0A 4MY3A 5IV0A 5K8NA 4CAWA 2PCUA 1M4IA 2FSRA 4RS2A 3B3CA 4KLWA 5G22A 3WT4A 1BPNA 3IC1A 4OC5A 5KTAA 1ZLIA 4UF4A 6CPAA 5DS0A 4FUUA 4MFKA 2OZHA 4F9UA 1Z9UA 1IY7A 3N5FA 2PVWA 2CNSA 4DNCA 1HDQA 2Q51A 3CPXA 5IB9A 1S3ZA 2CF4A 2ZOFA 4MFLA 5H86A 2YNCA 2P0WA 2B58A 1XMTA 2Z3MA 3PBEA 4JZ0A 2PJ4A 1Z8LA 4I49A 1LCPA 2QJ8A 4EMEA 5J8FA 4UA3A 3MGDA 5F47A 5K8MA 3T90A 4TWEA 4H2KA 3FBUA 4CAVA 2PC1A 4BBHA 1LRZA 1DTDA 4R76A 3TOBA 1YW4A 4B11A 4Q38A 4MBUA 4L8AA 4AG7A 4DUKA 4B13A 2J9AA 1ZO0A 3FECA 3IWGA 4H6ZA 2DPSA 5D8NA 4KOWA 2NSMA 5IX3A 3S6GA 1X12A 3A9LA 2OZUA 4DYOA 3KHZA 4GXHA 2B4BA 1Z2LA 3HUVA 1V0CA 3RO0A 2WPXA 2CTCA 5CBMA 2FIWA 2WYRA 3N7ZA 1FNOA 1UWYA 2J8RA 3V38A 3WC5A 5LYLA 2Q4VA 2Z3NA 5F46A 1CX8A 3IO1A 4KUBA 4OC0A 4A94A 4B14A 2Z11A 2FT0A 2PVVA 4AXVA 4OADA 2JBKA 2ZOGA 4MI4A 4OC3A 4C2ZA 2PDOA 1IYKA 1NE9A 2VEZA 4F0XA 2Q04A 2FCKA 1JQGA 1ELMP 4PXDA 4KOSA 2V8GA 5ELYA 1K4JA 5A27A 4YU9A 4IHMA 4WJBA 2CY2A 1EE3P 2AFZA 2J8NA 4MRIA 1I21A 4KVME 3S6HA 3DR6A 1Z5RA 1MJAA 4MFQA 1F2OA 1F2PA 1KWMA 2ZW7A 4CYOA 3S9LA 1CBXA 4JD6A 4MFPA 4Q36A 5HVHA 2GLJA 1NSLA 3D3SA 4CS0B 4KUAA 1S7LA
chains in the Genus database with same CATH topology
2QMLA 2VBQA 4XPLA 1CJWA 4NSQA 5GCNA 3GYAA 2FE7A 2G3AA 2JEVA 2VZYA 4L89A 2B5GA 4AVCA 1WK4A 4NCZA 5CNPA 3DR8A 3FYNA 3B8GA 3IGRA 4FD5A 3RYOA 2AJ6A 4HKFA 2VI7A 2F5IA 2EVNA 4FD7A 1MK4A 2I00A 1IB1E 3SXNA 4JJXA 4OAEA 2WUUA 3S6FA 3DDDA 3BJ8A 3F0AA 4CAEA 1TIQA 5I0CA 4C2XA 1BOBA 2H5MA 3H5ZA 1I12A 2GE3A 1QSNA 1YR0A 2PSWA 2YNCC 2PQ8A 3JVNA 4B5OA 3EY5A 4MHDA 1FY7A 2R8VA 5H84A 4C68A 1CM0A 2BSWA 2JLMA 1IIDA 1UFHA 1Y9KA 4II9A 1SQHA 3OWCA 2NMTA 3D8PA 5HMNA 3DSBA 4X5KA 2B5GB 2D4PA 2C27A 2Z3KA 2YNDA 2QIRA 4EVYA 3I9SA 5JQ4A 4UFXA 4CYPA 1Q2YA 2GIVA 2KCWA 2B4DA 4R57A 3G3SA 2YNEA 2ZW4A 5G20A 4CYNA 4UCPA 5KTCA 3CXSA 3KKWA 3I3GA 2BUEA 3W6XA 3JUWA 3PP9A 2PRBA 2WPWA 4LX9A 2HUZA 4C7HA 2B3VA 2Y0MA 4C2YA 2OB0A 2P6EA 4PK2A 1S7NA 2IL4A 4E0AA 3F8KA 4UCMA 3TFYA 1S7KA 3G8WA 3R9GA 2BL1A 3IU1A 2JDCA 4ZGYB 4MY0A 3GKRA 4BMHA 1VKCA 4KVOE 2Q7BA 2ATRA 3CXPA 4R87A 1L0CA 1XF8A 2G3TA 3BJ7A 4KOUA 5IB0A 1ON0A 3R9EA 4CGNA 1YX0A 3R1KA 4IF5A 4HNXB 3IU2A 4U5YA 5J8CA 2ZW5A 3BLNA 1RXTA 4NF1A 2Z3OA 4B5PA 4FD6A 3JTKA 3T9YA 3EXNA 4CAXA 1M4DA 2Z3PA 4KSAA 2FL4A 4R3LA 2R7HA 4CRZB 2VQYA 1Z4RA 3GY9A 4A32A 4XPKA 1S7FA 3W91A 4QC6A 2OZGA 2R98A 2PR1A 4HNWB 4CGOA 1QSTA 1YREA 1OZPA 1XEBA 4FD4A 4R3KA 4PSWA 4AVBA 1P0HA 2ARHA 4XPDB 4A95A 3F5BA 5F48A 3PGPA 4ONUA 4QB9A 4QBJA 3QAHA 1MJBA 3R96A 2D4OA 2I79A 3EFAA 4KORA 3TO6A 4AB7A 3VWEA 2DPTA 2HV2A 4ZBGA 3WR7A 1P4NA 2JDDA 3FNCA 4ORFA 4KOXA 4Y49B 4YRHA 2Q4YA 1M1DA 2Z10A 4PK3A 2ZPAA 2R1IA 5AG5A 3UY5A 1YVOA 4U9YA 1IYLA 5AG7A 4YGOA 4PSXA 4KOTA 1PUAA 1RO5A 4UFWA 2Q44A 4B5PB 3TT2A 2YGWA 4RI1A 4KS9A 3TOAA 1Q2DA 1XIXA 1WWZA 2WSAA 3LODA 4A33A 5BWAB 4J3GA 2OH1A 1B6BA 4Y49C 3C26A 2CXAA 4CAFA 3P2HA 2O28A 4UFVA 3D2MA 1QSMA 3V8IA 2OU2A 4A2ZA 3TO7A 3ZJ0A 1KZFA 4XNHB 1NMTA 4M3SA 4C7IA 3IWEA 4E2AA 4GS4A 2BEIA 4MFJA 4CGLA 4A30A 2FS5A 4CYQA 4JXRA 3NE7A 1PU9A 2HQYA 2VZZA 2Z3LA 3H4QA 4LUAA 2CNTA 3FXTA 4B10A 2K5TA 1YVKA 1I1DA 2G0BA 3CXQA 5G21A 4H6UA 3PZJA 4KOYA 3W6SA 4JXQA 1Y9WA 2X7BA 5AGEA 4KZTA 4AG9A 4XNHC 2GANA 2REEA 4JLYA 5F49A 1S5KA 2QECA 2ZXVA 3P2FA 1Z4EA 4F6AA 1IICA 3E0KA 3FRMA 1KUVA 4M85A 1XE4A 4AVAA 1J4JA 1VHSA 5EBVA 5C82A 5E96A 4MFZA 4UWIA 4CGMA 2P6FA 3EC4A 4UWJA 1R57A 1QSRA 1QSOA 3EO4A 3R95A 1Y7RA 2Z0ZA 4MJ8A 5G1ZA 2B4DB 2AE6A 4QVTA 1GHEA 4A31A 3QB8A 2FXFA 4E8OA 5AG4A 3DNSA 3D2PA 3FIXA 2B3UA 4UBRA 3TCVA 5A28A 1KUXA 1MJ9A 4JWPA 5C88A 5ISVA 1YLEA 3TTHA 2DXQA 4KSFA 4OLLA 3TO9A 5AG6A 2J8MA 2FIAA 3R9FA 3TE4A 5FVJA 4CGPA 4HNYB 1YK3A 4UCNA 4PV6A 4YFJA 5EC4A 1YGHA 2Q0YA 3SXOA 4B12A 5JPHA 1N71A 2VXKA 3VWDA 1U6MA 4K30A 1B87A 3S6KA 1Q2CA 4CRYB 2REFA 4QUSA 4XPDC 2A4NA 2ZW6A 2EUIA 4KVXA 1BO4A 4R9MA 4H89A 2RC4A 5HH1A 4NEXA 4U9ZA 4KOVA 4IUSA 4NXYA 5DWNA 3ZZIA 4F0YA 3LD2A 4KLVA 5DWMA 5KTDA 2CNMA 3FB3A 1M4GA 1M44A 1KUYA 2PR8A 1S60A 2P6GA 3K9UA 3SHPA 5IV0A 4MY3A 4CAWA 1M4IA 2FSRA 4RS2A 4KLWA 5G22A 5KTAA 4MFKA 2OZHA 1Z9UA 2CNSA 4DNCA 1S3ZA 4MFLA 5H86A 2YNCA 2P0WA 2B58A 1XMTA 2Z3MA 4I49A 5J8FA 4UA3A 3MGDA 5F47A 3T90A 4CAVA 3FBUA 2PC1A 4BBHA 1LRZA 3TOBA 4B11A 4Q38A 4MBUA 4L8AA 4AG7A 4B13A 1ZO0A 3IWGA 4H6ZA 2DPSA 4KOWA 5IX3A 3S6GA 3A9LA 2OZUA 2B4BA 1V0CA 2WPXA 2FIWA 3N7ZA 2J8RA 2Q4VA 2Z3NA 5F46A 4KUBA 4B14A 2Z11A 2FT0A 4OADA 4MI4A 4C2ZA 2PDOA 1IYKA 1NE9A 2VEZA 4F0XA 2Q04A 2FCKA 4KOSA 1K4JA 5A27A 2CY2A 2J8NA 1I21A 4KVME 3S6HA 3DR6A 1MJAA 4MFQA 4CYOA 2ZW7A 4JD6A 4MFPA 4Q36A 1NSLA 3D3SA 4CS0B 4KUAA 1S7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QML A;  2VBQ A;  4XPL A;  1CJW A;  4NSQ A;  5GCN A;  3GYA A;  2FE7 A;  2G3A A;  2JEV A;  2VZY A;  4L89 A;  2B5G A;  4AVC A;  1WK4 A;  4NCZ A;  5CNP A;  3DR8 A;  3FYN A;  3B8G A;  3IGR A;  4FD5 A;  3RYO A;  2AJ6 A;  4HKF A;  2VI7 A;  2F5I A;  2EVN A;  4FD7 A;  1MK4 A;  2I00 A;  1IB1 E;  3SXN A;  4JJX A;  4OAE A;  3S6F A;  3DDD A;  3BJ8 A;  3F0A A;  1TIQ A;  5I0C A;  1BOB A;  2H5M A;  1I12 A;  2GE3 A;  1QSN A;  1YR0 A;  2PSW A;  2PQ8 A;  3JVN A;  4B5O A;  3EY5 A;  4MHD A;  1FY7 A;  2R8V A;  5H84 A;  1CM0 A;  2BSW A;  2JLM A;  1IID A;  1UFH A;  1Y9K A;  4II9 A;  1SQH A;  3OWC A;  2NMT A;  3D8P A;  5HMN A;  3DSB A;  4X5K A;  2B5G B;  2D4P A;  2C27 A;  2QIR A;  4EVY A;  3I9S A;  5JQ4 A;  1Q2Y A;  2GIV A;  2KCW A;  2B4D A;  4R57 A;  3G3S A;  2ZW4 A;  5KTC A;  3CXS A;  3KKW A;  3I3G A;  2BUE A;  3W6X A;  3JUW A;  3PP9 A;  2PRB A;  2WPW A;  4LX9 A;  2HUZ A;  2B3V A;  2Y0M A;  2OB0 A;  2P6E A;  4PK2 A;  1S7N A;  2IL4 A;  4E0A A;  3F8K A;  3TFY A;  1S7K A;  3G8W A;  3R9G A;  2BL1 A;  2JDC A;  4MY0 A;  3GKR A;  4BMH A;  1VKC A;  4KVO E;  2Q7B A;  2ATR A;  3CXP A;  4R87 A;  1L0C A;  1XF8 A;  2G3T A;  3BJ7 A;  4KOU A;  5IB0 A;  1ON0 A;  3R9E A;  1YX0 A;  3R1K A;  4IF5 A;  4HNX B;  4U5Y A;  5J8C A;  2ZW5 A;  3BLN A;  1RXT A;  4NF1 A;  4B5P A;  4FD6 A;  3T9Y A;  3EXN A;  4CAX A;  1M4D A;  2FL4 A;  4R3L A;  2R7H A;  4CRZ B;  2VQY A;  1Z4R A;  3GY9 A;  4XPK A;  1S7F A;  3W91 A;  4QC6 A;  2OZG A;  2R98 A;  2PR1 A;  4HNW B;  1QST A;  1YRE A;  1OZP A;  1XEB A;  4FD4 A;  4R3K A;  4PSW A;  4AVB A;  1P0H A;  2ARH A;  4XPD B;  3F5B A;  5F48 A;  3PGP A;  4ONU A;  4QB9 A;  4QBJ A;  3QAH A;  1MJB A;  3R96 A;  2D4O A;  2I79 A;  3EFA A;  4KOR A;  3TO6 A;  4AB7 A;  3VWE A;  2HV2 A;  4ZBG A;  3WR7 A;  1P4N A;  2JDD A;  3FNC A;  4ORF A;  4KOX A;  4Y49 B;  4YRH A;  2Q4Y A;  1M1D A;  2Z10 A;  4PK3 A;  2ZPA A;  2R1I A;  3UY5 A;  1YVO A;  4U9Y A;  1IYL A;  4YGO A;  4PSX A;  4KOT A;  1PUA A;  1RO5 A;  2Q44 A;  4B5P B;  3TT2 A;  4RI1 A;  3TOA A;  1Q2D A;  1XIX A;  1WWZ A;  3LOD A;  4J3G A;  2OH1 A;  1B6B A;  4Y49 C;  3C26 A;  3P2H A;  2O28 A;  3D2M A;  1QSM A;  3V8I A;  2OU2 A;  3TO7 A;  3ZJ0 A;  1KZF A;  4XNH B;  1NMT A;  4M3S A;  4E2A A;  4GS4 A;  2BEI A;  2FS5 A;  4JXR A;  3NE7 A;  1PU9 A;  2HQY A;  2VZZ A;  3H4Q A;  4LUA A;  2CNT A;  3FXT A;  2K5T A;  1YVK A;  1I1D A;  2G0B A;  3CXQ A;  4H6U A;  3PZJ A;  4KOY A;  3W6S A;  4JXQ A;  1Y9W A;  2X7B A;  4KZT A;  4AG9 A;  4XNH C;  2GAN A;  2REE A;  4JLY A;  5F49 A;  1S5K A;  2QEC A;  2ZXV A;  3P2F A;  1Z4E A;  4F6A A;  1IIC A;  3E0K A;  3FRM A;  1KUV A;  4M85 A;  1XE4 A;  4AVA A;  1J4J A;  1VHS A;  5EBV A;  5C82 A;  5E96 A;  4UWI A;  2P6F A;  3EC4 A;  4UWJ A;  1R57 A;  1QSR A;  1QSO A;  3EO4 A;  3R95 A;  1Y7R A;  2Z0Z A;  4MJ8 A;  2B4D B;  2AE6 A;  4QVT A;  1GHE A;  3QB8 A;  2FXF A;  4E8O A;  3DNS A;  3D2P A;  3FIX A;  2B3U A;  4UBR A;  3TCV A;  5C88 A;  1KUX A;  1MJ9 A;  4JWP A;  5ISV A;  1YLE A;  3TTH A;  2DXQ A;  4OLL A;  3TO9 A;  2J8M A;  2FIA A;  3R9F A;  3TE4 A;  5FVJ A;  4HNY B;  1YK3 A;  4PV6 A;  4YFJ A;  5EC4 A;  1YGH A;  2Q0Y A;  3SXO A;  5JPH A;  1N71 A;  2VXK A;  3VWD A;  1U6M A;  4K30 A;  1B87 A;  3S6K A;  1Q2C A;  4CRY B;  2REF A;  4QUS A;  4XPD C;  2A4N A;  2ZW6 A;  2EUI A;  4KVX A;  1BO4 A;  4R9M A;  4H89 A;  2RC4 A;  5HH1 A;  4NEX A;  4U9Z A;  4KOV A;  4IUS A;  4NXY A;  5DWN A;  3ZZI A;  4F0Y A;  3LD2 A;  4KLV A;  5DWM A;  5KTD A;  2CNM A;  3FB3 A;  1M4G A;  1M44 A;  1KUY A;  2PR8 A;  1S60 A;  2P6G A;  3K9U A;  3SHP A;  5IV0 A;  4MY3 A;  4CAW A;  1M4I A;  2FSR A;  4RS2 A;  4KLW A;  5KTA A;  2OZH A;  1Z9U A;  2CNS A;  4DNC A;  1S3Z A;  5H86 A;  2P0W A;  2B58 A;  1XMT A;  4I49 A;  5J8F A;  4UA3 A;  3MGD A;  5F47 A;  3T90 A;  4CAV A;  3FBU A;  2PC1 A;  1LRZ A;  3TOB A;  4MBU A;  4L8A A;  4AG7 A;  3IWG A;  4H6Z A;  4KOW A;  5IX3 A;  3S6G A;  2OZU A;  2B4B A;  1V0C A;  2WPX A;  2FIW A;  3N7Z A;  2J8R A;  2Q4V A;  5F46 A;  4KUB A;  2Z11 A;  2FT0 A;  4OAD A;  4MI4 A;  2PDO A;  1IYK A;  1NE9 A;  2VEZ A;  2Q04 A;  2FCK A;  4KOS A;  1K4J A;  2CY2 A;  2J8N A;  1I21 A;  4KVM E;  3S6H A;  3DR6 A;  1MJA A;  2ZW7 A;  4JD6 A;  1NSL A;  3D3S A;  4CS0 B;  4KUA A;  1S7L A; 
#chains in the Genus database with same CATH topology
 2EWB A;  2QML A;  2VBQ A;  4XPL A;  1CJW A;  2IQ6 A;  2PJ9 A;  4NSQ A;  5GCN A;  3GYA A;  2FE7 A;  2G3A A;  2JEV A;  2VZY A;  4L89 A;  4F8Z A;  4ZY1 A;  2B5G A;  3FEE A;  3WC7 A;  4P6Y A;  4AVC A;  1WK4 A;  4NCZ A;  3IIB A;  5CNP A;  3DR8 A;  3FYN A;  3B8G A;  3V7Z A;  1ELL P;  2PJB A;  2CTB A;  2PJ0 A;  3IGR A;  1ARL A;  4FD5 A;  3KZW A;  3RYO A;  4P4E A;  3S9N A;  2AJ6 A;  2C6C A;  4HKF A;  3NH5 A;  2VI7 A;  2F5I A;  3PRT A;  3D68 A;  2EVN A;  2WZN A;  4FD7 A;  4P44 A;  4NFR A;  1MK4 A;  2I00 A;  1IB1 E;  3PB4 X;  3SXN A;  4R8F A;  4JJX A;  4OAE A;  4A39 A;  4P4I A;  2WUU A;  3S6F A;  3DDD A;  3BJ8 A;  2OR4 A;  3F0A A;  4CAE A;  5LYI A;  2EO8 A;  2G9D A;  1TIQ A;  5I0C A;  4C2X A;  1BOB A;  1F57 A;  2H5M A;  3H5Z A;  1I12 A;  1LAP A;  2GFQ A;  2GE3 A;  3FJU A;  1QSN A;  3RNZ A;  2ZEP A;  1YR0 A;  2V8D A;  4LQG A;  2PSW A;  4MHY A;  5HVG A;  2YNC C;  1ZG9 A;  1PYT B;  2PIY A;  2RB7 A;  2PQ8 A;  3B35 A;  3JVN A;  4MCP A;  4B5O A;  3EY5 A;  4MHD A;  2PJ7 A;  2F7V A;  4B6Z A;  1FY7 A;  4IK2 A;  3IJ3 A;  5K8O A;  2HC9 A;  3VAT A;  1Y0R A;  2R8V A;  3RBU A;  3D67 A;  1NSA A;  4OC2 A;  5H84 A;  4NGN A;  4ZYQ A;  3SI0 A;  4C68 A;  2PJ6 A;  1CM0 A;  2BSW A;  2JLM A;  1IGB A;  1IID A;  1UFH A;  4ZX9 A;  1Y9K A;  2CIJ A;  3DLJ A;  4NGM A;  3BXM A;  4II9 A;  5JH9 A;  1SQH A;  4OC4 A;  1A2Z A;  3KL9 A;  3OWC A;  2NMT A;  3D8P A;  3H8F A;  5HMN A;  3DSB A;  4HPS A;  4X5K A;  2B5G B;  2D4P A;  2C27 A;  2Z3K A;  4MHP A;  4MXU A;  3B3T A;  5CPA A;  2GU2 A;  1Y7E A;  5J1Q A;  2YND A;  2QIR A;  4EVY A;  3I9S A;  3FX6 A;  2HB6 A;  1IU8 A;  3NE8 A;  5JQ4 A;  4UFX A;  2DF5 A;  1Q2Y A;  4CYP A;  2GIV A;  2KCW A;  2B4D A;  1ARM A;  4R57 A;  3G3S A;  3NH4 A;  4OP4 A;  1R43 A;  3MN8 A;  1BPM A;  1AYE A;  2YNE A;  2ZW4 A;  5G20 A;  1PCA A;  4CYN A;  1YSJ A;  2PJA A;  4UCP A;  5KTC A;  3CXS A;  3GUX A;  2PJ5 A;  4M6G A;  3KHX A;  3KKW A;  3I3G A;  5HXD A;  2BUE A;  3W6X A;  1YW6 A;  5JGF A;  3JUW A;  2PJ2 A;  3PP9 A;  3BI0 A;  3FED A;  4OKO A;  2PRB A;  2WPW A;  4LX9 A;  2HUZ A;  3FH4 A;  4C7H A;  3B3W A;  2B3V A;  2Y0M A;  4C2Y A;  2OB0 A;  1GYT A;  2P6E A;  2ZED A;  4PK2 A;  1S7N A;  2IL4 A;  2GLF A;  2VL1 A;  5D29 A;  3SI2 A;  4E0A A;  3F8K A;  4UCM A;  3TFY A;  2C1C A;  4FBE A;  1S7K A;  3G8W A;  3R9G A;  3TC8 A;  2BL1 A;  4UIA A;  3IU1 A;  2NYQ A;  1H8L A;  2JDC A;  1M4L A;  4ZGY B;  4MY0 A;  1Z8W A;  3GKR A;  1YQE A;  2AFM A;  1YME A;  1VKC A;  3JRU A;  4KVO E;  4IAV A;  4MMO A;  4O23 A;  2ZEL A;  2ATR A;  3CXP A;  2Q7B A;  8CPA A;  4R87 A;  1VHO A;  2FVG A;  1L0C A;  1XF8 A;  2G3T A;  3BJ7 A;  1BAV A;  4KOU A;  3PEI A;  1ON0 A;  2ZEO A;  4Q7A A;  3R9E A;  3RAM A;  4CGN A;  5IB0 A;  3GIU A;  1YX0 A;  4OIW A;  1JWQ A;  3R1K A;  1XFO A;  1HEE A;  4IF5 A;  4HNX B;  3IU2 A;  4U5Y A;  2C6P A;  5J8C A;  4MCQ A;  3KGQ A;  2ZW5 A;  3BLN A;  1RXT A;  4NF1 A;  2Z3O A;  4P4J A;  4B5P A;  4FD6 A;  4P4D A;  3JTK A;  3T9Y A;  4NJQ A;  3EXN A;  4CAX A;  2ZEM A;  5I4M A;  1M4D A;  2Z3P A;  3CT9 A;  3KR4 A;  5JM6 A;  4KSA A;  2FL4 A;  4R3L A;  2R7H A;  2PJ8 A;  3KQX A;  4CRZ B;  4G1P A;  2VQY A;  1AMP A;  1Z4R A;  3GY9 A;  4A32 A;  4PQA A;  4XPK A;  4CPA A;  2ZEF A;  2PRQ A;  1S7F A;  3W91 A;  4QC6 A;  4X3R A;  2OZG A;  3PBB A;  2R98 A;  3PFE A;  2PR1 A;  4HNW B;  2ZEN A;  4PXC A;  4CGO A;  4RN7 A;  1BLL E;  1QST A;  1YRE A;  2GRE A;  1IOI A;  1Q7L A;  3NH8 A;  1OZP A;  1XEB A;  4FD4 A;  4R3K A;  4PSW A;  4AVB A;  3BHX A;  1TKF A;  4Z65 A;  1P0H A;  2ARH A;  3VAR A;  4XPD B;  3VH9 A;  3L2N A;  4A95 A;  3F5B A;  3LWU A;  5F48 A;  2AFS A;  3PGP A;  1CP6 A;  1TF9 A;  4ONU A;  4QB9 A;  4QBJ A;  2ZEE A;  3PB9 X;  3QAH A;  1MJB A;  3MRU A;  4UIB A;  3R96 A;  2D4O A;  2I79 A;  5EMI A;  4R7M A;  3EFA A;  3IFE A;  3KR5 A;  5HVF A;  3PB7 X;  4KOR A;  2AFW A;  3TO6 A;  1OBR A;  4AB7 A;  4OME A;  3VWE A;  3D66 A;  2EBJ A;  4ZY2 A;  3KQZ A;  2DPT A;  3ISX A;  1QQ9 A;  2HV2 A;  4ZBG A;  4P4B A;  4PXE A;  3WR7 A;  1P4N A;  2JDD A;  3CZX A;  3FNC A;  1HDU A;  2EK9 A;  4ORF A;  4KOX A;  1VIX A;  4Y49 B;  4YRH A;  3IWW A;  2Q4Y A;  1Z8X A;  2BO9 A;  3B3S A;  3D7G A;  1M1D A;  2PJ1 A;  2Z10 A;  4PPZ A;  4PK3 A;  2ZPA A;  3PFO A;  5K8P A;  2QVP A;  2R1I A;  5AG5 A;  2Q43 A;  3UY5 A;  1YVO A;  4U9Y A;  4LQ6 A;  1IYL A;  3WC6 A;  4X2T A;  5AG7 A;  4YGO A;  4PSX A;  4KOT A;  4TNU A;  1XOV A;  4F9V A;  1PUA A;  1RO5 A;  3SJE A;  4UFW A;  1XRY A;  2Q44 A;  4B5P B;  2ZEG A;  3TT2 A;  3NFZ A;  1Z8T A;  2PIZ A;  2YGW A;  4RI1 A;  3B7I A;  3I1U A;  4KS9 A;  3TOA A;  1Q2D A;  3SJF A;  1RTQ A;  3CPA A;  1XIX A;  1WWZ A;  2EK8 A;  2WSA A;  3LOD A;  4A33 A;  5BWA B;  4J3G A;  1LOK A;  1B6B A;  2OH1 A;  4Y49 C;  3C26 A;  2CXA A;  4CAF A;  1ZG8 A;  2O28 A;  3P2H A;  4UFV A;  2XEI A;  3D2M A;  1QSM A;  4M6I A;  3V8I A;  1QMU A;  2OU2 A;  4A2Z A;  3TO7 A;  3ZJ0 A;  1KZF A;  4XNH B;  1NMT A;  1LAN A;  4M3S A;  3IWE A;  4C7I A;  4E2A A;  3K2K A;  2C6G A;  4JYW A;  1TXR A;  4UEZ A;  3QNV A;  1Y0Y A;  4GS4 A;  2BEI A;  2IMO A;  3FVL A;  4MFJ A;  4CGL A;  3PB8 X;  2F8H A;  4UEF A;  4P4F A;  4GM5 A;  4WWV A;  4A30 A;  3BI1 A;  3IEH A;  2FS5 A;  4NGR A;  4CYQ A;  2XEF A;  4JXR A;  1ZG7 A;  3NE7 A;  1PU9 A;  2HQY A;  4ONW A;  1TKJ A;  2VZZ A;  3HLP A;  2Z3L A;  3H4Q A;  4LUA A;  2CNT A;  3FXT A;  4B10 A;  2K5T A;  1YVK A;  1I1D A;  1IOF A;  3D7D A;  2ODF A;  4NGQ A;  2G0B A;  3CXQ A;  5G21 A;  3S9M A;  1TKH A;  4H6U A;  3PZJ A;  4MCR A;  3FMC A;  4KOY A;  4NGS A;  4OID A;  4UEE A;  4JXQ A;  3W6S A;  1Y9W A;  3GB0 A;  2X7B A;  5AGE A;  4KZT A;  4AG9 A;  4XNH C;  2GAN A;  3TX8 A;  2REE A;  3D4U A;  3SI1 A;  1VHE A;  2JEW A;  1S5K A;  2QEC A;  2ZXV A;  3PB6 X;  3P2F A;  4JLY A;  5F49 A;  2PE3 A;  1Z4E A;  2Q4Z A;  1LFW A;  2BOA A;  4F6A A;  1IIC A;  3E0K A;  3H8G A;  2ZEH A;  3FRM A;  1KUV A;  3NA6 A;  4M85 A;  5LYF A;  1XE4 A;  3SJX A;  4AVA A;  1J4J A;  2ANP A;  1VHS A;  2QYV A;  5EBV A;  5C82 A;  5E96 A;  4P45 A;  4YWY A;  3GLJ A;  4MFZ A;  4UWI A;  4A37 A;  4R6T A;  1X10 A;  2OOT A;  4CGM A;  1CPS A;  2P6F A;  3EC4 A;  4UWJ A;  1R57 A;  2Q7S A;  4FWU A;  2PJ3 A;  1QSR A;  4EWT A;  1QSO A;  3QAY A;  1FT7 A;  4EFD A;  3LAC A;  4P10 A;  1DE4 C;  2O4H A;  5THW A;  3EO4 A;  3H8E A;  3R95 A;  1Y7R A;  2RFH A;  3D7H A;  2Z0Z A;  4MJ8 A;  5G1Z A;  2B4D B;  2AE6 A;  4X8I A;  2O53 A;  4MCS A;  4QVT A;  1GHE A;  4A31 A;  1TF8 A;  3QB8 A;  2FXF A;  4NGP A;  1XMB A;  4PXB A;  4E8O A;  5AG4 A;  3DNS A;  5LRG A;  3D2P A;  2ABZ A;  3RZA A;  2V8H A;  3FIX A;  2B3U A;  4UBR A;  3TCV A;  5A28 A;  1KUX A;  1MJ9 A;  4JWP A;  5C88 A;  5ISV A;  1YLE A;  4A38 A;  4MHZ A;  1CPX A;  2XEG A;  2DXQ A;  3TTH A;  3WAB A;  4BMH A;  3KAS A;  2V8V A;  4KSF A;  4OLL A;  2I3C A;  3TO9 A;  1AUG A;  2J8M A;  2FIA A;  4K3N A;  5AG6 A;  3R9F A;  4M6H A;  4BIN A;  3LMS A;  3TE4 A;  3CDX A;  2PJC A;  7CPA A;  1ZLH A;  2AFO A;  4BD9 A;  5F09 A;  5FVJ A;  4CGP A;  4HNY B;  1YK3 A;  1YLO A;  2POK A;  3B2Y A;  4PV6 A;  4UCN A;  1CG2 A;  2V77 A;  4YFJ A;  5EC4 A;  4MHN A;  2AFX A;  2AFU A;  4ZI6 A;  1LAM A;  1YGH A;  2Q0Y A;  3SXO A;  4B12 A;  5JPH A;  1N71 A;  2VXK A;  4OC1 A;  1CP7 A;  3VWD A;  2JBJ A;  4FAI A;  2XEJ A;  3D7F A;  1U6M A;  4K30 A;  1B87 A;  3S6K A;  2BCO A;  4NGT A;  1Q2C A;  1XJO A;  4CRY B;  2REF A;  3T8W A;  5LYD A;  1VGY A;  4QUS A;  4XPD C;  3SJG A;  2A4N A;  3B3V A;  3FF3 A;  2ZW6 A;  2EUI A;  4KVX A;  3K9T A;  1BO4 A;  1R3N A;  4H89 A;  1XBU A;  3ISZ A;  4R9M A;  4W9Y A;  2RC4 A;  5HH1 A;  4NEX A;  4U9Z A;  4KOV A;  4DJL A;  4IUS A;  4NXY A;  4NJR A;  3DGV A;  2IJZ A;  5LRJ A;  5DWN A;  3ZZI A;  4F0Y A;  4RUH A;  3LD2 A;  4ZX8 A;  4KLV A;  5DWM A;  2DEA A;  5KTD A;  2CNM A;  3KI9 A;  3FB3 A;  1M4G A;  1M44 A;  1KUY A;  2PR8 A;  5LRK A;  1S60 A;  2P6G A;  3K9U A;  4KSI A;  3SHP A;  4ZY0 A;  4MY3 A;  5IV0 A;  5K8N A;  4CAW A;  2PCU A;  1M4I A;  2FSR A;  4RS2 A;  3B3C A;  4KLW A;  5G22 A;  3WT4 A;  1BPN A;  3IC1 A;  4OC5 A;  5KTA A;  1ZLI A;  4UF4 A;  6CPA A;  5DS0 A;  4FUU A;  4MFK A;  2OZH A;  4F9U A;  1Z9U A;  1IY7 A;  3N5F A;  2PVW A;  2CNS A;  4DNC A;  1HDQ A;  2Q51 A;  3CPX A;  5IB9 A;  1S3Z A;  2CF4 A;  2ZOF A;  4MFL A;  5H86 A;  2YNC A;  2P0W A;  2B58 A;  1XMT A;  2Z3M A;  3PBE A;  4JZ0 A;  2PJ4 A;  1Z8L A;  4I49 A;  1LCP A;  2QJ8 A;  4EME A;  5J8F A;  4UA3 A;  3MGD A;  5F47 A;  5K8M A;  3T90 A;  4TWE A;  4H2K A;  3FBU A;  4CAV A;  2PC1 A;  4BBH A;  1LRZ A;  1DTD A;  4R76 A;  3TOB A;  1YW4 A;  4B11 A;  4Q38 A;  4MBU A;  4L8A A;  4AG7 A;  4DUK A;  4B13 A;  2J9A A;  1ZO0 A;  3FEC A;  3IWG A;  4H6Z A;  2DPS A;  5D8N A;  4KOW A;  2NSM A;  5IX3 A;  3S6G A;  1X12 A;  3A9L A;  2OZU A;  4DYO A;  3KHZ A;  4GXH A;  2B4B A;  1Z2L A;  3HUV A;  1V0C A;  3RO0 A;  2WPX A;  2CTC A;  5CBM A;  2FIW A;  2WYR A;  3N7Z A;  1FNO A;  1UWY A;  2J8R A;  3V38 A;  3WC5 A;  5LYL A;  2Q4V A;  2Z3N A;  5F46 A;  1CX8 A;  3IO1 A;  4KUB A;  4OC0 A;  4A94 A;  4B14 A;  2Z11 A;  2FT0 A;  2PVV A;  4AXV A;  4OAD A;  2JBK A;  2ZOG A;  4MI4 A;  4OC3 A;  4C2Z A;  2PDO A;  1IYK A;  1NE9 A;  2VEZ A;  4F0X A;  2Q04 A;  2FCK A;  1JQG A;  1ELM P;  4PXD A;  4KOS A;  2V8G A;  5ELY A;  1K4J A;  5A27 A;  4YU9 A;  4IHM A;  4WJB A;  2CY2 A;  1EE3 P;  2AFZ A;  2J8N A;  4MRI A;  1I21 A;  4KVM E;  3S6H A;  3DR6 A;  1Z5R A;  1MJA A;  4MFQ A;  1F2O A;  1F2P A;  1KWM A;  2ZW7 A;  4CYO A;  3S9L A;  1CBX A;  4JD6 A;  4MFP A;  4Q36 A;  5HVH A;  2GLJ A;  1NSL A;  3D3S A;  4CS0 B;  4KUA A;  1S7L A; 
#chains in the Genus database with same CATH homology
 2QML A;  2VBQ A;  4XPL A;  1CJW A;  4NSQ A;  5GCN A;  3GYA A;  2FE7 A;  2G3A A;  2JEV A;  2VZY A;  4L89 A;  2B5G A;  4AVC A;  1WK4 A;  4NCZ A;  5CNP A;  3DR8 A;  3FYN A;  3B8G A;  3IGR A;  4FD5 A;  3RYO A;  2AJ6 A;  4HKF A;  2VI7 A;  2F5I A;  2EVN A;  4FD7 A;  1MK4 A;  2I00 A;  1IB1 E;  3SXN A;  4JJX A;  4OAE A;  2WUU A;  3S6F A;  3DDD A;  3BJ8 A;  3F0A A;  4CAE A;  1TIQ A;  5I0C A;  4C2X A;  1BOB A;  2H5M A;  3H5Z A;  1I12 A;  2GE3 A;  1QSN A;  1YR0 A;  2PSW A;  2YNC C;  2PQ8 A;  3JVN A;  4B5O A;  3EY5 A;  4MHD A;  1FY7 A;  2R8V A;  5H84 A;  4C68 A;  1CM0 A;  2BSW A;  2JLM A;  1IID A;  1UFH A;  1Y9K A;  4II9 A;  1SQH A;  3OWC A;  2NMT A;  3D8P A;  5HMN A;  3DSB A;  4X5K A;  2B5G B;  2D4P A;  2C27 A;  2Z3K A;  2YND A;  2QIR A;  4EVY A;  3I9S A;  5JQ4 A;  4UFX A;  4CYP A;  1Q2Y A;  2GIV A;  2KCW A;  2B4D A;  4R57 A;  3G3S A;  2YNE A;  2ZW4 A;  5G20 A;  4CYN A;  4UCP A;  5KTC A;  3CXS A;  3KKW A;  3I3G A;  2BUE A;  3W6X A;  3JUW A;  3PP9 A;  2PRB A;  2WPW A;  4LX9 A;  2HUZ A;  4C7H A;  2B3V A;  2Y0M A;  4C2Y A;  2OB0 A;  2P6E A;  4PK2 A;  1S7N A;  2IL4 A;  4E0A A;  3F8K A;  4UCM A;  3TFY A;  1S7K A;  3G8W A;  3R9G A;  2BL1 A;  3IU1 A;  2JDC A;  4ZGY B;  4MY0 A;  3GKR A;  4BMH A;  1VKC A;  4KVO E;  2Q7B A;  2ATR A;  3CXP A;  4R87 A;  1L0C A;  1XF8 A;  2G3T A;  3BJ7 A;  4KOU A;  5IB0 A;  1ON0 A;  3R9E A;  4CGN A;  1YX0 A;  3R1K A;  4IF5 A;  4HNX B;  3IU2 A;  4U5Y A;  5J8C A;  2ZW5 A;  3BLN A;  1RXT A;  4NF1 A;  2Z3O A;  4B5P A;  4FD6 A;  3JTK A;  3T9Y A;  3EXN A;  4CAX A;  1M4D A;  2Z3P A;  4KSA A;  2FL4 A;  4R3L A;  2R7H A;  4CRZ B;  2VQY A;  1Z4R A;  3GY9 A;  4A32 A;  4XPK A;  1S7F A;  3W91 A;  4QC6 A;  2OZG A;  2R98 A;  2PR1 A;  4HNW B;  4CGO A;  1QST A;  1YRE A;  1OZP A;  1XEB A;  4FD4 A;  4R3K A;  4PSW A;  4AVB A;  1P0H A;  2ARH A;  4XPD B;  4A95 A;  3F5B A;  5F48 A;  3PGP A;  4ONU A;  4QB9 A;  4QBJ A;  3QAH A;  1MJB A;  3R96 A;  2D4O A;  2I79 A;  3EFA A;  4KOR A;  3TO6 A;  4AB7 A;  3VWE A;  2DPT A;  2HV2 A;  4ZBG A;  3WR7 A;  1P4N A;  2JDD A;  3FNC A;  4ORF A;  4KOX A;  4Y49 B;  4YRH A;  2Q4Y A;  1M1D A;  2Z10 A;  4PK3 A;  2ZPA A;  2R1I A;  5AG5 A;  3UY5 A;  1YVO A;  4U9Y A;  1IYL A;  5AG7 A;  4YGO A;  4PSX A;  4KOT A;  1PUA A;  1RO5 A;  4UFW A;  2Q44 A;  4B5P B;  3TT2 A;  2YGW A;  4RI1 A;  4KS9 A;  3TOA A;  1Q2D A;  1XIX A;  1WWZ A;  2WSA A;  3LOD A;  4A33 A;  5BWA B;  4J3G A;  2OH1 A;  1B6B A;  4Y49 C;  3C26 A;  2CXA A;  4CAF A;  3P2H A;  2O28 A;  4UFV A;  3D2M A;  1QSM A;  3V8I A;  2OU2 A;  4A2Z A;  3TO7 A;  3ZJ0 A;  1KZF A;  4XNH B;  1NMT A;  4M3S A;  4C7I A;  3IWE A;  4E2A A;  4GS4 A;  2BEI A;  4MFJ A;  4CGL A;  4A30 A;  2FS5 A;  4CYQ A;  4JXR A;  3NE7 A;  1PU9 A;  2HQY A;  2VZZ A;  2Z3L A;  3H4Q A;  4LUA A;  2CNT A;  3FXT A;  4B10 A;  2K5T A;  1YVK A;  1I1D A;  2G0B A;  3CXQ A;  5G21 A;  4H6U A;  3PZJ A;  4KOY A;  3W6S A;  4JXQ A;  1Y9W A;  2X7B A;  5AGE A;  4KZT A;  4AG9 A;  4XNH C;  2GAN A;  2REE A;  4JLY A;  5F49 A;  1S5K A;  2QEC A;  2ZXV A;  3P2F A;  1Z4E A;  4F6A A;  1IIC A;  3E0K A;  3FRM A;  1KUV A;  4M85 A;  1XE4 A;  4AVA A;  1J4J A;  1VHS A;  5EBV A;  5C82 A;  5E96 A;  4MFZ A;  4UWI A;  4CGM A;  2P6F A;  3EC4 A;  4UWJ A;  1R57 A;  1QSR A;  1QSO A;  3EO4 A;  3R95 A;  1Y7R A;  2Z0Z A;  4MJ8 A;  5G1Z A;  2B4D B;  2AE6 A;  4QVT A;  1GHE A;  4A31 A;  3QB8 A;  2FXF A;  4E8O A;  5AG4 A;  3DNS A;  3D2P A;  3FIX A;  2B3U A;  4UBR A;  3TCV A;  5A28 A;  1KUX A;  1MJ9 A;  4JWP A;  5C88 A;  5ISV A;  1YLE A;  3TTH A;  2DXQ A;  4KSF A;  4OLL A;  3TO9 A;  5AG6 A;  2J8M A;  2FIA A;  3R9F A;  3TE4 A;  5FVJ A;  4CGP A;  4HNY B;  1YK3 A;  4UCN A;  4PV6 A;  4YFJ A;  5EC4 A;  1YGH A;  2Q0Y A;  3SXO A;  4B12 A;  5JPH A;  1N71 A;  2VXK A;  3VWD A;  1U6M A;  4K30 A;  1B87 A;  3S6K A;  1Q2C A;  4CRY B;  2REF A;  4QUS A;  4XPD C;  2A4N A;  2ZW6 A;  2EUI A;  4KVX A;  1BO4 A;  4R9M A;  4H89 A;  2RC4 A;  5HH1 A;  4NEX A;  4U9Z A;  4KOV A;  4IUS A;  4NXY A;  5DWN A;  3ZZI A;  4F0Y A;  3LD2 A;  4KLV A;  5DWM A;  5KTD A;  2CNM A;  3FB3 A;  1M4G A;  1M44 A;  1KUY A;  2PR8 A;  1S60 A;  2P6G A;  3K9U A;  3SHP A;  5IV0 A;  4MY3 A;  4CAW A;  1M4I A;  2FSR A;  4RS2 A;  4KLW A;  5G22 A;  5KTA A;  4MFK A;  2OZH A;  1Z9U A;  2CNS A;  4DNC A;  1S3Z A;  4MFL A;  5H86 A;  2YNC A;  2P0W A;  2B58 A;  1XMT A;  2Z3M A;  4I49 A;  5J8F A;  4UA3 A;  3MGD A;  5F47 A;  3T90 A;  4CAV A;  3FBU A;  2PC1 A;  4BBH A;  1LRZ A;  3TOB A;  4B11 A;  4Q38 A;  4MBU A;  4L8A A;  4AG7 A;  4B13 A;  1ZO0 A;  3IWG A;  4H6Z A;  2DPS A;  4KOW A;  5IX3 A;  3S6G A;  3A9L A;  2OZU A;  2B4B A;  1V0C A;  2WPX A;  2FIW A;  3N7Z A;  2J8R A;  2Q4V A;  2Z3N A;  5F46 A;  4KUB A;  4B14 A;  2Z11 A;  2FT0 A;  4OAD A;  4MI4 A;  4C2Z A;  2PDO A;  1IYK A;  1NE9 A;  2VEZ A;  4F0X A;  2Q04 A;  2FCK A;  4KOS A;  1K4J A;  5A27 A;  2CY2 A;  2J8N A;  1I21 A;  4KVM E;  3S6H A;  3DR6 A;  1MJA A;  4MFQ A;  4CYO A;  2ZW7 A;  4JD6 A;  4MFP A;  4Q36 A;  1NSL A;  3D3S A;  4CS0 B;  4KUA A;  1S7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...