4L8BA

Crystal structure of the h2db in complex with the np-n5h peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8bA01
2J8UA 4CU6A 4KV5E 4BJLA 2D7OA 4NQUA 4UUJA 2DLTA 3TIEA 3V7MA 4N8VA 4YEFA 5I18L 3IS0X 4NQEE 3WBDA 4LPUA 1LVEA 5ITFB 4IEFB 2PYED 1MRCH 3PWNB 5L88L 2BCKB 2C1PB 1WFNA 3PV6A 4ZSOA 3V7AE 2BNQA 2Z92A 4OIIL 1JUFB 4W6YB 4QXUL 2BNRA 1F4XH 3DUSA 3ES6B 2VAAB 3GJFK 1NGQL 3PP3K 3QUMA 3O3EB 1I3GH 1YMMD 1HH6A 6CGTA 3ECBB 3NTCL 4J3WA 4CMHB 5C0CB 3QQ4B 3O2DH 5TQ0H 1XF1A 5D2NA 4AEHL 5E08H 1RZ7L 5ESAB 5DMKA 3DMMD 2NY6C 4N1HB 4G9FE 2I60L 2WSKA 4N9GB 3A6OA 3ULSB 5ICZA 3PV6B 1TCRB 3SGEH 3RY5A 5CCKH 2VLJE 5CEXB 1P1ZB 3F7RA 3PGDB 1LO2H 4LCCB 1HIMH 2R1WB 7FABL 5I66B 5HHVH 5BS0A 1JHKL 4JY5H 1CICC 4LARL 3VD7A 1YEFH 5LXGL 3M17A 4GAGH 5GS1C 5CP7A 1FVDA 4XI5C 5FOJA 5L7XL 1HXYA 3L3DB 4P5KA 2GFBA 1NL0L 4HFUL 4HHAB 2AJSH 3P11H 3MXVH 3LKOB 4U1NB 3TJHD 4KKBD 3PQYB 4R3SB 3SE4A 4DEPB 2BXZA 3WHXB 2AXGB 5AG8A 5EUOA 3N1MC 2JJSC 1FVEB 4YDKH 2DM3A 4YHYC 4XMLH 1NL0H 2Y7QA 4HFUH 4TUKH 3W5NA 4ENEC 4DUXA 4YUEH 1VEPA 3MO1A 4BSVB 5IK3B 4YXLL 2OZ4A 3U82B 1U0QA 3TBYB 2VDRL 4LFHG 1R3LB 3KHQA 1HCVA 2FO4B 2Z92B 2DQGH 3WHXA 3O8XB 5J13C 1HINH 1G6VK 3MLTB 1LP9B 5E9DE 1ZLUH 3JWDH 1QLFA 5HGDA 4JY4B 4KI1A 4LLMA 3BI9X 1ZWIA 1SHMA 1KB9K 4FQXC 1JFQH 2GITA 4LBEA 2YD5A 4EUPA 3PXHA 1T1XA 4KDTA 3ECBA 4F37F 2H1PL 3MGOA 1VACA 1NEZB 3WXVL 5ITBL 1WBZA 4F3FA 1ZHNB 5CJ8A 3NH7H 5I8CA 4Z7UA 5DMKB 1UENA 4ZYKA 4Y1AE 2H2SD 4H0IA 1GOFA 2ED8A 5IBLC 1ZHLB 4K94C 1YEEH 1YPZF 1EJOL 3EO1A 3MJ7B 1NAKL 5HSFA 2DQUL 3SCMD 4M00A 3L3HB 4CJ0A 4NP4H 5IB4B 1WZ1L 4GRWE 1PJ9A 3GMRB 4AH2B 3KJ6H 1XGTB 5BW7A 1JV5A 2NY3C 3K4ZA 5DFWH 4JQXA 5DEGB 4NGHH 3FKUS 5ID0B 3TESA 1G9MC 2HVKB 2VN7A 2NY0C 2XYCA 3O11B 4U1JB 4HC1H 2ZZUT 3MV9A 1MJJB 4P3DB 3V5HB 3ZKXB 2HN7A 1A4KB 3PGFH 2OJZH 1AXSB 4PP2B 1N26A 1UJ3A 1W8NA 1H8OA 5KAQF 3JV4A 1K8DB 5CWSA 3EYOA 1KT2B 1RIVL 3HE6A 1FGVL 3BAEH 3DGGA 5IHUH 5DSCB 4JG0H 3ME0A 3U0WH 3G9AB 3WS3B 3O6KH 2AJZB 4LVNB 2G2RB 3F5WA 1L7TL 3V5HA 3H9YA 3EDKA 1IJ9A 5F1SA 1A6VH 2C5DC 1RUQL 1TDQA 3VU2A 3RPIA 3CFCH 1IAKB 1HQRB 1AR2A 3TFKC 5DJZB 3R06B 4P23D 4RGNC 3RJQB 1W0WA 4XZUA 1GGBH 2EYRA 3ULUL 1A64A 1DQLL 3BJ91 3GMPA 1CT8A 1S5IH 1J12A 2H9GB 5KOVC 2Y36L 2X89D 1I3RB 4MYWB 1U8JB 2W92A 4WY7H 2E7HA 4NKOB 1PLGL 2DQIL 5E99H 4GAJH 2HTLC 1CQYA 2E6QA 5EOCL 1RJYA 3H3PL 5E70A 1ZLWH 1M6OA 5H8DA 1OL0A 1U92B 4GFTB 1YJDL 4Z7NE 4NO2A 3O8XC 4MD5A 3VRJA 1H3TA 1K3ZA 5DUML 4OGAD 2IG2L 1S7RA 3S6CA 4UV4L 1Q9OB 2VE6B 3P4OB 4HCRH 5FUOH 2A9NL 4OF0A 4YXKL 2B4CC 5JXED 3RWEA 1SJXA 2HG5B 2AJXH 5JOFA 1S7SA 4ZFOB 3TZVD 5BS0E 3VRLF 4GMSH 5I1AA 1AP2A 1T5WB 1DUZA 4LASL 5DJ6B 2IG2H 1BFOA 3E2HA 2D31B 3L95A 3KLAB 1CFSA 1NAMB 1DJSA 1FO0B 4Z7VF 3RVXC 4M9PA 4WW2A 2R56H 4UOJA 3FB6B 5BMFH 3D69A 2YN3A 3SDDD 4JFDA 3B2UC 2YKLL 2X4TA 4K3GA 1MVFA 3H2WA 3UX9B 1Q9LB 1I8LC 1MWAB 3VXNB 2IBBA 1RZJL 4X6DE 3LPWA 4JANB 4MMZC 1XF4B 2RQ8A 5TJWK 5HHNA 4M6OH 4IRJA 1CS6A 4OIBA 1MFBL 5D7JD 3WLBB 4D0BA 1JF5A 3P77B 2E7MA 2YD2A 4U6XA 1MOEA 3VFSA 1PSKH 1G1CA 4QTIL 4JJ5B 1QVOB 2DWEB 3EO9H 2LABA 4HPOL 4ZO6A 2DQEH 1D5MA 3TBVB 1R3JA 2P5EB 1QP1A 2WUCL 1JTOA 3MLSH 1P2CA 1U8NA 1BD2D 4RZCB 3VGFA 5F89B 4MD5B 1J0YA 2YK1H 1N6QL 3B4NA 5GJSH 2WBJC 1S7UB 1BOGA 4UOW1 4JKWA 4DCQB 3HNVL 5I17A 4QWWC 1YEDB 1Q72H 3V4UL 4OLYH 5CSZA 4LLDA 5F3HA 1L7IH 2BHZA 3DVNB 5FF6B 3QNZA 1OAQL 3SE3C 5FOBA 4EOWL 5E6IC 5MHSE 4ONHA 3TIDA 2HT3D 3GHEH 1QFPA 5KSAB 5DXWA 3DWTA 3MNVB 3OJVC 5B38G 2IAMC 4Y8AA 4FP8H 4OLYL 4OSUL 1ZGLM 1TITA 1QRNE 4XH2A 1ZV5A 3FOLB 3GBMH 3G5YA 5FGBA 5FGRA 4Z7WB 1FRGH 5C0NC 1DQML 4Z9KB 4PRIB 4G6MH 5DJ6A 2P43B 3KPOB 3K7UA 4NZUH 3WMSA 2ZWLT 4Y16D 1EEZA 3VXRD 3O3DA 5C0BB 2VLME 3JWOL 4GUPB 1MWAA 6FABH 2CGRL 1MCWM 3MX0A 5KSAA 5B3JE 2CIKA 5GGRB 4LKXA 4WW2C 1DL7H 5A16B 3FRPG 4RSVA 3ISWA 2L0DA 3P9WB 5D9SB 4YFEA 3PIQB 2NXYB 2MFNA 4O9HH 1B0RB 3HFMH 2X4RA 4MA7L 3TT3L 1I8KA 4TRPL 3MLWH 2C1OA 5BCAA 3PP3H 3QR2A 1YUHA 1JK8A 2DI8A 3BEVA 2R0WL 1XF2B 2QHRL 3T3MF 1WGOA 2FX9L 2HLFD 1KLGA 5DJYA 4OLZH 1SMOA 2B5IC 5K9JL 4MCZB 2R2HB 4N8VB 2X4RB 1BIIA 2VDLL 5FB8A 3RHWK 1DQQB 3QJFB 1QR1A 4I0PC 1FYTB 2GYSA 3MV7A 5DTFB 2Q8AH 5IESH 1WWWX 2UWEA 3BZEA 3W81A 32C2A 3O81A 3U7YH 1H9VA 4LHUD 4S0UC 4HBQA 4NO0D 4N8PA 4XWGH 3JSSA 1Q1JL 1WC7A 1HHGA 1NPUA 5DUPL 3RA7L 2KUTA 4IJ3C 5DVMA 4NRYB 4R2GD 3DUHA 4F57L 3DUUA 3VXUE 4Z7WA 3Q5YA 3KPPB 3P0YL 3ULVF 3DROA 1BFSA 4XWGL 1KENH 2VITA 2E7LC 5CEZL 1C7SA 3QIWA 5DJCA 1T1WA 4G6JL 1VGKB 1QFWL 4EI5A 4G8GA 5AYUL 2KQNA 3CX5K 4ODUA 4MAUH 4LLWB 4LU5L 4ZFGH 1UKQA 2WINB 4HDIA 2JTDA 2R29L 1KNOA 2A0LC 1ETZA 1XGPB 4BSJA 5IBTL 4RCAA 4PRPA 1HH6B 1EEZB 3QCUH 1CL7H 2YHGA 3SO3C 2C7UA 4LQFH 1YYLH 2G5BB 1ZANL 3HPJB 3QO1B 3MRCB 4ZAKC 3SDDA 1TZGH 4JAMB 3SKNA 2GTWB 3C60B 3OG6B 1MHHB 4KK6C 5DHVB 4NC1E 2DIJA 5BRZB 5IQ7H 4NT6A 1P7HL 4FXKA 4E0RB 4N5EA 2UWEB 4DTGL 1F58L 3RZCB 1JGEB 4PY8I 1GPOH 2FJGA 1VFMA 5HYQB 4KV5F 1B0GB 3WFDH 2ZJSH 4PUBL 4XCNB 3BESR 5F96L 4JFHE 3S4SG 2AABL 2FH8A 5C3LD 4FA8A 4GXVL 4QYOB 5FUCC 1Z9MA 5AZEL 3QFJD 5A2KH 1FE8H 2AXFB 1A1MA 5C3TA 3TJHC 1PG7H 2Y5TA 4Z7OE 1N5AB 2GJJA 2W0KA 4PRBA 1P4BH 1P84J 4ZTPL 1FL5A 3H7LA 4PYHA 3BGAA 3HAEB 3QFDB 4NC1C 3CX2A 3GI9L 5AEAA 3T3PE 4R7NB 4QRTA 3MA9L 4MA1C 1T2QH 3SGJA 4OZHA 1MCOL 4UU9B 4YQXH 2R0KH 1Y0LB 4K7PL 4MD4B 2VQTA 1U8PA 1DN0A 1I1AD 1LP9A 4PJBA 1D3CA 4WCYH 3WIHH 3ZZ1A 3K74B 2CUMA 4F58L 4U1GB 2EEAA 1S78C 3I3BA 5HD8C 3G6JF 1BEYH 2XY2A 4P2CG 2BCKA 2C1PA 2HH0L 4FMFA 3IKCA 3G6AA 3OQ3B 4MQ7B 2J7LA 4K71C 5FDWB 1IQWL 3O9WA 4XVSL 3QUMB 4ZOEA 3QUZC 1BQSA 3T0AA 5F1IA 5I0DA 1JZ8A 4POZC 3AREB 1OQXA 3X11A 3PWUA 4KDVA 2BY3A 4Y4FC 5HHOE 1DANT 1EH9A 3BIAX 1IL1A 4WU7A 2B2XH 1B0GA 1P7QA 5CJOH 3MYJA 4L8SC 1QPPA 1MCJA 1ONQB 3MLRH 2FEDD 2R4SL 4A2LA 3BH8A 4JRYA 3V0AC 1I85A 5DUBB 1D5BB 3L3HA 5HVGB 1KCRH 3AREA 1YNKH 1QEWA 1YDPA 4KHTH 3MV01 4PJAF 2DI7A 3THML 3ETBF 2B4CL 1G7JA 4HIEA 1PGRB 1WFTA 5JW4R 3QIUA 3HRZB 3WJLC 5GZNC 3GHBH 5E8NA 1JN6A 2QSCH 3IFPB 3NABH 3OJ2C 1JBJA 1CGXA 2OR9L 3WIFA 1IVLA 4D8PB 2NY0D 3BVNA 1TTUA 4JQXC 1X7QB 4CADA 3LEVL 3JWDL 1U36A 5SWZA 1OD9A 1EVUA 3KWWA 3JV4B 2QSCL 3NABL 4S11A 2VDQL 3I02B 1SVCP 3FO0L 5GRUL 4ZUWA 3UJIL 4P9ML 4KPHH 2GAZA 4P9HC 3ZL4H 3CD4A 4M62L 5EBLB 5I1GH 5GXBB 5GISH 5KG9A 3VXQB 2EEDA 2KL6A 4A6YL 3P9LB 3D39D 1A7NL 4DKFH 3V5KB 1E4XH 2RFXA 4AM0B 3NFSH 4LPYA 4PV8A 4JO2L 3NCCB 5KSAC 1G6RL 4M48H 1XF5B 1K2DA 3I50H 4UILH 4CMMB 1EJOH 4BQCA 4WJ5A 1NBZB 3LRSB 4HF5H 1A3LH 2ITCA 1X6NA 1HQ4B 1ZA3A 4MJ5B 1T83C 3QPXL 5GRZA 1NC4D 1KF9B 3G9VA 3GK8L 2BVTA 1DCLA 4S1SH 5F1IB 4MHHI 5JOPE 3VFPA 5I8OH 1NEZA 1DEDA 1A3LL 5I1EH 3F62A 1ACYH 4XNYH 5E95B 1BBJB 1LEGA 3OR7B 1IGFH 4LPCA 4KKNA 5ID1B 2R39A 4R90H 1GHFH 4XRCA 2R69H 1UXSA 3ZE1F 2W1NA 2V5RA 5DGQA 1NCWH 4G80A 1QLRB 2AVGA 3E6FA 1UB5B 4YFLF 5MP6H 1Q0XH 1RIVH 2ED7A 1B0WA 3IXTB 3EJJX 2OSLA 3KHOA 3CX5J 1S7WB 5J1SC 1V7ML 4PGBA 1V5JA 1RHHB 2YA0A 1G7HA 1KXQE 4YNYA 5ESAA 5LWYL 1BIHA 3S8WA 3BZFA 4LNRA 3TZVC 3RAJL 4HS6B 2F5AL 4XMKL 5DJ2A 1KPUB 5T3ZH 1WBYB 4XHJC 4LGRB 4JJ5A 1RJCA 1HXMA 5K59F 1FH5L 3MLUL 4N0CA 3S37L 4NBXB 3IJYB 4R26L 4L4TB 2BDNL 1EUTA 1TQCB 1UM5L 5E56A 4CMHC 1L0YA 2YPLE 3QXVA 4OZFH 3FOLA 3O4OC 3T1FB 1JZ7A 2ZG2A 5DSCA 4GQPH 5FYKE 1LO5A 1HI6A 3PWLB 4JPKL 3S37H 2X9XA 3O3DB 1VPOL 3QEGH 1BAFL 2G2RA 3L1OL 1A7RL 3HHRB 2XKNA 3MJ8A 3QUXB 1QBBA 5D72L 4RIRA 3ZLQC 4XC1H 35C8L 1FZOA 2AXGA 1C7TA 2PYEA 1C1EL 4Q9QL 1EFXA 3VCLB 3C5ZB 4FFVD 5IK3A 5TGBB 2X05A 4OLXL 1RZFL 1MI5B 3CK0H 3F12B 4G8EA 4PGZA 2XTJE 2MSPA 3PDDA 3DECA 2FBJH 3G5XB 2Y06H 3O2DA 1C1EH 4J3VA 4JM4L 2DDQL 3FQWB 5IMOB 1FO0H 5DVNA 3QDME 5TDNA 4FQHB 1JF6A 4TTGA 4HWBH 4Y5XA 5BVPH 4XCCL 1KEGL 1P53A 4P2RB 5LJYH 3QHZH 2PO6B 3GZKA 2EECA 3RNKB 3NCEB 3MUY1 2HT2D 4UNUA 3IFOB 3QI9C 3O4LA 1KPUA 3MV8D 4K3EH 2LAAA 4JN1H 3H0TB 4XXDB 5DJXA 3IJHB 1NBYB 3VMOA 4CNIB 1NFKA 1WBZB 1MLCA 4BK4A 4F3FB 3G5YB 4IDJL 1BD2E 1EAPB 3K8KA 5DRWB 3NIDF 4PJ8B 1NLBH 1CU4L 2VDOL 1JHLH 1FNSL 3CVIH 4WI9A 4NM4L 2WBWB 3P30L 4HS6A 5L9DL 1J0IA 2XZCH 1EVTC 3MR9A 5C0ND 3NCBB 1OGAB 5IOPA 1AHWB 2A38A 4YC2B 5F1NB 4F7CB 3EOBA 1PSKL 5LBSH 4I48B 5GHWL 3BZ4A 4MNGE 4HUKB 2QADC 4J3SA 2HTKC 4NM8L 4XI5D 1QACA 1QO3A 4U1KB 4PRAB 3RUGF 1A3RH 5GGRY 1Q9WA 4L3EA 4P2RE 2A9ML 2VLRB 1FLRL 3LV3B 3RY6A 1VEOA 4KKLD 4U1HA 5JLZB 4MAYB 1WBXA 1KLUB 2PTUA 1NDMB 2NY3B 1AQKL 5AAMA 1RIUL 3F7VA 4NRZB 4PJEA 4I48A 5E1AA 3U2SA 2AEWA 5F9OH 1A9EB 5EORH 3WJJC 5DQJA 1SJHA 1KFAL 4NCDA 5I76B 2VLLB 4MDJB 5D7IE 3S9DB 1NGYB 4WI7A 5DRXA 4JRWA 1DQDL 4RFOH 5EIIA 4N8VG 3CUPB 4YWGL 3HZYB 4HX1A 2D7PA 3C6LC 1IM9B 2V2XA 4HLZG 2F58L 5EO9A 4TOYL 5DR5H 1DQQA 3QJFA 4E0RA 3TBVA 5F7FA 3EDFA 4KJQD 5EC1B 1YA5A 2H41A 2Q6WA 1KIPA 2DLFH 4BK5A 4YK4C 1UYWH 4OSUH 3HZVA 4NKDB 4Y19D 2NLJB 5EN2A 5E5MB 3DXAE 3BW9B 3DV6B 4KZEL 1T7VA 2CDEA 2R0WH 1IM9A 1LQSR 1F02I 3Q2CA 2IAND 1B3JA 1J1PL 5JHDA 6FABL 5E00B 3C09B 5IHZA 4OUUB 4DGIH 2GTWA 4RFNB 4LVEA 4Y19B 4B0MM 2PN5A 5C08B 3MBEB 1AFVH 5JA9A 1FBIH 2WP3O 2WP3T 1PKQB 5I71B 1QBMH 2PR4L 1Q9WB 3U4AA 5JHDB 4DN3L 4PREB 2CKBB 3GJFH 4I8DA 4L8CB 1HXYB 3L3DA 5KSVB 1EEQA 3QXAB 4MAYA 1NGWB 2ZUQC 5DVOA 1OPGL 3VXSD 2D03L 3PQYA 4TVPE 1QLEL 2GW5A 1T6WA 5I8EB 2DMCA 1UGNA 2RAMA 4HIIB 4Y1AA 1GZPA 3AFLA 2KKQA 1KIRA 3TC9A 4OTXL 4OGYL 5IEKA 3TWCH 1BFVH 2BK8A 3VJ6A 5KVFL 5HYEA 2M26A 3JTTB 4PS4H 5CEYA 4K7FA 4GQ9H 2FX8H 3RGVA 3X3FH 1Y0LA 4J12A 4DZ8B 3C5JB 3PG2A 4EUPH 4OCYL 3SE4C 1UB6B 1X6LA 4PJAE 3N1QC 3TN0B 3KPRA 4FOMA 1GZQA 3H7BA 1NBVL 4UAOB 5FB8B 5BOZG 1YY9D 4WWKC 5AD0A 1NMBH 1CFQA 1NGPH 5HHME 2Q6WB 1CDIA 3RWGB 4XVJH 2A77L 2DTML 1TJIL 4FZEH 3MV8B 4S2SB 5CEZE 5FECB 3ZDZF 4R0LC 43C9A 5JQ6L 2OS7A 3Q1SH 1VACB 3FT2A 4NSKA 5BJTB 3GMMA 1S7QA 1U8OA 4I77H 4LCWA 4UTBL 1G0DA 2H2PD 4MQSB 1F4HA 4NJAL 2PF6A 4IIQC 4WU5A 2BMKB 2H26B 3RWDB 3DHJA 1HHHB 2WM0A 3LKSB 4XNXH 4XB8A 5DYOA 4MB3A 3DURB 4UV7H 4GXVH 3BISA 4XTRC 4Z7VB 3IB4A 1F11B 2DBLH 1S78D 3G6AB 3GMMB 5I1IH 1VFOA 3STBA 4NWUL 1TNMA 4DOHE 1IC5L 4Q9RH 3DGCR 1KB9J 3TT1H 1WAAA 3T77A 1LE5B 1RUKH 4L8CA 4LLDB 4YAQB 4M6NH 1RZ7H 2HRPH 4L5FL 3LSOB 5T3XL 5HHMA 3MA9H 5K9OA 5H2BB 3WJJA 5DFVD 4JVPA 4CMMA 3MACH 4OFYA 3QUXD 4Z7VA 1ND0A 4FABH 3RDTB 1NCUA 1T22B 2ZCKL 4HMEA 2MMXA 1PFCA 2K3TA 1TJGH 4LSQL 1LGVA 1UFUA 3GKWH 4O4YL 5IJKC 3HB3C 2CRYA 3LQZB 3TCLB 3W11D 4YBLC 1CDJA 4NPYA 4QGTA 3PE9A 2BERA 5JW4N 3VXQA 4L4TD 1IKFH 3MUGA 4OB5H 3LS4H 4DZBA 3QT2A 4H1LA 3D39A 1UJ3B 3MV8A 1FPTL 1ZXQA 2FWOA 3L7EB 3CFEA 1HK6A 3V0VB 1HQRA 3ARBA 3RTQD 1XCQA 1CTOA 2ICWB 1NCTA 1YMMA 3VRLE 4EDWH 1H3GA 2W0FB 3TCLA 2DQDH 4QLRA 3M1BA 4FFZH 4J1UA 4KHXL 3SOBH 5HJ3A 5I71C 1NMCC 5EOQH 2DWDB 1AC6A 1HHHA 2CKBH 3GJFB 4OBSA 3BSZL 4Y2DA 4OLUH 1ADQH 1S7XA 4RMQA 4R6UA 2VNCA 2ZSVA 5LCVL 5E2TL 2B20A 5C9JB 4CL7A 4LPVA 3DVIA 1HDMA 1FGNL 4O00A 2Y1VA 3P4LA 3BJLA 4R96B 3O6MH 3BKMH 3ORJA 4H5SA 4Z76B 5K9OB 4ONFH 4GBXA 1ZLWK 1HI6B 4QWWD 4XPFH 1F6AB 3FZUD 2APVA 1EFXD 4H26A 1OAKL 3RWCA 3WE6B 2H1PH 1EK3A 5KANI 4RGOL 5HYIA 1EGJA 3O9WB 2BZDA 3UTQB 4KKAD 4TSAL 1BZQK 3HE6C 1R5VB 5L8JB 5JXEC 3AS1A 4KRNA 2JB6A 4M7LT 1I7RA 1OARH 4TSBH 2WWKT 5JUEL 4HW6A 1WV7T 3CXDL 4EI6B 5D7LA 4I3RH 4QF1B 3D39B 3KYKH 4OKVB 2AJUL 4B5EA 2JJVA 2VXUL 3HG1E 5EPMA 1EUUA 2NNAB 5BV7L 1SBSL 3K8MA 4ZNEA 1OLLA 3QWOA 3RWHB 2CK0H 4OZFG 4ZS7L 4PTUA 1MFEH 2ICCA 3C87A 3FO0H 5GRUH 3UJIH 4P9MH 5TDNB 2ZNXA 1QEWB 4A2MA 1CGUA 2AJUH 4Y2DC 3ILPA 1FJ1A 3NCMA 4IDLA 1KG0B 3HR5A 2R1YA 3GSVA 3QPXH 8CGTA 4N0CD 4P2OC 1C12B 2GSIB 1U3YA 4UIMA 5ETUB 1IEAB 4APQD 3LZFH 1IM3B 2X2YA 2X4NB 1NLDL 4M9OA 4PTTA 1NAKH 3T3ME 4E5XB 5HGAB 5TH2A 3P4MA 5GS3A 3ULUD 3BVNB 1NKRA 4P5TD 3GI8H 4JVWA 4QHLA 4PJIF 2FGWL 4LKCA 4XP4H 3BP6B 4FNLH 3MJ6A 4XHJD 1I9RL 1ZA6B 4JFQA 1JWMA 3O6KL 4RMWA 1PQZB 1A3QA 2H32H 5HDBF 4NHUA 4KROB 3LD8B 1YMHB 2FGWH 2Q7YA 4G8IB 1A6VL 4L3AA 1RUQH 5E2VL 3ZE1E 1LO3L 2ARWA 4YBQD 4M8QB 4OGXL 3MJ8B 1H3UA 4QHLB 1YEDA 3UZVB 1H15A 5HVFB 3QQ3B 1R3KB 3OB0K 4PY7A 4K2UH 1KYOJ 3BAEL 3ARFC 5L2KA 3VFRA 3BDBA 3NPSC 4MWFB 3LN4B 1NCCH 2Z93B 1TVHB 4PGEB 5T3ZL 3PDOB 3CU1A 5I6XB 3AXLB 1EIBA 3QRFM 1T1ZB 3VFWA 3EOTH 4YXHH 4YGAB 4M1GH 1MFNA 4DOHB 1CGWA 1QA9A 2BNQD 2AV1B 2WBJA 2XRAH 5CMAA 4YX2L 4MD4A 5E6IB 4KY1H 4MDJA 4E42B 5FM8A 3AU1A 5FOBB 1FJ1B 3U0PA 4FQ2H 2XTLA 3LIZL 4LEOB 2NY5C 3V4PL 2HMID 1YY8B 5DD5L 4LLMB 1H3PH 5LAXA 4E41B 2ARJQ 5JZ7D 5DUMH 3FOMA 4KY1L 4Y4KA 1U3ZA 1MHEB 2EYTB 4UV4H 4X5XB 5T33H 3D0LA 2QV2A 4L9LA 1MJUL 1ZKAA 2EIZB 2H32B 2WK2A 3ZYJA 4NUJA 3IDXH 5KS9A 5E5MA 1MH5A 1QQDA 1NBYA 2PUQT 2FR4B 1GSMA 3H3PH 4LASH 1ZHNA 2YEZA 4MS8A 1QLFB 1HHJB 3I2CH 4PJBF 5J11C 3MV7E 4IRZH 1IL1B 1GRWA 1SJEA 4HJJH 4Q97A 1Y6MR 3G08A 1EO7A 1YECH 3PNWB 2QQNH 3PL6A 3IDNA 1UCBH 3QRGH 5E8OB 4R3SA 3HNTL 4G43B 4Q9QH 4OCLC 3S7GA 4MD0B 2UZIH 3GMQA 1CBVL 2YKLH 1L6XA 1TENA 5CGYD 1LDSA 3BDYL 1HHJA 4G6KH 2Y4SA 1W72A 4MJID 4PJIB 2VIRB 4PG2A 3ARBC 5CZXD 3TBTA 2Z91B 2UZIL 3WDHA 4QEGA 1EFQA 4DAGH 3E3QE 3IDMB 3OR6A 4HEPG 5HDBE 5EZLA 1R24A 4RFEB 5MEOB 5J6GA 2V9QA 2WIMA 1I9JH 2ZPKL 4OFPA 2ITDA 2F19L 4ZOAA 4Y19A 3QXUA 4I1NB 2OI9B 5GHWH 1CDYA 4WENB 4Z8FH 4KWUA 5KOMC 1HHGB 2YD6A 4U1IA 4FQPA 4WHTB 1GIGL 1I1AC 2X1QA 1MFBH 4PLNC 3D9AL 4QXTB 2OX5A 1FNEA 5DD3H 4IDJH 5FCUL 4H0GA 5FYKU 2ICEA 5B8CB 3BQUA 3R1GL 3GM8A 3BP5B 3OXSA 4HIHB 5FYLE 2ERJB 4E41A 2VISA 3U79A 1NAMH 2MCPH 1WIPA 1JP5A 5H37H 4EUPG 3MSPA 3QIWD 3CVHB 1ZVHA 4POZD 2QEJA 2IBZY 4NO0B 5MI0C 4TSCL 4ZQKA 4PJ5B 3FN3A 2FB4L 2EH8H 3RVWD 2H3NA 3B2VL 3D2UB 3IF1A 4PGCA 5ANME 5IB3B 4X4MA 3H9SE 4S1QL 3O6LH 1BGXL 2A6JB 2PXYC 3S5LB 4YXLH 2G5BA 4Y19E 3L3IB 4HUVA 3G6JE 2FB4H 3QEQD 3KAAA 1J0HA 4P5TA 3C9NA 3F7QA 4XP1H 4KMQA 3ARDA 1U8JA 3OAZH 1FLTX 3EDJA 1XF3A 2VLKB 3HI5L 4K07A 3DO7B 2LAGB 5T1DL 1RZJC 1EHLL 1E28A 4TUOB 4YPJA 2VXTH 5DK2B 3MRGA 7CGTA 3ARVA 4N90E 2K7QA 4M03A 5E7BA 1LWRA 4YFDB 2ZCHL 1Z5LA 3CVHL 4X6CF 1UH3A 3H9HB 1NEZG 3EYVA 3MRFB 4GH7B 4EDXA 4F9LA 3GSNH 4JFFB 4GMTH 2VR4A 2CLZA 4IOIB 1U3HD 1AI1L 3RY6C 4PJ7A 3LQZA 4PRHD 4GLRH 4OM1H 4GMTL 1C5DB 1IAIL 1J8HE 3HC0A 5FV2A 2FO4A 3SPVA 3EYVB 5KSAD 1G7LB 2NR6D 4HKJA 4PJCE 3OX8B 4AG4H 4X7SH 3S4SA 4KH2A 5FYJD 3WCYA 3L5WA 3QG7H 3P4NB 2CDGB 1MREH 4WDIB 3ZKND 2EDEA 4RWHA 5GPRA 3SE8L 2WANA 3VE0B 4QOKA 1SY6H 4K9EH 3VFTB 3BP5A 3OXSB 4MNGB 4NQED 3NCYS 2PYEE 5DMGD 2BC4A 5DLML 4CVZA 3H6JA 1QFWH 2BMKA 4MX7A 4HUWA 4QRQB 3BH8B 5K9QI 4GW1A 1JMXA 3C8KA 2I27N 1XF4A 5T1MB 5IKCA 2EZ0C 1NBVH 2VKWA 3SY0B 5DLMH 2OP4H 4JGJA 4XTRD 2BFVH 4XVJL 1PAMA 1HDMB 1AP2B 2Q3ZA 3BXNB 2W9DH 4NDMB 3V52L 5E8NB 4GRLC 3JTSA 5A40E 4G6JH 3AB0B 1U8IA 2L7JA 1L7TH 4I77L 1CFSB 2ARJA 2VAJA 2UVFA 1VKXB 3RI5F 3LMJL 3MRRA 2ATPB 3DJ9A 2V2TB 3EFFA 2F53B 2R2BA 3N85L 1EEUA 3DI3B 3KYOB 4FHBD 1IAMA 1RK1B 2EIDA 4FTVB 3ULUH 4OZHE 3C60C 3QUYB 2JB6B 4ZAKB 3OHXB 2DJSA 1BP3B 5I1IL 1I9IH 1G9MH 3VRIB 5D7LB 1EO5A 2X09A 3LKRA 2GJ6E 5D8JH 4XX1E 5CWSB 4GSDH 4PJFE 1C08B 4JY6B 4L4VB 4PRNA 3IXAA 5CLTA 4Q6IB 3MRMB 3V9FA 2C3WA 4HH9A 4KQ3L 3TZVB 5GRWA 2Z8SA 2AW2A 2PCPA 4BFEA 5IR1B 2JK5B 4XCEA 5JW4M 1A9BB 3UTPD 1ZA3B 4MJ5A 4K8RL 4NZTL 1BQHB 4Q9CA 1CE6B 4HC1A 3GKWL 5CJBA 3W0WD 5CD5D 2ZUUA 4WW2F 3OG4B 4P4KC 1IC1A 4NSKB 3AAZB 5FYJU 3IT8D 4XNQB 4PJGA 1N3NA 2CDFB 4YBHA 5AZEH 3U7WH 3VXUD 4GMSL 1M4KA 1T7YA 3QQ9C 4M1CC 4WU5B 3TNMA 3TPUE 1YUHB 4IJ3B 4N0RA 3MRJB 3GNMH 1YN6A 5J57B 5EZOH 4F15C 2AV7A 1U91A 3MNZA 4MNHA 4N0FB 2HWZH 1KB5B 3MBXL 5KZCB 4O5LH 4JFXA 2E6JA 4UT7L 3DV6A 4YHLL 1MRFL 3BIKA 5EBWA 3VFGL 4G9DA 3FZUC 3BSZH 4YDKL 1CFBA 2OR7A 1MHPL 1UG9A 1MCHA 1PZUB 4Y5XC 5HHVL 3QDMA 2VUYA 4IRSC 3T8XB 2ESVE 5FHAH 2X89A 4FQLH 1BEYL 1K4DA 2DJUA 2WNGA 4G8FB 4PB9L 1MHPH 3C2AH 3RDTA 3FMGH 1AD0A 1KCRL 1UT9A 3ARRA 2HG5A 4GW5A 5C0DB 5IGXL 2DQJH 2AV1A 4Y5YC 1KNOB 2I26N 3INUL 4OCRL 5C0CE 4WGVB 3C2AL 3T8XA 4IHOB 1OP9A 5IWLC 1NJ9B 5FAAA 1JFQL 3FRPA 1TMCA 3DETD 3VG0L 1R3KA 4BQ9A 5L0QB 5DJ0B 5J9PA 5KVGL 1N3NB 2CDFA 5J89A 1S5HB 2FZ3B 3CXDH 3O41A 4QRRA 3O6ML 2XA8L 4OFYD 1J88A 4U05A 1JYNA 3VG0H 4GS7B 1S9YA 4N0UB 4QRPB 3MRJA 1LK2B 3ZHLA 4Q2ZB 5I1DB 1DZBA 2VXQL 4BZ1H 2GEEA 2FD6H 4DGVH 5T3XE 2HFFB 5HI5C 2FJHB 1E6JL 1YEEL 4RGOH 1DQJB 5D5MA 3PNWA 4X8JB 3B9EA 4Y5XB 4JKPL 5EO0B 3PWPB 1SVZA 3RKDC 1TZIB 1Q38A 4FQ1L 4KUZH 5TF1L 1AGDB 3B6SB 4ZMAT 4IIQB 3RGHA 1SM3H 4ELMB 3HC4L 3MCLH 5ILTH 1N59B 2X7LB 3IS1X 4Y4FA 4DN4L 3JVGC 4YZFF 5JA8B 2CGRH 5EUOE 3GI8L 1KB5A 3AXLA 1FL5B 3QI9D 3GB7B 4XXDA 4EI5B 4MXQC 1N4XH 1I1CA 4JQVA 2APTA 3QQ4A 4ZFZA 1YPZB 3SGKA 4DCQA 4FQQA 4X6EA 4X7DC 5AWNL 1D6EB 5KANG 1TJHH 5IB5B 1OD7A 4JG1H 1C5BL 3QH3B 4IMLA 2BSED 2BVQB 3GBLA 4X6DF 2R69L 1TQBC 1KOAA 4OGXH 4PRBB 3DXAB 1QSFD 4MQTB 3IDIB 3CFJA 1JGLL 2XT1B 5DFTA 3HE7D 4FXGA 2YN5A 5E1HB 1ZGLA 4NQEA 2ZOKB 2SEBA 4LPTA 4O2FB 3S35H 3BWAB 2WQ8A 2D0FA 4R90L 3P3YA 2BNQE 4WI4A 1KTKE 1DQTA 1IEAA 4LNVA 2BNRE 3U0WL 1A1OB 5IMMA 3QIBD 1FAIL 4RMUA 4P4KA 3CUPA 3CVHA 1KJ2L 2X4SB 5KVDH 2ZUQB 5F9DC 5B22A 4KAQL 2NY1D 3D85D 4MD0A 3CFCL 2SEBB 3U4BL 3FQTB 2P47B 1ZA6A 3HS0A 1WBXB 3L3KA 4JFEE 4MZ2A 2EXYD 3VI4E 3M8OH 4H8WH 2ZOLA 2Y36H 3OBAA 2XTJC 3UO1L 1ZTXH 5BRZE 3DMMB 5BO1L 3TVMD 3D39E 3DX6A 3ARGB 3I2CL 5CZXC 3WHE1 4CADB 2YPKB 3HLAB 4X5WB 4Y5VB 4LIQH 2APXA 4J1UB 3EJYC 1MVUB 5D96C 3I02A 1CDUA 2Z93A 3G6DL 1I7TA 3ARWA 4ODWA 4UQ3B 2A6IA 1QFHA 3J8F7 3C6SA 3ZE2E 1BVLB 1OOAA 3ZDYE 5IHBA 3D3VB 1U3HA 5L88H 1FO0L 1D9KB 4HBCL 3KXFA 5JTWA 1FN4A 5EUOF 2CSPA 3CC5B 1YQVH 2YRPA 4EVNB 3O2VH 4PREA 3NN8A 4JFEB 3RU8H 4YHNB 4OLXH 4FZ8L 1HILB 4P3WA 3UAJD 1NCBL 1JPSL 5FA4A 1P9MA 1RFDH 4LSSH 5I15H 4ODXB 2AEPL 4M43H 5IMMB 4G3YH 1JYXA 4AMKH 2LU3A 3WYRA 4W4OA 3ZSTA 4JRXD 5E8EB 5ADPL 1RFDL 2CDGA 2P8PB 2VLMD 1CU4H 4M6AA 3BRDA 3CLFL 5T5NF 1AGFA 3MOAL 3S5LA 5FA4B 4U7SA 5CILL 1AKJB 5FKAA 4QGYA 2A1WL 3NIFE 4MVBC 3C60A 1EMTH 4L4JA 1F4WH 3QWOB 1T2QL 3FB8B 3LRGA 4IS6B 4YHZH 4UT6H 5EBGA 3I6LE 2P24B 3HAEH 4JZOA 5ALBL 3WN5A 4ZUSB 5LQBL 5TFSH 3HMXA 3OKLA 3WEXB 4ESKA 5GRJH 1RHHA 3PHOB 1A7QL 2VDOH 4NKMA 4CVXA 3HZKA 2X1OA 3L6FB 3QWQB 1PG7W 3MOQA 3LCYA 4UT6L 1FP5A 3FO1B 4G80B 3UPRB 1GZQB 3MLZH 1AXSA 3W9DA 4QYOA 3SE3A 5L0QC 4LKCB 3R1GH 2XZAH 1N6QH 5GJSL 4PJXE 2I07B 4RWYL 1FFNA 2A9MH 3FN0L 1QHPA 4ZSOE 1BOYA 4O02L 4XP1L 5T1MA 4HZLA 1NCAL 2BY2A 3LB6C 4YNYB 5CIPH 1B2WH 4UT9L 2AJYL 1A6ZA 3NA4A 4LMQI 3PV7A 2XY1A 5E94B 4ZAKA 3UTSA 1ZS8A 5MERB 1A5FL 3BKJH 4DQOL 3V6FB 2VDRH 4Z7WE 3LQMA 3WD5L 2WLZA 4Z7VE 3OGCB 2IJ0C 2VTFA 5TPWL 5BOPA 2AQ1A 1J1PH 1F2XK 1MAJA 3GSOA 3KS0H 4FQJH 4FQIL 2F58H 1YEHL 3S97C 4M4RA 5I1LA 5CJXC 1UEYA 1A14L 2A2QT 1OTSD 4JE4B 3ZDZE 2W07A 4UDUA 2VLJB 3EYFA 2QHRH 4LOUD 4X99B 1MLBA 2J5LB 1AFVL 3EDEA 4PLKC 4GAYA 4OF8A 4F8QA 3QA3A 4PPTA 4XP5H 1MCWW 2UUDK 4RFNC 4V3DB 4P2QD 3V79C 2XACC 2VZVA 4GRWH 1J8HD 3U46B 2AXJA 2GUOA 1EXUB 4JM2B 2IADB 4KPHL 1B6DA 5DHXB 3MLXH 1MCNA 4TTDC 3CDGB 1G7MB 5D1XB 4LNRB 5GSRB 2I9LB 5EU6D 3S3JA 4UINH 1PX4A 3CDYA 3D85A 4JFDB 4PJHE 5A2FA 4DKFL 5DUPH 1EZVY 3WXWL 1AI1H 2VZUA 3RTQC 1U93B 4X9HA 3CFDA 4AT6B 5MENB 2EKSA 2W59A 3BPCB 1G7JB 4NQCD 3PHOA 4NKMB 4YLQT 1L0QA 1P4LB 4M7JL 5KVEH 1NQBA 5E2JA 3L7EA 4P5TC 4GO6B 5IESL 1SYSA 4YDVA 2E9WA 1MIMH 3OHXA 4HKZB 3O45A 3EJZC 3NFNA 4IRJC 1HHKA 4WFED 4F7CA 3STZA 3HE7A 3LN5B 1RVFL 3QIBB 1CGYA 1P5UA 5EWIL 3JXAA 4N8CL 2DQFA 3RA7H 1FZJA 1EO8H 2F74A 5F6HJ 2FATH 5BZWA 4LRIC 4LQ1A 3RL1A 4R96A 5D1QC 5C7XH 1BFVL 1QSFA 3MNZB 4L9LC 2CLVB 4MNHB 2VH5H 4N0FA 3RZWA 4KMLB 1BQLL 5D5MF 4BZ2H 4U1HB 1S5IL 5EWIH 5J8OA 1CG9A 4RX4D 3SDAC 3T0XA 3IDYC 5A3IC 3F7VB 3HE7B 4NRZA 3P0VH 1PG7X 5GGQH 2CRZA 4ORGA 3SJVE 3OX8A 5I1HL 4PJHA 2IALB 3X3GH 1CWVA 5AYUH 3DXAD 3DYMA 4NJAH 4WFFE 5J9PB 4EZMA 3GSOB 2BOCB 3LEXB 1I9IL 4N0YL 4MSWB 4HQQL 1NBQA 3OKMB 3VA6A 3U1SL 4POYA 4UTAL 5F9AC 1DQLH 1KCLA 4OZFA 5I18H 2AK4D 1F4AA 1ZE3C 3MA7B 1OSZB 4X4XA 3Q48A 4N1CA 3STLB 5LGHH 4WUUE 5E4IA 3ARFB 4RGMC 4H20H 5TE6L 4RNRB 5IF0A 3W5MA 2MPAL 3MV9E 4S10A 2I24N 4GAJL 3TH2T 5HBBA 5FYLH 3TO2B 2P5WB 5C0EA 1HYRC 1GAFH 2AGJH 2PO6C 2D4DA 3IGAA 4NDMA 2F54D 5GIRA 4FTVE 4ZS6C 4JPWL 1ZWIB 2E7CA 1T20B 2XPGA 1BECA 1NGXB 4H20L 3N1FC 3QNZB 4OZFB 1VFBA 43CAB 3BD3A 3IDJB 1WIUA 5IHLB 1KCSL 5SWSA 3GIZL 3HZVB 4PTUB 4TVPD 2ZJSL 2DAVA 1FL6A 1T04A 3IFLL 5CEXA 1U8HB 2NW2A 1CQKA 2NY6D 5C8JB 3QUKB 2ZUSA 4HCRL 5FUOL 4OI8A 1F6FB 3MRPA 3VXMA 3DUUB 4XWOD 2CRMA 3O0RH 4IMLB 5EFIA 3UP1A 1JVKA 5KS9E 1PG7L 3MCG1 2ICWI 3O2WL 5TH2B 5IB1A 5F7MC 3U0TA 4YIQA 3MV11 5AUMA 3UROR 3LDBB 3U2SB 4TULL 1NUNB 1PKQA 3QWRD 2YUXA 2OXGA 4X80H 3BZEB 3AGVA 2BRRL 4LLWA 4WTZG 3NIGE 2AJ3A 1MRDH 1E28B 4TUOA 3U4EB 5JR1L 1EZVX 1N5YL 3OPZL 4Y4FB 1X5XA 3AS2A 4L8BA 3TV3L 3D5OF 4LGSB 4PJ9B 5EU5A 3LKPA 3UTZB 5EZOL 2D7QA 5J7CC 1KTDA 3U30C 3IDGA 5FA3B 4X80L 5HHMD 3RVVC 4K7FB 2DD8L 1HH9B 5CLWA 5IGXH 2IPKA 5CKGA 5CHNB 4U6HB 4YHIB 1DQJA 5D5MB 1FNLA 5EN2B 1KTLB 1NEUA 2Y5EA 3HE6B 1OQOA 1HYSD 4EEEA 4PLJC 1OAYL 2APBA 2DLIA 1Z3GH 4HEME 4U7KA 2HJFB 4TQEH 4AENB 2ADIB 2AJZA 4ODUB 4NKIH 1LK3L 1SMAA 2W0PA 4XPHL 2IPKB 1RMFL 2EDYA 4D9LH 4LSPH 1U91B 4J3XA 5GSVB 1ETZB 5LBSL 4N5EC 5FKPA 1INEL 1S9WA 1A21A 3ZT6A 1DDHB 4KFZC 4FP8L 1G7IB 5MI0B 4XVTL 3VG9B 3FQRB 4BZ1L 5D6CA 12E8L 2YRLA 4LEXH 2AQ2A 3FFCE 3KXFD 4CVZB 1BLNA 3G08B 1MHEA 2EYTA 4KVNH 2ERJC 2VITB 3GSRA 3MUZ1 1LHZA 4Y4HA 3C8KB 3GSNB 2XG5A 4Y8DC 1LP9E 4RISH 4GG8A 1OAZL 3B8SA 4PG9A 4RAUB 3KGRA 2OR9H 2GY7B 4GRWF 4ZUVA 1RURH 2DQUH 2NPLX 1XH3A 4QTHB 1FYTE 1HWGB 2X6MA 3W82A 5A2LH 3MLWL 4LSDA 2P45B 1OAZH 2WQRA 3TYGH 5ANMB 3KYKL 5TF0A 3RNQA 4K94H 5DWUH 5T5FL 1FCGA 3QZWG 2PTVA 4YHKH 5BQ7B 1J0JA 1WQVT 4XBPA 2A6DB 4LCCA 1P84K 4HUXA 3FCTA 3SO3B 3FB7B 1BWMA 2XOTA 3QXWA 1XH3B 4QTHA 2ILLA 5ERWA 4ODWB 1BPVA 5CBAA 4OLEA 4OQTH 1X5GA 3NMEA 1SEQL 4J8RB 4HS8H 5IQ9B 2Z91A 1KN2H 1NDMA 2FLBT 5JORA 1L8JA 4I4WB 5DC9B 2F53D 4G7VL 5KW9L 3SBWC 2Y07H 3MYJB 1Q1JH 1QBLH 1SEQH 2FX9H 3FCTB 1DSFH 1YEIH 4JB9L 2DQCL 3QPQC 2A83B 1QFUL 4NO5B 3FQRA 3PGCA 4KVCL 1F5WA 2FIKB 2XTJD 1BVKB 3GGWA 1KENL 2R9HC 2G9HB 2WIIB 1KIPB 1KJ2H 1Z2KA 4Y4HB 5JXAH 2X4PA 5KVDL 4L3CB 4KXZH 1NMAH 2GK0B 1UH2A 4FFYH 4OCNC 2R0ZL 3H42H 2PYFA 3W9EA 3BIBX 4JRXA 1AO7B 4Z6AT 1CD1B 1OB1B 5DURB 4C56D 3FO1A 2GT9A 3QZWA 3FFDA 3EOYG 2DS4A 4U2YA 1D6VH 4JDTH 4XNQA 5K33A 1K4CB 1UM5H 2IBZX 3K2MC 4LAQH 2N1KA 2O5ZH 1DLFL 1KPRB 2J8HA 2HTLD 3UBXG 1R5WB 3VRJB 2MNUA 1DLHA 1IC4H 1BAFH 1OP3K 3KPLB 1A7RH 4GG8B 3U9PH 1JWSA 1AO7A 2FECL 4JZJB 2R1XB 5IB3A 5HY9A 1S7UA 2GY5A 4GRLD 4WWKB 5FM5O 3UDWA 2JCCB 2N4IA 4U1GC 3N1PC 4OD2B 4PJEF 1MQKH 3SKUD 5F7NC 5D2LA 4IRZL 4CRPA 5EU4A 1VA9A 3P40A 2E27H 1A6AA 3X12A 1I8IB 3D25A 5TDPA 1PZ5A 4GKNA 4OM0L 2IH3B 2YC1A 4WW2B 1IGMH 1RZKC 4OT1H 3L1OH 4GAYB 5IEHB 1KTRL 1ZANH 1MJUH 3IJSA 3OAYH 3N9GL 4G6AD 4NO5A 5FEBA 4OIIH 1JWUB 5IQ9A 5EU6A 3ALWA 3BPNB 5KJRH 5H94A 4Y5YB 4I4WA 2HKHH 1HKLH 4L8DB 5D7IA 1T1YB 4KK5D 1S9VB 4AEHH 2MKLC 4NQDE 3UYRL 3S4SB 4NRXB 3U9UB 1GPOL 2NR6C 4DFIA 2VB5A 3QZWB 4WEBL 5EZIL 2V2WA 4P46B 4NWUH 3RU8L 4G8GD 2IMNA 3RQ3A 5HHXL 4LCYA 3TFKD 3K8LA 3RZCC 4HWBL 3OKDB 4GW4B 1D5MB 1X5KA 4U33A 4I0PA 3QSKB 4JFQB 4P4KD 1FE8L 3EO9L 3MFFB 2OK0H 2PW1B 5T3XH 1UEMA 2NCMA 4OQ1A 2V6HA 2PYFB 1A6ZB 3CMGA 4NRXA 1F6AA 3F65A 4OZGE 4P2QA 3V5KA 5C0AE 1X5AA 3STZB 3MXVL 1RZGB 1CT8B 4P3CH 1BF2A 1KIQB 5F3HB 4K7PH 3WSQL 4CJ1A 4P5MA 4X6CB 4OLVL 1E4WH 1DE4A 2PW1A 2V5MA 4YPGA 1Q72L 3RUGE 4EI6A 2X10A 1FAKT 5J6HA 4YK4B 1YC7A 3CVIL 2YZ1A 4XB7A 1U8MB 2UYLB 3MLRL 2FSEB 2OBGA 1A8JH 4IRSD 5LQBH 1DQDH 3FO2B 4ZUTB 2GJ6A 4PLKD 5IB5A 2A6KA 1QFWI 5D2NE 3LH2H 1U8IB 1UM4H 3GBML 2YA2A 4MNQE 4HULB 5F7UA 2N56A 3BGFC 1HHKB 3BKYL 4JM2A 3ZE2F 5TDPB 5LAXB 2EDLA 1F6LL 3TH3T 5GS0C 4MA8L 3VFWB 1UA6L 4O2EB 1M1SA 2XA3A 4WV1A 3O6FC 1MY7A 2C4FU 4WGWB 5KN5B 5C6TL 4FQJL 3D0LB 4OZGA 1NANH 1CI5A 3FN0H 4X5LA 3RIAF 5ACZB 5MENA 4MJIB 1UA6H 1TVDA 1BGXH 3B2UD 5H94B 2ZCHH 2C3VB 4RX4A 4J3OC 3MGTB 2V7NA 4G6FB 3MRLB 3BKML 1A5FH 3BKJL 4WW1A 1AGEB 1S9XA 2VSDA 1T03L 1YMHA 2J6EA 1NCNA 1FORH 4M61B 1EEYB 4OV6F 1Y6KR 3F58H 1WZKA 3WO4C 3NGBC 3HI5H 4XPTL 3FT3B 3K4DA 3FT4B 4JHZA 3E2HC 1MCCA 5JPNB 2FR4A 5IR1A 1QRND 3LKQA 8FABA 3MFFA 3QO0B 1P2CB 1U8NB 3HMXH 4U49A 2PW2B 5CEZD 3D0VA 2EDWA 3WXVH 5ITBH 3MROA 4HF5L 2GSGB 4AG4L 2UZYB 3ROLA 4LCWE 5C09E 3VXRA 1S7TA 1DBAL 5D2LF 4FFWC 2WBJD 3KPPA 5FXCH 4WO4C 2R1WA 4LLYA 3VWJB 3NFSL 3QDMB 2OYPA 4DK3A 3KPSB 4WHYH 5KVFH 2A6IB 5AG9A 4WWID 2MWCA 5E6ID 1A7OL 4R8WL 4Y4KD 4BQBA 1KC5L 2BNQB 5FM5M 2V9TA 2AEQL 1WAAE 2YUWA 3CXHJ 3QHTC 5MEOA 2XN9D 2BRQA 3RWFA 5EIIB 3MLVL 3LHPH 3V6BR 3BUYB 1I1YB 5HHQA 3WIHA 3HE7C 3KPMA 4PRHA 4UBDC 3SJVD 4BKLA 2HP4A 5I66A 1GHFL 5F3BB 2DLEA 3ULVC 3RWHA 3ZT7A 5IM7A 3TA3C 1GL4B 2J8UE 4N0YH 5EU5B 2VDML 3O8XA 1UKTA 5L2JA 1I8KB 3PABB 4G43A 4KROD 4KRPC 4RA0C 3VDBA 5JLZA 2XG4A 1JF1A 1XF2A 1ZSDA 2V7NB 2W9DL 3MRLA 2GHWB 5F7DB 1NFIA 1IGTA 1OP3H 4EIZC 1D5ZB 3V7AG 1FDLH 4WUUD 5GRXG 4X7TB 4JPKH 1T0NA 2X4NA 1KYOK 4Z7UF 4M7LL 1JGVH 4P5TB 4QHUB 3TN0C 5CJ5A 4NO0A 3EYUH 2FZ3A 3O41B 3UZQA 3MXWL 3MBEA 2DBLL 5H35A 2XWJA 3ZHDA 4JZOB 4ZFOL 3MC0A 3NPZB 4APQB 1FH5H 1NC4A 3MLUH 4X0KA 4JRYD 5M7QA 1PQZA 5HI4C 1IGTB 2VZ3A 2QADD 5HYJD 3TF7C 1ZEAL 1FNHA 3L5XH 5J1AB 5DRNB 4PRHE 3WS6C 3BN9C 2X5PA 4R7NA 5DRZA 3BPOB 3S3PA 4KKLC 4F7EA 5C0AA 4KRLB 4N0UE 3RVVD 3TO4B 1W2KT 5DRXB 4JFZH 5SWZB 5IHZB 5J4MA 5F6IB 3FJTA 5HYSG 4Z95H 3L3JA 2CUHA 4JFYB 4AIZB 1MCOH 5DHYA 1UM6L 5B8CC 5L6YH 2ZNWA 2JJTA 2NTFA 4HUMB 4B50A 5HPMA 4PJEE 2NX5A 3MGOB 2OL3B 1T5XB 4PBXA 1YPZA 2OR8A 1YEGL 3SE9L 3MOBL 3B9DA 1QA9B 1KEML 3IFNL 4M02A 3SHSA 1RUPH 4AEEA 4KJQC 2X1WL 1FZKB 2R2EA 4UQ2B 1YN7B 2ZUTA 3U7WL 4XNMA 5C0IB 5HHQB 1ZHBA 4LVOB 3H8NA 2A6JA 2AEIT 4G6KL 4WHYG 4YHYB 2XIDA 4CGTA 4HS3A 5EBMB 5IT2L 3HKFA 1P7QB 1RUPL 3CFJB 4Y7MA 4JGUA 2G9HA 2WIIA 5F3BA 1MF2H 4QRQA 1RK0A 5DQ9A 4QRUB 3BPOC 3MCKB 4HWEL 1A1NA 3BH9A 4Z7QE 1RQ5A 1MFAL 1E6OL 3NIFF 1INDL 3MRQB 4ACPA 2XQBH 1MUJB 4JN2A 1CICB 4LCWB 2FEDC 1FV1A 2R4RH 4XP6L 5C0JB 5IFHL 2YXMA 2DD8H 4QTIH 4KHXH 1E6OH 4TNVK 3IDNB 1I85C 1JHLL 1HEZB 1XGYH 3OKKA 3C6LB 1CLOL 2EDNA 3TN0A 3TBWA 3WNKA 1J1OH 3NAAH 3MRKB 5FO8A 3FONA 1JPFA 3MLSL 3FFCD 3KXFE 1EERB 1J05A 2CLZB 4CVUA 2D2OA 2M1KA 5FIEA 4ZXBA 3C5SB 4KI5D 5SWSD 4JREB 5SX5H 3EJYD 3T77B 2VIRA 1TLKA 4YR6A 4L29A 5HVHB 1CFVH 1GOHA 5HHOD 1GGTA 3RGVB 3ZDXE 1YEJH 1T89C 3VXMD 2E9JA 3D3VE 4GKNB 3W0WE 4OV5A 4YHIA 4XPFL 3RDTD 1OAQH 3CFIC 4FQ1H 5F9OL 3JV6A 3LDBC 1Z0NA 5D2NC 5C0IA 5I2IB 2YMXH 5EUKA 4K71B 2WAHA 5HY9B 3I50L 1F3JB 5FECA 3NIDE 2NY2B 3VD3A 1FBIL 5KSBA 2R2EB 1DR9A 4ZD3L 1DVFD 5BV7H 3DNKA 4GBXC 3SDXB 1CICA 3GK8H 1JRHL 5K9JH 3VWJC 3EZ8A 2LTQC 3EZJB 4BFIA 1BLNB 3I9GH 3T08A 5ICXB 1IGJA 1MCQA 1A9BA 2EDKA 2DQCH 3ARQA 3MCKA 5IFJB 3DX8B 3X13A 4FQCH 1NH6A 4Z77A 3WKML 3WS6A 1J7VR 2I5YL 1KJ2A 5D7JA 4WTWA 1R3HB 1XFPA 3ARSA 1RJYB 3QULB 4U6YA 1NSNH 1O7SA 4S1RH 3WEXA 5GS0L 3KLAA 4F80A 5JXAL 4DJMA 3IU3B 5JNYA 3VH8B 4JZNA 2ORBL 2VERN 2B8OT 3VGAB 3Q5OA 1CF8L 2Q76A 2NY5H 3FB6A 4C56E 3V6OA 4DN3H 4LCUA 1AH1A 2AV7B 1H8SA 4RRPG 1DSFL 4JKKA 1X7QA 4YXHL 2FEEL 3EDDA 1LEIB 1VGEL 1KJ2B 1E4KA 5I16A 3UYOD 4FN0A 1LO0H 3WE6A 1VSCA 1XGTA 5I19L 4P2OB 1BM3L 4PP1C 4KQ4H 1T5WA 3SDAB 4QOKD 5JOPD 1JZ5A 2R29H 1G7PA 1NFDF 1NMBL 4CUCA 4EQ2A 3TWCL 2WV3A 5F6HI 5CJXA 1H8NA 3SKJL 3QJHB 1Q8MA 5DD0H 4JKLA 3W11C 4QF1A 4JDTL 5F7HA 3EOTL 5FYJH 5CEZH 2J4WH 4M1GL 1T2JA 3Q1SL 3PWVB 4KAQH 3VXSB 5C2UB 3UPCA 3C5ZA 1G84A 1DEEB 2F9BT 3EYQC 3DI2B 1UC6A 3UC0H 3EYFB 3V6FA 4DKAA 4K3DH 3LS5L 3PWPE 4B7LA 4WI6A 3QJHA 1ZAGA 1BZ7B 4I13B 4KUCD 3KLHD 1VESA 3RPIB 5HGHA 5A2IH 1YQVL 3MBED 5C08D 4MJ6B 3B43A 1AXTH 3N06B 5FM4A 1MFDL 5IG7B 3KPQA 2EYSB 2JIXB 3E8UH 3SGJC 1MIEH 3WUWG 5DA4A 4UDUB 5D1XC 5HGGS 4U0RC 1A6UL 4NQDD 4M6NL 4LSSL 2B7DT 3VGGA 1NGQH 2I9LA 3OKEA 4YHOH 1P5VA 3O4LB 1FNAA 4NQDB 5FYKD 4G8GE 1CN4A 2JIXD 5DHVH 1YECL 3W39A 1QSED 3JWOC 3EYSL 5JQHC 4CNIA 4NOBA 2R1YB 1M7IA 1JPTL 3IU3A 3O2VL 5SX4I 4F9PC 1I9JL 2XXCB 1TVBB 3AY4C 1I7RB 1IC5H 4Q9RL 5E0QA 1IM9D 3B83A 3HI6L 1F4XL 1NLBL 2RCSH 4UI2A 1S7RB 4OKVA 5DMJB 2EDRA 3P2TA 3V5DB 5IV2B 3MACL 2UY7A 5EULV 3QG6A 5LXGH 4GAGL 5BVJA 4OLVH 4UIKL 5D6DC 4HMDA 4N90D 4MAYD 4ODTL 3BPNC 4YBLB 1G7PB 4HXBH 1NC2A 5J1TC 2ZPKH 3R4DA 4HKZA 3AU1B 4WO4A 4NQCA 5DI8A 4XVUC 3T4YB 5CFHA 3OB0H 2X4QB 1NGYA 4HXBL 4OCWH 4ZOBA 1GIGH 1ITBB 4N0CC 4P2OD 4CKVX 5BVJB 3VXSA 1CE1L 3WL9A 3BN3B 1B0RA 1OGAD 5D70H 2CLVA 3QNYB 1E4WL 2M2DA 5JPNA 4PLOB 1KCUL 1FGNH 3C08L 1U8KA 1V3MA 4EDWL 1EBPA 2IAMA 3GMLA 4Z78B 2YUZA 4WUKH 2X4QA 4X7TA 4HG4K 2EXWD 3TJEL 1KCUH 1K9TA 3C08H 1ADQL 2YSSB 2GIYA 3ESUF 1I1YA 2DQJL 1UM4L 4G8EB 5DJAA 2APWA 3QEUB 1WTLA 4LDLB 3NIGF 5KSUB 4JLRA 4N5ED 2PO6D 4FFWD 1XGUB 4P2RD 4BUHA 3DUSB 3ES6A 3RL2B 1G0XA 5GGUB 2AERT 5DRNA 2VXUH 2X42A 4C54A 1Z0MA 1JMZA 4MXWH 3WFCH 2AKRA 1OTTC 3SKMA 4CN1A 5BXFB 1FIEA 2NY2D 4JRXE 1FIGL 4HUUB 1FNGA 4H1LH 4Y4KC 5T1DH 2AXFA 1X4YA 5I1CH 4UUJB 4TSAH 1A14H 1D5IL 2J6EL 5DVKA 4ZTOL 3V6OE 3FN9A 3VD5A 3BP7A 3ZTJG 1JL8A 4GKZA 3HUJA 1AR1D 4NGHL 2HMIC 1OPGH 5BZDA 2AKRB 2D03H 1DVFA 2X4SA 3NCJH 4EBQL 1MREL 4NQVA 3M17B 3TNNA 2VXVL 3BE1L 4KK9D 4XP4L 3I6LD 1IFHL 5DK0A 5I1KH 3ELAT 2AJVL 2BSRB 3T0EB 5EOCJ 1HILA 5F1NA 1D5XB 3VD9A 3LKOA 5I74C 2R8SL 3MGAA 4ZFFB 1G6RH 2GJ6D 2IH3A 2YC1B 3HPJA 5T1KD 2XN9E 4M61A 4Y5VC 5I1KL 2Q87A 3PL6B 3MRIB 2AJVH 5IHUL 3AVEA 3PXJA 3LHPL 3MRBB 1XR8B 5FDWA 3HPLA 3QNYA 2B1HH 4RAVB 4IS6A 3DRTB 5FO7A 3HLAA 2YPKA 3PWNA 2WUBL 3C6LD 1HYSC 3DTXB 1U42A 5EC1A 4F9LC 1N5AA 3D18B 3HMWL 4WVRA 4OZHB 4UU9A 2BP3A 1V7MH 3RL2A 3AROA 4H1LB 2W9LA 3BW9A 3SDCD 5JIHA 5C0RH 5D71L 2A77H 1MCFA 1TJIH 1AD9B 4FZEL 2BSSB 1IZJA 4NNYB 4E9LA 3R8BB 4WY7L 1UJTA 1YYMH 4BYHA 2VL5A 2LFGA 2FJFA 3VG9C 1BQLH 1A1NB 3BH9B 4ZDHA 3HRZA 5T5NG 2HFEB 4I18B 4LLQA 2XNAA 5GGQL 1OAUL 5BXFA 3ROOB 4BH7B 3ZTNH 4XMKH 1TCMA 4TVSa 5KSVA 3JV6B 4P2QE 2B0SL 3FAXA 1LE9A 4K3JL 4M3JA 5SX4H 1JGVL 1IQDA 2W91A 3S88H 4HKXB 3RWIB 3ZTNL 4LCIL 1T22A 4ZNCD 2WINA 1JIBA 5I8CB 3B9KC 4POUB 2HYMA 4JHAH 4CAGA 1ODAA 3D6GA 3TCXA 3C5SA 1QD0A 1JGDB 4PGCB 1CBVH 1CFNA 3G5ZB 3MREA 4NNPH 1TETL 4LAJH 4NQCE 5JORB 5DEFA 2VMFA 4Z7UB 1LD9B 2CIIB 1TXKA 3VFNA 4PP2A 1DFBH 2QADB 5HYJB 3TFKA 4JFFA 4PJ5E 1OVZA 3PHQB 4IMKC 4AIOA 4JRYB 2NY0B 2CMRL 5FGCE 1YJDC 4UT7H 3QFJA 4GXUN 2HVKA 5EUKB 3QPQD 4PV9B 4X9BA 3JTTA 1CL7I 5CEYB 3ILPB 1JGEA 3NZ8A 3MRGB 1A4KA 1LEKA 3VH8A 4WUUB 5T3XD 3UJJH 1P69B 1IILE 1YEGH 3X14B 5BVPL 3I85A 2BHYA 1T4KB 4NOFA 5IMKA 1FG9C 2ZSVB 3EYOB 1KSRA 1RZ8B 4KI5C 3E6FB 1QLRA 3IKKA 2J1KA 4OLUL 3OGCA 1NCDL 1VKXA 4O5LL 2DQTH 3MRDB 2DI9A 1NC2D 4WFFD 3TLRA 3GMOB 3HNSL 1A2YA 1DBJL 4IRSA 1BVLA 4YE4H 5BW7C 4RGMB 3VFPB 1AGBB 1FG2B 4FQXB 3HN3A 3V4UH 3VRIA 1F4WL 1BX2B 4M7ZC 1AQKH 4S0TD 4KJPC 3FQNB 1RIUH 4PB9H 4D0DA 4R4ND 2DQFB 2EH8L 4LEXL 4PY7B 1C08A 1KJMB 3PWVA 2XQYG 3MREB 1K2DB 4DFHA 2QQKL 3WUZA 5DS8B 1JWSB 4NM8H 5JXEA 5D93B 3MRRB 2EDXA 1DQMH 2BJMH 4KDWA 4ZXBC 2WBJB 1INQB 3NFPB 4PJ7F 4MQXC 3LAFA 3PF2A 4R4BB 2OZ4L 2EZ0D 3LEXA 1A6AB 3O4OB 1KXVC 4LP4A 3O6FD 3HC4H 1XR9B 3T09A 3J7HA 1IBGH 1WUNT 1U92A 5KTEL 3ARBB 4JY6A 4L4VA 5HDLA 3V95A 5JMOC 4Y2DD 4NWTH 1BF8A 1H3VA 2P1YA 2ATPA 4AQOA 4Z7WF 5KTEH 2OMBA 1NDGA 1IGIH 3MPCA 1N6VA 2YPLA 3RZCD 1I7ZA 2DIBA 4PJIE 1U95A 5TE7H 1W0YT 1FO0A 3GBNL 1SM3L 4G6FD 5E9DA 2JELH 2FECI 4HAFA 1MFCL 2JJSA 4OM1L 5BRZD 2ATKA 3AAZA 3SDYL 3C60D 4R97B 4LHUG 4QXGL 3HG1D 5J56B 2GTZB 1UADC 3GSNL 1ADQA 5SV3A 4FS0A 4XNZC 2CRIA 3QUYC 3HTLX 5IB2B 1T1ZA 3H42L 4JHWL 5FGBC 4YIQB 1F4YH 5K9KB 1QSEA 3ZMRA 2VDLH 1KACB 4OFDA 5I1AB 1KPVB 1UACL 1INQA 3NFPA 4JFOB 3X3FL 5GS0H 1TVBA 4CW1B 3ARFA 4X4YB 2YBRB 2RJMA 4LAQL 1C16A 4OD1H 2EYSA 2JIXA 4DK6A 2YD4A 3WKNA 1VADB 5I30L 4ODSL 4MB4A 1AD0B 5I1DA 4FQ2L 5IBTH 4FFYL 4RMSA 4F57H 2IWGA 3V4PH 1LO0L 4I2XA 3TF7A 3UTQA 3A6BH 5DT1H 1FNEB 4JFXB 2VQ1A 1UCTA 3BMWA 3N85H 5JIPA 1J86A 5JZ7C 5IVXA 2F5BL 1RV6X 3GSUB 5D1ZC 1QSVA 5C6PB 2NY7L 4D94A 1AGDA 3B6SA 4PJ8A 1FYTD 4UTBH 5ISZB 5IWLA 3SDCA 1A4JA 4NN7C 1ZT4B 1EEYA 3B8YA 4YDJA 2I9TA 3EOBB 4XBGB 4ODHL 2CR3A 3T0DA 4W4NA 2HFGL 3UO1H 1MUJA 1MY5A 4Y0GA 4OZIE 4ZO8A 3GSUA 1NFDB 1SBBA 5JQ6H 4XAKE 3ARDD 3WFBH 5GJTH 1CZ8H 4WFGD 4ODHH 5EU7E 4UDTA 4D9QD 2BVQA 5IVOA 4NQSA 5AZ2L 5IOPB 3KVQA 3EO1B 5FV1L 1R5IB 3SGDI 4J4PA 1AXTL 4G3YL 4I5BA 3D1MC 1P4IL 1FC2D 2PKDA 2HKFH 3BP6A 1P4BL 3LKQB 3PIQA 4TVPL 2FBOJ 3EO0B 3ARBD 1FFRA 1GJIA 2V2XB 4OD3L 1QNZH 4HFWB 3CLFH 2HJFA 4KKBC 2NLJA 3O6FB 1MRCL 3QUZB 4GKSB 4O2FA 4PRID 4PRDA 4WHTA 4TUJB 3WNPA 4H25A 3IETB 2W0LA 4UIKH 4IOFD 1R5IA 1IKFL 1MHCB 5BQ7A 5E8DH 2R23A 3VGEA 1JHKH 3BPLB 2BXYA 3MRIA 2CDEB 2W9EH 1JZ4A 3D9AH 1RU9H 3NACH 5DJCB 3OKMA 5TFSL 3H9ZA 1A22B 3WFEH 2MQ0A 1CIDA 5E8DL 1ORQB 2I60H 2PXYB 1KBGH 4BA8A 9CGTA 1X4XA 2XV6B 3GUTA 1CE1H 1T7ZA 4GKOA 1OGAE 5HHPA 3S34H 2MHAB 2X40A 3FQUB 1ZLVH 5E6IA 1WC7B 3ULVD 3FO9A 2HWZL 3FMGL 3AUVA 4ONGL 2HAZA 4FQXD 4NN6B 3H7BB 5LCVH 2BHUA 1N7ML 3OKNB 2P5ED 2IQ9L 1PW3A 4LF3B 4Y4HD 5JDSB 2CJUH 1WISA 1OWWA 2FJFB 4S1QH 5C1MB 4U0QB 2F8OA 2GK0A 2XTJB 3SOBL 3DXAA 4DQOH 4QHKJ 1RIHH 2IQ9H 4LRIA 5D7JB 1A47A 3MRPB 3GHBL 5IBLD 1CK0L 3OXRB 1OAYH 4P46C 4PJIA 3R8QA 4FQIH 1M6OB 3VH8G 3SCMC 3SKNB 4TUJA 1LK3H 5FYLD 3DURA 3GJEA 1IT9H 2AJYH 2R23B 3B5HA 4HLJA 1HINL 1SJVA 3CXHK 2V2TA 3FB5B 4DEPC 3ZDXF 5IEHA 5I74B 4JCMA 2J6EH 4M7KL 4MDIB 4ZTOH 4F37K 2BNUA 3KPRE 5HPOA 4JGMA 1JGDA 3LKNB 3KR3L 1IT9L 3MZTA 5CIPA 1Y18B 4KK6D 1MEXL 2D31A 3L95B 2NY1C 1I1AA 3AMKA 2ED9A 1MHCA 4HGKC 1T1YA 3WFCL 1OARL 4TSBL 3C5JA 1J8KA 3JUZA 1P9MC 3QEQE 4XCNA 1N4XL 2Q20A 4WHDA 4XMPH 4NNXA 5ESVB 3UJTL 2VDKH 5C0AD 2IPTL 4PJHF 1K4CA 1VERA 3OSKA 4XC3L 5DJAB 3SDCC 3UBXB 4BFBD 1DBKH 3VMPA 4DUVA 5F9WC 5J11B 5E2UL 3TVMC 4HK3J 1W8OA 2FX7L 4HGWB 5BRZA 4P23C 2AK4A 4I2XE 3QIWC 1LDPL 3FO9B 4YAQA 5C0CA 1WZ1H 2ICEB 2ICWA 1DBAH 3RZCA 2AS5M 3CC5A 4ALAH 1OSPH 5E2VH 1HWHB 4FRWA 1LO3H 2CIIA 2BVYA 3VFNB 4ISVA 3EFDH 2CXKA 2DOCA 4OUUA 2P7TB 3IKCB 4R0LB 4G42A 4P23B 1KN4H 3F7YB 1K5NA 4W4OC 3I75A 1I9RH 1NCCL 4S1DC 4NZDA 5A43C 3WN5B 5E5UB 3AS3A 5CSGA 3MUGB 4UAOC 2QKIA 4OZIA 3CH8A 4GG6F 5FYJE 3MQIA 4H0HB 5JHDE 4YR6B 1QHOA 3IRZA 3T0EA 3X11B 2G75A 3VFUB 1NCWL 4HIJA 5D6DA 1DBMH 3K1KC 1BZ9B 5D71H 5IB4A 4GG6E 2W0FA 4PJ9D 4Y4FD 1EDQA 5EOCH 3QA3B 3PL6D 4J23A 5GGTA 5DZNA 4RAVA 5T1KB 5T33L 2GJ6B 4PRIA 4K9EC 3LD8C 2P46B 4F2MA 4PJFF 1H0DA 4P3DA 5DI8B 2YD8A 1DLFH 2JJUA 4PJCF 1XGQB 4L9DA 2J2ZA 4V1DA 5F21B 3U1SH 2X9YA 1GC1L 4NC2B 2JB5H 4UTAH 2FH6A 3WV0A 1RZFH 5F8QC 4JFZL 2QSQA 3PWUB 2ZSWB 1S5HA 3DX7A 1MNUH 1I1FB 2BVOA 4K8RC 4KTDH 5CD5C 3RWGA 3ZE0E 4G42B 4H5SB 1BJMA 1I7UB 1OLZA 4YDIL 5D72H 2E27L 2F8VA 3SGKC 3BDYH 4JPWH 1QYGH 1OB1A 3MLYL 3SQOH 4YXKH 2GJZB 2HJLB 2QQLL 1CXHA 2D0HA 2VXSL 3P4MB 4PJXA 3JVGA 5C9JA 4LSTH 3FT4A 3VI3F 4DGYH 1FSKB 3QIUB 3QIBA 2XWTB 3P9MA 1N5YH 3OPZH 1MCDA 5DEZA 1A6TB 2A6KB 4K3EL 2IC2A 3GSXA 3SQOL 3VFGH 3DX8A 3X13B 4HJ0C 1U9KA 4ELMF 2DDQH 4DW2H 4PR5B 5D7LE 4JPVH 1LILA 2Z9TA 4NZJA 1T21A 5EDXA 3UTPE 1KEMH 3IFNH 3O9WC 4ZFZB 5I15L 4FQLL 3SKOB 3VFOB 2QKIB 1IARB 1FNSH 3HNSH 2D0GA 5DQDH 5TE4L 3PJSA 3DSFH 4PJGF 5ALBH 3CLEH 4PJCB 3W0WA 3TH4T 2YBRA 3BPLC 1V3LA 2YWZA 4MWFA 2C3VA 5E6YA 3BUYA 3OR7A 4V1DB 4NKIL 4MS8C 2GCYB 3REVA 5JW5A 1T3FB 3OV6A 3KYOA 1PY4A 5DZLA 4HWEH 5I75B 4KXZI 3QAZC 5IVZA 4BZYA 2IGFH 1L7IL 3N0PB 3NVQA 1FVCA 2DQEL 5F70A 1C8PA 4NHCH 5MEQA 4S0SD 3EAKA 1LK2A 5IFHH 2LU4A 1AJ7L 2QR0B 1I7ZB 5F7DA 3OWEA 1CE6A 3S96B 4UIMB 2MQCA 2EH7H 2F53E 1FZOB 1OT2A 4Z7UE 2IGFL 4BKLB 1M7XA 5D7IF 2VZ1A 3D69B 5DR5L 4TOYH 3ZT5A 3NAAL 1S7TB 3MRMA 5DHVA 5TGBA 1HSBB 1NFDE 1WEJL 1WT5A 2FO1A 1MPAH 2ADGA 5D1XD 3U36B 3ZYOA 4YGVB 4KUZL 1EHNA 4RIRB 5EORL 4KGJA 5TF1H 5C0CD 2BJML 3MUJA 4JM2D 3TYGL 4KVNL 1T7XA 4E42A 15C8L 1NCAH 4NN7B 1WEJH 2OSLB 4HD9A 4P2QB 3OMZA 1NUFA 1QSEB 3BIKB 5EBWB 4KK8D 5C6TH 3QNXB 4D0DB 1JZ6A 4QHNA 4JJHA 2PYEB 3RVUD 3T1WA 5GGVL 3O4LD 5F72S 5F1KC 4D3CH 15C8H 3EO0A 4MXQD 4JFYA 4NO2B 4AIZA 3MODL 1G6RB 1TVHA 4RGNB 2CO6B 4KJYA 3SDYH 5IFAL 1MCRA 1HXMB 4GBXB 1ZHKA 5JIKA 3DO3A 4W6WB 4O58L 2ADFH 3QUZA 4GKSA 1BOGB 3DHMA 5DRZB 1OF2A 2D7TL 3RHWF 1JUFA 1CDBA 4F7MB 5IVZB 4X98B 1DUZB 3ABZA 1YEIL 4JB9H 5EUOB 3PABA 1X44A 4TRPH 4URTB 4XBEH 2ADFL 5IF0B 1VB9A 1Q0YH 1K6QH 3MO1B 5D2NB 1O7VA 1Q9KA 1F2QA 1OWRM 3U6RA 1JNLL 2A0LD 1A1OA 2X1PA 4ODXA 4XVUD 4OTXH 1MIML 3MLXL 4QHUA 3DETC 2PR4H 4QRUA 3UZEA 4L9LB 3KG5A 3ERYA 4OD1L 4EN3B 3UTSD 3H0TA 3MMEA 1FL6B 5D1QB 3CMOL 5GGVY 5I75C 3BQUB 2Q8AL 3QIBC 4NFDA 2VYRE 3GRWH 4R97C 2VJXA 4IRJB 3WO3B 4KI5E 2BFVL 5SWSE 1F4YL 3OF6A 5E9DB 4AL8L 5J6GB 5DK3A 2OTUB 1WIOA 2NXZD 4J2XA 1QO3B 4U1KA 2LVCA 4OGYH 5E8OA 3ZE0F 4EN3A 3NCFB 4P2YA 3VXME 3JV5A 3C2SA 4ZPTA 3P0YH 3QCUL 1E0OB 1AE6H 2NW3A 4PV9A 2AJ3B 2DTMH 1PDKA 2EDDA 4PJDB 3UC0L 4ZUSA 1R0AH 2XFXA 1IGCH 4I0PD 3P0GB 1SYVA 3VI3E 1TZGL 2NZIA 3G5VA 4BZ2L 3HAEG 3TGXA 5B39B 2W65A 1FSKC 1L9MA 3SGEI 1PKOA 4RBPK 1G9ML 1REIA 1F3DH 4R4FL 3ARXA 4X4YA 3S5LG 5ESQA 4JDZB 4LVOC 3F6LA 3NCYP 5IROC 5KJRL 1PY9A 4HS3B 3VXUA 4PJBE 4PUBH 4ZUUA 1MQKL 1U2HA 1YYLL 4E41E 3GSQB 3OL2A 2J5LC 1FHGA 4FQXA 2H2SC 3GUTB 1NCBH 4JFED 1RK0B 5DQ9B 5ABDE 1DVFB 1CCZA 5CMAB 4OLWH 4PB0L 3OZ9H 2YPVH 4OT1L 4WEBH 3D2UA 2H6PA 2LVEA 2Z0BA 1XIWB 4G9FB 2YWYA 4MNQD 1D9KD 1JHTA 5TE6H 5TQ0L 1XF5A 5L2KE 3RNQB 4NC0B 4X7FC 4U3CA 4JO1H 5A16A 3TO4C 1N64L 2ITCB 3T3PF 1ONQA 1L4IA 4X5XA 4I3SH 1RZKL 5J3HC 4RDQG 3UYRH 2EE6A 5ACMA 4RAUA 3RGVD 3FFCA 5GS1B 1ZT7B 1WWBX 4NN5C 4CU7A 3O2DL 5I73C 2HH0H 3MRCA 2P7TA 4L29B 2VRAA 1A6PA 3O0RL 1SY6A 4XT1C 3KPRB 3JZ7A 4HT1H 1XR8A 2W65B 3MOBH 3D85B 2W60A 4L3ED 3UXFA 3I75B 4EDXB 4ZO9A 2P5EE 3DVFA 1FYTA 3MV7B 1BWWA 3DTXA 2HA1A 2HVJA 3DOSA 4IOIA 4LLUA 2X4PB 4HFWA 3BXNA 3LH2L 4YHLH 4P3CL 3DIFA 3ARPA 1JPGA 4PJ7E 1HNFA 2DLHA 5E94A 4LCWD 3EGSA 2X9WA 5B39A 2F54A 5T3ZD 2ARJB 5EZLB 2DQGL 3C8DA 5HYSA 4HKBB 3RX5A 3NOIA 4KHTL 4LSRL 5FHAL 2H9GA 4YHNA 4AJ0A 3HCVB 3QDHA 3ARYA 5IROA 3T1FA 3LKSA 1R5WA 1KB5L 1QSFB 4ORZC 3HC3L 4X9GA 3KDMA 3ZO0A 3VXTB 5E4EC 5CJOL 1X9QA 2CKNA 4WUKL 4XXCC 4M7KH 1BZ7A 3DRQB 2VXQH 3BEWB 4X8XA 4EVNA 2P4AB 4RISL 2X41A 43C9B 1UZ6F 3B9KD 1YNKL 3LRHA 1QSEE 2XN9A 3R06A 5DEFB 4YEEA 3QI9B 1IQDB 1MI5A 3F12A 2E7LE 4JAMA 3E6HB 4LHUA 2Q76B 2H2PC 5HDQH 2DJ4A 5CUSL 4FXLA 3MA7A 1JNNL 3LEVH 5IJVB 4M48L 3F58L 4UINL 4WWKA 1JRHI 5JOFB 3HZKB 2Y6SC 2DTSA 2XPGB 4GJTB 3E2HB 1T6VN 1YEKH 1HEZA 3GSXB 3CSYB 3DX9B 3C5ZC 4ZS7H 1UVQA 3UYPA 3CFBA 3BUTA 5ICYB 3TBSB 5I8OL 1U8MA 1T04B 4LSUH 3OKDA 2Y07L 2DBJA 2P44B 1QBLL 5T5FH 4M6ML 1MCKA 1KCVL 4PJFA 4QHMA 3OTTA 5HYJE 4X4ME 2FLRT 3FL7A 3GMNA 3TZVA 5K93A 4G6AC 3QAZB 3LB6D 3H9HA 3HB3D 3TIDB 1QVOA 5D5ME 3MRNA 4G8FA 3V0VA 1UXWA 2OM5A 4R8WH 4RA3A 5EU6E 3EBAA 5TQ2L 4G7VH 4X6CA 1I3VA 3BRGC 1MCBA 4R4NC 1NSNL 2VLRA 2E8ZA 5IW1B 5ACZA 3UTOA 3LQAC 3CJJA 1OM3L 5C0BA 4PRDB 5ISZE 3A6CL 3GMLB 4Z78A 4XAWL 4HQQH 4ZG1A 3KYNB 4X4XB 5CZKA 5HGBB 4R26H 1IAII 5CSZB 2HT3C 4R4BA 1I75A 2R0ZH 4JDVB 4ZXBD 4WFEE 5I17B 2DWEA 1A0QL 3T2OA 2DQHH 1O0VA 5IW1A 5CZVL 2FWOB 2ADIA 5EPMB 1K3IA 1CLZL 1NGXA 3S88L 3IDXL 2OXHA 5DD6A 4HWZA 2DRUA 3QCTL 2OQJA 3MROB 5D1ZD 3HR6A 4AT6A 1U6AL 4C4KO 3LIZH 4HJJL 4LHJB 5DD5H 3DBXA 1AGEA 4L8SA 3GMNB 2EIEA 1G7MA 3QBTB 2B5IB 3OKYA 3F8UB 5DJ0A 2UVEA 3U0TB 4KRMB 4IM8A 2Y25A 2MCG1 1U93A 2IQAB 3SE9H 2Z35B 2HLFC 4WV1B 4L4VD 4P2OA 1FFPB 3GSWB 1BREA 4KJWD 2F15A 4MNQA 1MFDH 4AMKL 2FL5B 1QKZH 5D7LD 3RWFB 5DJYB 2GFBB 1CG9B 1JPST 4MZ3A 1N6UA 3IYLW 4ZO7A 4QY8B 4Y16A 5EO1A 3QRGL 4M8QA 1DFBL 1FFOB 1ES0A 3QUYD 1KCGC 2A73A 2F54E 5HHOA 3QDGB 4FTVD 1NCDH 2RR3A 3ILQC 5BZWB 1GZPB 4E5XA 1FC1A 2HFTA 3IXAB 5DGRA 1UQSA 4NUGL 5B38B 2BNUB 2XQBL 5HVWA 3P30H 4M93C 5L9DH 3VJ6B 3ULUC 1M05B 1BJ1H 8FABB 3UJJL 1B4JH 4M5ZH 1FFOA 4OFVA 2JKXA 4KGLA 3TJHA 1J5OH 2GSGA 3V6OC 3T2PA 2OTUA 4JDVA 4X6FB 2WWKO 4AQ1B 5LGJA 2VDNH 4LEOA 2A1WH 4L8SB 4ZPTB 2FIKA 1QR1B 3PDGA 1UXSB 2NY4B 1A4JB 3HS0B 3BD5A 3MZGB 5A2JH 1YN6B 5DC0A 4XCYB 2X4OB 1DBJH 4YE4L 5F8RC 2IPUK 3P73B 3V6ZB 4EOWH 5INDA 1UZ8B 2HT2C 4PBVC 5C09A 1AY1H 1X5ZA 5IMOA 1G7QB 2OTWB 4MLSA 4O02H 2F8XC 4HMCA 4NQEB 1CFVL 3NA9H 4MA8H 5C07B 1OF2B 4Y4HC 4FXGB 5I9QB 2WY3A 4P99A 1ED3B 2VDPH 1LP9F 1FRGL 3HNVH 5GIRB 1AJ7H 1SJEB 5M94B 1XMWA 4C56A 5ESQB 4P4KB 2CLRB 3IDJA 1F42A 1VEMA 2ESVB 5DYOB 4QT5A 5C0FA 2C7UB 5HPMB 5IIEA 4G8GB 1U3HB 5ADOH 1F11A 1GGCL 4P46D 4I0CC 3VFRB 1MHHA 5DWUL 4QRRD 4U1LB 4YHKL 5IFAH 4K7PX 1XGPA 4PDCE 4YDLC 5FO7B 5HYQA 4WNQB 2I25N 2NMSA 5LVEA 3RWJB 1YN7A 5EU4B 2XWBB 4AEIL 5EA0H 2ESVA 1ZMYA 3BT2H 2DLGA 4HXAL 1CD8A 4RFEA 1T0NB 2ZOLB 4U3HA 3C8HA 2Y72A 3GO1L 4L8BB 4R7DA 4BSVA 4MXWL 4QRRB 4JQIL 3RBSA 1N8ZA 2VLKD 4O9HL 2XKUA 1RD6A 5ALCH 25C8H 3IDGB 4PLJD 4FMKA 5FA3A 1GOGA 5TE7L 4FFEX 1FL3A 3QEQB 4X7SL 3V6ZA 4XPGH 1SJHB 2CD0A 5CGMA 4LDEB 5E8PB 5FKPB 4G5ZL 3UTSE 3PP4L 4P5KB 4Z18A 4XP9H 5C08E 1YY9C 4WWKD 4GRLB 1JHTB 3D2UD 1F13A 1W0WB 2R9HD 3DX6B 4JY4A 4XZUB 3ROOA 3BN9D 3NCJL