4L8BA

Crystal structure of the h2db in complex with the np-n5h peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8bA01
3T65A 2DMCA 4UT7H 2OTWA 4I0PA 4K55A 5IHZB 5SV4A 1LO2L 3TPUE 4YHYB 3DGGB 1HSBA 2F53A 4IRJD 5CLWA 4FQIL 4WO4D 4PYHA 3DV6A 2Q3ZA 4JFEB 1JCKA 3S35L 1F3DH 2EKSB 1F3JA 1GZQB 3MCLH 1A1MB 4L9LB 3S3SA 5CHNA 3LH2H 1T1YB 1LDPL 3DYOA 4JFYA 1T2QH 5F89A 5FV1L 3ULUE 3EDDA 1ZVHA 3E0GA 1YEFL 4KJYA 3T2OA 1QZ1A 2OBGA 5HHVH 4OCYL 1AHWB 4IS6A 2F54D 4XTRC 1ZVSA 4NZJA 5JXEC 4FNLH 2YD7A 5IWLC 3OKKB 4OF5A 1EZVX 4I13B 3B9KD 5SWZA 4NHUB 1UM6L 2EH7H 2BC4B 1DFBH 1ONQA 2Y07L 5EUOA 4PREA 1DBJL 1JF1A 3GFUA 4LVOC 1LEGB 1JFMA 3DOSA 3P2TA 4AH2A 1UJTA 4GQPH 2GJ6E 1ZTXL 4G6FB 2BOBB 4NM4L 3MLSH 3K80A 5DZLA 3OX8B 3QPQC 2H32B 3T04D 1LD9A 1YY8B 2ZP0T 2MCPL 4BZYA 4JRXD 4B50A 3VFOA 2YPVL 5JPMB 4JJ5A 3O4LB 3HC0A 2ZZUT 1FZKA 5I1DB 2XG4A 3GSWB 4S2SB 4UUJB 2K7PA 3FO2B 4EKXA 3HZKA 4X8JA 4KUZH 4A2LA 1CZ8L 3MFFB 4ZQKA 1QSEA 4XBGB 1D3CA 4HBCH 4C57C 2R39A 4LP5A 3X14B 4M9PA 1OP3K 4X4ZA 1BQHA 5HYJD 1NGPH 3W11C 3RY6C 2EDJA 4EIZC 4BSWA 1BF2A 5A3IC 4JPVH 1C16A 1X5FA 5DGQA 4DN4H 5IQ7H 3WJJA 4HJGB 3ZLQC 5HPMA 3SDAB 4UDUA 1HHJA 2J88H 3MRQB 1Z3GL 2W60B 5D1ZD 1EUTA 3PHQA 3UROR 2VDQH 5D1XB 2EDFA 2VKXA 3VXSD 4Q6IC 4WU5A 3AS1A 4PG9B 1NAMA 4C56E 4JR9L 4YHNB 1A21A 4OLZH 2DQUL 4R4ND 3TO4B 2BNRD 4Y5YB 3T0WA 1IGYB 5DJAB 1MFBL 4ZXBD 3M07A 3BOVA 4LAQL 3HR6A 2VZTA 1N3NB 5JW4Q 2F5AH 3Q1SL 2V9RA 4XPFH 2XV6B 4LLAA 4FXKA 3WXWL 5ICYA 3F7YB 5IB5B 5ILTH 5D2LA 2XFXA 4LVHC 4JREC 1NBZB 1P84J 3H3PL 1RHHB 2PUQT 4L1DA 2ZCKL 2P8MB 3I50H 4M6NL 4Y4FB 3VXOB 3PGCB 3CVHB 4XBPA 4CMHB 3BX7C 2OJZH 5DK2A 3MR9A 4JN2B 5I1GL 2BVOA 5EBLA 1F6FB 1K8DB 2WUBH 4HPYL 1F2QA 3EKCA 4NCC2 1Q9WB 4PY7A 2AKRA 5H35A 4LSVL 5D5MB 2P5WD 4YBQD 3O2DL 3G5ZA 5CD3A 1UQSB 1S9XA 3AVEA 1DTUA 4PJ7F 2X89A 1VSCA 3P4MA 2DQJL 3DRQB 3EO9L 2BNQD 3OBAA 4ZMAT 2B7DT 4K3GA 5IBUB 5E9DD 1S9YB 5ACLA 2WUCH 4KUCF 4OLXL 3MLYH 2D7OA 1AFVH 3WUWA 4QRQB 4WW1B 5DYOA 3OJDA 3MBEC 1Z2KA 4HXBL 5EO9A 4BQ8A 3RI5K 1H8NA 3CFCH 4K3EL 5F8QC 2A6KA 1UZ6F 4FQPA 1MRCH 4JQXA 3AU1B 3FN3A 3DO7A 1K85A 1FBIL 1XH3A 5IESH 4O5LL 2FWOA 4HG4J 3RZCC 3MRGB 1YDPB 1KTDA 3D18A 3EO0A 4K3DL 4V1DB 1CK0H 2ZCLH 1S7QA 3G9VA 2BSSB 2FH8A 2VAJA 3GJEA 3W81A 1MUJB 3PQYE 3SDXE 3QDMB 4XMPH 5J6GA 1D6VL 2B2XL 4JJHA 4EI6B 3AFLA 1ULVA 1II4E 4LLUB 5SWSA 3DX6B 4WUUE 4Y5XC 1X5AA 2VC2L 2VZSA 1J0ZA 5F9WC 3UYOD 4S11A 3WBDA 5JHDD 5CP7A 3ULVH 2UY6A 2HT4D 1T03L 1MVUB 1B0RB 2BRRL 2XOTA 1HHHA 2P8LA 5EBMB 2VE6B 5JDSB 5C08D 4AJ0A 1JWUB 4I3RH 1KPUB 4YEEA 4K8RL 1MCLA 3TC9A 3GIVB 3CMOH 2DICA 4P2YA 1NGZB 1JGDB 4G9FE 2H32H 3UO1L 3ARGA 1FIEA 2R56H 3MV9A 1YN7B 3MO1B 1ZHKA 1S7TA 1HILB 4XNQB 5T3XD 5K9KB 3RBGA 4ENED 3B8SA 4FXGB 4JFFE 3FQRA 1C08B 3V7AE 1LO4H 3ARDB 4MQ7A 1JNHB 1FORH 2Z31B 5IBLC 4X7SH 4LQ1A 1DQQB 4XWGL 3NAAH 5LWYH 3MUGA 1JHTA 3KPRB 4YE4H 5EUKA 4Q97A 4MXQA 4RZCA 4IOIA 1KTLA 4KI5C 4JHBA 1A3QA 1SYSB 1V7NL 2IH3B 4JVUA 4XNMA 3UBXI 1S5IH 3PJSA 4M62L 4D9LH 5KZCB 3KLAB 3BEVB 3OB0K 3S5LB 2ICWI 3JXAA 5J1AA 5GSRA 2V7HB 1TCMA 4G9DA 1RZKH 2XG5A 5E2WH 5B4MC 4GAJL 3UYRH 5CJQL 4HCRL 1N6QL 3FOLA 2P45B 3TBVA 1E6JL 3HZYB 2YUXA 4ZSOA 2XWJB 3O45A 3D39D 4H25A 4E5XB 3CFEA 5BVPH 4PJGA 5EDXA 1OP5H 3LMJH 1TVDA 4OB5L 2IPUK 4QYOA 5JOFB 4NOFA 1UACL 3GSNL 1NLBH 3ZHKA 2ED7A 3FN0L 3L5HA 4EDXB 3U48A 4AM0B 3JV6B 4W4OC 2J8HA 4UV7L 3MLVL 2Q8AL 3P73B 4BKLA 4D9RE 1G9NH 5GHWH 4XXDA 2DM3A 1ZS8B 2AABH 1OQXA 4GRWE 3BKJL 2B1HH 3K81A 2DQEH 1S8DB 4DGVL 4IMLA 3ILPB 3VCLA 3ZTNL 4OSUH 4GS7C 1AC6A 3JWDL 4P2RA 3MRRB 4YX2L 4R96B 1T4KA 3MJGX 3CVHH 1WZMA 3QI9A 2B4CC 3RWJA 5DQ9B 4QGYA 1XR9A 1IGML 1MHEB 2MJWA 2DLFH 3HE6B 5DUMH 3CXDH 4OZHE 3ARQA 1XIWD 3CGTA 1XF2B 2EDXA 4L8SC 2B20A 4R4BA 5FUCE 5KVDL 1BP3B 1XR8B 4YC2C 3MA7B 4KKLD 5D7LA 2VDKL 2X4OA 2OSLA 1TETL 3TZVD 3FOMA 4YZFE 2Y5TA 1MFAH 1MFEL 1XZ0B 3LKPB 1CR9L 3VFGH 4LIQE 2D03H 5DC4B 5F97E 4OKVB 4N8VG 3SDCC 3INUL 2OR8A 3MBEA 4XCFL 4KVNL 3MRLB 3MNWA 2R23B 4P3CL 4X98A 5GGRA 5JIKA 2GI7A 4YHIA 4OF3A 2EXYC 4PJIB 4MVBA 1L4IA 4OLWL 4XP4L 1T66C 2DJSA 3HAEG 4TOYH 3MLTB 3IDJA 4X6EA 5IW1A 4I9WD 4Q7DA 1MEXH 5HHQB 4RFNB 4G8GB 2PXYA 3OKMA 4N8CL 1ZANL 4MDJB 3RZCA 3TYFA 5F7DA 2VXQL 3I75A 4XNZC 4PGCB 3IAGC 1MWAB 4QXGL 3JTCA 2E5EA 1URLA 4IOFC 5JDJA 5MEPA 5DTFB 2VXTL 1CL7I 2NZ9C 5MEND 4Z0XA 3MJ9H 2YZ8A 4OM0H 4EOWL 3HC4L 2R0LL 2RGSA 4DFIA 1UM5H 5GS0H 2A77H 4GQ9H 1CBVH 4FG6C 5ISZE 3SKOA 1RFDH 3H8NA 3G5YA 1C8PA 1SJHA 4PB0H 3EOTH 2WP3T 4NZTH 4EN3B 5C09B 2AK4D 4QXTA 3T0ED 1KFAL 4ODWA 3PL6D 2AJSH 5FEBA 2FO1A 3CDCA 4W70A 3ZDXF 1BLNA 3SDXF 5F1SA 4W4NA 3DRTB 3UZQA 1QBMH 5A16B 4F7MB 1D6EA 4OIIL 1I8MB 5IJKA 1JUFB 1HSAB 1FH5L 3KR3H 4M6MH 1XGPA 2ZJSH 1ZSDB 2FL5B 1TZIA 3D85B 3FB7A 4K9EC 4GSDH 3QHFL 4F2MA 4L3AA 2LE9A 4P2CG 1OD7A 1RZFH 1C1EL 1IBGL 1TCRB 4NT6A 3UAJD 5DT1L 2WZPD 4MA1C 3A6CH 4TULL 2E7MA 4F7EB 3QDJA 1ZMYA 4HX1A 2CKNA 4U1SA 4XPHL 2C9AA 4MAUL 4U1HA 3NA9H 1VESA 1QSZA 2YXMA 1U41A 4KK5D 5IB1A 1I1RA 2VQTA 5ESVA 5ICXA 1E6OH 4B0MM 4KTDH 3P3YA 1FNHA 5EULV 3M8OH 4EI5A 4JFQA 1S7XA 4P46C 2G2RB 4Y1AD 4M7JL 1UC6A 4MQSB 2BCKA 4P23C 1KN4L 1I8KA 2DL9A 3V52H 1MCEA 4P48A 3PNWA 2BXYA 5I1IH 4LGRB 1WLHA 2DDQL 2VLJD 4NN7C 1DN0A 3UBXA 1BEYL 4PJ9D 1G6RA 2NY0C 3MRCB 3QUZD 5HI5D 3ZZ1A 4YDIH 3FT2A 3K74B 2P47B 4JO2H 3UTTE 2ICWA 1OB1A 5KVFH 4GG6A 3L5WA 2NTSP 5J8OA 1HQ4B 4W4OA 4KRNA 3L9RA 3WNKA 1HKLL 4JPWH 3G04A 4NSKB 3HR5A 3JTSB 4HWEL 3LIZL 4RFEB 2NX5A 4FQHB 2HVJB 5E00B 5KVEL 1WEJH 2H2SD 3VXUA 1IEBA 1KIRB 3ZE2E 3KPTA 4OZ4B 1EHLL 4KHXH 4C54A 2CSPA 3D48R 1Q8MA 4LPWA 3QO0B 4GRLC 1R5WB 2FZ3A 5DMIL 3MV8A 4WJ5B 1L6ZA 1IEAB 5KSVA 3V7MA 1PKQB 3BPLB 3PWPB 4NO3B 2BSTB 1U93B 4HK0A 3O4OB 3M45A 3GNML 3IVKA 3H9SD 2JB5L 1NQBA 1RJCA 3GMRA 2YA0A 4U1IB 4GRWF 2W0PA 3RWIA 2NY2D 2VN7A 5BS0D 2Z35A 4PBVC 3QWRD 3QCUH 4QRTA 3P4NA 4O02L 1EK3A 3AM8A 1CS6A 4M5ZH 1ACZA 1OW0A 4PJDB 1ED3A 1PX3A 3HAEH 3QIUC 2PO6C 1FV1B 1YEKL 2UWEA 3GHBL 3T77A 3B2UD 1N6VA 4EUPA 1NCWH 5IJVA 5AD0B 4Z7NF 3JV4B 1MJ7L 3SE9H 1HHKB 3KXFE 4OJFH 3Q5OA 1WITA 2X5PA 3TJHD 4OZHF 1I8LA 4PG2A 4DOHE 1VFBA 2N7BA 1GPOL 5D2NA 1FC1A 1O7VA 1XGQA 3UXFA 3DX8B 3T2QA 2IH1A 3WIHH 1VPOL 5TE7H 1OAQL 1BX2A 4MCZA 4YZFF 4X0KB 3FZUC 5DLMH 4YDVA 3QIBA 4JKPL 2XN9E 2E9WA 4I2XB 4U6YA 5DEFB 3ROOA 1CD8A 4M48H 3KYNB 4QY8B 5I30H 1NCTA 4UNVA 1Q94A 5TF0A 3BN9D 4NC1E 3VXMD 4IMKA 3T8XA 4JFHD 2VYRE 5DFVD 1T0MA 3U9PH 1VEOA 3MRBA 4K7PL 2JK5B 2AJ3A 2Q1EA 3V4UL 1RD6A 3KYMB 3O9WC 4JY5H 5HHPB 3GSQA 4QRUA 1S7VA 2OLDA 4FQIH 4EVNB 2R4RL 2Q6WA 3EGSB 5JHLL 4LBEA 4YFLF 3S35H 2VISB 5LXGL 3EO1B 5HI4C 3O6KL 2K9UA 3MXVH 4PV9A 4UIMA 3QUXC 2H8PA 4KKNA 4WI5A 4OGZA 2HT3C 3TVMD 2X9XA 1N64L 3IDMB 4ONHB 3MLPA 1LDPH 5EN2B 3QYCA 2OI9B 4A2MA 1N26A 1DBBL 5CGTA 4HS8H 4FFVD 4NGHL 1RZJH 1EBAA 1YEFH 4MNHA 5C0JA 2PYEA 2X9WA 3RBSA 3MROA 1CDCA 1GC1L 1M1SA 1HH9B 4OCYH 1FPTL 2GTWB 2IAMC 4HFWB 4J3OC 1KENL 5C0CD 1P7KA 4MQXD 4OCNC 1R3KB 4YK4B 1FL6B 4PJ8B 1T22A 1GVIA 2EYRB 2HFGH 1UM6H 2EDBA 2Y07H 1DBJH 3BMWA 3T08A 2VL5B 2GFBA 1P2CB 2VN4A 4HUUB 5CSBA 4U1MA 4GW4A 4NQUA 1BBJB 4HF5H 1DSFL 3F7RA 3O6FB 1G9EA 2APVA 3VFTA 4NM4H 5DVKA 2IADB 3WXVH 5K9QI 2MCPH 3FT3A 4JPIB 2C4FT 2YPVH 1UXSA 4X6DE 2GEEA 2R2EA 2HMIC 2A9NL 1Q9OB 3RWEB 5HHMD 2JJSA 2QHRL 4V3DB 3OAYK 4X9GA 2HFEA 1CZ8H 3NACL 3IXAA 4HUWA 2YMXL 4OGAD 4JRYA 1KCGC 1P1ZB 2NXYD 1G7IB 1JL8A 3PDOB 1FCGA 4I18A 2YSSA 5FF6B 5EZJB 1J5OL 2YUWA 2CK0L 5D7JD 1OTSC 3FB6A 1Y6MR 4KTEL 5I1JL 3G5XA 5SV3A 3WIFA 2XIDA 5I6XC 4S1RH 3G6JB 5HDQL 1H9VA 1Z3GH 3W0WB 2DJ4A 3MRKB 1KUMA 5DEGA 1A4JB 3RPKA 5J9PA 3S96A 3PE9A 4A6YA 1AKJD 3ULSA 1T7YA 3VMOA 2UUDK 4HWZB 5FECA 2BOCA 3GSNB 2DQUH 2APWA 5EWIL 3GMNB 1D5BB 2ZG3A 4PJDF 3TBYA 5K9OA 1NGXB 2FRGP 3ZE2F 5FM5O 4IRSA 4LAQH 4BA8A 3C09C 4K07A 1HHIB 2EECA 4PGBA 1U9KA 2Q86B 4D0BB 2FSEB 3HE7C 1YEIL 3Q1SH 4OM1L 4QRPD 3WXWH 2MOVA 1T0PB 3MLUH 3VRLE 4KKAC 4M93B 3H42H 3QIWB 2ZCKH 2NW3A 1LVEA 4GW5A 4KK6C 4KTYA 5HHOE 2CXKA 4M6NH 3WDJA 1NH6A 1JPTH 1NDGB 3D0LB 3E3QA 3H9HB 4FOMA 2KZ1B 3IFPB 5I1GH 4Y4KC 4HPYH 4PTTB 1SJEA 4HIHB 2Q76B 1CXKA 2IQAB 1G7PA 1NANH 2O5ZL 3O2DH 4UOJA 2V2TA 3WNNA 4HIIA 4L29A 2BSRA 2WBKA 4YEFA 2DQJH 3SE3A 3EO9H 3I6LD 5EIVA 4BJLA 4UAOC 1LE5B 4J3SA 4L3EA 3PGDA 4KDTA 1AE6L 2WQ8A 5CINL 4YDKH 2R69L 5L2KB 1FDLL 1U8NA 5C0AD 3K4DA 1NAKL 3OG6B 1KCLA 4CW1B 5GZND 3TEUA 1MAKA 1YNLL 3LEVL 1C5BH 3WL9A 3E6HB 3CUPB 1XT5A 3TA3B 1V5JA 4JO3L 2YK1H 3FQTA 4ZFGL 2PETA 1AQDA 1M05B 4PJCA 3U4BL 4HXBH 1BPVA 5T3ZL 4HUVB 2BMKB 4AEIL 1NBYB 3IETA 4AIZB 4K3EH 5GIRA 4JANA 3O41B 5SX4I 3DPBA 1P7HL 1X7QA 3CC5B 5MHSE 2YPKA 5JW4N 2P43B 2JCCE 1YEDA 1Y0LA 2HLAB 1FBIH 4HH9A 1W0WB 3K2UL 4O5LH 1DL7H 5DVMA 4JFDB 1YEJH 4N0UA 3DVGA 1Z9MA 3QNYB 4P3DB 3OXRA 3QUXA 5GS1B 1QHOA 2R8SL 1DQDL 2WLYA 4RBPK 1I3UA 4G6FD 1BQHG 4ORZC 3KPPA 4IRJC 4ZOAA 2B2XH 4OLUL 4WO4C 1F8TL 4LLMB 1CU4L 5C0IB 4LPCA 3KYOA 2QKIA 2UYLA 1T5XB 5HSFA 3K0WA 4JM2B 1GGIL 1C5CL 3KPSE 2F5BL 3M1BB 4RGOL 4UB0L 2OP4H 2I24N 1X4YA 5B21A 3B8YA 1T03H 5FOBB 4ETQB 3BH9A 2BY3A 1QQDB 3BISA 3QEHA 1JGUL 1I7UA 1D5MB 1MPAH 3TNNB 4PJ5A 2ESVA 1MCOL 3L95B 1P7QD 2GT9B 4TUOA 5IF0A 4OT1L 5GSVB 1SEQL 4LKXA 5IB2B 1QFWI 1HQRA 4PRIE 3PXHA 1ORQA 3F7VB 1R3LA 2GITB 2YZ1A 4KI1A 2EDEA 1MI5E 4L8BA 3UO1H 2QR0B 3B9KC 5EZIL 1XGTB 5TE4L 4NQSA 4YXLH 5KVGH 4WEBL 5GS2D 3QDGE 1T3FA 4PJAB 1HXYA 2ZSWA 4PD4J 1QFOA 1T1XA 3DTXB 4HLJA 4V2BA 2X4NA 3TGXA 3EJZD 3CJJA 5BQ7B 5D1XD 1AGFB 5C0BE 2YD6A 4NO2A 5MERA 1FZOB 1F4WH 1KIUA 3HKFA 1XMWA 2DLTA 1V7NH 3TO4D 4K94L 1MFDH 2ICCA 4QXUL 5IT2L 4M62H 4LSUL 2VLRE 3UTOA 4Y5VC 5D71L 4LSDA 5GRYA 5DRXB 4X5WA 1GGCH 4Y16B 4GAJH 4HCRH 4N1EA 3BEWA 4JZJA 1E6JH 2J4WL 4G42A 4N0FA 1U8IB 5KSAC 4X6DF 4J12A 4UQ2A 3R06B 3QUKA 4Y4FD 2R29L 3EYSL 4FA8A 1CQKA 4MD0A 5EU5A 5BZDB 2DMKA 4LOUD 4OB5H 1UACH 3GSNH 3OB8A 4KZDL 1FG2B 1FLRL 4MNQE 2JB6A 1S9VA 3SDDA 2IMMA 3IF1B 1AQKL 5E6YA 2UZXB 5B38A 1GHFL 4K9EL 5D1ZC 4TUJA 3BWUC 2IC2A 3VFUA 1XCTB 2BSED 3GM0A 1U8LA 2Q3AA 2BVEA 4LCWE 2AJZB 3QDHA 3AROA 5JNYB 1FFQA 3ZTNH 1ZLSL 4NO0D 3JWDH 1A1OA 5E6IA 3SY0B 4F7CA 4ZXBC 5CIPB 3AREB 4M4RA 4OBRA 5I8EA 4JE4B 1IC4L 4XI5D 2G9HA 2NY3D 3FT4A 4YLQT 3D0VA 5DUBB 4ZPTA 2UVFA 3GDBA 4OQTA 2DI8A 1ZT7B 4NC2B 5IEHB 2FECL 4LVOB 1K6QH 2GW5A 3MOBL 3MBXL 3FONA 4XP5H 4RMQA 4V1DD 3VI3E 5KVDH 4XPAH 5JQHC 4KMTL 2WAHA 3DMMA 4LCIL 3HG1A 4N8PA 1CLZL 1UB6B 3BZDA 1KB9K 1BD2B 3CK0L 1CLOL 1I9RL 4NDMA 1MFEH 2XQBL 1CR9H 1NKOA 4DKFH 4YBQC 3INUH 3Q6GL 5E7BA 3S7GA 3ULVE 2MSPA 2AGJL 4XCFH 2EH8L 4KVNH 4LLVA 1KJVA 4R7DB 4P3CH 5ESAA 4K3HA 5F9DC 2BFVH 5DI8B 2X9YA 2NCMA 2IF7A 4OLWH 2C3WA 3T1FA 3REVA 3TWCL 4NQDE 3O6MH 2CDEB 3DSNA 4N8CH 1ZANH 1RUPH 3RL2A 2VXQH 3GZKA 4QEGA 4LVEA 1JMXA 4QXGH 1C12A 2BNUA 3VMPA 5E0QA 4HK3N 3MUY1 2XT1B 2VXTH 3N1MC 4HWNA 4QOKB 4XWOD 5DJ6B 1H8SA 1TENA 4EOWH 3J8F7 5IW3A 4WTZA 1RULL 2R0LH 3IJHA 3ROLA 3G6AA 5DJCB 5I8OL 3DWTA 3H3KA 5IEKA 1OGTA 3U46B 5L0QC 3CAFA 4Z8FL 1CFVL 5K9JH 3KPRD 1KLGB 4OAWB 2WBJC 1F6LL 4XBEL 1OWRM 4ZPVA 2EEBA 3D2UA 4NM8L 4HZLA 1TFHA 2YD1A 4OLYL 3H9YA 3STZA 3VDAA 1KEGL 3K4ZA 2FJGA 5KZCD 1WIOA 4HKBA 4HDIA 1RJLB 3GJFB 1VGEL 3JBG7 4NNYA 2X4TB 5AZEL 1CQYA 1RIVL 2HT4C 3REWA 4PRBA 4LVHB 1UCTA 1FH5H 2X4RB 3CFIC 4JREB 4DGIL 5CGMA 4MNGA 5IM7B 2CLRA 3P40A 4DZ8A 3QHFH 5T1KD 3VWKB 4LLDA 43C9B 4XCEA 3QULA 1DEEB 4W68A 3OR6A 2AEWA 4J6RL 1C1EH 1IBGH 4DFHA 1MFCL 3DX7B 3WDHA 1TPXC 5DT1H 4TULH 2P46B 4EJ1C 2XWTA 3P9MA 3R1GH 2GYSA 3V6OA 4XPHH 4Y4HC 4LGSB 4ENEC 2XKUA 4D0CA 2GTZA 1Q38A 3NCBB 4Y5VA 1X4ZA 4XAWL 5DD5L 3ARFA 4O2EA 3HC3H 3RVWD 2G60L 4JFFA 4DCQB 2P5EE 1JNLL 5F7LB 4XZUB 5KOMC 4DTGL 1CDIA 4ESKA 1AGCB 4BFIA 1KIQB 4BH7B 1OAXH 1HI6B 1KN4H 4KHTL 1HK6A 1WSST 3CD4A 5D4QA 2Q7YB 3VRIA 4PRPB 3GUTB 3ISWA 1BEYH 2RFXB 1EEZA 1NDMB 3DROB 3HE6D 1MLCB 1WUNT 3R0NA 1BZ7A 2XYCA 1BWMA 5CKAA 3ARBA 2C1OA 4WFHD 4YO0A 1HKLH 4HWEH 3LIZH 1SEBB 1QHPA 4JLRA 4ZAKC 1RU9H 5GGTA 5KVEH 2AJUH 1U91A 4BFBD 5CSZA 1G7MA 5JXAH 1FNSL 1MLBB 1MCIA 4NRXA 1BAFL 4LEOA 3FB5B 4Y5XB 2OZ4A 2CGRH 2BNRA 2BVUA 2GSGB 3UCRA 4RISH 3VD9A 5IROA 1TZHB 1JZ8A 1IRAY 5L7XL 3PHSA 5CIPH 3QEQB 4KPHL 4Y19E 4YGVA 5DMIH 2BXZA 3WEXA 1ZA3A 3PV6A 1B9ZA 5C9KA 1KPRA 1JNNL 1J05B 4G8GD 3EFDL 2BP3A 3GNMH 3VFNB 3RGHA 1U58A 4H1LA 3EOYG 3VGHA 4P59L 1N8ZA 2VQ1A 3CH1B 5IVOA 4FQJH 4NFCA 2EZ0D 4O02H 1INEL 4PJEB 1P4IL 3QP3A 3RDTC 2V5MA 5EBWA 5FK9A 1XIWC 4GKZB 3GHBH 5C0EB 1EUUA 4LKCB 1XGRA 1WC7A 4HEME 4ODXA 1MJ7H 4KKLC 4NP4H 3VXTA 3EDJA 3TZVC 5FYLL 1W72A 5C09D 3PWNB 2XQYG 3S98A 1GPOH 3LSOB 2H41A 3MSPA 5F71A 3VI3F 1XF3A 5FA3A 2YKLH 5JTWA 1EEUA 4MA7L 2EDHA 4WI8A 4TQEH 1OAQH 4OKDA 5BXFB 2GJZA 3P11L 4HUKB 1OQOA 3R4DA 4JKPH 2V5RA 3IDIB 4G7VH 1FFOA 5IFAH 5KSBE 3NBNA 3SJVB 5LG1A 1AP2A 5AAWA 1ERNA 2V5SA 3I2CL 3ULVF 2NR6D 1LO3L 3CZJA 3D85D 4L3CB 2HKHL 3PHOB 3HZVA 5GJTL 1ZEAH 4XVTL 1K4CB 2BZDA 4GW1A 5HD8D 3UYPA 3FKUS 3WO4B 3A0OA 1FN4A 5DSCA 3RUGE 2BVQA 1NCDL 4B7LA 3V4UH 1C7TA 2ZUSA 4OZGB 2PN5A 1BVKB 1T21B 3VXNB 4E41B 1HHGB 2HAZA 3RZWA 4BZ1H 1K3IA 3MPCA 3GJFH 4FXLA 4I77L 3L6FA 1UWXK 2R4RH 3L3IB 4HMDA 5DJ2B 5D1QB 3S34L 3D9AL 43CAB 1NL0H 2GK2A 4M1DH 4ZUUA 1N5YL 1JPFA 5LXGH 5A2LH 3O6KH 4G6ML 1CDJA 3LN4A 5AG8A 1UA6L 4NQXA 5LBSL 4O2FA 4QRRE 5ISZA 3ZYOA 1JGEB 3D3VA 1NC4A 4GS7B 4E42A 3T0EC 2CO7B 1N64H 3LKRB 3NN8B 3OAYH 4P5KA 2HT2C 3PL6C 2Y06L 4ODUA 1DBBH 1UB5A 4TTDD 1TVBB 3BP6B 3V4VL 4F7TB 35C8L 1WBZA 5F88B 1X6NA 1GC1H 4KAQH 4QHNB 1FPTH 2OXGA 3P4OB 1F5WA 5DC0A 1CD1B 1DBMH 5LVEA 1BM3L 1JGLH 2W9LA 1JZ2A 2HJFB 1DVFB 4MS8D 4YHZH 3UTZA 1JZ6A 4J8RB 5J12B 1A9BB 2DM7A 3C5SA 5FKPA 2E7LC 4OD2A 3MJ6A 1KV3A 1OSPH 3KLSA 1A8JH 1RJYA 5T1MA 3UAJC 5ICZB 2I07B 3SDCB 1M6OA 2GAZA 2JIXA 5DJZB 2ATKB 5DRNB 3LN5B 4U0RC 5CEYB 1DUZB 1WQVT 4XPTL 3MRNB 3F62A 4L8DB 1RMFL 3CU7A 1IM9B 3CDGA 4CVZB 5CFHA 4JY4A 4NKIL 4J2XA 4K71B 4KK5C 1KELL 4M9OA 2XWBA 3PWPD 3CFBB 2ZNWA 2W65A 4HV8A 1J0HA 4Z7OE 1GOHA 4FQXA 2A9NH 4R0LA 5TDOB 4FMKA 4WVRA 3RVUD 1C5DB 1OT1A 3JUYA 3NACH 3D39A 4RRPG 1M4KA 3BP4A 5IQ9A 2HVKB 3OKYA 1QSFB 5KBNC 1QFHA 4TRPL 5GS3A 4PJ9C 2EDTA 2MNUA 3QUZC 5F6HJ 5HI5C 2MQ3A 4MZ2A 3OKNB 1MNUL 1J5OH 4KTEH 3EYFB 2LAAA 3X13B 3RWHA 5I1JH 2W92A 3WE6A 2YS4A 2DWDB 2VH5L 2PCPB 5EU6E 3QUML 2AXFA 5JPNB 3UTTA 5DVNA 2H2SC 4TVPE 3V0VB 4GUPB 5IGXL 3TJEH 1RZ8B 1BGXL 3SO3C 4B5EA 3VXRE 4HWBA 4WHYH 4CGTA 3BGMA 4ZUTA 1AXSA 4LNRA 2VIRA 3P0YL 1BIHA 4R7NA 3V5KB 4J3XA 1ZWIB 2OM5A 5F9JB 4ELKA 5TF1H 4DAGL 2GK0A 1HN1A 3A6BL 1DQLL 3H7BB 4BH8B 4M1CD 3RX7A 1LQSR 4OUUB 1PEZA 2NY2C 1D7FA 1DUYA 3KXFD 4EQ2A 3GB7B 4OZIE 3IDXL 4YHPA 3RGVA 4CVXA 2H3NB 3QFDA 2A1WL 3B2UC 5ITFA 4P57B 3U0PB 2PTTA 2O5ZH 5HGGS 2H1PL 3TJHC 4H5SA 2XN9D 1JK8A 4P46B 1WISA 1XCQA 1T89C 4P23B 2CIKB 1AE6H 3SKJL 1FDLH 1UJ3C 4IIQC 4M3JA 4JFXB 3ECBB 5E94B 3NCJH 5H37G 3IDYB 1YNLH 2FJHA 3LEVH 1AC0A 5ALBL 2KQNA 4NN7B 4PJXB 3C5JA 4H26B 4JO3H 1WK0A 3KPMB 4QNPE 4EEEA 5T3ZH 5IMLB 5MENA 1MCHA 4AEIH 3G6DL 1F2XK 5FA4A 9CGTA 1A6AB 3MUZ1 5AUMB 5EZOL 3V4PL 4PJ8D 3TN0C 1WFTA 4OGXL 4HIXL 3BN9C 3S4SA 5F7FA 5DFVC 1I3VA 1NLDL 2MPAH 4YNYA 5DJDA 4ZNEE 1SMAA 1CFNB 1ZHBB 2BVTA 4K8RD 2R8SH 3MREB 1DQDH 3O6FD 2A6DA 3PL6A 4U1KB 2YWZA 2B4CH 1EMTL 1NC2A 3KWWB 4OLUH 3GGWA 4OI8A 5EC2B 1F8TH 2J7LA 3B9AA 3HCVA 3V6BR 3NGBB 3O6LH 4WUKL 3UTSD 1ORSA 4L9DA 3RUGF 1GIGL 1LEKA 3TH2T 1GGIH 2D0GA 4UB0H 2F5BH 4PP2B 3STLA 1ND0B 2X40A 5J11C 4KVCL 3VJ6B 4J7RA 4JGMA 3TVMC 4P5TD 2X4QA 3DVNA 1NUNB 1BFSA 3U79A 5E5UB 2E7LA 1A1NA 4FFVC 4FQ1L 5EB9A 4U7SA 5IK3A 3QPXL 3SKMA 1J1OH 3S37H 3UJIL 3PWUA 1SEQH 3VE0A 3B9EA 5GGSB 4WFFE 2FEEL 2PO6B 5HYIA 4HKZB 5ESQA 2VDRL 4JFOB 3BAEH 3FRUB 4LHUB 2I25N 2VL4A 4MQXC 1A7QH 3QFJA 4R4FL 1E4XL 4H20L 4L5FL 5EZIH 2ADIA 5TE4H 1PFCA 4WEBH 2VDPL 1QR1B 3WHXB 2P7TB 2DQFB 5F7HA 5DEZA 2MMXA 4UIKL 1IC1A 5DD6A 1JYVA 4TSAL 1JPGB 2NTFA 3NCEB 4Q9CA 4BSJA 3FO9B 4N9GA 4NQEE 2X7LB 2R0KL 3U7WL 4GO6B 3QWQB 1ZLVK 5KN5A 1YMMB 4APQA 4Z77A 1OTUD 3I6KB 4QXUH 5IT2H 1R24A 3CFJB 5IFJB 2A38A 4Z7UB 1KYOK 4LSUH 2VLJA 1GRWA 4PJ9A 3BXNB 5IR1B 1VDGA 2YPLB 4IHOB 3WIIL 3VFSA 1TITA 3HI5L 5JUEH 3C60B 1Q1JL 1FVDA 3AAZB 1RZ7L 5FDWA 2J4WH 4L4TE 4OGAC 3QIWD 2NNAB 5M7QA 4HKXB 4O4YH 4Z7OF 2NXYC 1JPSL 3EYSH 5K33A 4ETYA 2HH0H 3BQUB 3V8CA 3O9WB 5I74C 3UPRA 5F7MC 5ANMB 3U2SA 1RI8A 5INCB 2XNAB 5D7JC 2DLGA 1INQA 5HHNB 1NFDE 1NSNH 3JWNC 4KZDH 3R0MA 1IKFL 3CVIL 1FLRH 4P4KB 1GZPA 1EERB 4OGYH 4NUGL 1PYWB 2X70A 4UDTB 5D6CA 1AQKH 3OKLA 5JR1H 2L0DA 1UVQA 1GHFH 4K9EH 2Q8BL 4YGAB 2I9TB 5IIEB 2GCYA 2NY4B 1LO5B 1R5VB 5MEQA 5L2KD 1JRHL 2CKBL 2D0FA 5DRZA 2X4SB 5DJYB 3IS1X 3WN5C 1NFIA 5FM5M 1UM4L 1ZLSH 4PRAA 3VFPA 3TA3D 3VD5A 3ES6A 2YN5A 3WLWD 1F3RB 2IAMB 3FFDA 3T0VA 4JY6B 3BPOC 3K8LA 1N6UA 2FHCA 4YFEA 4NUJA 1IZKA 1IC4H 4G6AD 4XT1C 2XKNA 5BZWB 4BQ9A 5E24E 3GKZA 1VB9A 3MBXH 5I1CL 1LP9E 1F97A 3GMMB 5H37H 4JDVA 5CWSB 1A7PL 4RA3A 4GG8A 4LCIH 4ELMF 1CLZH 3OWEA 1ZHLA 4MD4A 5IVXA 1CLOH 1I9RH 4ZFOA 4PJXF 5HHOA 1L7TL 1NEZG 3KDMA 4R9HA 1RUQL 4OZIF 3Q6GH 1U0QA 2YRLA 2AGJH 4Z76B 4JM2D 4XCYA 4PRHA 4FFEX 4QT5A 3TIEA 5INDB 3VGAB 4L9LC 5E56A 4XPBL 5L2JB 4I3GA 1T1ZB 1U3HB 5MHSD 4F33A 3OXSA 5GZNC 2DIAA 4JVPA 2WMPA 1NMCC 4XB8A 4MWFB 3HPLB 4HAGA 1QA9B 3T0AA 4U6HB 4WI3A 1HOCA 1DE4A 5DWUL 4Z78A 4IEFB 1BJMA 2D4FA 4LSTL 1P9MA 3FJTA 4QNPF 1OAYH 3WNLA 1D5IH 3GO1H 3HUJB 1H3XA 4WU7B 1RULH 4HUXB 2FX8L 4RQQB 1I9IL 5DMGD 3QWOB 1QR4A 1YPZB 3EIFA 3MV11 4FQCL 3U7AA 2JCCA 3F12B 4AEFA 2NQCA 1F4AA 2C3GA 5C8JB 4NQCB 3HMWL 4Z8FH 1CFVH 3TVMA 3KPQB 2HLFD 5CZXD 4XP9L 4XBEH 4NM8H 3ARUA 5CZKA 2YWYA 4MAYD 4GKSA 4OLYH 5FYKU 4Q6YA 1KEGH 4XX1G 3TBWA 1QOKA 1PJ9A 2ILLA 3HE7B 1VGEH 4U7MA 5CJXA 1K4DA 5EIQA 2VLKE 5AZEH 4AT6B 4PRID 2L7JA 2VKWA 1RIVH 3BFOA 4W6XB 5C0CA 4NJAL 5B38G 4JFZL 4Y16D 3DXAB 3CCHB 2BHYA 4DGIH 4BQCA 1LE9A 1PLGL 4WW2A 1NCBL 5E4IA 5F7EL 4CU6A 3MZTA 2F53E 5CEZL 5HVWA 3QDGD 3WUZA 4J6RH 5HGHB 2FDBP 1T6WA 1VACA 2E27L 1I1CA 5LJYH 4Y4KB 2CO6B 5K59F 3X3FH 3QUYA 2Z93B 5C0BD 1U8PA 4LCYB 3I6GB 5C0RH 3KPNB 2OL3L 1OPGH 4HQQL 1IQDA 3ARTA 4M5YL 4BK4A 2VNCA 2J8UB 1WTGT 4JB9L 5AEAA 3LVEA 5C3TA 3EOBA 4ZS7H 4MJ5A 1MI5A 1P53A 1NCCL 4XAWH 4XC1L 4CN6A 5D1XC 5HHMA 4P2OB 2G60H 1JNLH 4RGNE 1KYOJ 4DTGH 3VW3L 1CE6B 4LSPH 1VGKB 3JWOC 4I0PB 3DYPA 5LAXA 3JTTA 1EJOL 3TO4C 2GY7B 4JM4H 1I7TB 5DS8A 5SWZE 3HI1A 1HSBB 3GMPB 3L3HA 1QRNB 5EUOE 3N85L 3ARED 2KUTA 4WFEE 1G9NC 1F3JB 4HMCA 4X9FA 3EZJB 2YEZB 4P9HC 4JFYB 2C5DC 4MNQD 4PLOB 4PDCE 4HFUL 5HI3C 4BSVA 4Z0BL 4WFGE 4ZUSA 3QJFA 2ZOLA 4RMUA 4Y4FC 1JZ4A 1VKXA 3KPOA 5EZLB 4LEXH 1KTRL 4KJYB 3C5ZA 4DKEL 4CMHC 1AKJA 1BD2D 1FNEA 5F3HA 4IRJB 4WO4B 4KMLB 1GJIA 2LTQC 3PDDA 3CSPA 4LCWD 3NZ8A 4K2UH 4YHKH 1ZVSB 2EYTB 5EORL 2Z92A 1QSEE 1CD9B 5L7XH 1CT8B 1MCDA 4UBDD 4KPHH 3BZFA 2IFFL 4U0QB 3GMLA 4WTZG 5AZ2L 2CH8A 3QUMB 4XC3L 1NFDF 3W39A 3MZGB 2ADGA 4J23A 4Z7WE 1AIFA 1JNNH 3BYTA 3DBXA 4PV8A 2P8PB 3F58H 4Y0GA 3B3IB 3EFDH 4PLKD 4LPUA 3WS3B 4GAYB 1F4HA 2F54B 5BRZE 1MF2H 4HIJA 2C3HA 3P0GB 4XI5C 2D7MA 2NY3C 1G6RL 2L4OA 3HC0B 4QOKD 4OUOA 1FZKB 3DGGA 4PUBH 4OF8A 3CLFH 4X8JB 1YC7A 4JFEA 4QHUB 1UWXH 2EKSA 3HRPA 1GZQA 3F5WB 1A1MA 4L9LA 4NBZB 2OYPA 3VFRB 5IB3B 1EFXA 2JJTC 3LRHA 5FYLH 3B9VA 5EA0L 3UX9B 3RNKB 3IU3B 1LP9F 1QVOB 2NYYD 3BPCB 4FFWD 2WW8A 2DI7A 4JG1H 4JRXB 4MA7H 2AJVH 5D2LE 4XCNB 4LU5L 3O8XB 4Y88A 1X5XA 1AHWA 4UDUB 1JWMA 5F7NC 3MC0A 3S97C 2P48B 3OKKA 4Q0XL 5ECJE 3IAQA 4NBYB 5JQ6L 1LO3H 3I84A 5KSAB 4NHUA 1MJJB 2BC4A 1NMBH 3VWKD 5ABDE 4WU5B 5HYJB 3QBTB 3HNVL 1LEGA 4NQDA 3KHOA 4W6WB 5D8JL 1H15B 2BOBA 5MI0B 4CU7A 4XWOC 1NCDH 3OX8A 2H32A 5H8DA 1YY8A 8CGTA 4FXKB 5L6YL 5E03A 1OD9A 3FQWA 5C0GA 4F58L 3CMGA 1AO7B 1FFNB 2XFXB 1R3HB 3O4LA 4CNIB 1S9WA 4PY8J 1L7IL 3D9AH 4S2SA 4YR6B 1IQWL 3WHE1 3FO2A 5I8KH 4G6MH 4JHWL 1UA6H 2F19L 2EICA 1HEZA 3MFFA 4MCYB 1WGOA 4XBGA 5BO1L 4YH6A 1A6PA 4O2CB 2Y06H 3X14A 2IBBA 4PY7B 2EYSB 35C8H 3CSGA 3MRFB 3BKYL 2PF6A 1S9XB 5B3JE 1LILA 5T1LD 3X3GL 1A7BA 1CGSL 5DRWB 4HJGA 1VFAB 3SDAA 2R1XB 1IGTB 5DD1L 3AXLB 2W60A 5FUZL 2KL6A 4JKWA 1H3GA 2Y5EA 1QPXA 5SWSE 3RWCA 5IMMB 1AD9B 4PBXA 3VH8B 25C8H 3OJDB 4PG9A 4H1LG 2P5ED 2P5WB 1UEYA 4YHNA 2A6KB 1AGBB 4LSSL 3TO4A 3NPZB 4Y5YA 1JBJA 5DJAA 3VH8G 2Z91B 3QEQD 4XPTH 1N3NA 2VUYA 4LGPB 1ODAA 3D18B 5E9DB 4ZS6D 3RVWC 4KJWD 1S3KL 4CDHA 3F7YA 2C26A 2XTJB 5T5NF 3V5HB 5IB5A 2ZUQB 2EC9U 4DGYH 1NBZA 1RHHA 4YPJA 4JO1L 4HKJB 5J6GB 3MV9E 1G84A 2P8MA 5ELIA 2H26B 1V3JA 3FMGL 3GMOA 4Y4FA 5H94B 3VXOA 2X6MA 3PGCA 1RVFL 3CVHA 4HWUA 2VLME 4HC1A 4TRPH 4JN2A 1PZ5B 1K8DA 3SBWA 4ZD3L 1U3YA 3HE6C 1Q9WA 3BO8A 1MNUH 2CR3A 4I4WA 1UWEL 5D5MA 5EUOF 1UQSA 4OCRL 4K23L 5GRVL 4EDWL 2FNBA 4U1LB 1UKSA 2VH5H 3DRQA 3QNXB 3QUMH 1HYRC 4LFHD 4Y19D 2CQVA 3TF7A 1QPPA 2WBJB 3OR7B 2WY3A 2M26A 3OQ3B 4XNUL 5IGXH 4LP4A 1M7DA 1XF5A 5D7KD 2ITDA 2NXZB 5FYJU 3MV01 5KS9B 3MV7E 1BGXH 1D5ZA 4LARL 2G5RA 4XRCB 4QRQA 4WW1A 4NHCL 3QR2A 4X4MA 3VDCA 5JHDB 4LRIA 3RTQD 5HVHC 4ODSL 4O58L 1ZHKB 4ZSOE 2CLVB 2FHFA 4XVJL 3FQRB 3SJVD 4PJGE 1EGJL 3AU1A 3P0YH 1J0YA 3MYJB 4MQ7B 3S36L 1LDSA 3NIDE 3L3JA 4N0CA 3QG6A 4RAVB 4DAGH 5A2JH 5CCKL 3OAZH 4PJBE 3T4AB 3MRGA 3O2VH 1YDPA 2CKBB 2A6IB 3F65A 4RZCB 1TPXB 5FUCC 4OLEA 4XNMB 2HP4A 4G3YL 1Q9KB 1MUJA 2EZ0C 3QDMA 3IDXH 3ARPA 3MJ9A 4Y4HB 4X99A 4GT7A 4E41D 3PV7A 4OCMC 2UZYB 2A1WH 1A0QH 4Q74A 1N0XL 4ODHH 2FYYB 5GRVK 2W1NA 5TPWL 5D1QD 4P2RE 1NCUA 5DJ8B 3O11B 4H25B 5IFHH 1D9KD 4RGMC 2EIBA 5KG9B 1MVUA 4WDIB 3GSRB 1B0RA 4KRLB 5E99L 1RY7B 1JIBA 3K8KA 5EBMA 4JKLA 4MJ2A 5I73B 2I60H 2VE6A 5JDSA 5BW7A 2R0WL 1BBDH 4Z18A 2VABB 3GBNH 2R9HD 1JWUA 1CF8H 4PGJA 5DHYB 5BOPA 3GIVA 4LF3B 1YEHL 4NNXA 3N1FC 1NGZA 1JGDA 5D7LE 4BKLB 3G6DH 4PYGA 5D2LF 2VMFA 4N5EC 2NR6C 1J1XL 5FCUH 2DQHL 3MJ7B 4XNQA 1DVFD 5K9KA 5FO9B 5EZOH 2NY7L 4FXGA 3V4PH 5KSBA 4U33A 4OGXH 1C08A 4U6TA 3ARDA 1U8KB 4HIXH 1I9JH 2Z31A 1FNFA 2Q20A 4ZAKB 1LNUA 3VCLB 3SGKC 1FJ1B 1DQQA 1NLDH 3LD8B 5HD8C 4M1GH 2W91A 3KPRA 2ICWJ 4RWYL 4XAKE 2E9IA 4MA3B 5DQJB 3IFOB 5T33L 3RWJB 4Q9QH 5JOEA 3DUSB 4QRRD 5DHXB 1XR9B 1J18A 2EEAA 1EMTH 3T2NL 5MP6L 4WUKH 3RUGA 3KLAA 1DJSA 1RUMH 3S5LA 1IM9D 4GMSL 1T66D 1U6AL 1KEML 1SQ2N 2D4DA 3BT2H 4MJIE 4R4BB 4UNUA 2W59A 2FJFA 5JIHA 5EO1B 4LCCC 2OSLB 4KVCH 4ZNCD 1W2KT 3SCMD 5HYSG 2Y5TB 4GRMA 2XWJA 4TTDC 4FQ1H 3TIDA 3QPXH 1QSFD 1AGEB 2QQKL 5JOFA 3RDTB 4J3TA 3EDEA 2VDRH 2YUVA 5FKAB 5HHXL 5C71A 4EDXA 4AM0A 5I19L 5I15L 1H3VA 2BHZA 4MS8C 5CBEB 1IILE 4H20H 4L5FH 4ZDHB 4X6EB 4MMZC 5B3JF 4M3KB 1FZJB 1TNMA 1U8QB 3OKMB 3TZVB 3EYQD 1BQLL 1ZS8A 1OGAE 2MKWA 1TQCB 5FYKL 1J8HB 4UIKH 5C0DB 1QEWA 2NY1D 3IDGB 3ILPA 1BFTA 2OL3B 4PGDB 2R0KH 3QO1B 4R96A 3X11B 4WHDA 4Z7VB 1JV5A 4XHQA 5JO5B 2IGFH 3RHWK 3I02B 1JHLL 4M8QB 1A4KA 4HGKC 1MHEA 1SYVA 2JJVA 1MELA 5FGCE 3HE6A 1KB5L 3G5YB 3Q48A 5E8DL 1SJHB 3MACH 3HI5H 1XF2A 3RVUC 1Q1JH 2DQIL 1NKRA 4KI5E 3TBSB 4LK4A 3ERYA 3QDJE 1ES0B 1RZ7H 4OTXL 2V2WA 1XR8A 3LPWA 4N8VA 4ODWB 1PW3A 4QRSA 2XTLA 3JVGA 2DQTL 2EE3A 4X7TA 4NFDA 1XZ0A 3IYLW 1NANI 3LKPA 1BIIA 3HAEA 3WS6C 1HCFX 1IKFH 1JTTA 3CVIH 3MRLA 1X5GA 3FB7B 2R23A 4NUGH 4RAHA 2DF3A 4PJIA 4P46D 2Q8BH 4M43H 2AK4B 4KFZC 2UVEA 3MLTA 3S4SG 3VDBA 3CXHK 2KH2B 1Q72L 1S5HB 4OCLC 1SM3H 1YNTA 5HHQA 5EU6A 1JRHH 1LK2B 4MDJA 2CKBH 5HDOA 1OAKL 4FQLL 4NWTH 4FTVB 5E95B 4M7LL 4U2YA 3WIHA 2VDNL 2FH6A 1E27A 1K8IB 1UM4H 4HX1B 4GG6E 2Y36L 3TCLB 1G0YR 4K7PX 5DTFA 4CU8A 5I16B 2NX5E 3VXRA 5T3XH 1B2WL 3L7EA 2AV7B 1MCRA 5F1NB 1IT9H 3MODH 4PJGF 4M1CC 3PGFL 5I1CH 1OARL 2BCKB 1NCAL 1I8KB 1CICA 3NIDF 3JWOL 5T1DL 2OXHA 5E1HB 5E8PB 4EN3A 5C09A 3KJ6L 4IDJH 3QQ3B 4LAJH 3VA6A 4YWGH 2CXGA 4L4VE 5I1AB 1DN0B 1G6RB 1L7TH 2ZWLT 1RUQH 1QFUL 4TYUA 2ICWB 1KCVH 1U2HA 2VR5A 3E2HB 3DRTA 4Q58C 5DK0A 5A16A 4F7MA 1JUFA 3L9RB 4UOW1 4Y1AB 2MHAA 1EEYB 3HR5B 3BSZH 3ZE1E 1ZSDA 2IANB 3D85A 2A9ML 2UZIL 1VFOA 3T09A 1IEBB 2OI9C 1CFSA 3WFBL 2ADJA 3DI2B 2UWEE 1FGNL 4KQ4L 3SKNA 2HA1A 15C8L 1J1PL 3DX9A 3GBML 3BD4A 4F7EA 2V6HA 1DLHA 5CP3H 1KC5L 3MV8B 5FUOH 4UT6L 5DWUH 3UTQA 1LO0L 1I75A 5E2JA 3DO3A 4LSTH 2W0KA 4M61B 2DTML 2FX8H 1I9IH 2E7BA 5IW6B 4FQCH 3C8KB 4TSCL 2CDFB 4C83B 5L88H 2YD4A 5BV7C 1J87A 3RWIB 5JW4M 2G2RA 4K8RC 3HMWH 2Z35B 2N56A 3O6FC 1YQ2A 3GIZL 4P2QB 4XP9H 5D7SL 3P4NB 2WV3A 3FQXB 2E6PA 4U05A 4ZNEA 4X6CB 1YMMD 3DUUB 3GMQA 1ED3B 3U36A 4JPKL 2CUHA 4G6KH 5GJSL 2NW2B 4EUPB 4QHMB 4Z95L 1MAML 2PW1B 2BHUA 5IJVB 1UYWL 5C9JB 4NBXB 3CSYB 4JN1L 1K9TA 1CGTA 1DQJB 1OCWH 3H9SB 3C60D 4NJAH 4P5TC 1HQ4A 5D2NB 1XGQB 5F7EH 2NY2B 4NSKA 5BS0B 1GGUA 3JTSA 4RFEA 4FQHA 2IH1B 3PIQB 4MSWA 1SHMA 5E00A 4X7CC 1QBAA 2E27H 4MCZB 4AQOA 1KIRA 1JHKL 1KJ2L 4DK6A 3BQUD 5EOCL 5F3BB 1FIGL 5HGAB 4OZ4A 2OL3H 2HRPL 4HLZG 1TQBB 4U6YB 3QEGL 3FB8B 3QO0A 3ROOB 4HHAA 4NQED 4JB9H 4ZTOL 4P4KD 3HPJA 5ACZA 5TJWK 1Q94B 3HI6L 3PDGA 1PKQA 1NCCH 2BSTA 3T8XB 4XC1H 2NY4D 4DK3A 2PYEE 4IIQB 4N90D 3SE4C 3VW3H 2AJ3B 3AMKA 3BDBA 4U1IA 1MHCB 1U8HA 3BH8B 1OTUC 3UP1A 4L4TD 3O81A 1TZGL 5I1LB 3N85H 4LVNC 4EZMA 1A7RL 4Q2ZB 1OM3H 1J0IA 4I3SL 4LBEB 6FABL 4Q9RH 3AY4C 2GJJA 3TN0B 4S1DD 1ADQH 4UIMB 12E8L 1QACA 4M93C 3TT1L 5FDYA 1U3ZA 2R0ZL 1ZE3C 3TNMB 3QIWC 1T7VA 4HFUH 4JVWA 4Z0BH 3WNMA 4JQVC 5KJRL 4QTHA 1DR9A 4DKEH 4IRZL 4S0SD 5C0JB 2EDLA 2EDOA 3DX8A 3MROB 5DC9B 3W9EA 3RJQB 4ORGB 3D69B 1CFQB 1FLTX 1FYTE 1QFWL 5C86A 4HK3J 3CXHJ 2DKUA 4LDOB 3O2DA 3HZMB 2QSVA 4OCWL 1T22B 4ALAL 2K3TA 4I2XA 4QO1A 5DEFA 5AZ2H 2E9BA 1U3HD 3ETBF 3DHJA 3HRZA 4DKAA 4D9QE 3KYNA 2DD8H 1X9QA 32C2B 2CJUL 2YHGA 4LLQB 4KU1A 1CE1L 3OF6D 4MJ6B 3TA3C 2DQGL 2VO5A 2PYFB 4QWWD 3WLWC 3GSUB 4KK8D 2FIKB 4G6AC 3ZDZE 2VXVH 3KYMA 4PS4L 4ZO8A 4GG6F 5EPMB 5HHPA 2BJML 5GRXG 1EZVY 4EVNA 4ZOBA 2FIRT 1G0XA 5KW9L 4DN3L 1DBAH 4LLWB 3L3OB 3WKML 3IXAB 4HUWB 2DLHA 4JRYB 5GS1C 1P6FA 4F15B 4NQCD 5DXWA 1LP9A 3NA4A 5KAQF 3GI8H 5EN2A 4I18B 5E2UL 5HTSA 2OI9A 2YSSB 3JV5A 4FN0A 2OZ4L 1OWWA 3QH3A 4LU5H 3FB6B 4U2ZA 2D3VA 1L0XA 3WIFB 1HH9A 3FFCB 2XPGA 4IJ3B 4D2NA 1NGYB 4HFWA 2EIDA 1F4XH 2DBJA 1OL0A 3GRWL 3E3QE 2QEJA 3ZHLA 1NFKA 5JQ6H 1FL6A 4PJ8A 5K93A 5J9PB 3S96B 2APTA 2P42B 4OD3H 3EYVA 2VL5A 2HTKD 4HUUA 3ZE1F 1A6ZA 2BOCB 5I74B 5F1KC 1BBJA 2OTPA 4Y4KD 3BKCL 1PG7L 4KV5F 4GXUM 5HGDB 5D8JH 2LU7A 3O6FA 5DHVB 3MRMB 4IRSB 5L9DL 2UWEF 2C1PB 1T80A 4L3EE 4PGBB 2IADA 1BOYA 2DQDL 2E6JA 3LV3B 2V2XA 5CMAB 5L6YH 1T83C 4JPIA 4AENB 2WIIB 3RWDA 4F58H 3OL2A 5DMGC 3TFKA 1R0AL 3VWJD 4YHOL 3ZKMD 2DWEB 1TTGA 2FLRT 4PJCE 1Q9OA 5GGSY 1U42A 4YXHL 1IQWH 3RWEA 4P2OD 2XY1A 5CZXC 2HLFC 5B3NA 4JHWH 4ERSL 4UV4L 5BO1H 3EOAB 2O5XL 4I0PD 1HCVA 2AEQL 2RCSL 3DYMA 4FP8L 5ANME 4MAYC 1BVZA 5ADOH 4AEHL 1GOFA 2F53D 1A7NH 1QRND 2N4IA 5D6DC 1JPST 1FL3A 4LIQL 4AMKL 5CJOL 4KMQA 4ONFL 5EZJA 4PJ7B 4QRPB 4N0UE 5FM8A 1F13A 4L29B 4QCIB 4X9HA 3LAFA 2C7UB 4Y16C 2Y9RT 3QXDB 4HCRA 2WP3O 2A74A 2VLKA 3G6JA 5DD1H 3W0WA 2CMRH 4U1JB 3W5MA 1CDBA 1A4JA 1L0QA 3MGOA 4UTAL 4R3SB 5IHUL 4JKKA 5SX5K 2YRPA 3ZYJA 4XMKL 4HWZA 5C07E 3GSNA 1A02N 4RGND 3OMZA 1WBXA 5ALCL 5BMFL 4LSSH 1X7QB 2YD2A 3GMNA 2YPKB 3P9LB 5SWZD 4LLYB 3S6CA 5EOTB 4X4YA 1HHIA 2Q86A 4PJ5E 2ESVE 1TTFA 2FSEA 3CZFA 5C0AB 4MB5A 1T04A 3SHSA 2XZCH 4HULB 3TCXA 1YUHB 2BRQA 5IHBA 1NMCB 5TH2A 3QIWA 1KGCE 3KPPB 3Q6FB 4OF7A 4WFGD 2QHLA 1NDGA 3NCYP 1RVFH 3AREC 5IKCB 4KROB 3H9HA 5BCAA 1A3LH 2QBWA 5HYQB 2UYLB 3IFPA 4ZYKB 3TPUB 1S7WB 2IPTH 4PTTA 4ZD3H 2IBGA 1A3RL 4BUGA 1KG0A 4HIHA 1KB5B 2Q76A 1UWEH 2IQAA 3IU4H 5DURD 4X5XB 4BUHA 4OCRH 3DSFL 1IAIL 4K23H 5EOCJ 4EDWH 1QSED 5DO2D 4XXCC 2EDNA 1OY3B 1LE5A 3TH3T 4H0GA 4GXVL 4QTIH 3NZHH 4CW1A 5LQBL 1ORQB 2VZ1A 1I1YB 5ENWB 3E6HA 3O8XD 1TXKA 1M05A 3LQMA 1M71B 1RK0B 4ODSH 2BMKA 4UBDC 5L8JB 1NBYA 4AIZA 4LNVA 3O41A 1T3FB 2I9LB 2ZSWB 1EGJH 3EDFA 5IOPB 3ZKQD 2XRAH 5D93C 3S36H 1NBVL 5KSAD 1GL4B 1UWGL 4NO2B 5FHAL 5CCKH 3T0DA 1P7QB 4XX1E 3WJLA 3RVXD 4JFDA 3IKCB 3MLZL 4PLKC 4Z7WA 2ATPB 3DECA 1N7MH 3HNSL 5AYQA 5GS1A 4G3YH 1W8OA 3OKDB 5TE6H 2D2OA 2GJ6B 2J8OA 3RL1B 3VFMB 3SQOL 5C0FB 2WINB 2X1XR 2MTPA 4LLMA 5BRZA 4WI7A 1JFQH 5D7IE 3CLEL 1AO7D 4P5MB 4URTB 1T5XA 3OZ9L 3BEWB 4JM2A 3ZDZF 5TPWH 3QCTL 5AYUL 1KACB 3QG7L 5FV2A 4ETQA 5DDHA 5E70A 2NYYC 4MD0B 5EU5B 3ZL4L 1TIUA 1NCNA 1NMAL 3MJ8B 4FFWC 3QZWB 5I1EL 1D5MA 3TNNA 3L95A 2R0WH 2GT9A 5GSVA 5FO7A 5IB2A 3A67L 4CUCA 4LPXA 1S9VB 4NN5B 5DHVH 3F7VA 4OZFB 1DN2A 3HG1E 2QR0A 1EXUB 1J1XH 5DF0A 3MUJA 1XGTA 2BY2A 3VFUB 2DQHH 3WNOA 1ZLWK 1B4JH 3U4AA 1U36A 3VWKC 2NY7H 4PJAA 2NLJA 3RIFK 3ELAT 4OZFG 1BQSA 1IGJA 4FFZL 2LTQB 1FZOA 4RWYH 3DVFA 4PIRF 3RU8L 3FO0L 4R26L 1GC1C 3QDAA 4C56B 4PB9L 3THML 2G9HB 2DS4A 3D0VB 4ZPTB 3RHWF 1JWSB 3O0RL 1CGVA 4NKOB 3BIKB 4GMSH 1KEMH 5J0BA 2XTJD 3DURB 3QJHA 4EQ3A 4NO0B 2AK1L 5DJ0B 3RA7L 3R8QA 5FGBC 5IBUG 1U8IA 2VTFA 3R06A 4PJCF 2WIMA 3BE1L 4PLJD 2HWZL 3RIAK 2XZAH 2NY3B 3VFVB 1FFPB 2YA2A 5GRUH 3LEYL 1DDHB 5ESAB 4KDWA 2J1KA 2RAMA 5HHXH 5I15H 3IF1A 5IBTL 3NCFB 1X5HA 1A6UL 3VXPA 4NRZB 1X44A 2WBJD 4DVBA 1RZIA 1XCTA 4PRDB 4U7KA 4KKCD 1EFQA 5FYKH 2BNUB 1SJVA 2NXZD 2AJZA 1KJ2B 2G75B 3WHE0 1QFWM 5JNYA 3O3BB 1IAOB 1YNKL 1WZ1H 3MA9L 4MNGE 5EO0B 3ARGD 3MV9D 4OFDA 5JXEA 3HMXH 5CIPA 5IWLA 3AREA 1CVRA 2SEBB 4MHHG 5C6TL 1JHLH 4JAMB 4NCC1 4ZS6C 3G6AB 2VLMD 4KH2A 4KJWC 1KB5H 1OGTB 1IC5L 2AEPH 1ZT7A 2DKSA 4IM8A 3TT3L 1AXIB 2DQIH 2R2BA 4PPTA 3F8UB 2JLLA 4MXQD 5BV7L 4WTWA 3LKNA 3D2UB 4OTXH 3V6OE 3ULUF 2J12B 5I9QC 4MA8L 1ACYH 1F42A 2DQTH 2J5LB 3IB4A 1UB6A 3PQYB 3Q3GB 3SDXB 2FJGB 2EO9A 1G9ML 4HKBB 4DUXA 2AV1A 5ADPL 1CDYA 1A9EB 4Y4HD 1WT5C 1SVZA 4H8WL 3RX8A 2AJXL 4WUUB 2X2YA 5JMRA 4EXPX 4KK9D 1CG9B 3B5HA 4R7DA 4DZ8B 1FAIH 2CIIB 2LQRA 4XCEB 5DI8A 3MRDB 1EO5A 2ZOKB 3OR6B 2X10A 1Q72H 1X5ZA 4LQFH 1OAKH 4FQLH 1KN2L 5HYFA 3RY6A 3TV3H 2X4UA 3RTQC 5HY9B 3KS0J 3MV7A 5FYJE 2Y36H 4NZRL 2VDLH 2R4SL 4G8EB 4XNYL 4D0CB 4G9FB 3B2VL 4QOKA 3IFNL 2HFFA 5DJ6A 5GS2H 2ORBL 3S5LG 3VXSE 1LK3H 3ARFB 5T1KB 1R6VA 4KC3B 2ZUTA 4JFFB 4KJQD 1YYML 4ZAKD 2BNRE 3BD5A 4Q6IA 1OARH 1NCAH 1ZLUK 4PJBA 3JWOH 5B22A 4OAWA 1KLGA 3PP4L 3WO4C 5DZNA 3BI9X 3QI9D 4P4RA 3K3QA 3HB3D 4C4KO 4LL9A 2XA8H 1EEZB 4OV5A 1DP0A 1RJLA 3GJFA 3GI9L 5GGQL 4HGWA 1X5IA 4XCCH 1T7WA 4PTUB 1FE8H 4OZFH 5D1QC 3ARBB 4X4XB 1D9KC 5D7IF 3KNBA 3LEXA 2X4RA 1T7ZA 1GH7A 2K7QA 4P9HH 5D7LD 5TQ2L 5IM7A 2A9MH 2APXA 4HS6B 1U91B 2WWMD 3VWKA 3U0TB 43C9A 1G7MB 1DEEA 3L3DB 1TJHL 1J8KA 4HC1H 5ID0A 2R9HC 1FGNH 3OSKA 4GMTH 3QQNA 3DX7A 2VAAB 15C8H 1EAPA 4H88L 4XPGL 2BNQE 2IQ9L 3RDTD 3MLRL 4XAKD 2B0SL 5I71B 5C92A 4NQVB 3QNZA 1WZKA 4MVBD 4P99A 3WEXB 1MJ8L 4UT6H 5C2BL 4G8IB 1ZA3B 1LO0H 1DVFC 1KPVB 1KPRB 3FO1B 5EU4B 5J12C 2DTMH 2PXYD 2J6EL 5CEZD 1WF5A 4GRWB 1WZLA 4TSCH 2CUMA 1U58B 1X6LA 2NY5C 1J8HD 1N8ZB 4XZUA 1KIQA 3ZKXB 4BH7A 1GCFA 3GIZH 1HI6A 5D7SH 1BF8A 4TSBL 5HVHB 3MGAA 4BYHA 5IMOB 2Q7YA 4JPKH 4YDJA 5FK9B 4PRPA 5GJSH 4HXAH 3SDYH 4K71C 4J1UB 3GUTA 2VERN 1MAMH 4Z95H 4PJHE 1NDMA 2EIZA 3DROA 1UYWH 4OZHB 1MLCA 4JN1H 1VADB 1YYLL 3SCMC 4MJIA 3KLDA 1CWVA 3V6FA 3TLRA 3Q2CA 1T2QL 3LPGA 3NIFE 2CRIA 3IJSB 3W82A 3VGEA 4K94C 4U31A 5ETUB 2CR6A 1IGFH 2GJZB 4RCAA 1KJ2H 1S78C 1MLBA 4X6FB 3DETD 5EOCH 1YY9D 4RIRA 3FB5A 1FFOB 1FIGH 4FNLL 4Y5XA 2ZG2A 2HRPH 1IAIM 2GSGA 4F3FA 2ZUUA 3D3VE 1JI1A 5FIEA 4ZTOH 2O61B 5C2UB 1DFBL 3EYQC 4RGMB 3L3KB 4G8FA 5C08E 3HI6H 1N0LA 1F6AB 4NCDA 3NCCB 1FFRA 2HT2D 1J05A 4GW1B 2H6PB 2NY1C 4KDVA 5D96C 3VRJB 4FTVD 3VFNA 1ZOXA 1OGAA 3MLSL 3QDJD 1MHHB 1OAUH 5T3XE 1IL1B 4E0RA 3CH1A 1YEEH 2VWEE 4PJEA 1A7RH 1CLYL 2MCG1 4I3SH 1F00I 1TJGL 4AQ1B 5C0EA 3LN4B 4EI5D 4NQXB 4YIQB 2X1OA 1CGXA 1BFOA 5ISZB 4LKCA 3TT1H 2OR9L 1NC4B 4RDQG 4E42B 5CEXB 4WWID 5FCSH 5B39B 4ODUB 1UB5B 2V7NB 1DANU 3BP5B 3HTLX 3T4YB 4Y2DC 1O7SA 5C7XL 3PWNA 1WBZB 3LSOA 1UH4A 4IRZH 2PR4H 1I3GL 5D70H 1OTTD 5B39G 4DN4L 2GSIB 5I1HH 4K7FB 4PFEA 4L8CA 1RIHH 2J88L 3D39E 4OCWH 2D7NA 1AD0A 3V79C 4LCCB 3UTPD 4ALAH 4XP6L 5FB8A 5DGRA 4OD2B 2VDQL 4PP1D 4WV1B 2IAND 1M7IA 1RJYB 3P9WB 4L3CA 3PHOA 2WBWB 3VXUD 3B4NA 2P24B 1CE1H 3RVVD 1M6OB 3IDYC 4OLZL 1XF4A 4OFYA 5EU7C 4WY7H 2DQGH 3U9UB 4F9LC 2DYPA 2XXCB 1CFTB 3MV8D 2F5AL 1T2JA 4XPFL 4PS4H 1BVKA 1T21A 2XWBB 3VXNA 2BJMH 5B8CC 2W65B 1SBBA 5ILTL 1I4FA 4FQXB 4N68A 1JZ3A 4R0LB 3L3IA 1KNOA 4DN3H 5D1QA 5FHBH 43CAA 3RWFB 3WKMH 3QXUA 3X12B 2I5YL 3I50L 5CBAB 2PW2B 5IQ9B 5EC1A 1JGEA 4JG0H 3IDNA 3LKRA 3NN8A 4P2QD 5E2UH 2WUBL 3NGBC 3SGDH 2A2QT 2CPCA 3RWHB 4L4VA 1PAMA 3H3BC 1WCQA 5GISL 1HDMB 4NKQB 4QHNA 1SY6L 3P4OA 5JOPD 1CD1A 4L8SA 3UTTB 1Z9OA 2HJFA 3GRWH 2JE8A 2WUCL 4J8RA 4KJPD 3IAPA 1L9MA 2AXJA 1JTPA 1E4KC 3EYOB 3MLYL 1NJ9B 3SKUD 5FO8B 1WIUA 5KTEL 5ICZA 4CL7A 5I66A 2I07A 3QIBD 3SDCA 3CFCL 1AXSB 1OVZA 5J89A 2V17H 1BQUA 4LNRB 5DJZA 1MRCL 5L9DH 3LN5A 1DBKH 5D72L 4AL8L 5I0ZA 4I9WE 2DQDH 3TYGL 2O93L 1KLUB 5E4EB 3MRNA 3FCTB 4Z9KB 5IHLB 4CVZA 1YJDC 4BK5A 1R0AH 2DRUA 1CK0L 4RRPA 5I8CB 4GOSA 5EG6C 5TDOA 4JDTL 1MWAH 4UOW0 3QAZB 5MENE 3C6LB 1H3UA 1C5DA 2RQ8A 4ERSH 4XMPL 4YHPB 3QSKB 2CRYA 4UV4H 2O5XH 2AEQH 3U4EB 3RGVB 3BZEB 1QKZL 4UZGA 3PWVB 4LIQH 4AMKH 3V8OA 5CJOH 4ONFH 3OKNA 3ULVL 3TN0D 3C60C 1JK8B 3HS0B 1I85C 2QADB 1JYNA 3C2SA 3T0EE 3UJJL 1P4BL 2DWDA 2PCPA 3KXFB 3RFZC 2OX5A 5JPNA 3MOAL 4DOHB 3TPKA 4UTAH 5IHUH 3V0VA 3BQUC 3P77A 1LO2H 2DM4A 4YAQA 5IUSA 1V05A 1CXHA 2X09A 3NH7L 4O00A 4XMKH 1CTNA 4M7LT 1WFOA 4P4KC 5CLTA 2A73B 4N1CA 2XN9B 2E7LE 1A5FL 1LO4L 4OI9A 3V5KA 1ZWIA 2NY4C 3S88L 2VJXA 4WWKB 3KS0H 1OHQA 1OP3H 1AR2A 3H7BA 3QFJE 1NC2B 3GGWB 3GB7A 1FNGB 4TVSa 4AIXA 2H3NA 1RZKL 4S1DC 1A3RH 5FXCH 3STLB 3UYRL 4P57A 4BFEA 3U0PA 5T5FL 1BJ8A 1MY5A 1A2YA 3DVIA 1EV2E 5BV7B 4P46A 5BVPL 4JRYD 4RMWA 5BJTB 1MCWM 3LMJL 3SKMB 4J3UA 1ZTXH 2CIKA 2P44B 4P23A 3RNQA 2DKMA 2VLJE 1H0DB 3VE0B 4JGUA 3ECBA 5E94A 1NLBL 3UTSB 4YFDB 5TDPA 5ESQB 5LQBH 3B5GA 2IPUG 4ONGL 1B6DA 4H26A 4W6YB 1KJ3L 3KPMA 2YOCA 4ZUVB 3JSSA 5IMLA 3FFCD 2M8XA 1BJ1J 3VGAC 3NVQA 4P5TB 4JEGB 1FYTA 1U3HC 2WM0A 4F7PB 3RIFF 5LGJA 3MLZH 4GH7B 4OSUL 3MX0A 3Q5TA 4QWWC 5KN5B 3D1MC 1N5AB 8FABB 4Z77B 3HNSH 1CFNA 4KK8C 3WYRA 3L1OL 4IRSD 3SQOH 4GRLA 2KPNA 1RSFA 1CTOA 3KWWA 3IDUA 4JFPB 5EC2A 3NFNB 1HNFA 2J2ZA 3ARRA 1MJUL 3L3GA 3NTCL 3OZ9H 3CFKA 1GGTA 3QQ4B 4PP2A 4X6DB 1MOEA 3QCTH 3ZYIA 1ND0A 4GKNB 3BRDA 1OP5K 4JR9H 1KXTB 5KANG 4S1QL 3ZL4H 1NMAH 3RIAF 1WCBB 1MFBH 2D03L 5I1EH 1JZ5A 5IG7A 4LVNB 1INQB 4PJFE 2HJLB 5GGSA 3ARWA 4U3XA 3O3DB 3QIUA 1Z9SA 2PO6A 3W2DL 4DWHA 4HKZA 5D6CB 4JFOA 3U1SL 4S0UC 3FRUA 5D9SB 4LHUA 3TO2B 5IV2B 4TOYL 3H3PH 2GCYB 3LKSB 4L3ED 3HLAB 5IVXE 1MEXL 5TDNB 5MEQB 4KUCD 2CRMA 2AQ2A 2P7TA 2HTKC 2DQFA 3DHMA 1TMCA 4PRAB 3ZYZA 3ES6B 4PRHE 3RU8H 4K3JL 4QHKJ 1JPGA 3FFDB 5CAYB 3FO0H 2DB8A 4LSVH 3FO9A 4R26H 5AG9A 2X7LA 1BMGA 4PB9H 4NUJB 3OKOB 1RZGB 1YMMA 3I6KA 5IFJA 2G5BA 4Z7UA 4ISVB 5GS0L 3VXME 3BPNB 3BGAA 3O0RH 5A2FA 4JFHE 3VWJC 1CBVL 4U6XB 3ZKMC 2DMBA 3BXNA 5JA8B 5IR1A 1PD6A 2YPLA 4IHOA 1AH1A 1IKNC 4GAGL 3SGJC 3C60A 4P2OC 1INDL 2C3XA 1IM3B 4OLXH 1MCCA 4NZTL 1WWAX 2QLVB 2BY0A 1IC7L 3MOQA 3AAZA 4I48B 4QF1B 3KPLA 5FYKD 4I0PC 2F58L 3RA7H 1ZHLB 4MD4B 1UH3A 2NNAA 4HKXA 5IMKB 1BZ9B 4ZOEA 5HHOB 3BE1H 1K2DA 1P4LB 2APFA 2DBLL 5KSUB 4KROD 3M17B 3BQUA 3O9WA 5ANMA 1DCLA 3LEYH 1A64A 5INCA 2XNAA 3LQZB 2ENYA 5HHNA 2ZJSL 4K3DH 5JLZA 4P4KA 5HJ3A 1H3PL 5IBTH 4UDTA 4F33B 1A6UH 4L1HA 2AS5M 2I9TA 5IIEA 2R2HA 2ESVD 1JMZA 2WNGA 1LO5A 1R5VA 1D6VH 3ULUD 2X4PA 2X4SA 5DJYA 1LEIB 4RGNC 3VG9B 5C0CE 1KCUL 1HOCB 4RX4A 2VC2H 1DE4B 4WEUD 3OB0H 3F7PC 1KGCD 2IAMA 2VQUA 4QHLB 5DMJB 4JY6A 5C07A 1KCRL 3RP1A 2BRRH 3HHRB 3AS2A 1E6OL 1G7LB 3F7QA 4KTDL 5BZWA 3VGBA 1IC5H 4HIEA 5BVJB 1RUAL 3WKNA 4FQQA 3ZHDA 1ZT1B 2NY5L 3FRPG 5BV7H 3H2WA 3GMMA 1JYXA 3V52L 5CWSA 4RA0C 4K8RH 1IFHL 1NEZA 1BHGA 3AB0C 1RJZB 1P5UA 1P6AB 2GJ6D 3WFCL 2ZUXA 5ADPH 2VDOL 3FHQA 2RHEA 3MLXL 5A2IH 5HHME 4H8WH 5A2KH 4JO2L 3SOBL 4DEPB 4PLNC 3LRSA 4Z76A 4U1NA 5DO2C 3KPSB 4XWGH 1JNJA 4Y89A 5INDA 5L2JA 3WNPA 3WCYA 4YPGA 3QT2A 2FBJL 3D25B 4KWUA 1VACB 4F57L 4MAYB 1I7RA 3QUYB 3O8XC 3BKML 1UZ8A 3WJJC 2XZZA 3HPLA 1QA9A 3LOWA 4NZUL 2A6JB 4PRIB 3SDDD 4AG4L 4U6HA 2R4SH 1FG9C 4MJ5B 4XNYH 1MREL 5CJQH 4PR5B 1MI5B 1N6QH 3IFNH 3RKPA 3GSOA 2ORBH 1N2RB 3KLHD 5HI3D 3HUJA 4WU7A 3NCYS 3QDGB 5JIIA 4HUXA 4OD1L 3RVXC 1YPZA 3LKOB 1YYMH 2Z8VC 3F12A 1JJUA 1HE7A 5C0BB 3GHEL 5C8JA 4LDEB 2OMBA 2IPKB 5E6ID 2ADFL 3KPQA 3FN0H 5MI0C 2DJUA 4C56D 5ID1B 2E9JA 3IGAB 1R3JA 2IWGA 4X7FC 2X42A 2HN7B 4UV7H 3MLVH 2Q8AH 1N59A 1L0YA 2VLRB 3O3AA 3HE7A 2HTLD 3GI9H 5GGQH 4OF0A 4Y7MA 4MMXC 3E1F1 3OV6A 3BKJH 4OJFL 4AT6A 5D7IA 1QP1A 4MLSA 4DGVH 2JELL 4PGEB 3DXAA 3DMMD 3CCHA 3HG1D 2XZQL 5TQ2H 1FNEB 5I18L 4YX2H 4DZBB 3G08B 3L7FB 3WIHL 5TE7L 1Q0YL 3NZ8B 4TVPL 1MIML 2FEEI 5HGHA 1RK1A 4JFEE 4Y4KA 1IGMH 2Z92B 3GKWL 4NJ9L 3DNKA 2Z93A 3W9DA 4H88H 3I6GA 1QBLL 3KPNA 5E5RB 3I6LE 2IQ9H 2DQCL 3MLRH 4M6AA 5F1OB 4MNQB 4PJFF 1BFVL 1FNLA 5C3LD 2PKDA 3QISA 2VDKH 2MWCA 3GSXB 1TETH 2J6EH 3VRLF 1NUFA 3VD4A 1IKNA 5IVXF 4LCWB 4P2OA 4HG4K 4HIJB 1CE6A 5I76A 1VGKA 5E7FA 1I1AB 1I3RB 4JQXC 1MQKL 1I7TA 4JY5L 4TSBH 3BIBX 5E8OA 1QLEL 3GMPA 3QEUB 4NHUE 1QRNA 1Q0XL 4R2GB 4IOSD 3CX5K 4R8WL 4XP4H 1FVEB 5D93B 3MCKB 4GXUN 4JO4L 3E6FB 2XTJC 3T3ME 3MXVL 3EFFB 3IJYB 2ZUQC 2IBZX 4NRYB 1YYLH 1EFXB 2YEZA 2ZUYA 4C55A 1S7SB 3BZ4B 3D2UD 2ED9A 4HS8L 4PLJC 1U95B 1RZJL 3SGEH 4D0DB 5EZLA 5I17B 3O4LE 3PQYD 1XGYL 4IRJA 4WO4A 3FAXA 3HC4H 5FFLA 1JWMB 1R5IB 1IVLA 1G7HB 2EYTA 4WUUD 2F15A 1CT8A 2JCCF 2HFGL 3C9NB 5J57B 1S7RB 3P4LA 1JRHI 3QUMA 1TLKA 3UZVB 4NQDB 3VFWB 4KKCC 1KFAH 3K7UA 3S36X 2NXZC 1YN6B 2P8PA 4HF5L 4TNWF 3B3IA 1BJ1H 1CVSC 3WS3A 4UU9B 4GAYA 5SWQA 3ARGC 1Z6JT 2F54A 4ZFZA 3WXVL 4OIIH 3FQWB 5C0GB 4G9FD 3B9KA 5AAMA 1S9WB 4OFVA 4WI2A 1CLYH 3PWLB 1U2CA 3LQAC 1YJDL 4POZD 3ARFD 4WW2F 1TJGH 4JFFD 1TJIL 4MXQC 4QHUA 1UKTA 1HEZB 2OR9H 3F5WA 5F7UA 4KQ3L 4MGXA 3V6ZB 1H5BB 3VFRA 1FGVL 4W81A 5IB3A 2B39A 4PY8I 3V5DA 5C7XH 3RNKA 3IU3A 1E28A 1QVOA 3BPCA 4LCUB 1RQ5A 1I3GH 1BVLA 5JZ7D 3LN9A 4JRXA 4MAUH 4N0RA 4XCNA 5EFIB 3ZT6A 3O3EB 3O8XA 3H0TB 4KK9C 2D31B 1FCCA 2EIEA 2HYMA 4S1RL 5EIIB 3ARBD 5FYJD 4XP6H 4JRWA 2R1WA 3PP3K 4M7JH 4XHJD 3T0BA 3MGTB 4LSRL 3RWCB 1UFUA 5KSAA 1NPUA 1MJJA 1ZA6B 1OSZA 3QA3B 5I73C 5HYJA 1WAAA 5EU3B 4CMMA 5J06A 1VFMA 3ABZA 5D5ME 2VUOA 5C6PB 2AXGB 5GRJL 2DDQH 1I1FB 5T1LB 3E8UL 1H15A 1FHGA 2FO4A 5DMKB 3VU2A 2VLLA 5A1AA 1RV6X 5DD0L 1RUKL 5D1ZA 3OKEB 1AO7A 1FFNA 3MLUL 4KJQC 1R3HA 4XMLL 4CNIA 4D9RD 1MH5B 3VXSA 4ODTL 3H42L 3BP7A 3TBTB 4X4ME 1L9NA 3LD8C 4YR6A 1QNZL 2P5EB 2VITB 3GMOB 2I5YH 3ZTJG 1JPTL 4MCYA 1EHLH 3QI9C 3HB3C 1KCKA 4O2CA 2X1PA 2IMNA 4ZXBA 5JW5A 2R1YB 4X6BB 3K8MA 2EYSA 3BO8B 1CDUA 1ZT4B 4I4WB 3MRFA 4V1DE 4MXVE 5GISH 5J6HB 1SY6H 4NKMB 5DRWA 5E8NB 1VFAA 5DA4A 2JB5H 2R1XA 3QDME 4YDKL 1FO0L 3MTRA 1IGTA 2WWMC 3AXLA 5I9QB 1M7DB 1XF5B 2ITDB 1FSKB 5GXBB 1D5ZB 1C5BL 3SPVA 3BW9B 5IMMA 5KTEH 1AD9A 2YK1L 3VH8A 4NNPL 3BGFC 1B88A 5MEOA 2P5WA 4JZOB 4MD5B 2HG5B 1YEKH 4WHYG 2GUOA 3B5TA 4KGJA 4MVBC 1AGBA 1KB9J 5D72H 4AL8H 1MCNA 3C6SB 2Z91A 3L3JB 2BNQA 3TYGH 1AR1D 4Y19B 3QG6B 3MRIA 2PXYC 1DL7L 2C3VB 1ZAGA 5E2VL 5E9DA 4P0DA 5HXMA 2Z8RA 4WTXA 1YEJL 5E1AA 4MB3A 3DGCR 1TQCC 4NPYB 3V5HA 2D9CA 4JDTH 4LFHG 2XICA 1VPOH 4HS3B 3CX5J 3ZDXE 2E8YA 4NYLB 4HKJA 3MNZB 2LU3A 2L7UA 3RTQB 3PWJB 2H26A 1D5XB 5H94A 3BRFA 4X99B 2O26U 2CLZA 4WEMB 1T5WA 4N5ED 1QKZH 1PZ5A 3U6RB 5AWNL 2OP4L 3KPRE 2IFGA 3IS0X 5J3HC 3OAUL 4PJHA 3UJJH 5ISZD 1P4BH 4U1LA 3D3VD 1NC4D 5KOVC 3BWAA 3QNXA 4K7PH 3T3MF 1MPAL 2WBJA 3OR7A 3MOAH 1KJMB 1Y18B 1EPFA 4ZTPL 3DETC 3PABB 1YY9C 4JZNB 5KS9A 4XVSL 3RVTD 5IJKC 4NNXB 3NH7H 4XRCA 3VGDA 1AGDB 2LABA 5JHLH 5JHDA 1MQ8A 3S8WA 1QG3A 4YXLL 5KVGL 1A6WL 2CLVA 4CADA 1D9KB 2F74B 5KSBB 2EE6A 1A5FH 1OF2B 3MYJA 1LNUB 2AJYL 1TDQA 4RAVA 2ZNXA 3CU1A 4PBWD 3S88H 3T4AA 1F4WL 5M95B 4NGHH 5C08A 3TM6A 2CKBA 2A6IA 3N50A 4YBLB 3UC0L 1VEMA 2JIXD 2OQJB 3WLBB 4JDZA 1MFDL 3MNVA 4KRMB 1ETZA 1PKOA 1Q9KA 1U92A 4D94A 3RUGB 3WD5L 1KENH 4M02A 2YC1B 4Y4HA 1LHZA 3S3JA 4GBXB 2FJFB 1GGCL 2DOCA 1JF5A 4EI5C 4FQXD 2FYYA 5T5FH 3OJVC 1I8IB 2W0FB 4GRMB 4RMVA 2Y7QA 5DJ8A 3O11A 3P30L 5KG9A 4WDIA 3GSRA 4OCSL 3TIDB 1DSFH 4QRRB 1TTUA 2UUDH 3EJYD 5C1MB 4G43B 2OTUA 4S0TD 2H45A 1JGVL 1OTTC 5HGBB 3MRPB 3N1PC 2VABA 2BVPB 1CD0A 3ZT5A 2H2PD 5LGHL 4ONGH 1G1CA 1KJ3H 5DHYA 3E2HC 7FABL 2ERJC 4LF3A 4WFHE 4HD9A 4CAGA 3OGCA 3SCMB 5TGBB 2QHRH 1OLLA 4PP1C 3UTTD 5C0ND 3MJ7A 3ZTJH 3CFDA 1QTYT 5FO9A 3JZ7A 2YMXH 5F44A 3RWGB 5GGUB 4WNQA 1QFPA 1U8KA 5E5MB 3RVVC 4YXKL 1QEWB 1U8OB 4ZAKA 2XKSA 1FJ1A 2ITCB 5IVNA 4BQBA 3IXTA 4MA3A 5DQJA 3KHQA 2CK0H 3G5VA 1U8JB 3IFOA 1JV5B 3KJ4B 4PJIE 4F37F 3DUSA 1G7QB 1Z0NA 4F80A 3L1OH 5D5MF 4Z7NE 1A4KB 5CP3A 1SYVB 3VXQB 3GEWB 2DIJA 2FX7L 4G8GE 5HDQH 1JN6B 5HYSA 1MJUH 1K6QL 2OJEB 3BUYA 4UQ3A 4RAUB 4XP5L 3VMNA 3NTCH 5ACMA 2V2WB 5EO1A 4XPAL 3U30C 1AY1L 4N8VB 2NY1B 4QRSB 4XP1L 5D96B 5E2TL 4X7TB 3C6LD 2D0HA 4GAFB 2A83B 1FZMB 4S1QH 1PGRB 3AM8C 5EWIH 2KKQA 1OW0C 3LS4L 4DKFL 1QLRB