4L8BA

Crystal structure of the h2db in complex with the np-n5h peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8bA01
1WFUA 1WIUA 1HQ4B 4XC3L 1YMHB 4K23L 3GSNB 1HILA 4JG1L 4R4ND 5IFJA 2FZ3A 3ALXA 5KSBE 3QHFH 3NA9H 5D7IB 5L88H 3B9KD 3GSWA 2PXYC 3MRIB 3O3AA 2F53B 1HHGA 3OJMB 1FPTL 3EJZD 3GBNH 4M7LH 3NPSB 4I5BA 3T0EA 1OP9A 3CFIC 3DUSA 5HVFB 5C0CD 1QFWH 5I71C 5D1XA 4PGEA 4I4WA 5ESQA 1XGQB 1WWBX 1S7QB 4ZAKD 1GXEA 3V6OA 3DO7A 2H9GB 5EPMA 1VGKA 4M93C 4PJDE 3PGCA 1HN1A 3INUL 5MEQA 5FCUL 2B5IB 5CINH 1KIQA 5D5MA 4ZUSB 4DW2L 1URLA 4RISL 1RY7B 2V2XA 3NIDF 3A6BL 3C6LC 3G5VB 1I7UA 2AXHA 1TETL 4G80A 3S4SB 1E6OH 3S35L 1TJHH 1YY8A 4PJHA 2PO6B 4HT1H 5EC2B 5LWYL 3O3DB 1UT9A 3G5YB 5GGRA 1A7NL 4JE4B 3AM8A 1FSKB 3GZKA 5FHBH 3JV0A 3DGCR 4Y16C 1F6FB 2AJZB 4ELKA 4KZDH 3O8XD 4KKCC 4JY4B 5ETUB 5TF0A 4M8QB 3WFDL 4FFVD 4J23A 3B2UC 1IGYB 1XGTB 4RX4D 5L0QB 3DX6A 1JI2A 2YRLA 5JHDD 4OCRL 2ZJSH 3P73B 5TE7H 3O9WA 1A7QL 1J12A 2YRZA 3CMOL 3VXSE 1R3IH 4R97C 2GITB 3FZUD 4PJIF 4P46A 3PDOB 3QWRD 2YOCA 1CLZH 1P7KA 3O2DL 4DOHB 1ZGLA 5ACLA 1S9WB 4WFHE 3JTCA 1KJVB 2ICES 1TZIA 3OKYA 2AVGA 3U1SL 3GJFB 5KSBF 4UTBH 5IV2A 4ZSOE 1N4XL 1BOYA 5KW9H 4D9QE 3PWPA 5IG7B 4LBEB 1S7SB 1DSFL 1CXEA 1WCBB 4YH6A 4X6BA 1CFTA 1MJ8H 2Z4QA 3U0TA 2HFGH 4PJXE 3GJFK 2ZUXA 5HHMB 4HJ0C 1CWVA 4WFGE 4FTVE 1YJDL 1BEYL 4O02L 4XXCA 4V3DB 4G42A 5D6DC 5CILL 1T89C 4Z0BH 3U7WL 5F88A 1KYOK 2R1WA 4XC3H 3WD5L 4K23H 5LGHL 4NSKB 5H35B 1WBZB 4JG1H 3FN0L 3MA9L 4UNVA 1NBYB 4WNQA 3FT2A 5DUMH 1J9CT 35C8L 4L4TB 1AQDB 5FYJU 4AH2A 1H15A 3LKRA 1FZOB 5DQJB 4IS6A 3DRTA 5ACMA 3S35X 3OKMB 2B1AH 3BUTA 1OTTC 2VR5A 4TTDC 2UVEA 3X13B 5JOFA 3VXRB 3C6LD 5I16A 5E1AA 2DQGL 4FFYL 1PDKA 2NLJB 5C09D 3EJYC 4QHKI 5ID0A 1RU9H 2APFA 5IW6B 4WWKC 3BFOA 2EDQA 3C8DA 4Y16D 1W72H 5FGBA 2X4RB 4LSQL 1BOGB 3F8UB 1F3JB 4IIQB 4RISH 4KKCD 2WWKO 4ZOEA 1U8QA 4X9FA 1TETH 1IM9B 4G8EA 3SGDH 2Q7NA 5DS8A 3RWIA 4UT9H 3V6BR 2YSSA 1AXTH 1T5XB 1QFPA 5LWYH 1CGWA 3K80A 4L8BA 5LGJA 4MVBA 2OI9C 5C08D 3MFFA 3RY4A 2JJSA 3KXFD 4G6KL 2A1WL 5EIIB 4ONHB 2FEEL 2VR4A 2UY6A 4Y5VC 4NOFA 1G9MH 1ZHBA 3WFDH 1XIWC 4NQXA 4U1JA 1DQDL 5HDBF 2VLLB 2IQAA 1UB6B 4GRLC 4HWEL 4PJXF 4U1NA 1FP5A 2V6HA 4MDJA 2R2EA 5IJVA 2B7DT 1N2RA 5GRVK 3GB7A 1ITBB 4TSCH 5I8CB 3MLXL 1S7VB 1E4KA 1IAIL 3O2DH 4W4OC 5TH2B 3SGJC 1MHEB 1FFRA 4HCRL 3H9SA 1NC2B 1AC6A 4HJ0D 2OR8A 4PJCA 3U1SH 3TYFB 5CUSL 4C58B 3WL9A 5M94B 1Z9LA 1RZ8A 4FRWA 2JB5L 3BW9A 3VFVB 1NBZA 4J3XA 4ZUVB 5C2BL 4N90D 5T3XL 1AKJB 2W60B 2XXCB 3LKNB 1DSFH 5E2TL 4R4FL 3LEYH 2LVEA 4R7DA 2YN5A 1Q0XL 4OZGB 1Q38A 4G8GB 3G6JE 1B0WA 1F45A 2D4DA 4NPYB 3FQTB 5F3BB 4Y88A 4IOIB 1YJDH 1WV7T 4UMGA 3TBTB 1H9VA 5F89A 1BEYH 3D0VB 3WNLA 1OTTD 4O02H 4YHOL 3LN9A 5TQ0L 4M1GL 5CILH 3EDKA 2Z31D 4XZUA 4O2CB 2CH8A 5LGHH 2R9HD 5CEXB 5CAYB 5C6WH 2VITB 4JHBA 3FTGA 3MA9H 3ARGB 3WS6C 3EJYD 5F1OB 3RDTB 1I1CA 4WFFD 2OQJB 4OGAC 1LP9B 3FO9A 1XCTA 3ZYIA 5FDWB 4KI5E 1T20B 5C2UB 1PAMA 3QXDB 4LVHC 12E8H 2E7HA 3NFNB 1TZGL 2GSIA 4NQCD 4HKXB 4I3RH 4MQSB 2FSEA 3JTSA 4TVPE 4PJBB 4RQQA 3EO9L 1I9RL 2EYSA 1JPGA 1R3KB 1AO7B 4YO0A 3V4UL 4ESKA 4HZLA 3ARDA 3TO2B 3QEQE 4NC1E 1DANU 2X4QA 4OIIL 3RP1A 2BOBA 3DV6A 3QP3A 3CZFB 5J1AA 1J8HD 3S34H 5ICYB 1QEWA 2EH7L 2P49B 3SE9L 1TTFA 4LPXA 1XT5A 4GRWB 4W4NA 3ZHKA 1X5JA 5I15H 3U0PA 2QQQA 1DN0A 1Q9LA 3UC0H 4R2GD 3DBXB 2XXMB 3EOBA 1EX0A 4HK3J 3QDME 4NC0B 5C0GA 4OF5A 4P2RE 4G6KH 2A1WH 1BQLL 1GIGL 3RUGB 2IBZX 4WO4B 4FQJH 1KV3A 4A6YH 1A9BA 3HKFA 5IW3A 5TDOA 3K2MC 4DUVA 3VFGL 5E08L 3G6JF 1DQDH 4JPVH 1MJUH 4HWEH 3MNWA 1KEGL 1I8MB 2YRPA 1PEWA 3P9WB 1HINL 4I0KA 4XPTH 1U92A 2DI9A 5DEFA 1FZJB 2VAJA 2D0FA 2Q76A 2BVQA 1IAIH 4W6XB 1MI5A 2FJGB 5C9KA 4HCRH 2AW2A 2BVOA 1NJ9B 1WZ1L 5BXFB 5CUSH 4D0DA 2BOCB 4ZS7L 2JB5H 4O51A 2ZOKB 1K3ZA 3MGAA 4KI5F 1T1YA 3GK8L 5T3XH 3D39B 1H3TA 3NPSC 3RA7H 5E2TH 4EUPA 4P49A 4R4FH 1W0YT 5FEBA 5JXEA 2W0KA 4M7JL 3G6DL 1Z0NA 2D31B 3OKLA 4LGPB 1Q0XH 1EA9C 3WSQL 1KB5L 1QR1B 4JVPA 3FFDA 5C07E 3H7LA 1S5HA 1G7MA 3GEWB 5IQ7L 4X7CC 2B5IC 2P4AB 4YHOH 1NFIA 4M1GH 5JPNA 5E8EB 1I7ZB 1D5ZB 5DC9B 1G9NL 4QHMB 3V6FA 5SWZB 1WC7B 5I1KH 3RI5F 1T80A 1QBML 4HQQH 3U46A 3JUZA 1IKFL 5TDNA 2A6KA 2PO6C 1QSEA 5FM8A 4YR6A 3KPMA 5CD5D 3MMEA 3HI1B 4LIQL 3D85B 4WW2B 1FSKC 2VDOH 3Q48A 2J2ZA 5IVZA 1TZGH 1VPOL 3SDDB 3NFPB 1NL0L 4CVWA 1EZVY 1A6ZB 5DHYA 1QO3B 3U7AA 1M05B 3V4UH 1CDYA 1RSFA 4ORGB 2VXVL 3QJHB 1LE9A 1H0DB 5I2IA 4Z7WA 1FYTD 3QCTL 4PV8B 4F7TA 1J87A 1A0QL 1E4XI 5JDSB 2EH7H 4IBLT 4P5TA 5ISZA 2GJ6E 1I1FB 1YEJL 3QUYC 4MS8A 3J8F7 3IU3A 3LD8C 5C0BA 2BSTA 1UB5A 4FQPA 5DJ0A 1NGZA 1HYSC 1LO2L 2NYYC 3QFJB 1U3HD 3G5ZA 2PNDA 4R8WL 4BJLA 3MODH 4N0CA 3CLFL 3W9DA 1BQLH 1GIGH 4ELME 3MREB 1MQ8A 2FB4H 2NY3D 1LVEA 2BNQA 3SGEH 3CFJB 1MCIA 3VFGH 2F53D 3WO4B 2VMFA 3T2NH 5DJCA 1S78C 3L3HB 5DT1H 1KEGH 1QHOA 3DETC 2IMMA 2WBJA 1IGCL 1GGBL 1HINH 1JPFB 2RIKA 1UWXK 5HHNB 4K07A 4U1GC 1MLBB 3P30L 3UTPE 2PR4L 1TQBB 1RHFA 3C60A 1JNNL 1ZT4B 1P7HL 2H3NA 1QLFA 1WK0A 1IL1B 2UYLA 4JFOB 3B9DA 5E95B 2GT9A 4PYHA 4HAGA 2IFFL 4LLQB 3TPUA 1RZIB 2F74B 4GXVL 4KTDH 4ZS7H 1PW3A 5D70H 4D0CA 1GC1C 4TUJB 3F7RA 1DQML 3GBLA 1A6UL 5J6GA 4HWNA 4M7JH 3L1OH 3G6DH 1G0DA 4PRIE 1K4DB 4U1MB 1R3LB 4X7FC 4D9RE 4LSVH 4NBZB 4JRXB 3WSQH 1KB5H 2NXYB 3STLA 1JTOA 1U41A 2A6JB 4JDVA 2OXHA 3SE4C 5BRZB 3FQXB 5IVXB 2O61A 4NKOA 3KJ4C 2UZYB 1CD8A 5GSVB 5BS0D 2OM5A 3B9KA 1EO5A 1UWEL 1G6RH 3FT3B 2Y25A 1QBMH 1IKFH 1A4JA 2DB8A 4FMFA 4X99A 2NY2D 5FB8A 3JV4B 4QXUH 3FFCE 5C0CA 2XN9E 4ZUUB 5C6TH 1PYWA 3VH8B 1BFOB 1FN4A 2A6IB 1VPOH 4QRRD 5KOVC 4ZAKA 5IFHL 2J8UF 3MV01 2ZCHL 3HRPA 3T0VA 4DZ8A 4ELMF 1N0XL 3HB3D 3QUYD 2M8XA 4X7EC 3QUXB 2NYYD 1RJZA 4QOKE 2VXVH 5EU6D 4PJ5A 3N1PC 5MEPB 3QCTH 1BFVH 4LQFL 2ZSWA 2NNAA 3Q3GB 1MFEL 4Q6IB 1PGRB 5LXGL 1A0QH 2EDLA 4U3HA 4U1HB 5IB4B 4XNQA 1TCRB 3VU2A 5GS2H 1YEJH 2H2SC 4L3EE 2Q86B 5I1AA 4MCZB 3PE9A 4FQ1L 5AG9A 3VXMB 3TBVB 4LSUL 4XCYB 2Q7YB 2V2WA 1LO2H 1W72A 3O8XA 4EQ3A 1FFPB 3MXWH 4R8WH 2VXUH 1P7QA 3RIFF 1E4WL 3NZ8A 2HVJA 5HYSA 1E4JA 4JKMA 4PJAB 1AR1D 5AUMB 5JHDA 1FG2B 5J1SC 1L9NA 2VXSL 4J1UB 2Y4SA 4HS6B 5K33A 1OCWL 1X44A 1MREL 5IIEA 1FFOA 1IGCH 4K8RL 3DUUA 5GGSA 5CSZA 5D7KE 5ACZA 4XB8A 3NGBB 1P1ZA 4NUGL 5DRXA 2PR4H 4K3HA 1VSCA 3CNKA 1JNNH 5DD1H 2E9IA 5IVOA 3UPCA 3ARGC 4Z7UA 4PBWD 2UWEE 5JNYA 1Q94A 4QXTB 1AGDA 1SYVA 4ODUB 5A2IH 2VRAA 2IFFH 2OTWA 4MNGE 5D7LE 1XF1A 1VFMA 1CGYA 2N56A 1DQMH 2L0DA 5C0JB 1UJ3C 1EEQA 1A6UH 4JY6B 5HHOB 2G60H 3O2DA 4K8RD 1IZJA 3MLZL 4HV8A 3RVTD 3T1FA 1JHLH 1S7TB 4PJFE 1K6QL 1LMKA 2Z91B 4OLWH 4DFHA 2FX8L 3OWEA 2NR6C 1JF5A 2F54B 4FQLL 4YPGA 4P5MA 3ABZA 1NCAH 2R0ZL 3MLYH 5FF6B 3QWOB 4MXQC 3PF2A 1IQDA 3HUJE 2MWCA 2NY6C 1UWEH 1EO8L 1S7XA 2JB6B 4YDJA 5DK0B 1ZANL 1G84A 3EDFA 2VZ1A 1SYSA 3ZHDA 5I1CL 1F6AB 1A2YB 3DGGA 2NPLX 4JEGB 1CI5A 1CE6A 3C6LA 4LASH 3S88H 4DWHA 1IJ9A 4S0UC 3MLVL 4LQ1A 2P5EB 4LPVA 4PRHB 4NO5B 4U31A 4S10A 2M26A 5C09A 4WO4C 5IFHH 1NGQL 4JN2A 3DVGB 1N0XH 4AMKH 3LZFH 1F4AA 2X2YA 4JKKA 4YAQA 4Y16A 4ZYKB 2OR9L 2CJUL 4LEOB 5HGHB 5JORA 1A7PL 2ED8A 4HPOH 2HJFB 1AKJD 4MMXC 3P9MB 2C3HA 4O00A 3PV7A 1OD7A 1RK1A 4LQFH 3ULSA 7FABL 4NP4L 1MFEH 1KF9B 4TNVK 3OMZA 4MCYA 3LN4A 4UQ2B 5LXGH 2VTFA 1ERNA 1NKRA 3SOBL 1JV5B 5C08A 5CSBA 1S8DA 4FQ1H 3KXFA 4F37K 4WHCA 4AT6A 3N0PB 1CTOA 2GFBB 4LSUH 2OMNA 4XX1G 3RTQB 3BEVB 2EDTA 2IAMA 4RGNE 3IAGC 5H37G 1H8OA 5ABDE 1E4WH 3O6FB 4JM2D 5EO1B 3ZDXF 2QHLA 3MUJA 3RNQA 3ZT6A 4LVEA 3WNKA 2DQEL 1MCWW 3QO0A 1MF2L 2VXSH 4ZPVA 4GT7A 4M62L 1OCWH 1Z9SA 4JN1L 1MREH 3QA3A 3OXRB 1IARB 3MRRA 3GIZL 1WWWX 4K8RH 2BXZA 4Y19B 3MRHB 4ODHL 4UQ3B 4LMQI 4NUGH 2GAZB 3WKNA 4A6YA 2BSED 4N0YL 4PG9B 3HUJF 4P9HL 2P5WB 4LKXB 4YFLI 4BZ2L 4IMKA 4XAWL 4KMLB 3U2SB 3OBAA 4G6JL 4YBQC 1ZSDB 5D2LF 2P24A 1CFNA 4WW2C 1P4BL 3FO2A 2HKFH 5BZDB 2BVUA 2NY6D 3SDDC 2V5YA 3B8SA 2H6PB 3PJSA 4HIJA 3MLZH 4HCRA 2VB5A 4JO3H 3M17B 1JRHL 1U8NB 5CGYC 1U8OA 1F3DH 4QHNB 5L2KD 4UUJA 1BX2B 2OL3B 4XCNB 3X11A 1VEOA 2Z31A 4BA8A 3X17A 4MNQD 4ZO7A 4MXVE 1JK8A 4WEUD 1JNLH 5F9AC 4IJ3B 4WO4D 3MR9B 1F4WL 3CUPA 2EYTA 4G3YL 3KS0J 5KANG 1EO8H 4XNMB 4MJID 5CBAB 5I75C 1RJLB 4XP4H 1ZANH 2BJML 2VISA 1XGPA 4LAQL 2OSLB 4R4BA 2DYPB 3BDYL 4L8SB 5I1CH 4YNYA 3NCYP 4NKDB 2GSGB 5CS7A 1DP0A 5DFVC 4NQCA 1AH1A 4X5WA 3RPIB 1R3HA 1T0MB 1QSFB 1XMWA 2EO9A 3JTTB 3MLVH 4XP9H 4L4VB 5KZCB 3MV8D 5HGAB 4JRYE 4PB0H 1NGQH 1RI8A 5D93B 3WO4C 1BBDL 2OR9H 2CJUH 5E8DL 2CRZA 3DROB 1I7TB 4LCIL 3FQNA 3K2UL 1J8HA 1UFUA 2W59A 4R6UA 3O2VL 3SJVB 3FHQA 4NJ9L 1BP3B 3UTQA 5FK9B 1TQBC 4GXUM 1TTGA 3SOBH 3VGBA 1J1XL 1NCNA 2DMKA 3E6HA 2ADJA 1OGAA 5MI0B 1ORSA 4KJPC 3KLSA 3RY6C 1EEZA 1YDPA 3VGDA 5IMLA 3SGJA 2XZZA 1M7DB 4H88H 5IEHA 5B38A 2W92A 2QQNL 5CZVL 4N9GA 3VRLE 2XWTA 4Y2DB 4RIRA 5KVGL 1F42A 1HCVA 3PQYE 2DQEH 2FJHA 2NXYC 2OTUB 3D3VE 1MF2H 1UXWB 2E5EA 1QFUH 2YUVA 3RVWC 3HAEB 3N06B 4PP8C 4JN1H 3MCKB 3MGOA 3D85D 2NTSP 1FDLL 3UP1A 5JW5B 5E8OB 3GIZH 3GMPB 1M1SA 4N0FA 3SDDD 2BHYA 3GSUB 3QHTC 4ODHH 4MXVF 5C0FB 1A4KA 2X4TA 2AKRA 3RBSA 4H26B 3QPQD 3A0OA 4I2XE 1HK6A 3SDYL 4N0YH 3TESA 4C57C 4OB5L 1RZFL 3QI9D 4BZ2H 5KVDH 4XAWH 4Z95L 4G6JH 5HGGS 2CRMA 1ROWA 3C5JA 5CKAA 1P4BH 1HHIB 3EAKA 5DJYB 4CL7A 4MD0B 4MQ7A 5F9OH 2WINA 4ZNEA 1BVKB 1OAZL 2JCCB 1RMFL 1KCLA 3SN6N 4NCC2 4HUVB 3HC0B 2EDJA 4RNRB 4RGOH 2E7BA 2DLGA 4L8DB 5DFVD 2LAAA 3QUXC 4KUZL 5FO8B 2QQKH 4PGJA 2JJUA 1P4IH 2V7HB 1CYGA 4Z7VB 2ZUQB 1TVBA 2CIIA 5KVFH 3IU4H 5GGUA 5GISL 4Q6IC 5FO7B 1F4WH 1ZLVH 1KB5A 4G3YH 1NUNB 1C5CL 3JV6B 4ZG1A 1MHCB 4LLMB 4Y5XB 2BJMH 3VI4F 4LAQH 1NGPL 2O5ZL 3BDYH 2R2BB 4Z5RA 4CUCA 3L3DA 4LLUA 5FA4B 4DGYL 3L3JA 3U6RA 1G6RA 4XGZA 5DRWB 3T0DA 3KYMB 4HEPG 3C9NA 4J4PC 3IRPX 4LCCC 1BVLB 4D0BB 5DMJB 5A2KH 1FYTA 1ZVHA 1BBDH 5E8DH 4X80L 3HE6D 4LCIH 1R3JA 4Z7QF 3K2UH 3E8UL 1YNTA 4YXLL 3MRBB 4YQXL 3IXTB 3NGBC 3W0WB 2ITDB 4NJ9H 4H5SA 5E8PA 3PWUA 4CU6A 2YD4A 1FQ9C 1EO7A 4YBLB 3OPZL 2K7QA 3K8KA 3CGTA 5AAMA 2YXFA 1VKXB 3RVWD 1J1XH 1U3HA 4YLQT 1U8JA 1DLHB 2LABA 4AL8H 3MBXL 1A3RH 3W5MA 4G9FD 3OGCB 1CGTA 3GMRA 2WWKT 3MRIA 3P9LB 4PJ7E 4BQ8A 4Q6YA 5KVGH 4JFFE 1IGJB 1R5IA 2YK1L 1GZPB 2DQCH 4MD5B 4ZPTB 2R23A 1NFDE 3CDGB 1FDLH 2H8PA 3DX7B 3T3MF 4GW1B 5JLZA 2XPGB 1KTLB 2IH1A 1KFAH 1UM6H 4H8WC 2IANE 3OKOA 2AK4E 2YUZA 2C4FU 5I9QB 3SDYH 4JDZB 4MD4A 4WI8A 5DYOB 3FRPA 4YGVB 4OB5H 1RZFH 5AD0B 1G7IB 2HJKA 2L4OA 3LKPA 4RA0C 4Z95H 3ZLQC 1XGRA 2FJFB 3MUHL 1CL7I 1VB9A 4L9LB 2HTLC 1D6EB 2DS4A 2X70A 5GZNC 2VXQL 5F21B 1AGBA 5IT2L 4X4MA 1T0PB 2F5BL 4PV9A 3ZDYE 4BH7A 5CZXD 1FCCA 1OAZH 1RMFH 4QCIB 3OR6A 1J8KA 4FFEX 4OZFH 2E7LC 2VLKD 3HG1E 3NN8A 4U1LB 3VFRB 2DBLH 2VXTH 2BSSB 5EUOB 1MRCL 4HF5L 2DKUA 4KUZH 1X3DA 5AYQA 3WLWC 5BS0A 1DUZA 3IDJA 3UXFA 3U4EA 4PLJD 1Q8MA 2C7UA 3HZVB 1F4YL 1UCTA 2BRRL 4J4PD 4JFXA 1C5CH 4OI9A 1QYGL 3W39B 1K4CB 1FH5L 3VRIA 3PWJB 1Y18B 4KK6D 1KGCE 1NGPH 2O5ZH 4K94L 4NRXA 2HMIC 5IOPA 3KPPB 3D2UB 3T4AB 5J13B 4QRRA 1MVUB 3RTQC 3VXUD 1DQQA 2Z8SA 3UBXA 2ESVE 4DGYH 2AJYL 3O6FC 1HOCA 3VFTB 4DN3L 4C4KO 5HHQB 3FOMA 4DUXA 3QDGE 3QUYA 5GZOD 3WN5B 3ROOA 5IF0A 4PJ7F 4YHPA 4LBEA 1CFSB 2MJWA 2Y6SC 5FYLD 4WU7A 5EU6A 4FOMA 2EECA 3QQ9D 3IXAB 4KRPB 4X80H 3E8UH 3I6LE 1NFDF 3EOYG 5ANMA 1DVFB 4M6OL 3AC0A 2QSVA 3RWCB 1K8DB 3F7PC 3OPZH 5FYKL 3CFEB 3BZEB 3P40A 3T0WA 3PWVA 2Z35B 3MBXH 1I9JH 3QSKB 3BEWB 4DQOL 4XNXL 1VERA 1ZA6B 1FV1A 3ZMRA 2CLVA 3U9PL 1Z9MA 5B3JE 4V2BA 3MRCA 3LDBB 2DKSA 1M6OA 3ZDYF 3QIUB 1B2WL 2ZOLA 1B90A 3KG5A 3UJTL 1YMMD 4XXDA 3RHWK 3TA3C 3HPJB 3EYUH 3I02A 4DGIH 5J1TC 3MRFB 1E28A 2P5ED 1U8MA 3VGHA 2FBJL 2IBGA 1SVCP 2ATPB 4IJ3C 4NKMA 1ZLUH 4Z0XA 5IW6A 1NCWL 4K3DL 4HUUB 4XP1L 2QL1A 1HHHB 1YPZA 5F3HB 3DSFH 4OUOA 4NYLB 3MOBL 2Z8VC 4L8SC 4YDVA 1JE6A 5FUZL 3QXTA 4HJJH 3WFHA 3UTSE 1K8IB 3GNML 2PYEE 1XGUB 1GOFA 5B39G 4GG8B 2F5AL 2GK0B 5D93C 1AGEB 1VFOA 4QRPD 2YMXL 3MZGB 3AY4C 1JGEB 1KUMA 4NWUL 1HI6B 1RULL 1HH9A 1XF2A 4Y2OA 1MRCH 2ADIA 2R1YA 3VXTB 3ORJA 5DJZA 4OQTH 1XR9A 4KV5E 2YWZA 1DBBL 2F58L 4M43L 1B9ZA 3MV7E 3Q1SL 1AY1H 2NY0B 1F4YH 5ENWA 3C8KB 4LF3B 2BRRH 2Y6SD 3QEUB 1OT1A 1FH5H 4K94H 4ODXA 2LU3A 3TH4T 4BUHA 4HJGB 3QCUL 4LLAA 3GRWL 2BP3A 4M00A 3VJ6A 2AJYH 3MBEB 5DFWH 4TNWF 5TGBA 4DN3H 4Y2DC 5GGTL 1CXIA 3TCLB 4NQEE 5M95B 3MNVA 5C0NC 1AKJA 3HS0B 3V8CA 4EN3B 1U2CA 1A1MA 3WYRA 2H2PC 3FQRA 5EZJA 3BH9A 5B8CB 1CXLA 3BZFB 5FYJD 3RAJL 4M6OH 5DGQA 4K2UH 1MFBL 3CLEH 2C3WA 4I18A 2CIKB 4QYOB 1HH6B 3FO0L 3TA3D 1JFQL 1QRND 5IB2A 3ZE0E 1RUAL 4JM2A 2VABB 4XNXH 4UV4H 1KC5L 4UB0H 2YHGA 2VLJE 4DTGL 3U9PH 3IFNL 2P7TB 4WI4A 1V8HA 3ES6A 3FB7B 1B2WH 4U6XB 3KNBA 1UJ3A 1HEZA 2HFFB 1A7BA 3NH7L 2ZUQC 4S0SD 1HXYB 4KFZC 5K9QG 3LKOB 1MWAB 4TUOB 4HX1B 4KV5F 5I66A 1CICD 3KPSB 1LO0L 4K3DH 2R15A 3U9UB 1ACZA 4Y5XC 2BNUB 3MJ7B 2WV3A 4LCWD 3ERYA 3X14B 5C86A 3MOBH 5FUZH 1CG9B 4DVRL 4BYHA 3HPLB 1FZKA 2GJZB 3DXAE 3SJVD 3GNMH 1CT8A 3I6GB 1R5VB 3T4YB 1HQRB 5L2KA 3MRQA 1RURL 3O4OC 5KS9B 2CK2A 2F5AH 1P2CA 4MNQA 2YMXH 1UM4L 3N1FC 2VL5B 4NWUH 4PJDB 1RULH 4JZNB 3K4DA 5GGRY 3RUGA 4EI5B 1Z5LB 5FO9A 2GTWA 4WO4A 1LE5B 4CAGA 1S3KL 5E9DE 2BMKA 2DDQL 4AENA 4K9EC 4D3CH 4MJIA 4ONFL 1DBBH 4M43H 1IKNA 3FQUA 3Q1SH 4YBLC 1I3GL 3LH2L 3BQUD 4LK4A 4NM4H 3UTZA 5EB9A 4WI3A 3HZMB 1A02N 3NOIA 5TDPB 3V5KB 2NZ9C 5KSUA 2A6DA 5FYJH 3QCUH 3GRWH 2Y07L 3MV8A 3UDWA 4YC2B 2KPNA 2XNAB 3ZE0F 1EZVX 4JZJB 2VN4A 1FNEA 4WHTA 1HHJA 1BFTA 2VLRD 5D7IE 3VXNA 1D5BA 1SEQL 3SDXA 3VXSB 4HMCA 1QRKA 5I74B 3WHXA 2R0LL 4MJ6B 3IKCA 1NDMA 3UTTE 4JR9L 3J7HA 3QFDB 3OV6A 3M1BA 2NY5L 2YPKB 5I9QC 3AS3A 3T08A 1LDSA 3BP5A 1NAMH 1YEFL 3QISA 1MFBH 2ATKB 4GMSL 4PY7B 5GRJL 1BJ8A 1AGFA 4ZSOB 3FO0H 1I7ZA 4KJWD 1JFQH 4DZBB 1XF4B 2KZ1B 1WC7A 1A6TA 4L9LC 3RJQB 3IS1X 3IFPB 4HIHA 3C2SA 4OFDA 2X89D 3AFLA 4DTGH 2X4NB 4PJ9C 3IFNH 1QLRA 1MSPA 1J10A 2FIKA 3VG0H 2EXYC 2DM3A 1EHAA 1P9MC 4FTVB 4PD4J 3QZWB 2X4SA 3AAZB 3NH7H 2IPKB 4H1LG 3QIBB 2ICWI 1RZJC 3EO0A 2J5LB 4PRDB 5LQBL 1T1XA 1CR9L 3QI9A 1MCEA 3BPNB 1T2QL 3VXPB 4XBGB 3TFKC 1UEYA 5EDXA 1JL8A 1LO0H 3EHBD 5C0RL 3IGAA 2BCKB 4I3GA 3JWDC 1LHZA 3HN3A 4O5LL 2Y36H 5BJTA 2PW1B 5J13C 1SY6L 2W65A 3MRKB 5CGTA 1J11A 4DVRH 1T2JA 4WU5A 2H26A 1TITA 2X4PB 1ZE3C 1BZ9A 1G7HA 4YHLH 3DYPA 4PJEA 1WZKA 4JFDD 4F33A 1TMCA 4N0UA 2IF7A 4PIRF 3V0VB 5D1ZB 4YIQB 2J4WL 3WN5C 3ULUL 2Y5EA 1RURH 1IILE 1FLTX 5H94B 3QB7C 4MA1B 1YEIL 4O2FB 1UM4H 3REVB 1EVTC 2G2RB 4I0PC 3IJSB 5D7IF 4KRPC 4WJ5B 1T1WB 1BJ1J 3BAEL 3STBA 4PJHE 5FUCC 1X7QA 4HKZA 1HSAA 3MLSL 4LL9A 1SJHB 3GHBH 1G7LA 4ONFH 4HKBB 5CMAA 4J2XA 5EBMA 1KENL 1QBAA 4MXWL 3CAFA 4OZFA 2XFXB 3LH2H 1T7XA 4JHWL 4X8JB 5DJAB 3B2VL 3GBMH 2F8XC 4X9BA 3KPRD 3BH8B 5HHME 4HIIA 1JWMA 4OCYL 1BLNB 4YFDB 3OKKA 1XH3A 4JM4L 4K7PY 1FNGB 1YNLH 5H37H 3RGVD 4LVNB 3DNKA 1MFNA 4XPBL 3LDBC 1DBAL 2A9NL 3HE6A 1J0YA 2IH3B 2HTKD 2LU7A 4MJ2A 4KJYB 2MMXA 3CXHK 3H7BB 4NO0D 4L4TE 5JR1L 5CGMA 1UGNA 3F7VA 2R0LH 1TZHA 5GS1A 1A47A 4JR9H 4Y4KB 3BZ4A 4PJ9D 2Y1VA 3PWPE 1N5AB 1U95B 3VXRE 2X42A 2NY5H 2I5YL 1S5IL 4C83B 4FABL 1YEFH 2D3VA 1YEDB 4G9FA 2JJTC 5GRJH 5FFLA 4YDKH 3MUZ1 4R26L 5A40E 2OX5A 3LPGA 2P44B 1D5MB 2QTEA 4N1EA 3O4LD 2AV7B 4XT1C 1LEKA 3WCYA 3ME0A 1C1EL 1UJTA 3IJYA 5JHLL 2VDRL 1ZMYA 2XI9A 4XPFL 5J9PB 3MPCA 1MLCB 3UTOA 4KK5C 1KG0B 1JCKA 3FB5B 2C3GA 5MENB 5IEKA 4JJ5B 1ITCA 4PJHF 4L1DA 2NY0C 1JZ6A 4L3AA 5DJDB 5C0RH 2CKNA 1RHHB 5JMRA 2A83B 4MA3B 1ZA3B 4I0PD 1S7RB 4G8FB 1W8OA 4O5LH 5DO2D 2HLAA 3QQ4B 3OAYH 1KN2L 1A6VL 4HS3A 5GRZA 5T1KD 1FO0B 4GH7B 3VFOA 4JAMA 3MBEC 2QEJA 3G08B 1T1ZB 1Y6KR 2EE3A 1F97A 2VLKA 5DMKA 1EAPA 4JPIB 4XWOD 2J4WH 5L7XH 3ULUH 1J05B 3TBVA 4WEBL 5D7JB 5LGKA 2EC9U 3CPLB 5I19L 3EFFB 5TE6L 3F58L 4EN3C 2C3VB 1ND0B 1GAFL 3BAEH 2PW2A 3AREB 1B6UA 1L0YA 4BK5A 5B8CC 4J4PA 4NHUE 3MLSH 3O41B 5AAWA 4LCCA 3MV11 2AI0H 1SBSL 4XTRC 3FRUA 4OTXL 1J18A 2E3VA 4MHHG 4I9WE 3MJ8B 4JHWH 5BVPL 3Q2CA 4WUKH 3VE0B 4M7ZB 3VXUA 2YD2A 1E4XH 5H2BB 3QDMB 2EEDA 4JM4H 1PBYA 4OQTA 3ECBA 2YEZA 3VFWB 5FECB 4P2RB 4PRBA 5ICXB 3RI5K 2OYPA 4NFBA 3T2QA 5EFIB 4XPBH 2QHRH 4M6ML 1DBAH 2APXA 4B50A 5F7UA 5HY9B 5DDHB 3LHPL 1OGTA 5F71A 4PLOB 5E4IA 3MZTA 5JR1H 1LP9E 3LSOB 2I9TB 3CSYA 3DHMA 4PJCE 2RAMA 3MOAL 4LLYB 4OCXL 5I8EA 4JFYA 4OCNC 2I5YH 1S5IH 4KXZH 4FABH 1IAOB 1RQ5A 2Z0BA 4Q74A 4YDIH 2BVEA 3QWOA 3CXDH 4JFEB 5J0BA 3S96B 2WUBL 4P2QB 1ADQL 5HYQA 4PJ8D 3S7GA 3SCMC 1JYVA 3JXAA 4AIZB 4JJHA 4X6DA 5TPWL 2YPVL 2R2CA 2QSTA 4KUCF 1YMMA 3RX7A 1HHKA 5JHLH 5L8JB 4OFIA 2VDRH 4FQ2H 5HD8C 3EUUA 3LV3B 4XPFH 4R96A 5GRWA 5T5NF 1OTSD 1U91B 5DRNB 4EI5C 4HH9B 3EZ8A 5BV7L 5GS0L 1GHFL 3EFDL 1K3IA 2Q8BL 3QBTB 3MROB 4OI7A 4U6VH 3G9AB 5HHPB 1UVQA 2PN5A 4OAWA 3NCYS 1JGDB 1AP2B 1KB9J 1T4KB 1CDGA 4NGHL 4R0LA 1MVFA 4NQVA 4GQ9L 5CWSB 5EOQL 3MOQA 4BFEA 3CCHB 3BJLA 3V6ZA 5I0ZA 1JF1A 1KN2H 1A6VH 2QADC 5FOJA 4WGWB 4YC2C 4PPTA 1DJSA 1U58B 4G5ZL 2BVPB 4XTRD 4JZJC 4QRPA 4OZ4A 3ZTJG 3P4OA 3TBSA 4KKLD 2IPUG 4BSVA 2WM0A 2GFBA 2GTZB 4ZODA 2KKQA 1L7TL 5TE6H 4P9HC 4QRTA 1VGEL 3F58H 1A3QA 1P5UA 5IROC 3B6SA 3BE1L 2D7PA 4Y4FB 5I74C 1GAFH 1KOAA 4XH2A 3EYSL 1LP9F 4CNIB 4BSWA 3MRDB 4S1DC 5CEYA 5JA8B 1SBSH 1A1OA 4OTXH 1OP5K 3JWOL 4PG2A 3BYTA 1B4JL 3OKNA 2D0GA 1KXVC 2GJ6B 4YK4B 4G6AC 1IMHC 4ZUWA 4P4RB 4GKSB 3P11L 2EDNA 4CDHA 3DI2B 4P23B 3TO4A 4P3DA 3LMJL 4ELMB 4U1SA 1RUQL 2R1XB 4PLKD 2DIAA 3LEVL 4M6MH 5SWZE 3K8LA 3QHZH 4H25A 1FE8L 4NO3B 2JIXD 4GRWF 4LGSB 1N6QL 3QIBC 1VADA 3GRWA 5L2JA 2NQCA 3NIFE 3EOAB 2J5LC 1IEAA 1D5IL 3SCMD 3PIQA 3MOAH 4NQDD 4QHNA 3BPNC 4OZIA 5E6IB 1U8LB 4TSBL 3BO8B 2FATH 3TA3A 4HKJB 2ICCA 1QRNA 5HD8D 3ZKMC 1N26A 2IGFL 2FR4A 1EFQA 3LQZB 1BGXL 2YUWA 5FDYA 1KT2A 1ZKAA 4LKCA 3WIFA 5D96B 3QR2A 3L95B 1X6LA 2YKLH 1J0IA 3H8NA 2WUBH 1J0KA 1ADQH 4Q9BA 2NW3A 3V4VL 3CFBA 4PRIB 1JN6B 1DCLA 3C5ZB 3R1GL 5D1ZC 5TPWH 4JO4L 1NAMA 3PL6B 3WE6B 2YPVH 5FGSA 3MA7B 1U2HA 3RPIA 5IMMB 4MA1C 3FHAA 1WISA 3G9VA 2OJZH 3TBWA 5BV7H 2QADD 5F7HA 1GHFH 3EFDH 5EN2A 1IEHA 3MRNA 1OSZB 1CICA 3BWAA 5DUBA 3PWLB 3BOVA 5K9KA 4TVSa 4UDUA 4XRCA 4LCWA 5EBWA 2AEWA 2PYFA 2YPLD 1CD0A 1RUML 4ZXBB 4KTEL 4GW4B 4HXBL 1D3CA 4GQ9H 4Y1AD 3FFCB 4JFQB 1HDMB 4JANA 1OPGL 2XN9B 1DDHB 4E9LA 3BP6B 4P5KA 3ARVA 4G5ZH 5BW7C 3EJJX 1JI1A 4Y8AA 5CIPH 1MPAL 4LVNC 5JZ7D 1UWGL 3HI5L 4KDTC 1QUNA 1LK3L 2J8HA 4NRZB 1XZ0A 4NT6B 4JQXC 4YHZL 4OGXL 4OZHB 1VCAA 5E2VH 1DZBA 4G6AD 3BP7A 1PKQB 2EZ0C 2FGZA 4RGMB 1L7TH 4D9QD 1VGEH 2FDBP 1FNLA 4MDIB 4UOJA 4QOKB 5KVEL 3BE1H 1TENA 3GMMB 1S7UB 5ISZE 3Q6GH 3EYSH 4Y4KC 5HVHC 3NIFF 1WUNT 3BQUA 4ODWB 4HAFA 4HIEB 4WW2F 3BVNB 2VQ1B 3GMOA 5HBBA 3S3SA 3JWOH 3UX9B 3DV4B 4PGDB 4WFGD 3ARFB 1NANH 2PETA 3GMPA 4FTVD 2B1HL 4L3EB 1DL7H 3ZHLA 3GSUA 3O11B 3SKUD 2VJXA 4AJ0A 2EXWC 1U8HA 3P11H 4UT7L 4OLYL 4PGBB 5GGSY 5T1LB 1YEHL 3AXLB 1N59A 3PV6B 5BRZE 3SKOB 4PRPD 4QTHB 1ZLWK 4ETQA 2VLRA 1KNOB 5C92A 4Q58C 4GG6B 5FA3A 5EU4B 5CEZL 1Q72H 4FXGA 3ZKMD 1L9MA 1JMXA 3GGWB 3VFSB 4FMKA 1FE8H 3H9YA 2HT2C 3CJJA 1YN6B 4WTZG 1N6QH 2ZKHL 5KOMC 3CFCL 5DF0A 1D5IH 4EQ2A 4DK6A 1FG9C 3KDMA 2D03L 4RNRA 4C4KT 2VH5L 4A2LA 1I7RB 1SM3L 3TPUE 5DVKA 2Y7QA 2P47B 3BXNA 5IB3B 1D9KC 4APQB 3E3QA 3VRJA 4Y0GA 4OV5A 4CVZA 2UWEB 4X0KA 8FABA 2IGFH 3DO3A 3BKYL 5CEZD 4QTIL 1DEDA 2X89A 3B3IA 1BGXH 4E41B 4KI5C 4MNGB 3QT2A 5D7LB 2VZUA 5FO7A 4QHLB 4EKXA 1VFAB 3NIGE 1EGJL 4Y5XA 2NCMA 5GRXG 2HJLA 2HFEB 3ELAT 2EH8H 3R1GH 4JO4H 1VFBA 4MZ3A 4PJFB 5DD6A 5I1DA 2JK5B 1KBGL 5CJXC 4JB9L 4JY5H 3IRZA 3WBDA 1C12B 3OHXA 3QQ3B 3AREC 4NC1C 3VXME 2VDMH 2DM4A 4UIMB 4R7NA 5EZLA 3RGHA 3HR5A 2DMCA 2HH0H 2EE2A 1DQJB 5C6PB 1XCQA 1RJYA 4XP5L 5ITFB 1RUMH 4WV1A 3QYCA 3TLRA 4R3SA 4KTEH 5E7FA 1JNHB 4XVJL 4HXBH 5E6ZA 1RZKL 2I25N 3HE7D 4JFDA 3SPVB 4U1IB 1T21A 4BFGA 2WW8A 1BZ7B 4Y4KD 4HWZA 1ONQA 3BIKB 4HXAL 5KSVA 5IVXF 1MPAH 1XR8B 25C8L 1J1PL 4PJ5E 3KAAA 4YHZH 2ZUUA 5KSAD 4OGXH 4NKIH 4P2OC 1XF3A 3S9DB 4WTWA 1YY9C 3BD5A 3Q5TA 2SEBA 4X7TB 3MC0A 2OJEA 1QLEL 4W6WB 2P46B 4FQXD 4NHCH 4DVBA 3S37H 1JHTB 4F7CA 1S7WA 3KPRA 4G6FD 3CDGA 3REWA 4PBVC 3BPCA 2BC4A 5GRYA 4KK9C 1MAJA 1TPXB 2B1HH 2HT2D 3TIDB 2VDKL 1UADC 2ICWB 5IKCB 2XKNB 4X6EA 2IALA 3RGVA 1AJ7H 2F54E 4RGNB 3N1QC 4GRMB 1D9KD 5F8QC 5IQ9A 4NO0A 5CEZH 2GCYA 4X9GA 3QUMH 1G6VK 5GPRA 3STZB 1FFNB 1YUHB 2VIRB 2V5RA 4EVNA 3CC5B 1LILA 4Q9RH 3LOWA 5EBLB 3KS0H 5F7DA 4U4BA 3LQMA 2EDKA 4PJ9A 1JWSB 3QUZD 4PY8I 4XMPL 2XOTA 3CFCH 4Z7UE 3NACL 5DJ6B 5A2LH 4LSSL 3QULA 1P9MA 2VH5H 3HZKA 1SM3H 4PRHE 5FOBA 4BKLA 1AD0A 3DMMB 4WY7H 1EBAA 3BKYH 1FZMA 4QTIH 4PJAF 1PSKH 6FABH 1F90L 3QEQD 2Z93B 3S98A 1ZT1B 1V3JA 5D7SL 5BOPA 3O4LA 1NBQA 1ZVSA 4JDTL 1JZ4A 3ARBB 4KVCL 1EGJH 4QRSA 4FHBD 4ZO6A 4M02A 3PHQA 3LN5B 5HYSG 3KPPA 3L6FB 4HC1L 1FC2D 5DLML 1ZVYA 1EHXA 1NKOA 3UROR 5IB5A 1KBGH 2CDFA 2VYRE 3TVMB 3RY5A 1ETZA 2XWJB 4JB9H 4YHNB 4IMLA 3WEXA 4Y4FC 3VW3H 1G7PB 4LNRB 4P2RD 4V3EB 1LO5B 2YD1A 4ENEC 3MRGB 1NBVL 4I0PA 5HHXH 1KYOJ 4XNUL 1HSBB 2X1WL 4L1HA 2DICA 4P2OD 4YK4C 5T1KA 4KHTH 2R4SL 1YY9D 1RZKH 1U3JA 3CDCA 5D6CB 3HHRB 4RFNB 1RAMA 3X12A 1NCCL 4P23C 4DCQB 5CKGA 2HVKB 2RFXA 4XWGL 3KYAA 3MCLH 2VZTA 4QWWC 4Y19E 5HDQL 3CFDB 3BT2L 4HXAH 1VDGA 5E2UH 4JRYB 2AK1L 1J1PH 1H8SA 2FYYA 2NXZD 2P5WE 3P4NB 1ZA6A 1VENA 4OGYH 1QACA 5LG1A 2Z8RA 2XT1B 2H32H 4NZRL 4PLNC 3TNMB 2OBGA 5GSRB 4UINL 4GW5B 5E5MA 1MHHB 1JIBA 5EOTB 3BGMB 5E6IC 5C07D 1YC7A 1LGVA 3QNYA 3PABB 4TNVF 1RUPH 4U2ZA 43C9B 2VDKH 1ED3A 1CBVL 1SJEA 5J11B 4FFZL 2X4OA 3MUY1 3QCVL 4HUXA 2UVFA 5F3HA 4XHJC 5DI8A 4F37F 2JJTA 2CGRL 2N7AA 3S5LB 3C5ZC 3GUTB 3FB8B 3BDBA 5EOCJ 4IRSB 4XVTL 4MAYB 3D3VB 1T22B 3CX5K 4YHIB 4WI5A 2W9DL 5E1HB 4RFEB 5HYJE 1A1NB 5BVJA 4XMPH 4H1LH 4MWFB 2DQUL 5IBLC 3NACH 4DGVH 1MCCA 3GI9L 1TVHA 4LSSH 1AGCB 4EZMA 5C3TA 4I2XB 1PVHA 5SV4A 4EI6B 4OFPA 4KZEL 3X3FH 2HFTA 1B6DA 3FOLA 1QG3A 2VDPL 1EFXD 1NUGA 4ZXBC 1NH6A 5A43C 4OT1L 3CDYA 3ZSTA 4PJ8A 1F90H 2B39A 1G7JB 1BF2A 3QDJB 3QXAB 4GAYB 3QJFA 4UDTB 5DQ9A 5D7SH 1M7IB 1I8IA 4JDTH 3VFNA 3IF1B 4ENED 4KVCH 3FO1B 1S9YB 3HC3L 4BUGA 4XVSL 2VDNL 1EHLH 1WIPA 4QY8B 1ZTXL 5T3XE 3D1MC 5DLMH 4PTTB 4ACPA 1NLBH 2AQ3A 4RGMC 5DVMA 1EBPA 3KR3H 1B88A 4WFFE 4N5UA 4P23D 1M71A 3UPRB 1ADQA 4F2MB 5A2JH 4S2SA 2FECI 3OKDA 2DWEB 1YYMH 4NN6B 1LEIA 4N8VA 5JTWA 1NBVH 4NQCE 4XNUH 2XG4A 5FGCE 3ARFC 2ADGB 1W2KT 1W0VA 3ULVL 5B8CA 5KTEH 2R4SH 2VO5A 3GJEA 3CFKB 4XI5C 1F2QA 3NFSL 1YC8A 1NCCH 4X6CE 4CADA 4DK3A 3UTPD 4KKAC 3VA6A 1HH6A 3BT2H 4NUJB 4OCSL 5E8NB 1J8HE 2AK1H 3F7YB 4YXHL 5C8JB 4JFPB 4QHUA 3V7AG 3CVHB 3GSOA 1NEZB 5ALCH 5INCA 1XF5B 3FQWB 1CZ8L 1OM3L 3L5WB 4K3GA 5JO5A 4X5XA 3F65A 2ID5A 3LKSA 3AU1A 3T65B 3BHBB 1R5WA 3RL2B 5JW4Q 4NZRH 2YBRB 3L3KA 1OGAE 4PRID 5CIPA 5F7WC 5HJ3B 4ZFOL 3O2WH 4X6FA 4D9RD 3VFMA 1KIRA 5HGDB 4M61A 3ZE2E 1CE1L 2FEDD 4PJIA 1A6AA 4APQC 2A73A 2YC1A 3GIVB 3TH2T 4B7LA 5ID1A 5F9WB 2F15A 4U6HB 4UOW1 4M7KL 3ESUF 4NNXA 4FFZH 5KSBA 2JJWA 5IBLD 3QCVH 3DX9B 2ARJQ 5J3HD 3P0YH 1AD9B 4PJ7B 4ZUTB 3EYOA 2JIXA 2VZ3A 4JFFB 1MCKA 4CW1A 1PZ5A 3NBNA 4HUWB 2W9DH 4NFCA 3D5OF 5C9JA 3SCMA 1ZXQA 5GJSL 1CXKA 4OUUA 1NFDB 1VEMA 1C16B 3BUYA 4NNYB 4N9OB 4NQDA 3L9RB 5IMOA 1N3NA 1LEGA 4EDWH 3DTXB 4MX7B 1LNUB 1OF2B 3KLAA 2W07A 1IGMH 2IANB 2AK4B 1FVEA 1JWUA 3SKMB 3SQOH 2ZUYA 3G5XB 4P2CG 3V5DB 2XY2A 3LRHA 3PHOA 3U79A 3LRSA 4KZEH 3V2AR 3OX8A 1F4HA 2VDPH 4OLUL 1ZK9A 1BQHB 3BN9C 1JUFA 3VWJD 5JW4N 4OT1H 4UZGA 1DUYB 2CDEB 4HIXH 3JWNC 3S36H 3RL1A 1IAMA 5IM7A 2B4CL 4ZOCA 2DLIA 5MHSD 1JZ2A 4X6CF 4RAVB 1L4IA 4XVSH 4F9PC 4GBXD 4ZFZB 3W0WE 1IGTB 2VDNH 3LKQB 1ZTXH 3PUCA 5IW1A 1IZKA 1YEGH 2EIZB 3IJHA 1W0WA 2DBJA 1J0JA 5HDLA 5I1EL 3HG1B 3VD5A 3OZ9L 2YZ8A 4RWYH 5IR1B 1IAKB 3LQAC 3R0MA 3KPOA 1V3KA 4JZOB 1OB1A 3IDUA 4XCEB 5T1LD 2NY1D 5D9SB 4IHOB 3KWWA 2DWDA 3V5HB 4F7EA 1OWRM 4PR5A 2YPLA 4FQHB 4E5XA 5D72L 1UC6A 2ITCA 5J6HB 4C56E 3L3GB 4TPRH 2V7NA 3D6GA 1QPXA 4KQ4L 5IROA 1OAYL 4Y1AA 3FJTA 3MJ6A 3WO3B 4J8RB 3ZE2F 1CF8L 2EDOA 3MV9D 1B0RB 1H5BB 1TPXC 4QRUA 3ULVH 3FCTA 3P0GB 2EE9A 2WZPD 1R0AH 4ZO9A 3SBWA 5DURD 4HPYH 2YD3A 2OCFD 3NFSH 2YPKA 4RGNC 2E8YA 2ESVB 3Q5OA 4OFYD 1KN4H 1ORQB 5GIRA 4LIQE 4KK8C 3QDGB 3OXSA 2MCPH 4YEFA 3T2OA 4OCSH 4MB3A 3KPLA 3LIZL 4WVRA 2LAGB 1FL5A 1RFDH 5HI4C 5EA0L 2D7NA 5D7LD 1P53A 1KLGB 5HHVL 3ZYJA 5E2WL 1CZ8H 1AHWA 4PJXA 4XC1L 2D9CA 5D2NB 3ARWA 3P77B 4ODBD 3L3IA 1SJVA 4U05A 1FL6B 4I3SL 4Y5YB 5AG8A 4OV6F 5B39B 4PRPA 1A8JH 2EEAA 5C0DB 4BFIA 2D7MA 5INDB 3ARBC 1AIFB 4PGCB 3E2HA 3KYOB 3Q6FB 2DQFB 2X4UA 2ZUSA 3BP4A 2PW1A 1U93B 3HNVL 4Q7DA 1CLOL 1REIA 1CFQB 3TVMC 1F11B 2NW2A 5GJSH 4P4KD 1I8KB 3IVKB 2ADFH 2H41A 1BM3L 3FT4A 5I1LA 3DHJA 4P57A 4YHYB 5I8OL 1MJJB 5DXWA 1RZGB 4YDLB 4ZQKB 1CDJA 3GSRB 3QIWB 5HGBB 5BMFH 3QUMA 5T5FL 2WANA 1S9VB 5JPMA 1KCRL 3C09B 4RFNC 3UTSB 1KJMA 2B4CH 3QEGL 1TQCB 5ICZA 5BS0E 1Q9KA 4N8CL 4LHUB 4XCFL 3ZTJH 5IHUL 3FB6B 4WW1B 5C0EA 1AXSB 3GSQB 3HI6L 1FFQA 1NSNL 4G43A 1EGJA 3UO1H 4OKVB 5D72H 5B4MC 1RK0B 3MV7B 4U0QB 2HWZH 3I75B 1QA9B 4BZ1H 3NTCL 4X5LA 1MRFL 4QRRE 4KQ4H 1WLHA 3HE7A 2PTVA 3FRPG 1U42A 3SDAC 2DQDH 1ZS8B 5DVOA 2IG2L 3GSVB 3GSXB 3ILPA 5J11C 3D0LA 4M1CC 3HC4H 4G8IB 4YUEH 3S4SG 5EU6E 5EUOF 4DKFH 3WFBH 5KSAA 3EIFA 5F7KC 5E99H 3SE8L 1CDBA 1U8KA 4NDMA 4LOUC 4IRSC 4NQEB 1KLUA 1KCSH 3QHFL 4MAYC 3NA9L 4NRYB 3IFOB 3UAJC 3QO1A 1UKTA 1BQUA 4X4XA 5HHVH 4HUNB 4FQXA 3G6JA 2D2OA 4M7LL 2V9QA 2MQCA 2UUDK 1C5BH 2B8OT 2MNUA 4XC1H 3VD7A 2CO6B 4MGXA 2AV1B 3D69B 3LS5L 4HFWB 1JGUL 5F70A 1MAKA 4I3SH 3LEXB 4CJ1A 5CD3A 4G7YL 3WXVL 1QFWI 3WV0A 2WAHA 2EDDA 2H32A 5F9JB 1D9KA 1LD9A 1AR2A 5BZWA 2VLJB 3UBXG 2GUOA 3TWCH 5IGXH 4IM8A 5BO1L 3QQ4A 4L3CA 3MYJA 3HNVH 5EU5A 5T3ZL 1E6OL 4IOFD 1TJHL 3QUZA 5EIQA 4GMTL 4PRAB 4YE4L 3IDGA 1NGWB 3SKNB 5IBUB 2C1PB 1IC1A 4XPAL 5IBTL 3OJDB 3VXOA 4AM0B 3RHWF 5I8OH 3CPLA 5CJXA 4NN6C 2MKWA 3ZKXB 3RZCD 3K81A 1WQVT 3T8XA 1DE4B 1ND0A 3NVQA 2DKMA 3TIEA 2VR9A 1CD1B 5T5FH 1BBJB 3QEQA 2XTJD 1F6LL 2LV4A 3H3PH 2OS7A 5T3ZD 4M9PA 4EDXB 4H1LA 2DJ4A 2EKSB 3TPKA 3DXAB 2ZJSL 3L7EB 3DRQA 1BIIA 5B4MD 4P99A 3VD9A 3RWEA 3FONB 1WBYB 3WHE1 2UZIL 3IDIA 1T0NA 3SDAD 5ERWB 5EIVA 4UTBL 1C5DB 2VE6B 4GFTB 2NX5B 4OIBA 5E9DB 3IKKA 4HEME 2ENYA 1MNUL 3TN0B 4RCAA 1R24A 3O3EA 3T2PA 4X98A 5I1IL 1UQSB 4P2OA 4Z9KB 4H0GA 3HCVB 3PQYD 2FO4B 4MAYD 5HPMB 3LSOA 3QEHA 4HDIB 2I9TA 5IB1A 4ZFGL 1FGVL 4QT5B 3TZVB 1YEEL 4ZS6C 4NKQB 3O3BB 2CKBL 2CLRA 2IG2H 5A16A 4RBPH 3KPNA 2P8LB 1DN2A 2CDGB 3KPQA 1B0GB 4HHAA 5GS0C 3H9HB 4Z0BL 1TTUA 2CK0H 4NO2B 4JLRB 3SE8H 2DN7A 4JHAH 43CAB 4FFWC 4RSVA 3IDNB 4ZTPL 1BD2D 5DRZA 3KPSE 3QQNA 1PKOA 3L3OB 3SKJH 5DUML 1KTDB 4V1DB 4Y4HB 3VD3A 4XBPA 3PGFL 1EJOH 3GMLB 1Y0LB 5EWIL 3UTTB 2B1AL 4GKNA 3MRPA 5C07A 4QGYA 4PJGA 3WLBB 4WFEE 3LS5H 1JGUH 2Y23A 4MA8H 3VXQA 2VERN 2DTML 4EJ1C 4G7YH 5KS9E 3WXVH 3WUWB 4HGWA 1RU9L 3DIFB 5EU3B 3W9EB 3U36A 3HZYB 5MEOA 1KPRA 3QG6A 4PFEA 1W72L 3K1KC 3MLTA 1YN7B 5AEAA 1FVDB 1BJ1H 5BO1H 3ZKNC 3ZE1F 3EYQD 5T3ZH 2VKXA 1HILB 4GMTH 4UT9L 1CK0H 1FIEA 2FZ3B 4YE4H 5IFJB 2V2TA 2AP2A 1AXTL 5C0AA 3BI9X 1TCMA 4XPAH 1CFVL 2P8PA 3GSWB 5IBTH 2YA0A 1S9XA 2BVTA 5E5UB 3OAZH 1KXTB 3O3AB 1MH5A 2OTPA 5SWSD 3SY0B 1KCKA 1HHGB 2HRPL 1EFXA 1I1AC 3L7FA 4ISVA 3QDAA 3CSGA 2P8MA 4I5BB 3T0EB 3DUSB 1KCGC 3RWGA 1G9ML 4PGEB 5D1XB 4I4WB 5ESQB 5F97E 5F7FA 4UOW0 4LCYA 1UZ6E 5D1QC 4PB9H 4MNQE 3DO7B 1SMAA 4MNHA 5EPMB 1OOAA 1VGKB 3IFLH 3PGCB 4TSCL 2VAAA 5DGRA 3V0AC 2X9YA 5MEQB 4Z8FH 3MLRL 4Z76A 4KGJA 1KIQB 4Q2ZA 5D5MB 2UZIH 4IRJD 2V2XB 4OCMC 3BD3A 2J8UA 1I7UB 4G80B 4QHKJ 5F44A 5E7BA 5J12B 1YY8B 4PJHB 2ZCLH 4NN7B 4J3UA 1MNUH 3LEYL 5I1IH 1G9MC 4FFWD 5GGRB 1BREA 1INDH 3EYVA 3N9GH 4Y5YC 2ICEA 3MV8E 4ZFGH 1FGVH 4ELKB 1YEEH 2PXYD 3I3EA 4OF0A 1PQZA 3DURA 4N68A 2CKBH 4D2NA 1EJ6A 5KS9F 5DD0L 9CGTA 3RWHA 5E56A 2D7OA 4PJDF 1FJ1A 2IAND 3O45A 3DX6B 3QUKA 2FWOA 4UT6H 3SDXE 4HK0A 3O9WB 1INQA 4ZO8A 5DJ2A 4ZTPH 4P46B 3D25A 1P7KB 1ZHNA 1H3PL 1CXFA 4M5YL 3R06A 3TNNA 5HDOA 1ZGLB 5FM4A 4LFHG 1TZIB 1AI1L 3PGFH 2AQ2A 5EWIH 3DX8A 5IV2B 12E8L 3ALWA 4YHYC 4YDLC 3PWPB 3VFUA 4ERSH 3QIWC 5DZLA 4I3RL 3NCMA 5I76A 4PTUA 1HXMA 1I8LC 2DTMH 1PG7L 4B41A 4QGTA 4YFLF 4X6BB 2GI7A 1CFTB 4DEPC 1G1CA 2IMNA 2Z4QB 3U0TB 1OTUC 1EV2E 1IM3B 2APVA 4ZFOA 1I1AD 1UZ6F 2DIBA 4I48A 3RWDA 1RUKH 2XZQL 5DTFA 3C5SA 3HLAA 3S34L 4G42B 2Y5TA 5F88B 4EOWH 2R1WB 2W1NA 2VC2H 4F8TA 1N64L 5I15L 3BISA 5IK3A 3UC0L 3B2UD 2ILLA 4LLWA 4WNQB 4L29A 1P4LA 3FT2B 5BOZG 1CFVH 4JFZL 1LK2A 3DYOA 5D1QD 3RWJA 4JCMA 4AH2B 1H15B 3LKRB 1ZT7A 1U8IA 4IS6B 2HRPH 3DRTB 4NZTH 2CLZA 3QXUA 5F7EL 4PREA 4FXKA 4FQJL 2ZWLT 3VWJA 4A6YL 2AXGA 4S1QL 4PJEE 3PDGA 5JOFB 2APBA 2G5BA 1AFVL 4N0UE 2RGSA 5I16B 4JPVL 1MJUL 3AVEA 5E1AB 2FEEI 3B5GA 1Y6NR 3C6SA 2ZSVA 3CVIL 2GY5A 5EULV 4GBXA 5ID0B 4XPTL 1OWWA 1NGXA 1TFHA 4JO2H 3NZHH 3VG9B 3MLRH 3SDXF 3VWKC 1X5ZA 1N7MH 1EH9A 4I77H 4XMLL 2V5SA 2BNRD 1U8QB 1NCUA 4G8EB 1IAII 3F5WA 1G1YA 3E6FA 5DS8B 3RWIB 4F9LC 3MUGA 1B3JA 3RNKA 3WJJA 4NHUB 4AEHL 2Z92A 3RA7L 3OF6D 1NMCC 1GVIA 4POUB 4L8BB 3MV9A 3CH1A 1WICA 3QRFM 3MFFB 4QNPE 2X9XA 1ZLSL 4Q97A 4OFYA 1I1YA 5DD0H 2GJJA 1ZHBB 4NQXB 4U1JB 5MENE 2IQAB 4TTDD 3K46A 4U1NB 3QIWD 1T6VN 1UYWL 4MDJB 1CTNA 4KGLA 2R2EB 4GKZA 5IJVB 4PP1C 5I1KL 1N2RB 4TUKL 4CU8A 3C08L 4HQQL 1A22B 3GB7B 1UH2A 1INEH 4JRWA 1H3PH 1QD0A 3SDCC 4U3CA 4M5YH 4MQXC 4WWKD 3H9SB 1AI1H 2PYED 2R2HA 5AYUL 4U1KA 4PJCB 4XNYL 2YWYA 4Z7NE 4G9FE 2VDOL 4J7RA 4KROB 1KTKE 3UZEA 1U8PA 5CP7A 1MUJA 1EEYA 3WL9B 1RZ8B 2YD6A 3ZKXC 2MHAA 5ADPL 1NBZB 1CCZA 4LHUD 2I9LA 2AJ3A 4OZFG 2OR7A 5SX4H 5CJ5A 4R7DB 1F58L 1PG7H 2CQVA 2YA2A 3ZYOA 3HUJA 4PJEF 2A0LC 1L7IL 3GMQA 5F1IA 4OCWL 5D2LA 4LLVA 1A6WL 1GJIA 2W0FA 5F89B 1GGCL 2XZQH 1OSPL 3PGDA 4ODVL 3QNXA 2HLFC 4P4KA 2XZCL 4XZUB 1N64H 4WENB 1XIWD 1C08A 2EIBA 4GRLD 3EO1A 3FTGB 1KCVL 4N1HB 2XQBL 4JFZH 2AJXL 1GGUA 3TN0C 3FO9B 1S9KC 5TJWK 3MODL 1KJ2H 4G6MH 1FVCA 1WCQA 5F7EH 3P3YA 3VWKD 2GYSA 2FB4L 1OP3K 3TZVC 4X7TA 4S1QH 3IDYB 2GSIB 1AFVH 1YECH 2VLKE 4LNVA 2FSEB 3T2NL 3JTSB 5DT1L 2PTTA 4RQQB 3CVIH 2EYSB 1JPGB 3SGEI 1I4FA 1N8ZA 4YO0B 4N5EC 4EEEA 1QPPA 2G9HA 4HZLB 3TYGL 3ARDB 5IKCA 1C7SA 2WLYA 5ESAA 2X4QB 4TTGA 4M5ZH 4G9DB 3VI3E 5K9OA 2BOBB 3DV6B 5J1AB 5ILTL 3VH8G 4XMLH 1QEWB 4M7LT 3MRJA 5HI5C 4ZDHB 3U0PB 1DN0B 5ADOL 1Q9LB 4KTDL 2NZIA 1ZWIA 4M1DH 1DBKH 5D70L 2VLJD 4JFEE 4AEHH 4P2QE 2VIRA 1YUHA 3EOBB 1EUUA 4PRNA 3VXUE 5E94A 3L1OL 4PP1D 3RKDC 4M9OA 3RWFA 15C8L 4NJAH 4LSVL 5C0GB 4OLEA 4WI9A 1DTUA 1ZLSH 4M3KB 3SDCD 1UA6L 4OGAD 4MQXD 5JOEA 2EICA 5DR5L 1A9BB 2RJMA 5TDOB 4ZTOH 3NAAL 2DL9A 1X4XA 3DVNA 3MNWB 4JGJA 4M3JA 1J7VR 1LO3L 1UYWH 1G6RL 1U92B 4TUKH 3C08H 5DEFB 1MCWM 4I8DA 4F7MA 5CJOH 4HFUH 1NC4D 2A0LD 1RD6A 2Q76B 2BVQB 1MI5B 3KYNA 4QXUL 2BVOB 3CZJA 5AYUH 1QR4A 2WIIA 2NY4B 4XNYH 3BMVA 5C6TL 4D0DB 1TNNA 1FL3A 5ADPH 4NQSA 4O51B 3B5TA 1T1YB 4EUPB 3TF7C 4POZC 5KG9A 1F58H 5D1XC 3OKLB 4X6DE 5L0QC 1HNGA 1MIEL 4E42A 1IE5A 4WTZA 5FYKE 3LS4H 2HT3C 3GSNL 3FFDB 1L7IH 2X7LB 5DK2A 4OCWH 3G04A 1S5HB 1BFVL 4ZFFA 1A6WH 2FX7L 1G7MB 1JYNA 1GGCH 5SV3A 5SX5K 1OSPH 1QQDA 1NFIB 1WTGT 4ODVH 5JPNB 1O7SA 3Q0HA 2XZCH 4WUUE 1KACB 3V6FB 3VGAB 3VI3F 1X5AA 5FKAA 5J12C 5I6XB 1KCVH 3U46B 4LPUA 2XQBH 3RZCA 5TDNB 1ZEAL 2A6KB 2AJXH 4NN7C 3MXWL 3PP3H 1QSEB 4YR6B 3KPMB 3MMEB 1DEEA 2VXUL 3S97C 1WZLA 2PF6A 1EEUA 3AM8C 1E27A 3MXVL 5E00A 4HG4K 2CXGA 3MRMA 5IVZB 3K0WA 3PWNA 5TFSH 4V2CB 5HI5D 1MOEA 1CD9B 2MCG1 1MQKL 3W81A 1ZHKA 1RIHH 5E0QA 5L9DL 3TJHA 4M6AA 3SDAA 3RKDD 1LE9B 3O9WC 5IMKA 3TT3L 4U6YA 3TYGH 5C71A 4HWBL 5I2IB 4MSWA 1MY7A 5DD1L 4Z7WB 4P46C 2EC9T 4F7TB 2Q1EA 1EK3A 5ILTH 1EPFA 5MERA 3HMWH 5J57B 2AXFA 1WTLA 5IHZA 4P5TB 5DHVH 2EYRA 5HI3C 5ADOH 5TQ2L 5ISZB 3OB8A 2VLME 3PQYA 3GO1H 5C0BB 2BSTB 1UB5B 5DJ0B 4L8CA 1NGZB 2G60L 2HN7A 3G5ZB 1X5IA 15C8H 1JHLL 2V9RA 1K85A 2PO6D 5F7MC 1UA6H 4OF8A 4OLWL 2VOTA 4NN5B 5DR5H 4P3CL 1DBJH 4RMUA 1F8TL 4N1CA 2BNQB 1TXKA 1ES0A 2DD8H 3GI8L 3NAAH 1NCAL 2Q6WA 3VCLA 4WEMB 1W8NA 5DJCB 3MLYL 4IIQC 1BD2A 2VUOA 1LO3H 2WBJB 4XXCC 2I26N 4CN6A 1F2XK 2A2QT 4LRIA 1JGVL 1NUFA 2N1KA 2CKBA 1HIML 2WNGA 4OZIE 2YD7A 3C60B 1OAXH 2NY7L 5DD5H 2H3NB 1QLFB 2HT3D 4IRZL 2UYLB 2VZOA 4LASL 3S88L 5FV1L 4LCUA 1GZQA 3TPUB 1G7QA 4FQQA 4D0CB 2WWMC 4YJZL 4XCCL 4NCDA 3ET9F 5J6GB 5F1NA 4OZHE 4AMKL 4MQTB 3LZFL 1PKQE 2A74A 3HRZA 1HYSD 3ROLA 1MIEH 3AB0B 3OKEA 4I0CC 3STLB 3GSNH 4HPOL 4E0RA 3IETA 5A3IC 4F58H 4LVOB 4JDVB 2FX7H 2AQ1A 3BN3B 5I8KL 2O61B 3VG9C 4NKOB 5GJTH 5FGBC 2E9JA 4GQPH 3B9KB 5HHMD 3VFPB 2VDQH 1MCJA 1GC1L 2ZP0T 1S78D 4LCWE 1G0YR 3D18B 5SWSA 2N7BA 2VUYA 3DETD 2HG5A 4CKVX 1SEBA 5T1MA 3NCFB 1ZEAH 1A4JB 1A9EB 5GHWL 4X99B 5FB8B 4MVBC 5C0CB 4HK3N 4R90L 1EERB 1PYWB 4LPWA 4OFKA 2VZVA 3MXVH 4K7FB 4W70A 4RX4A 1FN4B 4GG6E 4A2MA 1Q9OA 4L4TD 3T04D 2Z9TA 4CMMA 4ZAKB 4BM7A 1NGYA 5EOCL 3EGSA 3QWRA 4DZ8B 1GRWA 1MQKH 1CN4A 3EDEA 2X40A 5L9DH 1K5NA 4NOBA 3VXRD 4OIAA 2DRUA 4IRJA 3KPTA 1RJZB 3TT3H 4PJ5B 1LDPH 4HWBH 5I17A 32C2A 1QFHA 4TOYL 3LB6C 1PX4A 1AE6L 2ZSWB 2NNAB 3RDTC 2C9AA 1E4KC 4YXKL 4PJ7A 1CVRA 4E41E 4OZIF 5TQ2H 4KROC 4TSAH 4XNQB 1QKZH 2HKFL 2PXYA 2V2WB 4JQIH 1W72B 4KKNA 3O8XB 4RWHA 1IM9D 3EYFA 4KVNH 1P7QB 4JO3L 4Z6AT 3NZ8B 2HVJB 5HYSB 4NQUA 2IANA 3F12A 1UCBL 3MNZA 4OZHF 4P3CH 1F8TH 1QBLH 2AJVL 4GSDL 3GI8H 3MLUL 2FO1A 5SWQA 1JNLL 2P48B 3IAPA 2WWMD 5IIEB 2FH6A 1FFOB 3GJFH 4XX1E 2VWEC 3DUUB 5GGSB 5CSZB 3MJ9L 3KLHC 1JGVH 1CGUA 3ARQA 4XP4L 1P1ZB 5DRXB 5FGRA 1HIMH 4XAKE 2IADA 4FNLL 4RAVA 1QVOA 4RZCA 2NY7H 4IRZH 4Z7UB 3E3QE 3WS3A 4KUCD 4ORZC 4ZMAT 5JNYB 1Q94B 4UILL 1AGDB 1EMTH 1SYVB 5C0IA 2OTWB 2Y72A 4XP9L 2X1PA 4JO1L 2AABH 4XCCH 1NC2D 4PB0L 3IDYC 4GG6F 2H2SD 4MLSA 4FN0A 4HV8B 5E4EB 3T1FB 1I1AA 2C1OA 4Q9QL 4J8RA 3BWUC 5E03A 5I18L 3MO1A 4P5MB 4I9WD 4YPGB 3ARDC 5I8KH 2WUCL 1FAIH 4PP2A 4G8GD 2NTFA 2QBWA 1JTTA 3RVVC 3S8WA 4HLZG 1QSZA 5D1QA 5EO9A 1JPTL 1T5WA 1WAAE 1GC1H 4KDWA 1IEBA 1S7XB 2UWEF 4YDJB 3TP4A 5FUOL 1SYSB 5JIIA 4H88L 3R4DA 5GHWH 3DGGB 1PG7W 2DM7A 1CE6B 3C6LB 4OD2A 2BSRA 4R90H 4EIGB 3LB6D 4HGKC 3ARGD 5IWLC 3JBG7 1NCDH 3RDTD 1MCPH 5C09B 2QR0A 4NZUH 1QFUL 4PJFF 5EOCH 1NLDH 4LLDA 4JN2B 4BH8A 4YAQB 1KJ2A 4Y16B 4WI6A 5JORB 1TJIL 1FNHA 1MFDH 1TDQA 2BNRA 1CVSC 4QRQA 4TOYH 1CU4L 5INDA 1EHNA 1RK1B 3ULSB 1AE6H 5KVDL 5D6DA 1WBXA 4MCYB 1AO7D 1T89A 3I6KA 3LN4B 3RIAF 3ULUE 1WT5C 4YXKH 2NR6D 3KPRE 2PCPA 1ZV5A 1KEML 2NY4C 1ULVA 1S8DB 4I1NB 4MXQD 3KXFB 5F9OL 4AT6B 2R29H 4MJ5A 4HD9A 2IAMB 2JTDA 4Z78A 2COQA 2KUTA 4RGOL 5DEGA 3RRQA 3TBYB 4H20L 1UCBH 3RNQB 5DSCA 2YUXA 3QO0B 2QQKL 2AJVH 2W38A 1JRHI 2BZDA 1P4IL 4GSDH 4CVXA 3MLUH 4JPWH 4ZPVB 5KVFL 1HNFA 5F1SA 3IU4L 4LFHD 5KVMC 3QA3B 3NA4A 3MRRB 2X6MA 3MJ9H 4JKWA 4WWKA 5GS3A 2PYEA 3GKWL 5HYJB 4A6YB 5A1AA 4HMEA 2ZPKL 4LEXL 1V7ML 4FNLH 1WAAF 2E9BA 2FL5A 1KPVB 1RPQA 4GUPA 4H0IA 4MZ2A 4AG4L 1M7XA 2YR3A 3CXHJ 4UILH 2XQYK 1I3RA 4WW1A 5EO0A 2P24B 4DKAA 1CFNB 4LPYA 4JO1H 3FO2B 3GMNA 3I3BA 1X5GA 2OI9A 5K59E 1P6FA 3PJSB 1JNJA 4HIJB 1MJ7L 1NDGA 4GXUN 4F7PA 4RAUA 1U8OB 2XWBA 5JOPD 5A2FA 3D39D 5C7XL 4UUJB 4Q9QH 4K7PH 4Y5VA 3X11B 2Z31B 4NC2B 4Y7MA 3THML 4G59A 5I18H 1XIWA 3DARA 4GRLA 5T1DL 1JK8B 2WUCH 2B2XL 3H0TA 1T83C 3OJVC 1JPTH 3CUPB 4POYA 1LO4H 2EYTB 5BQ7A 2V17L 4P5TC 4AL8L 5EC1B 2NMSA 5FM5M 3G6AA 4HSQA 1A3RL 5DJXA 3ULUF 4W4OA 2VISB 5FUOH 1XGPB 3VWKA 4MS8C 4R4BB 4O2EA 4YNYB 3LY6A 4XBEL 5SWZD 4NQCB 4X5WB 2J6EL 1R3HB 5FGCB 2N4IA 4F9LA 5AWNH 1FHGA 4NN5C 1IQWH 4YBQD 2R0WL 2DQCL 3EDJA 2NY4D 3BYYA 4X6CB 5MP6L 5DJ8A 5DHXB 1KFAL 4GRWH 1UM6L 4GO6B 1TJIH 2WBJC 3FQNB 1Q1JL 1J8HB 1MCRA 1CU4H 1X5YA 1MCHA 2YD8A 5CGYD 5ELIA 1D5XA 3UTQB 3NCEB 2BHZA 4R2GB 3C60C 2WBWB 3QDJE 1KEMH 4F3FA 4NBYB 1MCOL 3E6HB 2ADJB 1OGAB 1ORSB 3WS6A 5HPOA 1EEZB 1YDPB 5IMLB 3SDCA 1ZHLA 2XKSA 1UM5L 5IEHB 5FAAA 2QV2A 1U3YA 5B38B 3M8OH 3T77A 4N9GB 5TF1H 2XWTB 1FNFA 2DBLL 4RIRB 5DHVA 2VXTL 1Q0YL 1T3FB 4H20H 3AB0C 5K59F 2I07A 3V0WL 4CMHB 3QFJD 2FJHB 1VACA 1J1OL 1KPUA 1RVFL 5F6HJ 4L4JA 3FMGH 4NCC1 1Q9WA 3MGOB 4WDIA 5CBEA 4D8PA 1A64A 4R4NC 1NC4A 1T04A 4N0FB 3GHEH 3B9KC 1A4KB 3O3UN 2HKHL 2X4TB 2AKRB 2X1QA 3GKWH 5DVNA 2ZPKH 4LEXH 5M7QA 1V7MH 2PTUA 1YYLL 5GGVL 2HP4A 4AG4H 3EJZC 4KU1A 3T1WA 5ESVA 3OJ2C 1GOGA 4J3OC 3C5JB 4O9HL 1RIVH 5CHNA 1JGLH 4MQ7B 2WINB 3VRLF 1QP1A 4ZAKC 5EUKA 4KJPD 1MJ7H 5KN5A 1T2XA 5C7XH 3O6LH 2QKIA 3O6KH 4JFHE 3THMH 5JUEL 3QNZA 5T1DH 4JRXD 1TVBB 2CIIB 2NXYD 5GGUB 4YHIA 2B2XH 1NQBA 1HQ4A 1YMHA 1KB5B 2V17H 5BRZD 1OHQA 1CIUA 3GSNA 5F6HI 1DFBL 1I9JL 1IC5H 1OLLA 5D7IA 4C56B 4YFEA 2WBJD 4Z5RB 4XBEH 3L3DB 3O8XC 4WIQA 4LLUB 2J6EH 3ZT7A 3BZDA 1WJ3A 2F53A 3L3JB 3U6RB 1G6RB 4FFVC 4XGZB 4WWID 5EZIL 4KKBC 2BERA 2R0WH 2FX9H 3C9NB 1JPSL 1FIGH 4HWUA 3ZDZE 3EYUL 4DGIL 2C5DC 1XGQA 5MP6H 1FYTB 1S7QA 3FZUC 3BMWA 3QRGL 3MGTB 1R3JB 2H9GA 1Q1JH 1YNTB 1DLFH 4W68A 3DSFL 4NWTL 4H5SB 5E8PB 3PWUB 4ZUSA 3QUXD 2MTPA 4P48A 1UWXH 4PJIE 3G5VA 4HJJL 4MYWB 1U3HB 1MCOH 2FHFA 1U8JB 3S4SA 4ODSL 4OLXL 4GS7B 2WP3O 5IESL 2PO6A 3TM6A 1OAQL 4HWBA 4N8VG 5EC2A 4YX2L 1UM5H 2XG5A 4YBHA 3O3DA 3VD4A 3GMRB 2AERT 3G5YA 2NY3B 3SY0A 1YEKL 2XY1A 5E4EC 3VXMD 2AJZA 4CRPA 4D94A 1Q0YH 3V0WH 2W0PA 2KL6A 2BY0A 1J1OH 1R5IB 4JY4A 1RVFH 3TF7A 5ETUA 4OQTL 2CPCA 4M8QA 2R23B 4KC3B 3HFMH 2H8PB 2J3SA 4NQDE 5H8DA 1IGYA 1XGTA 5JLZB 1AY1L 5FYLL 2GK2A 2IH1B 1QHPA 1YQ2A 3P73A 4FQIL 4Q0XL 3OKOB 3I50H 2HKHH 1GOHA 2GITA 1MRDH 3PDOA 4MD4B 1YYLH 2BY3A 5GGVH 2HJKB 1NUDA 1S9WA 3LKPB 1YJDC 1EXUB 1KJVA 3V9FA 1XGRB 3FL7A 5FYKU 2I60L 3GJFA 4P59L 4PJ5D 4O9HH 1IGFH 2X70B 1AGBB 3WIIH 2D7QA 2FBOJ 5IG7A 3B83A 4PV9B 4ZNCD 1S7SA 3VGGA 4BH7B 1WCBA 3OR6B 3CH8A 3ARXA 4H8WL 1H3WM 3NN8B 4LMQE 3ZDZF 5HHOD 5BS0B 5D2NE 5HHMA 5JUEH 4K2UL 1P7QD 1DUZB 1T6WA 3IDJB 2YPLE 1MEXH 3AMLA 3CLEL 3MRLB 1KCUL 1TLKA 4KKBD 1FBIL 3U4EB 2C7UB 1I9EA 2F54D 1YNKL 2NY2B 4FZ8H 4JFXB 4Y1AE 4NSKA 5H35A 5T33L 1WBZA 4NNPL 2ARJB 1DFBH 3VRIB 3UZVB 1NBYA 4UV4L 4NRXB 5IOPB 4UB0L 4L4TA 4QRRB 1AQDA 1FZOA 2ZNWA 5DQJA 3MQIA 1DQQB 2IAMC 3UBXB 2G75B 3OKMA 4LP4A 5K9JH 1HOCB 3FOMB 3QUYB 3LD8B 3L5XH 5EZIH 3ROOB 1I3UA 5IF0B 3X13A 3VXRA 1JPSH 4YHPB 2HTLD 4HULB 4WU7B 5EU6B 5GZND 5CZKA 5IVNA 4PRHD 2NLJA 2I27N 2F19H 3QRGH 3AROA 5HDBE 3X3GL 3SE4A 4ALAH 1IM3A 3UJIL 5ANMB 1C7TA 1A14L 4NWTH 4X7DC 7CGTA 2X4RA 1BOGA 1F3JA 4IIQA 4OFVA 3WLWD 4IMKC 1IM9A 3PWVB 1PY9A 4ODSH 4U1GB 4OLXH 4PRPE 5IESH 3OAUL 1OAQH 2ARWA 4YX2H 1T5XA 3QPXL 3GDBA 1FV1B 3U7YL 2CLVB 2UY7A 5C3LD 1YEKH 2HMID 1YA5A 3MRCB 1M6OB 4K55A 1FPTH 5EIIA 1CDHA 5DEZA 4ONHA 3RTQD 2ZOLB 2Z31C 3ARZA 4XXDB 3O6FD 4D3CL 1JYXA 2R9HC 3I02B 2VLLA 5TE4L 1UB6A 1E28B 1U0QA 1U8MB 5FYLH 4NM4L 4FQIH 4NKMB 4Q0XH 4Z0XB 3CIQA 5CEZE 5MI0C 3INUH 5I8CA 1YPZB 5FCUH 5FYJL 1S7VA 5TH2A 3KJ4B 4Y19D 1MHEA 2A38A 4YDVB 4DW2H 1NC2A 4AY0A 2I60H 3A6BH 4P59H 3RVXC 3TYFA 3QZWG 1HWHB 3MJ9A 3WFHB 2OL3L 2P5WD 3S35H 5B3JF 2ED7A 1KELL 3VFVA 4NHUA 4ZUVA 3B9AA 1KIUA 2JF1A 2W60A 4UV7L 3LKNA 1J0ZA 2J12B 2GKIA 1A7NH 4H8WH 4OZGA 4G8GA 4LP5A 1HH9B 1XF2B 3EW3B 4NPYA 2ADIB 2R1YB 3FQTA 5F3BA 2IAMD 4IOIA 5DJZB 3TBTA 1NAML 1XR9B 3D0VA 2RHEA 1GSMA 1KCUH 1FBIH 4R2GC 5ENWB 4O2CA 3F7QA 1YNKH 2D0HA 4OCRH 1A7QH 3CMOH 5CEXA 5T33H 2RB8A 4NNPH 2VITA 2R39A 4NFDA 5I0DA 3ARGA 2JELL 4ODXB 3RDTA 2OQJA 1LP9A 3AUVA 5FDWA 3CD4A 5ALBL 1T20A 3VJ6B 5HYJD 3VG0L 3QXDA 3NFNA 5TGBB 2DYPD 1N4XH 2DLTA 4FA8A 4LPTA 1EIBA 4CMHC 4HKXA 1QSFD 1O7VA 2G5RA 3MNVB 5JW3L 1VHPA 4DKDC 4L4VD 4PJBA 1A1MB 2C3XA 5E70A 5KZCD 1R3KA 1AO7A 2BY2A 3FQRB 5EZJB 3BH9B 3UPAA 5HYEA 3X3GH 3UJIH 1A14H 3TO2A 2WK2A 2Y36L 1UKQA 4MXQA 4JCLA 1M4KA 3CZFA 4OQ1A 4DKEL 4I18B 5ICYA 2BRQA 3U7WH 4Q9CA 1A21A 4AIOA 2FGWL 5HYFA 3WD5H 4YHLL 5T3XD 5IB2B 3OAUH 3DBXA 3UZQA 4JM2B 3FN0H 1QSVA 2Q8AL 3QPXH 4CBPA 35C8H 3U7YH 3MCG1 4N8PA 2H1PL 3ES6B 4OBRA 2NX5E 3KNBB 1U3ZA 5FM5O 1UJ3B 1HEZB 1XEDA 5JXAL 1UZ8B 3RVXD 3GHBL 4KRLB 3K4ZA 4LDOB 4Y2DD 5TE4H 4K3EL 1I8MA 2DQGH 4FFYH 2Q20A 2HA1A 5C0ND 3GBML 5I66B 1F13A 1NCBL 5CD5C 1FZJA 4UAOB 2H2PD 3H2WA 3WUZA 1JZ5A 2FJGA 3BJ91 2ICWJ 4LSQH 4G9DA 1Z9OA 4KMQA 1NJ9A 4U2YA 2NY6B 1YNLL 5BXFA 1FZKB 4ZDHA 2OL3H 2BOCA 1G9NC 1CT8B 1KELH 2ZOKA 4ZOAA 3NABL 3D39A 1UH3A 4UV7H 3MRQB 5L2KB 4V1DE 2D31A 1P2CB 1OGAD 4MNQB 5I73B 1JZ3A 5IWLA 2XICA 1LQSR 3T09A 1QR1A 1EAJA 3K74B 5FO9B 2GTWB 4UU9B 2BMKB 4AENB 3BD4A 4MJIB 3W2DL 4X9IA 3FQUB 2C26A 4YDKL 5E8EA 1D5ZA 4QHMA 3UTZB 1HZHL 5SWZA 1U3HC 4GS7C 2JELH 2DTSA 3MLXH 5KSUB 2A6DB 4NM8L 1WT5A 4M03A 3HI1A 3MV8B 3OTTA 4H0HB 5ALBH 2R4RL 4IDJL 2NY3C 2QSQA 3D85A 5CJ8A 4WW2A 1TVDA 1FNEB 4WHTB 1HHJB 1LWRA 3SDDA 4K9EL 4URTB 5C2BH 3NFPA 5JW3H 3VXNB 1D5BB 3SDXB 1N5YL 1A6ZA 2J6EA 1QO3A 1M05A 1X5FA 3WHXB 3IKCB 1NDMB 4ORGA 2X7LA 3QJHA 3WNMA 1H0DA 3T0EE 1ZLVK 4OF3A 3M1BB 4O4YL 4PJGE 4PV8A 4J3WA 3BP5B 3VA2C 4DKEH 5JDSA 5KANI 5TQ0H 1AGFB 4XHQA 2FGWH 3IDMB 4FP8L 3W0WD 3V6OE 1A6TB 1I1FA 3GFUA 4HIHB 5L7XL 2Q8AH 3HAEH 3BPOB 3QFJA 5D5ME 4BQ9A 3JZ7A 1QLRB 2H1PH 2NZ9D 4J3TA 2FIKB 2YXMA 3MREA 4C56D 1T7WA 2X4SB 5JXAH 4MJ4A 3CFJA 1DVFC 5C0AE 2AI0L 3