4L8BA

Crystal structure of the h2db in complex with the np-n5h peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8bA01
3SGJA 3O2DL 4M6ML 5CJOL 1J0JA 4J4PD 1G7QB 1YY8B 1U92A 2ATPB 3VJ6B 3BYYA 3QG7H 2CDEA 1R5VA 4O2CA 1M7DB 1P6AB 5IVNA 4XGZB 5T1LA 5BW7A 3DV4B 4G9DB 1OT2A 1HE7A 3ULUC 5F9WB 3HAEG 4DKFL 5GRJH 2JB5H 3DPBA 1GGBL 1SY6H 4OQTA 4L8SA 4LSTH 5I1CL 5GRVK 4K7PX 1DBJH 3O45A 2GFBA 3UTSD 3V0AC 4JQXA 4K2UL 1YPZB 5FO9B 4CKVX 4AT6A 3QQNA 4JGJA 4PRIA 2APTA 1TCRA 1KTDB 3CPLA 4JZOA 3N85H 4U6YB 4QXTB 5HYSG 2LTQB 3IRPX 1CXLA 4CN4A 5ANMB 4Y1AA 1CICC 2C4FT 2D0HA 3RX8A 4ELMA 2YZ1A 4RCAA 3KLHD 4K94L 4HPYL 3MRCB 5F7KC 4OB5L 1LO3L 4MD4B 5HPMA 2IJ0C 4N90E 4V1DE 3LSOB 3LKQA 5LXGL 4Q6IB 2PO6D 4Y2DD 1IQDB 5CZXD 2O61A 4P46C 1Y18B 4NT6A 4RGOL 2FEEI 1A6TA 3D0LA 3DVNA 2WY3A 1N5AA 3FO2B 5IMKA 4PJ7E 4NUJA 5I15L 3DSFL 4I5BA 4KMTL 5IB3B 1LMKA 1PFCA 2F54D 3QIUA 1N6QH 3N1QC 4PBWD 4XWOC 4OKVB 3X3FL 4OT1L 4JFDB 4NHCL 3PQYE 5EO9B 1DEDA 3NH7H 4WUUD 3JVGA 4QRRD 4NRZB 4C56A 1WWAX 4M5ZL 4JQIH 4JCMA 4ERSL 1IGYB 2KL6A 1H0DA 5JZ7D 3D48R 1ZT1B 4HIHB 5C0DB 1OAZL 5D7JD 1M6OA 1MFAL 1RZKL 1DBBL 3G08A 1PX3A 3ARPA 4MNGB 2EDKA 4X5XA 1YN7A 2DIBA 3IXAB 3MRJB 3OAZH 3BZEB 1MJJB 5EIQA 5E99H 1WGOA 1EHLH 2P47B 5L2JB 3TF7C 4WDIB 4WFHE 1NCTA 2Z93B 1GGYA 3MXVL 4P5TC 3FHQA 3ARDA 4F9PA 3HS0B 4OM1H 3HZVB 2EDYA 2J5LB 1TZIA 4P4KD 4J8RA 4PD4K 3H9YA 1OGAE 2FCBA 4QXUL 3PHOA 4PV8A 3QHTC 5DT1L 3TVMC 1MHHA 1P7QD 3VRIA 5DRXA 4P23C 1SM3H 1HDMA 1OAYL 5BOZG 1KTLB 1TJHH 4NWTH 2F8XC 1PYWB 2FBOJ 4O2EA 4JFEE 5BV7C 1X5FA 5DO2D 2H9GB 1KJ2L 3UC0H 1MPAL 4B41A 1IMHC 4WO4D 1DBAH 5HHQB 5IM7B 3BWUC 1P69B 1X7QB 1JHKL 3DV6B 4JM2F 4RISL 1MCPL 3K4AA 4C59B 2XZZA 2ESVB 4GQPH 5IBTH 1P84J 3L5XH 4J1UB 3U4EB 5IW6B 4XI5C 2Y7QA 4PP8C 3BH8B 3NFSL 4HS8L 5EOTA 1JHLH 5F97E 3SY0B 2UY6A 4CNIB 1JF1A 1QFWM 2NY7L 5IR1B 1WTLA 4KJPD 4NQED 3P9MB 1SJHA 2VXTH 2MQCA 3WIFA 5TE4H 5IWLC 3BWAB 4NP4H 4OM0L 4YDIH 3WL9B 1KYOK 2ZSVB 4WHTA 1D5BB 2HJLA 3EOAB 4ORGA 5E94B 2AK4B 2UWEF 2H8PA 2ICWJ 3W0WD 3WIHL 2CDGB 1YEIH 1JRHH 5IFJA 3OXRA 3G6JE 1DUZA 4LCWD 1BFTA 3WDIA 5CEZH 3HB3D 1MJ8H 3O9WD 1H3PL 4MNHB 1T83A 2OI9C 3HFML 3WXWL 4U7SA 1JWUA 3RZCA 3VCLB 3NMEA 5FGCB 4EIGB 4L3EA 2BVQB 1AE6H 4I48A 5H2BB 5EUKB 5DA0B 3WO4C 5I8OL 3RA7L 3T65A 3NIGE 2OR9L 3TBTB 4E5XA 5HHMB 5C09A 2BVPB 5F6HJ 3R1GH 5AAMA 3FRUA 4N1CA 5INDB 4R90L 1D5ZA 5D2LF 1R5WA 4QHLA 1YDPA 1G7MA 3HAEB 5E5MB 1U93A 5D1QA 5TDOA 3JV0A 5I1GL 1UWXK 3DX9B 1A4JA 3CFKB 3QISA 1JI2A 3DGCR 3CFEA 5DTFA 2P24B 4GKNA 5FB8A 1EUUA 5ECJE 2Y4SA 3NIFE 3GO1H 1P4LA 2EE6A 1IEBA 2YXMA 2F19H 3O3AA 3VFWB 3GI9H 3QFJB 4TTDD 5DS8B 1VKXA 4OTXL 1ZSDB 2P4AB 3GUTB 1KJMA 1WBXB 5F9JA 5HYSB 5BS0D 3TV3H 2DYPD 3MBEC 5GQBA 2MJWA 4N5EA 4M93B 3RPIB 4WCYL 4J6RH 5F88B 2F54B 2XA8L 4JEGB 1U8QB 4KKAC 2X2YA 2X4OB 3GDBA 2JJTA 4O2FB 5JXAH 5IHBA 2RJMA 4YHML 1RAMA 1WEJH 2J4WH 1FG2A 1V7NH 4TNVF 1FAIL 2CR3A 1YPZA 3LQAC 2VDKL 4JKPH 5BVPH 4EN3D 2LQRA 4RMTA 4E42B 4QXTA 3FQTB 3MLRL 4BYHA 1T0NA 1X5ZA 1W72L 3VWKB 4I3SH 1EBPA 5BO1L 2WBWB 5J57B 3SE9H 2OXHA 2CUMA 4ESKA 5C9KA 2EH8L 1MCBA 3QDAA 3DRTB 3QUXC 4XPHL 2IH1B 1NGZB 4WHYH 5CEXA 4X6CB 5C07E 4EKXA 3MV8E 4Z7OF 1QSZA 2KBGA 2V6HA 1GVIA 1W8OA 2AV7B 5BJTA 4NO5B 4P4KB 3CK0L 5CIPB 4CVXA 4I18A 4XTRC 4GRWB 5ID1A 2G75A 5SWSA 1GGCH 3UTTB 1WLHA 1AC0A 4APQC 2DQDH 4WIQA 1J0KA 2J8UA 1RZGB 2F53D 1ZT7A 4ETQB 3T4YA 3AY4A 4NQCB 1P7QB 4Q9QL 1BQLH 3VGDA 3GSRA 3AAZB 3GEWB 4P2YA 1I9RL 2AEPH 5JW5B 5CGYC 2DWEB 4OKVA 4OZGB 1RVFH 1NBYA 3QSKB 4XNXL 3L9RB 1OTUC 1KN4L 4P9MH 4F7MA 1DVFD 5GZOD 4LSPH 4MHHI 5E8EB 4NRZA 1XGTB 3VWJD 5D6CB 3TBSB 3IAPA 2BK8A 2DL2A 1I7UB 4DTGL 3SDXB 5D1XB 4ZUVB 1BAFH 2AGJH 2VKWA 4Q6YA 4HIHA 1X5AA 1NCCL 2ZCLH 4P99A 3U1SL 5E24E 5T5FL 4KMLB 1DQTA 2EDDA 5DJAA 4FQ1H 12E8H 3CNKA 2YN3A 5J12C 2EKJA 4WEUD 4R4FH 1N26A 5C0BD 4XX1G 1T1ZB 5GS1B 4PJGB 3V4UH 2OL3H 2F5BL 4XCEA 1UCTA 5TGBA 5L7XH 2OR7A 1YEGH 3HZVA 4G6MH 3QDJD 5IB1A 5EO0B 2NY5C 3TH2T 3I9GH 1AFVL 4NQVB 3MOBL 4JAMA 5I9QC 3E3QE 2A9NH 4PG2A 1DSFL 1MLBA 4N8VA 4OF7A 1YC7A 3D1MC 4XP5H 1Q9WA 3BAEL 5I6XC 3TPUB 1C7SA 3EHBC 3GI8L 4LSUL 3OMZA 3EYUL 4P3CL 4O4YH 4PRBB 1YYML 4FQ2L 3VFSB 2FX8L 2YRZA 3S35X 3RTQA 4PFEA 2FGWL 1J12A 1KXVC 1CK0H 2FL5B 5LVEA 3L5WA 1HH9B 5IM7A 1A1MA 1D6EB 2I25N 3DV6A 3SJVE 2FO1A 3QFDB 5L8KB 1UZ8A 5C0EB 4N5UA 2ESVA 4U6VH 3H7BB 4HWZA 3WLBA 1G1CA 4Z77B 4GXUM 3FQNA 4QRQA 1T6WA 1MCQA 2GCYA 3FOLA 3ARBC 3PUCA 5KVEH 5FYKE 4ODSL 4Z0BL 2VQ1A 2W0KA 4W4OC 4YDJB 5F7MC 5GJSL 2P5WD 1NUDA 4BH8B 4PJAE 4PJDB 3C60D 4XZUA 2EEAA 1S7RA 4PG9B 2AQ3A 5BS0B 2DYPB 5F7NC 2XN9A 4OF0A 1DN0B 5H8DA 3RKDD 4XWGL 4JPVH 3P3YA 1R3KA 5DWUH 1BMGA 1K5NB 2XY1A 4KKCD 2IANE 4FQCH 4PJIA 4H0GA 5HY9B 3QUKA 5JDSB 3GMNB 2DKUA 4DVBB 1AD0B 4Z5RA 1KLFA 2CD0A 1L0YA 1WV7T 4M7ZC 1NSNL 5D71L 3WLWD 1CCZA 3MCKB 3GHBH 5J9PB 5CLWA 3V5DB 5F9DC 3IJSA 2E7BA 5EUKA 1A7BA 3IDNB 2HTLC 5B3NA 1NUNB 5IHUL 2BVPA 1N0XH 4CVWA 3GJEB 5JORA 3KPTA 5FYLH 5FGBC 2MQ0A 1NCAL 4R3SB 2OS7A 1BM3L 4LCCA 1CICB 4HH9B 1H15A 4LDOB 3SDYL 1NL0L 4DQOL 3U7YL 2D7TL 2R2HB 2Q7YB 5E2UL 1OW0A 3CFJB 4KK9D 3CFKA 3K8LA 4I4WB 4LASH 1I8KB 4U1GC 4E41D 3IVKA 3QG7L 3GJFA 3QFJA 2F53B 4PRPB 5MHSE 1FCCA 1YNLH 3GZKA 3KGRA 5GRJL 4ZDHB 2WQRA 1QKZH 2X4TB 5IEKB 1SY6L 2AXFA 1S7TB 3HE6B 4LSTL 5E4EC 4WGWB 5CFHA 1DBJL 1XF2B 4G9FA 4GUPB 4KTDH 1U8PB 2I24N 4ZAKD 4Z7WF 4YE4H 2ZKHH 4KQ4H 4OQ1A 3TA3B 3BJLA 5IB2A 1IEAB 3VFTA 2NX5B 1UM6L 5GIRB 1NMAH 1S5HA 5FHBH 3SDAC 2XKNA 3N85L 4PLOB 3O4LE 5I73B 4MCYB 1II4E 4RAUB 4XPGL 3PWUA 1JWSA 5GRXG 2A0LD 5HVHB 5GSRB 3MJ7B 1PG7H 4HDIB 1FV1B 3F62A 4BFGA 2X89D 4YHNB 3LKPB 2ZOLB 2EE2A 5F1NB 1QHPA 1T66C 4R2GC 4P5TB 1KFAH 5CD3B 1QQDB 3ARED 2V5RA 1MY5A 1FZMB 2Y06H 1FZKB 5HHOD 3QDJB 3TZVD 1KSRA 4YHIA 1ZS8A 1OP3H 1KCLA 3TVMB 4ZFOL 1UWGH 5DJ8A 4HQQH 3ILPB 4RGNE 5MEND 2V7NB 3WD5H 1N6QL 5I75B 3FO1A 3GSWB 4FOMA 4M4RA 2BNQE 4NQCA 5I8EB 3B2UC 5A2KH 4Y4HD 1ETZA 1RJLA 5JLZB 4NIKB 3W11C 3NH7L 4K7FB 1YYLH 3Q5YA 3MV7B 4QOKD 3FN3A 4HCRA 4HZLA 2VISA 5JW5A 3LKNA 5TE6H 1KXTB 4JQIL 2PW1A 3L9RA 5I16A 4LGRB 5F3HA 3QDHA 4YAQA 5C0FA 2X1WL 4U1MB 2C3HA 3RUGE 1ND0B 3TBSA 4HAFA 5FYJE 1CFVH 5MEPA 4NN6B 4DAGH 3SO3C 3TN0C 5C1MB 5J6HB 5E99L 1EHLL 4MQTB 3WDHA 5HHVH 3KPMB 4JN2A 5T1LD 2P5WB 2PTUA 5DK2B 2PETA 1MIEH 4OM1L 3C60B 3T09A 4BH7A 1T1ZA 2EDHA 1A6ZA 2C3VB 4G8IB 4F7EA 5JIHA 1AGEB 3DHMA 1Y6NR 4N68A 5H94B 1JUFA 5EUOF 4AMKH 3EOBB 3P9WB 3OJVC 5I8KH 1SM3L 1A7RH 5HI4D 4NO2A 3ULVF 4IRSC 4LSRH 2V9RA 1F4HA 1JIBA 1LP9A 5DZLA 2P5EB 3WE6A 1JNNH 2IG2H 3UC0L 5DZOA 4KQ3H 5CSZA 1OP5K 2XNAB 1NBZB 5DK0A 3OKKA 2I5YH 1DBAL 3AUVA 3OF6D 2JKXA 2CIIA 4PTTB 4PJXB 1ADQH 2A1WH 1JGLH 5DI8A 1DQDH 1C12B 4J3WA 2CDFB 5SWZD 2FL5A 4UUJB 1JGEB 5IBTL 3HRPA 5KZCD 1S9WA 3L5XL 1HHGB 1JHLL 3OX8B 2LAGB 4XC3L 1T2JA 3H7BA 1J18A 3QA3B 4JG0H 4WTZG 1NBVH 3MROA 2VXTL 2X40A 1F3JA 4Q0XH 1MJUH 4QF1B 5TE4L 2BFVH 3CCHB 2DIAA 1FNLA 4JO2H 4NP4L 4YDIL 2HTKD 3ES6B 3CH8A 4BH8A 4F33B 1AGDA 1S7XA 3BGMA 2FHBA 4V2BA 4R97C 3MBEB 4PG9A 1YEIL 1JRHL 4C56D 1BWMA 3QQ3A 5ILTH 2XXCB 4LLDA 5CINH 3HI1A 1XR9A 5CEZL 1MJ8L 2DIJA 4MD5B 2FSEB 1TPXC 1SQ2N 2VZOA 1AE6L 3VFNA 1P4BH 3AC0A 4JN1H 5DQJA 2HJFB 3AROA 5K9JH 5F8RC 2AJ3A 3B9EA 3N1GC 3R1GL 5J9PA 2VIRB 3V5DA 1W8NA 3DI2B 1HI6B 4EUPG 2VLJE 5JHDA 4IMLB 4YHYC 3I75B 3ARDD 1MCOH 2D2OA 5ICXB 3NGBC 1K3IA 3AU1A 1NANI 4JCLA 4UINH 1CICA 4HH9A 2AK1H 3G5VA 3L3KB 1YJDC 3QEHA 1LO0H 1SJVA 1TZHB 3GO1L 3DXAB 2EKSB 4M6NH 2DI7A 2F19L 3LV3A 1T2XA 4P5KB 4YFEA 3GI9L 1YY9C 4NFBA 3ZE1F 1GAFH 5CEYB 3QQ9D 3MRIB 4OLWH 3TV3L 5C9JB 4P46A 3V52H 3OAYH 4PJ8C 1J05A 3KJ6H 3S8WA 4J6RL 4PP1D 4PRPA 5MENB 1H3TA 3RU8H 4TUJB 3ZKMD 4YO0A 4D8PA 5EORH 1T5XB 4Y4HB 5JXAL 5HVGB 3W82A 3SGKC 3D25B 5EZLB 1WEJL 1I1FB 1NGPH 3HAEH 5F7EH 1XF2A 1V7NL 4QOKB 2E8ZA 4G8GD 3Q5TA 4YXHH 3PIQB 1C7TA 3UTQA 4JKPL 5BVPL 2VN4A 1F6LL 3O2VH 3EYVA 4I3SL 2LU7A 1NC2D 3CFDA 3HNVH 4Y5YB 4PJCA 2R0LH 5DQDH 4HDIA 1TZGH 3OB0K 1A6PA 4P2OC 3K4ZA 4ZSOE 2DMBA 5DUBB 1LEGB 5TQ0H 5F96H 2EZ0D 2ZOLA 2CKBA 4KPHH 4Q2ZB 5I1IH 3TF7A 3EDEA 5E8OA 4JQVC 4RMWA 1BX2A 4KRLB 3DMMC 4JY6A 4P5TA 1IKNC 3ZTJG 1GGCL 4FQQA 2DRUA 5KSBE 4O9HH 2AVGA 1VACA 5F1IB 1G6RB 3WJLC 2WLZA 3M17A 3WHXA 1BQLL 4YXLH 3T3MF 1MELA 2AJVH 5C0JB 1KLUA 2HLFC 2IBGA 1DFBH 5ADOH 3F6LA 1X5KA 3FFCD 3ARRA 3HG1B 1Q94A 5ENWA 4P23A 2AEPL 4NQDA 3GSWA 1MJ7H 4OV6F 2DKMA 1OT1A 1A6AA 4P9ML 4Y88A 4XNUH 3OR7A 1MWAL 5FUOH 5I6XB 1WIUA 1JGDA 1I7ZB 4NZDA 4X4ZA 3JWDC 1FNAA 3CJJA 5HHNB 1LNUB 5SWZB 3W9EB 4DJMA 1BAFL 2AGJL 5CIPH 3T08A 4GQ9H 4GRWH 4KKBD 3FO0H 1NCNA 2DTMH 3KPRA 2ZCLL 3GGWB 4OLXH 2ZPKH 3DURA 2XWTA 5KS9F 2Q86A 3QXAA 4FQ1L 1TJIH 4JM2B 2Q6WB 5J8OA 1X9QA 4OD1H 3D18B 4DFHA 4R4FL 1J9CT 3CDCA 1ZANH 3GM0A 2YA0A 2OR8A 2WP3O 3MFFA 4OCYH 4N5ED 3V4UL 2OL3L 2P49B 2X9YA 1BHGA 5L7XL 3ZKNC 2AJZB 2YR3A 4Y4FD 1YEGL 3G5YB 2ADJA 3EZ8A 2NTFA 4KI5F 2E7MA 1DN2A 5C70A 4HS3A 2YA2A 4I0CC 3VMPA 5IWLA 1IAKB 1P5UA 2JCCE 3TNNB 3QUZB 5JNYB 1KOAA 5EDXA 3SDCD 2GUOB 3OG6B 3PWJB 2A9NL 3VXSA 2XTLA 3EOBA 4NUGH 4PJ5E 3TC9A 2ATKA 2ZUQC 4F8TA 2UWEB 3MV9D 4XP5L 2VR9A 2OI9A 4YZFF 5E2TH 2P5EA 3ULVC 1QLFA 3RBSA 4O4YL 1ERNA 1FL3B 2GAZA 3CC5B 5HHPB 4ZTOH 3JTSB 3WN5B 5B8CB 1HXMB 4RGMC 3QNZA 3BP7A 3V5KA 3J8F7 4GBXB 1HYRC 1QRND 4IRZH 3V6FB 1MHCA 4W6YB 1EUTA 3O2WH 4LMQE 2HRPH 1WIPA 4KROD 4U6VL 3VD4A 4UUJA 1J87A 2AEQL 2HVKB 5D2LB 4TSCH 4UTBH 2HJKB 1CD9B 1WTGT 4M1GH 3WFHA 3KS0H 2H6PB 1V3LA 2AV1B 5DJ2A 4QF1A 1EERB 2CR6A 3LKOA 3ES6A 4JPVL 4K55A 5I76B 2W0PA 4EUPB 5DWUL 5I8CB 5DVNA 5IMMB 3PWNB 4FXLA 4FQCL 2ZP0T 3MBEA 4HFWA 1RUQH 4NKMA 4NO3A 4NQTA 3ARSA 3X17A 2QEJA 3VDAA 3UTSE 1T4KA 2VLKA 2NW2B 2UVEA 5IHLB 3TCLB 2FR4A 2J12B 4XBPB 3LEVH 1FSKB 3GHBL 3TT1H 1FNEA 2W9LA 1QPXA 1Z9OA 1YMMA 3VXOA 5CP3H 3DVIA 4LLUA 1A6WH 2HG5B 3T1FB 5EIIA 4EI6A 1BOGA 1NC2B 1N0XL 1KLGA 2FBJH 2VIRA 1RZ7H 3FQXB 3EO0A 3TP4A 1PD6A 2OZ4H 1UM4H 4I0PD 1W0WB 5IVXA 3VFUA 4M8VA 4XNMA 2IQAA 1OTSC 4H1LG 5J1SC 3UEZA 3TIEB 3QUXA 3DBXB 1EO7A 4LASL 32C2A 5C3TA 1DBKL 4P5KA 1A2YB 2EYTB 1YNLL 5D1ZC 4APQA 1QKZL 3RWDB 3PL6D 1JF5A 3CFBA 1V05A 3CDYA 3ET9F 4P59H 3FFCB 4OCRL 3O3EB 4EVNB 2BVUA 1Q9LB 4KTDL 4YE4L 2ZKHL 4KQ4L 4GG8B 2RFXA 4LFHG 4WUUE 4QRRE 2R0ZH 1NMAL 5FHBL 1MH5A 2NY6D 2VZVA 5FCSH 3QULB 1G7PA 2EXYD 4O58H 4X6DA 2B7DT 5JW4R 3FHAA 2A74B 4Z7UF 3AXLA 9CGTA 5JW4M 3PHSA 5DJ6B 1E6JH 2GEEA 1PG7L 2EXWC 5F7DB 1L0XA 1UKQA 3P0YH 1XGUA 4HBQA 4OD2A 1C16B 5DFVC 2PYEA 3BN3B 5E7BA 4FG6C 4H0HB 1FZJA 2XN9D 4ZOBA 2GJ6D 3MGOA 1KFAL 3RDTB 3UYPA 4YGVB 4TUOB 2W9EH 5MERA 1Q38A 4Y4FB 2J8OA 1XEDA 1N7MH 3HPLB 3BJ91 5C0AB 3ALPA 2A9ML 3F7YA 1HEZB 1FO0A 3JWOC 3T77A 1SBSH 1J8HA 1DE4A 1EGJA 1UWGL 4HQQL 1G6RA 2GY7B 4MB3A 3QNYB 4WI5A 3WD5L 1EAJA 2H2SD 3KR3H 4N0UB 5A16B 3KYMB 3MV9B 4ODUB 5E8NA 4LCUB 3VFOB 3JV5A 3ZTNH 3DUUA 1YYLL 2X70B 2EDTA 3SCMD 5TE6L 3C6SA 1FVCB 4MSWB 3KPLB 4QRPD 3WUZA 5BXFA 5CP7A 1F6FB 3VFVA 4PB0H 5CMAB 3WFBH 4NKDB 1QRNB 1CFVL 3DOSA 1UB5A 3BSZH 1CGXA 4KROB 3L5IA 5D93B 1IEHA 4ETYA 5LCVH 1BVLB 5F93C 3P30H 5HHVL 3N0PB 3DETC 2GTWA 4MA7H 1CWVA 2Q6WA 5HYJA 4JDTH 5JHLH 4NQEE 2OMBA 1MIEL 3ARBA 1I1CA 3IU3A 4PJ9C 3HNTH 3RWCB 1ZLUH 3OGCB 1INQB 5DJXB 4W4OA 25C8H 1R3LA 4Y5VB 3WKML 4HGMA 3T4AA 1DZBA 2AJZA 4G80A 4R97B 2XQYG 4LLVB 4EI5D 5D96C 1TVHB 4X9FA 4Q97A 2JB6A 3W0WE 4DGYH 1AGFB 4ZNCD 5I8KL 3TNNA 4KI5C 1A7RL 3ARGA 4LCWE 5JNYA 3VFPA 3QEQE 1CD1B 4FQIH 4H26B 1OM3H 4LSRL 4O02H 1CVSC 3JUZA 1CFNB 3PWJA 5DMGC 3STLB 5BVJA 1OF2A 1JNNL 4PGDB 2IG2L 2QLVB 4TSBH 4FA8A 1SYVA 3S37X 4FABH 4N0CD 1HQRA 4UU9A 5CBEA 3L95B 4PV9B 2K3TA 2I5YL 3IDGA 3OSKA 5KSAA 4GW4B 2F8OA 1RK1A 2W0LA 5EBMB 1ADQL 1WC7B 2A1WL 2G9HA 1JGLL 4MQ7B 1EO5A 3EO9H 1DQDL 1NCBH 5DMJB 3VXRE 1SJXA 1IARB 5EZOH 1P7KB 1B0WA 2X1XR 2QKIB 2FEDD 2BNUA 3HI5H 5SV3A 1P84K 4YHYB 1BQHA 4I0PB 3V6FA 5GGRA 3S88H 5FGBA 3CSGA 1RUMH 1X5HA 2VDLH 1KJ3H 1I3RB 1NBVL 1UCBH 1YQVL 4XCNA 4Q0XL 1MJUL 1S3KH 5ACZA 1F58H 4YDVB 2BFVL 2EIEA 3EJZC 2VRAA 3MX0A 3C2SA 3HI6H 5ITBH 2FNBA 4RMVA 2H6PA 3H6JA 5M95B 3R0MA 5IT2H 4X6EB 5BS0E 1J1XL 1PKQA 5ILTL 4IRJD 2N56A 5CINL 1ORQB 3ZT7A 2VUYA 1T5WB 4WHDA 3BZDA 1S7UB 4BFIB 4HWBA 4L8DA 4D0CB 1P4BL 1BBDH 4H1LB 4JN1L 4NZRH 3FQWB 4LK4A 2D4FA 1QA9B 2WANA 5K9JL 2BNRA 1ZLSH 1EEZA 4Z0XA 1K8DA 2VN7A 4X5WA 4NNXA 4PJFA 5HGGS 3BGFC 4Z7WB 5F1KC 3D3VA 3OV6A 3SDAA 5EZJB 4XNYH 4HUXA 3MRHA 4U7KA 1MCOL 3ZSTA 4C57C 1EFQA 4OCSH 4ZPTA 2VITB 5GS0H 3MRKB 4LIQH 4KK8D 4ZUUB 2AK1L 5EOCH 1LO0L 4K94C 5KN5B 1UVQA 5DLML 2ZCKL 3MA7B 2YUVA 4C83B 3A6BH 2YC1B 3PNWA 3ARFD 3EYQC 4M6NL 4FN0A 4HK0A 3VGEA 3DMMB 2EH7H 5JOFB 1GAFL 1LK2B 4NJAH 4TVPE 4OLWL 3V52L 3KHOA 3P4NA 3KJ6L 5AYUH 2DQEH 4XPFH 3RU8L 4G7VH 5EORL 1ZTXH 3H9SD 1KIQB 4NHUE 3ABZA 2Y1VA 4L3CB 2B1AH 1NGPL 1QD0A 5F7EL 3IYLW 5FK9B 5SV4A 1AKJD 3SCMB 3O3EA 2C1PA 1E28B 4QHKJ 5LQBH 1CFTB 4MA3B 2R69H 2V9TA 3OKEB 1EAPB 4YNYB 4PJ7F 2DMCA 1S7QA 4I3GA 2NXYD 3O2VL 2C3WA 3RVWD 4HLJA 3HNVL 1RZKC 4C4KO 4JFOB 5DJDA 4N8CH 2R0LL 5DQDL 1OAUH 1TZGL 3OKMB 3TN0A 5C0BE 4XHJC 1FN4B 1G7HB 1OQXA 5TQ0L 1OB1B 5F96L 4R7NB 1F3DH 3C8KA 4KPHL 5I1IL 2ADGA 3PWLB 4NQSA 3V0VB 3ULUD 4R4NC 4TUOA 1BGXH 2R4SH 1G9ML 5E6IB 3MRNA 1P6FA 2IFFH 4O9HL 3B3IB 1H3VA 4GRMB 4EI5B 4HXBL 1C5CH 4N1EA 5C0AA 4M61B 2FJHA 4U1HA 4YXLL 4NC1C 4YFLF 3BKYH 3IDIA 2C5DC 1DFBL 4QHNA 5EC2A 5ADOL 2AXGB 4BZYA 3OKDA 5M94B 2PYFA 2J6EL 4X0KA 2ZUQB 4YC2C 4M5YH 5JOEA 2EDFA 4X98B 1MJ7L 2IPKA 5EUOB 3KDMB 4IRSA 1ZVYA 3IETB 3X3GH 4X4ME 3WUWG 2AQ1A 3DX7A 1JZ3A 5FUOL 2I27N 4ZS6C 5ESVB 1RHHA 3I3EA 3MUGA 4XX1E 5DRNA 5CKAA 5DHXB 5CD5C 1D5IH 3IJHB 1ZHKB 4ENED 4WFGD 5GGSY 3FMGH 3KPLA 4Y5XC 2P42B 4GQ9L 3FO0L 2DBLL 3VW3H 2DTML 1LEIB 4OLXL 2ZPKL 2PW2A 4LEOA 5IMOA 3HMWH 3DARA 1G6RH 1TJIL 2NY5H 5J11C 4KRPC 4OD1L 4HHAB 3VFRA 3P4MB 1ZANL 3BP6B 4OLUH 4JHWH 2X4RA 4OCYL 1S9VA 4LCYA 3RBGA 2IBZY 3ZO0A 2KQMA 3C5ZC 1LK3H 1MCCA 5K33A 5CJQH 1I1AD 4HUNB 4HIXH 3MODH 4A2LA 3UZQA 4IRJB 2ED7A 4DZ8B 5C8JA 1EX0A 1UH4A 4PJBA 1UB6B 4NUGL 3UTOA 2VNCA 4IOIA 4FQJH 3V7AG 4KK5D 2Y72A 2FWOA 3L3HA 2ZUTA 5EBGA 3MLTB 1ZA3A 2R23B 4QHUB 2V2XA 4PGDA 2V5TA 5H35B 2Q8BH 2W65B 3MJGX 3T2PA 4ZTOL 3HRZB 4YHPB 1YUHA 4OF5A 4IRZL 4Y19A 2VABA 4PR5A 3RWEB 3G6JF 4K71C 3GRWH 3O2WL 2HRPL 1MRFL 5SWQA 5CHNB 3QCTH 5DRWA 5HD8D 2QQQA 4KJWC 4EOWL 1V5JA 1U8NA 4TSCL 1Q9OB 4UTBL 2ITCB 3ARFB 3CH1B 1QEWB 4M1GL 3VFGH 2NNAB 4OFYA 3NIGF 1VFMA 3V0WH 4E41E 3RL1B 4J3OC 4C55A 4G8EB 5BZWA 4OZIA 4NJ9H 4NQDD 3OXSB 4FQHA 2ZWLT 5GZNC 5LGHH 2G5BB 3F58H 4S11A 2Y6SD 3ZSSA 1RUQL 4X6EA 3IFPB 3MGAA 3H9SB 5FUCE 4PJ8A 3RY6C 3ZE0E 1AKJB 4LRIC 3NIFF 4M02A 3DVGA 1QVOA 4JPKL 5FGRA 5C0CB 5DEFA 3LEVL 5AWNH 3TT1L 5L2KD 4D0CA 1FCGA 3VXQB 1A64A 4D2NA 1QA9A 4UDUB 1BJ1H 5E56A 4CN6A 1A6WL 1LO2H 3B6SB 4G3YH 3VGFA 2FLRT 4NM8H 3MYZA 4Z7WA 3VI4F 2WAHA 4QO1A 1KNOB 2OZ4L 3Q3GB 1KXQE 2WNGA 3MJ9A 3MLXH 1H3GA 3BFOA 3FN9A 1UM4L 4R96B 4KJQC 3O11B 1NDGB 4BSVA 1PX4A 1ZLVH 2H32A 4EUPH 1F2XK 2P8PA 4HJJH 1H5BC 2FECL 1MQ8A 2D4DA 3NCFB 1SVCP 4WEMB 2C26A 3KPQA 3LKRB 4P2OA 3RGVC 1K6QL 3VXSD 5I19H 5HHOE 4JQVA 1OTTC 3ETBF 3Q48A 3KPPB 3DMMA 3T2NH 1IKNA 1KIRA 5JOFA 3CMGA 5AYQA 1ACYH 1JK8B 5I18H 4U1LA 4MA1B 3MRRA 3BP4B 4P59L 5IF0B 4NKIH 1C5DA 3VXUA 4LEXH 4L9LC 5ISZD 5MI0B 5B4MC 3PP3K 5C0RH 1L6ZA 5JDJA 4HIIB 1D9KD 3TWCH 5LKNA 1B0GB 3CIQA 3DTXB 2R0ZL 5FK9A 2NY2B 1MI5B 3I6KB 3RY5A 2Y07H 3QUMA 3ARQA 4O58L 4JGUA 1MCHA 4G43B 1MLCA 4K3EL 1AO7A 5F89B 2IWGA 3R06B 2CLVB 5SX4H 3QJHA 2BY3A 4RFEB 3Q6FB 4X80L 4BJLA 3BEWB 5DHVB 4PGEB 3P0YL 5L9DH 3H7LA 3GMOB 5L88H 1HSAB 3BPOC 4X7TB 1T20B 2GT9B 4GFTB 1XZ0A 2HVJB 1L9NA 3UYRH 2W9EL 5TF1H 5KS9B 3WUWB 4DN3L 1N7ML 3NAAH 1ACZA 3W2DH 2X4NA 1I1AB 1UQSB 2XZQH 3GMPB 3PJSA 1I3GH 4QT5A 3TO2B 1SBSL 1BIIB 2R9HD 4JRXB 5D96B 3F8UB 4S10A 3K46A 3UAJC 1BVKA 3ZTJH 5GXBB 3KR3L 1DQJA 1X5JA 4PRIE 2DWDB 1M4KA 1YMMD 3ZTNL 2E7HA 3VGHA 2QADD 5GSVB 1CGTA 3RWFB 3FFDB 4F2MA 1QNZL 2EDQA 2VLRA 4JRYA 4Y4KC 3E1F1 3TM6A 3DHJA 6FABH 2D9QB 4C54A 3EIFA 3CUPB 1F4WH 2MMXA 5DC9B 4PB0L 3RVVC 4JFQB 5MP6H 1DQQA 5DC0A 1ZGLP 3BSZL 1CT8B 3I85A 1KJVB 1BD2D 5LCVL 1S7VA 1OARH 4AENB 3P30L 4NSKA 4XTRD 1OD9A 4JDTL 5JHLL 1QFHA 1I1YB 4APQD 3HNTL 1MCIA 1M1SA 3BP6A 5EU7E 3B9AA 3VH8G 4S2SB 4DFIA 4OI7A 2BSRB 25C8L 5C0ND 2YZ8A 2AJSH 4OUUB 4XRCB 4D9RD 2B2XH 5D72H 1MCNA 3LB6C 3BZ4B 4NBYB 5MEQB 4F7TA 3ECBB 2NY3C 5IJKC 5FF6A 4C56E 3JV4B 1GGIH 3HE7D 3S4SG 4FQIL 1OM3L 2NW3B 4HV8A 1ZKAA 4TYUA 2YSSB 2BY0A 3VXMB 4TSBL 4CU6A 4JPIB 3BH9B 4PJAF 3I3DA 2GK2A 4CBPA 4K23H 4WTXA 3EO9L 1NCBL 1VADB 5FKAB 2PYED 4X9GA 3BGFB 2W65A 5EZOL 1IAIH 2PTTA 3HI5L 1MCDA 4PPTA 3BIKA 1IC4H 1EZVY 3LKSA 2FZ3A 5B22A 3S88L 3DO3A 4GS7C 5DQ9A 3BN9C 1CE6B 5HI5C 3B4NA 1RUML 1NEZG 3RIAK 2VDLL 5T5NF 4XNQB 4HGWA 1UCBL 1CLZH 3OJDB 1J8HD 2BZDA 3OAZK 4B5EA 5D5MA 2AJUH 1S3KL 1F58L 5BRZB 2ITCA 3CH1A 4BKLB 1QEWA 3HI6L 5ITBL 4KUZL 4MS8C 1OL0A 4XP1H 5EN2A 1WISA 3T8XA 3T0EC 2P48B 2E6QA 2PTVA 4NO0B 1WBYA 5DUPH 3KNBA 1FYTA 5ISZB 5D1ZA 1D9KB 5EB9A 3EHBD 2Q3AA 3DROB 3QEUA 3QH3B 4JREB 1DJSA 1BBDL 1CGSH 4NZRL 4XPBH 1ZLSL 4G8GE 4PRDB 2FIKA 3QNXB 5C0CA 2Y23A 2Z8WC 4PGCB 2HRLA 2XTJC 4NN7B 4B50A 1GIGH 3IKKA 5AZEH 4LRNH 2VXSH 4GKSA 4CMMA 3TO4C 3KYOA 3B9KB 4XNYL 3O3DB 2BC4A 2PXYB 4QY8B 3ARTA 4OCSL 2OTPA 2BCKA 2R39A 4CDGC 2IPTH 5GS0L 2M8XA 4QLRA 4LIQL 2VAAA 4MWFA 4R96A 4Z7UB 3RWHB 5EOCL 2KPNA 3MTRA 4KV5E 2I07A 4PY7A 3A6BL 3HNSH 3KXFA 3O6FD 2EECA 5DC4B 4EXKA 1MAMH 1RHFA 4QWWD 2EH7L 2AJYH 1I8LC 1T0PB 3ARGD 2DF3A 3LKRA 4H1LH 3X11A 1EH9A 3MNWB 4JKWA 1XGPA 4I9WD 2CKNA 1FFRA 2HT3C 4MD0A 2DQEL 4L3EE 1HYSC 1ZLWK 1HOCB 4G7VL 4J2XA 1U36A 4LSQH 5KSAD 1ZTXL 4QRSB 3H3PH 3PGDA 5DEGA 2QADB 2B1AL 5C09E 3CMOH 2Z4QB 4ODWA 3WBDA 2XWBA 4DZBA 2BOCB 3TFKD 3U6RA 1I3VA 3MO1B 1OCWH 1JPSL 2R69L 3DRQB 4UAOC 3T0WA 3AB0B 3FO9B 4RQQB 5JO5A 3W5NA 1MCSA 35C8H 2MKWA 4JJ5B 3TBVB 1TTUA 1BZQK 4IHOA 1QSEA 2D7QA 3GK8H 1BD2B 3RNQB 2Z35A 4OZHA 2B4CC 4RFEA 4N8CL 1LQVA 3PWVB 1OAUL 1JHTA 5E2VH 1BVZA 3CAFA 4JFYB 4MJIB 1RJZA 5TDPB 4Y8DC 3OKNB 5DR5H 2XG4A 3FB8A 1LE5B 3PABB 1CIUA 1GZPB 5D8JH 1DUYB 1BGXL 2R4SL 2IFFL 5KANG 4BZ2L 4PJ9A 2DTSA 4EDXA 4RIRB 4L8BB 3RUGF 3QIWB 3EO1B 1C5CL 2OCFD 4I1NB 1LQSR 1UQSA 2AERT 2HKFH 4ONHA 5C2BH 1BIIA 1FBIH 2J3SA 3BKYL 4NNYB 2OLDA 3HE7B 3BQUC 1U41A 2BNRD 1SYSB 4U0RB 4KZDH 4BQCA 2ZG2A 4M5YL 3OHXB 1CDHA 3MV9E 1XIWC 3X3GL 4JE4B 1IC7H 4P2QB 5AD0B 1IC1A 3OKOB 3RWFA 2UVFA 3VH8B 3T2OA 1D5IL 1JRHI 3CUPA 3FMGL 2Q76B 1KENH 1F90H 1TNMA 1BLNA 1R3HA 4GKZB 5HVWA 3VW3L 2BSTB 2JF1A 4K71B 3HMWL 1FL6A 5HJ3A 1T66D 1XFPA 5SWSE 4P5MA 4CUCA 3S4SB 4NKOA 4UV4H 4WJ5A 4OLUL 4JHWL 4AENA 3C08L 3SDDC 2J8UE 4ZFFA 1R0AH 1CG9A 4MJ4A 3CZFA 5KVMC 1FC2D 1R3JB 3D5OF 1LK3L 1I1YA 1ZHNA 1YZZA 5JIIA 3RY4A 4FQPA 4S2SA 4QCIA 2HFEA 5CJQL 1LD9A 2ZUXA 3I6GB 3O2DA 5T3ZD 3LQMA 3ULVH 4XRCA 2P7TB 4HIXL 4HKJA 3MODL 3G6AA 4PJHA 5JIPA 3WS3A 2IBZX 5AG8A 4M7LH 2ERJB 2VXQH 3C09B 2C9AA 3HPJB 4ELKB 2NXZC 4OLYH 4FQJL 5JA8B 3C6LC 1NEZB 1PSKH 3GSQA 4MJ2A 2CJUH 3GNMH 1X44A 2Q8BL 1FL5B 2DL9A 5ACLA 4WY7H 2DQTH 1NJ9B 4U0QB 2DLFH 15C8H 1AI1H 4MVBD 4U1KA 5FDWB 2MOVA 3TN0D 5D7LD 5FKAA 1JZ6A 4HX1A 4OUOA 5FO7A 3D0VA 3GRWL 4F58H 5F70A 3L7EA 3OPZH 4YDLC 3QCTL 1W72B 4P9HH 3QDGD 2FX7H 3BXNB 4CW1B 2BRQA 5ESQA 3NPSC 4IJ3B 3IDMA 1QR1B 4KWUA 1JBJA 1FE8H 1U95B 3VFGL 2I9LA 3FT4B 3P9LA 3GMLB 5D7IF 4NGHL 4LQFH 4PJEA 3V0WL 4ODTL 2BXYA 4U2YA 3QXDA 2R2EB 3SHSA 4NJ9L 5I0ZA 3MRBB 5LGHL 4IRSD 3F58L 1IGJB 3CLEL 4N9GB 4NO0A 1G7JB 4XH2B 3S36H 1KV3A 2EDJA 4JVUA 4GKOA 3OZ9H 3ROOB 4U1NB 3L3GA 1QFPA 4G7YH 2R4RH 3GBLA 4GSDH 5FAAA 4V1DB 1T1YB 4WEBH 3UBXI 4PRDA 5EBWB 3FB6B 4G3YL 3BPLB 4NM8L 3VD9A 4ISVB 3ARUA 3MLXL 1AHWB 2VLLA 3W9DA 3QT2A 3BKJH 3BD4A 3EJYC 4JZNB 1S7WB 2AS5M 4PJ7B 1LDPH 5I1JH 4LNRB 1GJIA 1JMZA 3BPOB 3KAAA 4HJJL 1KULA 4P3DA 1NFIA 2XN9E 3ALWA 1G0XA 2CO7B 2DDQH 2GJ6E 4YR6B 2I60L 2BOBB 3PQYB 1Y6KR 4PJIE 5I19L 4MNQA 5KSUB 3T2NL 1G9NL 4Z6AT 1ACYL 1OQOA 5JQ6H 5TE7H 4L4TA 5I18L 1LO5A 3QRFM 3D2UA 4LEXL 4XPTH 4BFBD 3QAZC 5C0RL 1KPRB 2ZG1A 1ZHBA 3CDGB 1HQ4A 4Y2OA 3TWCL 3N9GH 3ZYIA 4Z8FH 4QYOA 5DJZB 3BGAA 3MOAH 2WUCL 3QBTB 3S96A 4Y19D 1NAMB 3U48A 1B6UA 2ADFH 3KLSA 4RRPA 3STZA 4PGBA 2Y07L 1JWMB 4QRPE 5KSBF 4UIKH 1KJ2A 5C07D 43C9A 2R8SL 4JHZA 3PV7A 1QO3A 3TYFB 2Y5TB 1BJ1J 4Y5XA 5DFTA 1OGAB 2AEWA 5TPWH 2R1YB 4JJ5A 4XCYA 2B5IC 2W60B 1URLA 5HTSA 5L9DL 1WAAE 2YD7A 2COQA 4ZXBC 4WW2F 3VE0B 3UYRL 2YPVH 5TF1L 3E6HA 1I7TB 4OLVH 4PTUA 1KB5B 4XNZB 3NAAL 4JFEB 5DD6B 1P9MC 3W2DL 3PABA 1Q9KA 2XZQL 1MSPA 1I3GL 1VFBA 3O3UN 3EDJA 1DUYA 2D7MA 3C5ZA 1ES0B 4G9FE 3VRLE 4AQ1B 3IFOB 4M3JA 2NY3B 4FFEX 3EO1A 2Z31B 2P46B 4NN5C 4NNYA 5D9SA 4OI8A 3WIHA 1KIPA 5DEZA 3S34H 1SYSA 1EFXA 4CADA 1GC1L 5DHVH 3DLQR 3MRGB 1LEKA 5EUOE 1B0RA 2NY4C 1UFUA 4Z76A 1F4WL 2MKLC 3UDWC 3ZHLA 5CBAB 5IBLC 2JCCF 5MP6L 1KG0B 4WI7A 2OBGA 4ONGH 2X4QB 1KCRH 1TQCC 4P2OD 5GS3A 5BQ7A 3CX5J 1HN1A 2DM2A 2XOTA 1OARL 4N1HB 2CLRA 3C5SB 1RZIB 1MFBH 5C08D 4L5FH 3G6JB 3GMQB 5EU5B 4BQ8A 3HZKB 1ORSB 3MNVA 1QP1A 3VA2C 1NFKA 2AXHA 2AJSL 4GRLD 4TULL 2B2XL 5D72L 1NUGA 2RBLA 2YPLA 4F8QA 5C92A 4LPUA 2IPUK 4X7SH 4U49A 3MV11 2OJEB 4PRHA 5DJYB 3UROR 1GGIL 2GI7A 3U30B 4ELKA 5B38G 3QDMA 5LJYH 3MNZA 3IF1B 1SJEA 1Y0LA 4LRIA 3P0VH 5T5NG 4K23L 1C08A 1WBZB 5FYKD 1OVZA 5DRZB 3V5HB 3U0WH 3WNPA 1AY1H 1IAIL 5HGDB 1T6VN 1FNGB 1IC4L 3HC0A 2GITB 4P4RB 3M1BA 3P40A 3GSOA 3GIVA 2N7BA 2BSSB 1W72A 5E5RB 2NZ9D 1CLZL 1VGKA 1YMHA 4M03A 3VFMA 1XGQB 4DKFH 1EZVX 2AJUL 1XF3B 2VE6B 2BXZA 1S9YB 4OCXH 3S5LG 4QHMA 1U3HC 1H5BA 2IADA 3FT4A 2LABA 5EC1B 1TTFA 4PREB 4PP2A 3RGVA 4XP1L 4LLQB 2CIKB 2A6KA 4OZFG 2F74B 1LP9E 2VLRD 3QUYD 4JRYD 5DUPL 4HJ0C 4ZYKB 4D9QD 5DMKB 1A3RH 2VXUL 2BHUA 3DX8A 1IGJA 5IBUG 5C0GB 2YD3A 4L9LA 1JV5B 3QXTA 4WNQB 1CGSL 4XPBL 1HINH 1HKLH 4G8FB 4JRWA 3GKWL 5CGTA 4LF3A 4H25A 1VDGA 5C07B 4KK6C 1GIGL 3MV8B 5ERWB 5AZEL 1TQBB 4UAOB 2VXSL 5HDBE 3IT8D 4P2RA 2YEZB 5CSBA 1BWWA 1T1YA 5EBWA 2R29H 1ZVSA 1SEBA 3G5ZB 5I1EL 4U3CA 2IPTL 4K8RC 3F7RA 4M9PA 1YEFH 1U8LB 2NY1B 2GSIB 3O8XB 2A6IA 5T1KB 3NCYS 4M8QA 3HNSL 5F9WC 3T0BA 1MAML 4KMTH 1P4IH 3B43A 3ZYZA 5I30H 4J12A 1HILA 1NCWH 5KW9H 2AJYL 4YLQT 4YR6A 5DVLA 3ULUE 1FGVH 1CBVH 1N3NA 3DO7B 1HHKB 2QR0A 4HC1H 1CN4A 1T7WA 1N6UA 3IAGC 4LSQL 3O4LD 5K9QG 2XQBH 3BUYB 4Q7DA 3H3PL 1F3RB 1OAZH 2LTQC 3F12B 1CFQB 1BQUA 1RZKH 1M7IB 3CMOL 1A6UH 4OFIA 1OCWL 5JHDE 4DN4L 3NZ8B 1TLKA 4Y4KA 5IOPA 3FT2B 4R8WH 4FFVC 4OJFH 4WFGE 1JWMA 3EGSB 35C8L 4Q6IC 3GK8L 1OTSD 1OLZA 1T7VA 4K3JH 3TYFA 2Y5TA 3D39A 4LVHB 4YIQA 2W9DH 5E2VL 4NZUH 4BSWB 4P48A 2DQJL 2DAVA 4AIZB 1I8MB 4PDCE 4P57B 4RGND 5HI3C 5DR5L 2EDRA 5EA0L 1XH3B 5JW4N 5D4QA 2W07A 3DIFA 1A3LH 2BNQD 2N1KA 4UDTB 3UX9B 1FYTD 5D8JL 4HBCH 5D1ZD 5AAWA 5GPRA 1WITA 4X83A 2V5MA 1BZ9B 3FQUB 1FFOB 4NC0B 1CI5A 3MACH 3SOBH 2CK0H 3FOMB 1FBIL 3L3JA 5EU6D 1CZ8H 1TDQA 2NXZB 3FQRB 5IJKA 4KZDL 1ZOXA 3SJVB 5FECA 4RISH 1PY4A 2SEBB 3U36B 4Q9CA 2BY2A 4BUHA 1J0HA 1JPGB 3MLUH 4ZO7A 1QUNA 4H20H 3OKLA 4PJCE 3LEYH 1KENL 2NY7H 2RQ8A 2EXWD 1F90L 2ZSWA 4PJAB 4RMQA 4HKZB 3WEXA 4FG6D 3ME0A 1EHXA 5DDHB 3GJFK 1XF5B 4R4BB 1ROWA 3U79A 5IIEA 2P45B 4MAYC 5FA4B 4RZCA 2IANB 5B38B 5I1AA 2VWEE 4GW1B 1R0AL 4KUCD 2WQ8A 1P5VA 4QTHA 4RAVB 4G42B 1QZ1A 5F7UA 3HFMH 4MCZB 3X13B 1A9EA 1VFOA 3ARYA 3U9UB 4HUVA 4NQDE 4MS8A 2QQKH 1HHJB 1UWXH 2VXQL 2A6DA 1U8KA 2X1OA 3T0EA 3BZFB 5JXEC 2OJEA 5GGQH 1JTTA 3BW9A 4E0RA 5A40E 4KVCL 4X6BA 4OCMC 4ALAH 1UXWA 4OLYL 5DD3H 5E8DH 2HMIC 5TFSH 1PSKL 4I8DA 1SY6A 2CJUL 4HZAA 1X3DA 3GNML 1JPFA 3BIAX 4X8JA 1QSED 3L6FB 5L2KE 3KPRE 4GAJH 1RZJH 3GMMA 3S5LB 4WY7L 5FO8B 1TENA 5JUEH 1S8DA 2DLFL 15C8L 1AI1L 4J4PC 1RUAL 4JY4B 5DSCA 3QQ4B 4OZFB 3VRJB 4F58L 3OPZL 1ITBB 1AGBA 1QTYT 4P9HL 3TO4A 1PW3A 3BHBA 2FX7L 4JDZA 4UT9H 3RNKB 1YNTB 2RGSA 4P4RA 3BPCA 3MRFA 1I4FA 4MDJB 3RI5K 4PJ9D 4M7KH 5IBUB 4P3WA 3VGAB 1FE8L 5BZDB 2FJGB 1J0YA 3PWPD 5B21A 4QNPE 3SE3C 3ARZA 1T2QL 1KCSH 4QRUB 1D5XA 4LQFL 2HFFA 4LBEB 5F7WC 5DA4A 2VE6A 3D69A 3EDKA 2LV4A 5GRYA 1U8JA 2WK2A 3VXSE 5MEOB 3BX7C 1F6AB 1FFPA 1I8LA 3LRSB 3CXDH 4DW2H 4G6FD 2XFXA 4KU1A 4YHOH 3O4LB 4Y7MA 4GG6A 4A6YB 3NN8A 1PQZB 1Q72H 3FTGA 1OSZA 4H5SA 3S36L 1KGCD 2LU4A 3H0TA 3MRPA 2XWJB 5E9DA 4ZFOA 4HS6B 3OZ9L 1IM9D 1W72H 2RHEA 4NPYB 2FX9H 4G7YL 2F15A 2WIIB 4M00A 3IGAA 2R4RL 5ALBL 4G8FA 4GSDL 3FCTB 4Z7VF 4J3XA 1XF4A 1MWAB 4HJGA 4WEBL 1K4DA 1ED3B 1IGML 2VSDA 4X99B 3CLFH 5TDNB 5I1LA 1MEXL 3BKJL 3REVB 1G7IA 2B5IB 2C1OB 2G2RB 3RP1A 1LDPL 5I1JL 2DLEA 3V79C 3F5WA 5A43C 4RGNB 2GSIA 4M93C 1Z3GH 2R2BA 3H8NA 2DDQL 3UJJH 2BNQB 4HUUA 2Q20A 1JPTH 5C0IA 5E00A 3FB7B 3V6OA 5CJBA 1TVBB 1BZ7B 5IEHB 1G9MC 1AQDB 5TE7L 2IBBA 4XNXH 1AIFB 3EOTH 3DO7A 3BKMH 2ZCHH 2VLKE 5DYOA 5JZ7C 4XPTL 1INDL 3RUGB 5D7JC 1YMME 3BQUA 3N9GL 4Z8FL 2UZXB 3VWKC 4AL8H 1U8IA 4NKQB 2ADFL 1EEQA 1M7IA 1XIWA 2HT4C 4YPGB 2NY4B 2PN5A 4UIKL 3TJEH 5IVXE 1JJUA 2ARWA 4AZ8A 1QLEH 1HSBA 3MLWH 5D7KE 4ONOA 4POYA 1ZAGA 4P4KC 2DQHH 4J3UA 3TEUA 5TPWL 1VEPA 1TQCB 1TETH 2NMSA 5IB4B 2BVEA 5FM4A 2C4XA 1RJYB 1OGTB 4WUKH 4DKDC 2YPVL 3ZKXC 4AIZA 5J06A 4HEME 5KSVA 3MOBH 4OLVL 4UV7H 2RCSL 3WSQH 1MUJB 2ILLA 4MX7A 3SDDA 4EIZC 1RULH 1GHFH 3LOWA 4D9RE 5T33L 4N0FB 1NAMH 2QQNH 3DJ9A 3OR6B 4OZ4B 5DD5H 4WO4C 2DQGH 4Z78B 1KPVB 2FYYB 1BZ9A 4U3HA 3L7FB 4MQSB 1AXIB 3K80A 4LNVA 5A2IH 4FQ2H 2XA3A 5IW1B 2VZ3A 4EZMA 2FGWH 1T1XA 3S34L 4OFKA 1QOKA 3FQRA 3RIAF 1CGVA 3O0RL 3QO0B 4X6DE 1MVUA 4L8CA 3GSNB 3OWEA 1M71B 2ITDB 1N2RB 3C6LA 3T04D 1I9IH 2SEBA 2VOTA 3TBYB 1HWHB 2R1XB 1C1EH 2W0FA 2PYEE 5FGSA 1KB5H 1T7XA 1U8HB 3HZMA 3MGTB 2EIZA 5GS1C 3TJHD 4ONGL 4G59A 2EYRB 5HGBA 2H26A 1KCRL 5KG9B 3D85D 3ZYOA 2DJSA 1XR8B 5CWSA 4K9EH 1MFBL 5DDHA 4L5FL 1NFDF 3GMRB 4R4BA 4R4ND 4KFZC 1J8HE 1K2DB 2FO4A 4NBXB 3O9WC 1GOFA 2IANA 1U3HB 3D2UD 5HYQA 3LQZA 1UJ3C 4CRPA 4HK3J 4JPWH 4PB9H 4X7SL 3NCBB 4G6FB 5EO1A 5D7IB 3B5TA 4UQ2B 3BISA 1GOGA 1VCAA 2Z92B 1IAOA 4FRWA 4R7DB 4YWGL 1EVTC 2FECI 3BZFA 1YEKH 2VLJB 4RMUA 3U0PB 2YA1A 1A1OB 1A9BB 2FHFA 4X9IA 4JDVB 4WFED 2UY7A 1BM3H 3IXTB 4YHZH 1MHPH 5ELIA 5IESH 2C3XA 4C58B 3S37H 5GGTA 2WBJA 1QSFA 2PKDA 3U0WL 1AY1L 5KBNC 5FA3B 3Q2CA 2IAMD 4KRPD 2QSCH 5GRVL 1FIEA 5HYJE 5J89A 3CX2A 2E9JA 2OMNA 2IH3A 1FH5H 3RWGB 4JFZH 3QQ4A 4M62H 3ZE0F 1XT5A 4WI3A 3EBAA 3MLYH 3U82B 1MFDH 4OLZH 1M05B 3BMWA 4OCXL 3SGDH 3SPVB 5DF0A 2DM3A 1SMAA 3MRLA 4LBEA 3F6IA 4GAYA 4I9WE 3QWOB 3STBA 3S9DB 2QHLA 1A3RL 1IKFH 3LRSA 1EV2E 1UM6H 4OGAD 4XVTL 3RZWA 1CR9H 2CK2A 4EN3C 1KUMA 4QRTB 4WU7B 5D2NE 2AKRB 3KWWB 5K9OA 4XPGH 4JANA 2GYSA 3UBXA 4ODHH 1HINL 1HKLL 3B83A 2APWA 4HS6A 4OV5A 1J0IA 1FP5A 3P4OB 4NDMB 5EFIA 2F8VA 4WVRA 1NKOA 4ZSOB 2ENYA 2YD4A 1Z2KA 2ADIB 1VB9A 4CU7A 3EYOA 1MWAA 3X14B 4PS4H 5J56B 2R29L 4J3VA 4KRMB 4PRAA 3S7GA 2VDQH 5KSBB 4MB5A 1YEFL 1VPOH 2D7OA 3HUJA 4U05A 3DUSB 1G84A 2C1OA 1DANU 2V2TB 3DVFA 4GAGH 4RFOH 1P4IL 2UYLB 5I30L 3HE6C 1NCWL 5KW9L 1VHPA 1PKQE 4XXDA 4ZXBA 5GZND 5I17A 5J6GA 3MR9B 1FGVL 1CBVL 1CFBA 1MCRA 2YRPA 4OAWB 4WW2B 1IL1B 1KT2A 3QDMD 1P9MA 2GJZB 2OL3A 2H3NA 5E1AA 3TA3C 3C5JB 5GZOC 4HC1L 4TSAL 1TVBA 1K4CB 4FQXD 3RWIB 1I9EA 3F7VA 3FT3A 5ID0B 1AXSA 2GSGB 2D7NA 2XQBL 5ACMA 5I73C 2BNRE 2XPGA 3ZDXE 1CDBA 1F11A 5B39A 4PJFE 1A6UL 1FRGH 4X6FB 3MLVH 3EJJX 2CO6B 5HVHC 3D3VE 2B4CH 2XV6B 3NCMA 4PYHA 1WCBB 2C7UA 4BQ6A 2A83B 4LLWA 3QXUA 3CU7A 2VDNH 4R8WL 1NGXB 4YPGA 4OJFL 3RFZC 2EICA 2EO1A 3P73A 3UDWA 1MRCH 4FXKA 4WWKD 3BP5B 1NGWB 4K3JL 3REWB 3ZKQD 2W9DL 4ONFH 4NZUL 1RK0A 2JCCB 1KEGL 1OP5H 4KTEH 3U46A 4L29B 4MAYB 5FM5O 1FNHA 5JPMB 3MUZ1 3P77B 4FTVA 2ICWB 3ROLA 2A73B 4HLZG 4PJ5B 5GGVY 1A3LL 5I75C 4HBCL 4ELMF 4IS6B 1HXYA 5T1MB 5KTEH 4HKBB 1AD9B 4RNRB 2CLZA 1E27A 3BVNB 4H8WH 4MJ6B 5T3ZE 1FLRH 2AP2A 4RA3A 3IRZA 3MACL 3SOBL 2VO5A 2CK0L 5I2IB 2YHGA 4U1IA 1CZ8L 1KPVA 5DXWA 4KMQA 5GGSB 2JIXA 2R0KL 2ZOKA 5ESAB 4S1DD 1A1NA 1NDMA 2JK5B 3DSNA 4NN6C 4P2RD 4K3DH 4X4YB 4G6JH 4JFFA 3OJ2C 4O5LH 4O51A 3MLUL 4L4VA 4H20L 1N2RA 5ICZA 3LEYL 4AH2B 1PG7W 4F7CB 4XC3H 1U8OB 2NCMA 4WU5A 5IK3A 2R1XA 2IAMB 5A2LH 3QO1A 3O41A 2V2WA 1CTOA 3C60C 5D7LE 1FC1A 2JJSC 1U8HA 4ODXA 3ULSA 2BMKB 3MCLH 4LPVA 1FJ1A 1A22B 1GOHA 5KG9A 3QDGE 4U6XA 1FVEA 3RKDC 1E4XH 3HLAB 4KH2A 4KKCC 2B20A 2OP4H 1JGUH 2X4PA 2OXGA 1JNHA 1QPPA 3QEQD 1ZGLA 3MRDA 3UTSB 3O6MH 4PRNB 3MYJA 1U3HA 4NYLA 3HR5A 3UAJD 5K59F 5I74B 3RRQA 3VXPA 2Q3ZA 1NC4A 2QQKL 3MJ8B 5FYKH 5FKPB 5GGQL 5LGJA 1YN6B 3KJ4C 4Y4KD 4ALAL 5J7CC 5DD3L 1IGTB 2OTUB 1HH6A 5E8DL 3VXRD 2DLGA 5TFSL 4F57H 5TH2B 4LVEA 2PCPB 4CN1A 1AXTH 4MAUH 1NGYB 4Y16D 2LVEA 5GRZA 1J8KA 4GAJL 1RZJL 1FIGH 2DQFB 3G5XB 2KKQA 3D39D 3ZHKA 3IXTA 5JUEL 3EFDH 2VQTA 4LHUA 2PO6B 1EHNA 4Y2DB 4S1RH 3BRDA 4UT9L 3UMTA 1G7QA 1PY9A 1YY8A 2ATPA 3V4VH 3VJ6A 2IC2A 4M7KL 2ORBH 4OIAA 5GS0C 4EXPX 1M7DA 1VFAB 4LP4A 5FUCC 4XGZA 3VI4E 3DV4A 1ZWIB 4G9DA 1KCSL 3LB6D 2E27L 4XAKE 4PJBE 1LGVA 4CMHB 2GQHA 4WUUB 1F5WA 4QRRB 5GHWL 1MIMH 5IKCB 3CXDL 5GGTH 4DW2L 3AS2A 4FQXB 4YHOL 2PR4H 5FO9A 3QXWA 4F7PB 3QI9D 1Q72L 4S0SD 4LLMB 5D7JB 1KTDA 4LQ1A 1CXEA 4KV5F 4OZFH 4U6YA 4W6WB 5KOVC 2Q1EA 3MC0A 1OOAA 2FX9L 5DJ0B 3IDUA 4Y19E 1JYVA 4RBPK 5ANMA 2D9CA 2OSLB 2Z91B 3BRGC 1SEQH 4NDMA 3P4OA 3EOYG 4NM4H 3PGCB 1S7SB 4ZSOA 3MRCA 1CDJA 3CLFL 5HI5D 3AREC 3BEVB 4WWKB 4MD4A 3PP4H 2IF7A 5ICYB 5HGHB 3M07A 3LSOA 3X14A 1L8JA 4Q6IA 4MJ5B 5GGUB 4TVPD 1IQDA 1RUPL 2YK1H 2QQLL 1Y18A 2WWKO 3F7PC 1Z3GL 4A6YH 3DUSA 4OZIE 3FO2A 3UJJL 5HDLA 3ZKXB 1OWRM 1EXUB 4LVNB 3T0ED 1JPTL 4Y4HC 5IB3A 1RSFA 5LAXB 3QIBD 1R5IB 2VZTA 2P8MB 3MR9A 4JFDA 4NCC2 5EO9A 4IIQB 3EOTL 3QPQC 4OAWA 2APFA 1R24B 3BKML 2ZCHL 1MWAH 4WO4B 1V7MH 3JSSA 4RDQF 4ZNEE 3GB7B 4YDKH 1G0DA 3LN4B 2GSGA 4XB7A 1IGYA 3PXJA 4AL8L 1ZT1A 5C0DA 4KI1A 2UUDK 1P1ZB 2VC2H 3A0OA 4Y5YC 4MNGA 4G6AC 3IXAA 4X9BA 5ABDE 3TBWB 3MRJA 3TJEL 4NQEB 3GSUB 3BZEA 1QLEL 1MJJA 3MLWL 3A6OA 1J10A 1T1WB 4U1JB 5L2JA 2K7QA 2DQHL 4WDIA 2Z93A 1ADQA 1T7YA 1TETL 3AGVA 3HS0A 2DS4A 2H2PD 3BP5A 4HXAL 3W0WB 3B2VH 3GSVB 3SQOH 2OK0H 1N64H 4WUKL 1ZT4B 5C08E 5F21B 4LCWB 5HI4C 1T22B 3WSQL 4UV7L 4X7EC 5JPMA 3QEQB 5FYJH 3O9WB 3WFZA 1RULL 4PJ5A 1GHFL 2NR6D 2FH8A 1NAML 2QQNL 1MRDH 1UJ3B 4WI9A 1KTLA 4MDIB 5E9DD 1PYWA 3R0NA 5DD5L 2DQGL 5DZNA 4HKBA 2WINB 4RNRA 2EC9U 3GFUA 2H9GA 3LEXB 1G7LB 4JG1H 5JW4Q 3VXRB 1IRAY 3LDBB 5IG7B 1CIDA 5JXEA 5HDQH 5HHQA 1PZ5B 5GGSA 3NCYP 4Y16B 1X7QA 4URTB 2J8UF 1AR2A 3W39B 1AO7E 4PIRF 1I9IL 5HPOA 4HEPG 2QBWA 4KDTC 5IMLB 1OPGH 4JFHD 4JM2C 5C7XL 4UBDC 4J1UA 3U4EA 5IW6A 3NFNB 1PJ9A 2AEQH 1QRKA 2AJXL 1C1EL 2GJJA 3BH8A 4LAQH 1KB5L 3L3IB 3SY0A 4CNIA 2G60H 4AH2A 3QZWG 5IR1A 5J1AB 5IFHH 2O5YH 4F7CA 1G1YA 3BE1H 4LPWA 5F9AC 5T3ZL 2FDBP 4J4PA 3P9MA 3RWJB 3CX5K 3QG6B 3MRMB 1GH7A 1N5YH 3BWAA 4K9EL 4U6HB 3WL9A 3G04B 2ZSVA 3E2HB 3QUZC 1D5BA 3V95A 3S36X 2BSED 3CFCL 3EOAA 5E94A 2AK4A 4NZTL 4OSUH 4CAGA 2CDGA 3SE3A 4FQLL 3GSNH 3NACL 3RIFK 4JPWL 4PB9L 4MNHA 3BQUD 4KTYA 4UT6H 3SKMB 3VCLA 3B5HA 4XMKH 2VLRE 2BVQA 4JRYE 3FB5B 5H2BA 4D9QE 1XIWD 4EN3B 3L1OH 3WN5C 5B8CC 1YEKL 4X7FC 1WFUA 3TBTA 4GBXC 5HHMA 4U1SB 5INDA 4QXWA 4YHZL 1MHPL 3TH3T 5IESL 4HIJB 3S37L 5GGRY 3HAEA 5E5MA 2X4UB 3OKYA 2DQFA 4M7LT 3G5XA 3DX9A 4WV1B 2QSCL 2P24A 1RY7B 1QLRB 3E6FB 4Z7VB 4M1CC 1FH5L 4JFZL 4M62L 1DBKH 3SDDD 3MLYL 3VFWA 1PGRB 3LH2H 5DS8A 4NRXB 3KPSD 1KEMH 4WW1B 4YX2H 3SKOB 1ZSDA 4PP1C 1MFDL 3GUTA 4OLZL 4ZUSB 1WBXA 3ZKMC 1P2CB 5HYSA 1IJ9A 3JUYA 1MOEA 4NHUB 4ZUTB 4HFUH 2R1WB 5EOQL 3RPIA 4LVOB 5SX4I 4CVUA 1ITCA 2F54A 5F88A 1U8QA 4OCRH 4ZQKB 3WKNA 3QIBB 4YEFA 5IQ9B 2X4OA 4O2FA 1MCWW 3ALXA 3I02B 4BM7A 4OF3A 5JIKA 2BVOB 1DVFB 1FSKC 4HULB 4WUUA 1G9NC 3N1MC 5EU4B 1IKFL 1W2KT 5SX5K 3VWJB 5IKCA 2ED9A 1CR9L 3C6LD 3RVXD 2DMKA 4I77H 3DYMA 4ORZC 1NMCB 4JHBA 3MV01 1QHOA 3IDYC 5D7JA 1OSPL 4ODHL 4B0MM 3MXWH 1WFOA 5EH1A 3WDJA 4F15B 4K8RH 1KB9J 1B6DA 4E42A 3FQTA 1XGYH 3VWKA 2J6EA 4PJIF 5C0BB 5DJ0A 4PBXA 3AM8C 2EZ0C 3DRTA 4PS4L 2IH1A 1NGZA 4HIEB 4K7PY 4X6CA 1FFNB 4I2XE 2VDQL 5DHYB 5D5ME 2AV7A 4NO5A 4P4KA 1VPOL 5ICYA 3RPKA 5CIPA 2A9MH 3C9NB 3LN5B 4LU5H 3UTTA 4KGJA 3MMEB 4GAGL 1NCUA 4RFOL 1CGUA 1CXKA 1FVDB 3VDBA 1RZGA 4ETQA 1P7QA 1FYTE 3X12B 1S9XB 2HT2D 3AAZA 4NZJA 4X4XB 4AEIL 3Q0HA 2DWEA 4OZGA 3B5GA 3NBNA 1KIUA 4PLKD 2CQVA 1CFSB 4WO4A 5EU6E 1WAAF 5E8EA 1KPUB 4KKBC 1XGTA 5D6CA 2WBJD 1RJCA 1QSFD 1FRGL 3MLVL 2CGRH 2DICA 1I7UA 1LE9B 2B4CL 1D5MB 3SDXA 5D1XA 4ZUVA 3OG4B 1GC1C 1P1ZA 2VDNL 1MQKH 3SGEH 3VRLF 1HNGA 4N5EC 2KDGA 1BFOB 1ZHLB 3RDTC 1MRCL 5JTWA 5K9KB 1BECA 2X7LB 4X7CC 5E8PB 4Y4FC 3KXFE 1OLLA 3KPNB 2DBJA 4KJYB 5GS1A 4PJGA 4S1QH 4XVUC 4ONFL 4ZPVB 5CKGA 3WKMH 4KTEL 5GS2H 1JN6B 1Z5LB 4BA8A 5DD1H 3SDCC 3MZTA 3AS1A 5EO0A 1U58B 3T3PF 1ZT4A 4PRID 1IAII 4NQVA 5FUZH 4YBHA 1AGCB 2HKHH 4M43H 3SBWC 1CDGA 5KTEL 3O9WA 1NFDB 1GSMA 1L7IH 4XB8A 4H8WL 1FLRL 5INCB 3QZWB 4Y1AD 1AQKH 3A6CH 1QSVA 4KZEL 3DX6B 3TPUA 3KJ4B 2QTEA 4PRBA 4AY0A 1FZOB 1T21B 3VFSA 4F37K 3NA9L 4GRWF 3RI5F 2VDPL 4K3DL 4G6JL 4KROC 1PZ5A 5D93C 6CGTA 1HH9A 4O5LL 1D6EA 2GTZB 1QSEE 3VXNB 3QFDA 5JPNB 4OZHE 5C0EA 5T3XE 2X4SB 1UC6A 1T3FB 5E4IA 5L6YH 4Z77A 1YQVH 4E41B 5F71A 5CP3A 3RVTC 3MCLL 1JVKA 4YDJA 5J1AA 4Y5VC 3QIUD 4ZXBD 5FV2A 4PJDA 1DEEB 1E4XL 1U42A 2OZ4A 3BT2H 2OP4L 5BS0A 1YQ2A 2DYPA 1MCLA 1JGUL 2RR3A 3PWPE 1J1XH 1DN0A 1J1PH 5J4MA 1MREH 4JLRB 1K5NA 3EYFB 3O6ML 2XACC 5HY9A 4ZFGH 1KBGH 2LAAA 4ZAKB 5JDSA 3GMNA 4Z7NE 2AQ2A 1KCUH 4DVBA 1AD0A 5FYKL 2XKUA 2JLLA 4D0BB 5D7IE 1BJ8A 3MREB 3MCKA 1EK3A 1BBJB 1CQYA 1KGCE 1QFUH 4F57L 4EN3A 3IDNA 1K8IB 1AXTL 1Z6JT 4MAUL 5HSFA 1IGFL 4I0PC 1T04B 3GJEA 5IBLD 3U0TB 1FIGL 2XY2A 1CS6A 4R3SA 3GHEH 2WSKA 3EFDL 4HUMB 3CVHB 1F2QA 5DLMH 1H3UA 2ZCKH 4MB4A 1LP9F 2R2HA 2Q7YA 4DUVA 4XBGB 1I7RB 2D7PA 4FTVD 5KJRH 3AREB 3CFJA 3FZUD 3HCVB 4S1RL 5HHOB 4I4WA 4UOJA 3TZVB 4YBQD 3V4VL 3ZHDA 1I8KA 1MHEB 2ORBL 3LD8B 3PL6C 4ZTPH 2F53A 4F80A 4NRXA 4PJHE 4ZDHA 1P2CA 2X4TA 4NRYB 5IEKA 1DL7H 5CAYB 4JZJB 1S7TA 3R8QA 3HE6A 5E7FA 2JIXD 5HDBF 1MIML 4LKCB 5GGTL 4XP4H 4ZQKA 4GUPA 5JMOC 1U8PA 2PR4L 2CRZA 3TNMB 1CGWA 3KLAB 1ZGLM 4LOUD 2EXYC 3TA3A 4L4VD 3VGGA 1IEAA 2FATH 2NX5A 5GIRA 4LPXA 3W81A 4BQ9A 4PLJD 4PY8I 1WFTA 1IM3B 1J86A 4MCYA 4RAUA 4LSSH 3NABH 1A14L 1U92B 1A7NH 5IVZB 2CDEB 2YD8A 5GSRA 3ULUF 1Q0XH 3MJ7A 2LFGA 4O2CB 1SEQL 2XZAH 1VEOA 4NM4L 1FV1A 5T1LB 2DN7A 5FYLD 4WHCA 4YHNA 3LKPA 4HKXB 3PHQB 2OJZH 4W4NA 5EPMB 3PP4L 5F1OB 5F1NA 3K7UA 3V8CA 4L8SB 5CD3A 1QQDA 4PJEE 1G9MH 5DHYA 3O45B 2JJWA 2GFBB 2IGFL 2YK1L 2VDOH 1FZMA 5CJXC 1KTKE 5K93A 1FZKA 4HXBH 3RZCD 3QDJA 4OCNC 4RDQG 4A6YL 3K8MA 4L3ED 4AT6B 4PRIB 1TCRB 3MLSL 4XPAH 3CPLB 4JZOB 3TVMA 3L5HA 3ILPA 2J6EH 2V7NA 5C09D 4HJ0D 5T1DH 5I8EA 3SCMC 3U7AA 1IBGH 5F72S 5JLZA 3PDOB 4Y1AB 1V7ML 5L8JB 1S9XA 4K7FA 4X4XA 3MV7A 4YDKL 5D1QD 2IPUG 3MUY1 2F9BT 5KZCB 4WI4A 1YEJH 4LHUD 1RQ5A 2DBLH 1CVRA 2VC2L 4U1MA 5BOPA 5DGQA 1ND0A 1JFQH 4WFFD 2O61B 1UG9A 4NT6B 1A6TB 3D0LB 1N5AB 5KOMC 4NUJB 3JTCA 5J6HA 2M2DA 3I50H 3INUH 3H9ZA 4S1SH 4I5BB 3WJJC 4WI8A 1A5FH 3KPMA 4GLRH 2WWMC 5K9KA 2A38A 2P5WA 5DK2A 5E6IC 3C60A 4EI5C 3B2VL 2C3VA 4G8IA 2O5ZH 3SQOL 4UTAH 4ZPVA 1AGEA 3NCEB 1N64L 2OK0L 4MNQE 4C56B 1JN6A 1ZMYA 2DI8A 5H94A 5FYJL 4L4TE 3CSBA 3LMJL 1H0DB 4PJCF 3O6LH 1HK6A 1SBBA 1M6OB 1MRDL 4N0CC 4NC1E 3U83A 3G08B 3ZT6A 4XC1H 4HLZH 4X5XB 5F44A 2E6PA 2PNDA 2AI0L 4JG1L 4D9LL 2XNAA 3ERYA 1NBZA 4OBRA 5HDQL 1U8MB 5EBLB 4PTTA 2FRGP 2FEDC 4PJXA 4ZUWB 1VFUA 1C12A 3ARDB 1S5IH 1TZIB 4WFEE 2CDFA 4OCLC 4J8RB 4FFVD 1MRFH 1JGEA 1OPGL 5SWSD 1FDLH 5AEAA 3PHOB 5DJCB 4EOWH 1MY7A 1HHGA 4LAQL 4PV8B 3OX8A 2G60L 3CFIC 5HYIA 1MHHB 2O5YL 5IFHL 3BE1L 3QA3A 2X44D 5DRXB 4EDWH 2V5SA 1HDMB 1QFWH 1DTUA 3WXVH 4GXVH 1N5YL 4P9HC 3CCHA 4O2EB 2EE3A 4F33A 4YHLL 4IRJC 3FJTA 4H88H 4OSUL 3Q6GH 4ODVH 3GSNL 4U7MA 4MD5A 5F3BB 4UT6L 4G8GB 2FSEA 4JPKH 1TCMA 5EG6C 2P8LB 4XMKL 2JTDA 5C6WH 5AUMB 2Y7QB 4GH7B 3PE9A 4N8VG 3L1OL 5EOTB 2HJFA 4OFDA 1JF1B 2YN5A 2EC8A 5J3HD 1QBBA 3IDYB 3DYPA 1SJHB 4QNPF 1FHGA 1LILA 1HI6A 4DGIH 5HYFA 1MFCH 4XCFL 3WIFB 5C6TH 1K8IA 4IMLA 4AEFA 4KK8C 1UACH 1A7OH 1S78D 3I75A 5ICXA 3V6BR 3ARFC 2H8PB 3BKCH 3L3KA 5IFJB 3PP3H 1TZHA 2BVTA 1DUZB 3DXAA 1CLYH 2EKSA 1K6QH 2DKSA 3AREA 1JYXA 1JWUB 3LH2L 5HHOA 1KEML 3NZHH 4L3EB 4YX2L 5JOPD 2YPLE 5CEYA 4I48B 4N0YH 4NNPH 4BQBA 2I26N 3MRIA 5C9JA 1U6AH 5H37G 4HFUL 3FAWA 3T65B 1X5GA 3QEGH 5MENA 4E5XB 5C09B 4TUJA 3FRUB 3RTQD 2PF6A 1T5XA 4NRYA 4Y4HA 5JXED 3D25A 1D5ZB 5EZLA 1R5WB 4QHLB 3QDME 2W92A 1I1FA 3CSYB 1G7MB 3TLRA 4QOKA 4M4PA 2QSVA 1U93B 5D1QB 5TDOB 3C2AH 4I77L 2APVA 5J13B 2ESVD 3PIQA 2NXYC 3LAFA 2ICCA 3CFEB 5DTFB 2W59A 4GKNB 3VA6A 4K3EH 1EJ6A 2E9BA 1GGTA 1P4LB 3MXWL 4TVPH 1IEBB 4K8RL 3L5JA 1XGYL 2B1HH 4X80H 1PKOA 1VKXB 1JZ5A 1KJMB 4Y5YA 5F9JB 1DCLA 2ZJSL 5IVZA 4F9LC 5FFLA 5CLTA 2Y5EA 5CILH 5DUBA 1EJOL 1LEGA 4OIBA 5E2JA 2AK4D 4HKXA 2DLTA 4DN3H 4OD3H 4DVRH 1L4IA 3PHQA 4PUBH 5EPMA 4Q2ZA 3K74B 4AIXA 1Z9LA 1JCKA 3K81A 1FG2B 4LU5L 4LLYB 3RAJH 4B53A 2NYYD 2YXFA 5F1IA 3UZEA 3VG9C 3SDCB 4MA1C 2NPLX 1IZJA 4W6XB 5MI0C 4LL9A 1MCFA 5C0JA 2YOCA 5IVXF 1T0NB 3HG1A 3BD5A 1QNZH 5HHMD 3S3PA 2NY2C 4HSQA 2VB5A 3PDOA 4ENEC 4POZC 3OF6A 1I7ZA 3QPXH 5CEXB 4LDLB 4P49A 2CGRL 1H3XA 5BJTB 1FQ9C 4XVJH 5HHNA 1LNUA 4P2RE 5SWZA 3W9EA 4CVXB 4I18B 5F7LB 3H2WA 5FIEA 2G75B 5ID1B 5SWSB 3MUHL 3K8KA 3SKUD 4HWEL 3GGWA 1MQKL 4IOFD 3WMSA 5DUMH 2J8UB 4KDTA 3QFJD 4JM2A 1ZT7B 2DB8A 3D18A 3T4YB 2EEBA 4IM8A 2BJMH 4BK5A 5JQHC 1FORH 4S1QL 5L0QB 3GSRB 4YBLC 1I1AC 1VEMA 3WNMA 4G9FD 1U0QA 3G5YA 4X6DF 4FZ8H 1NBYB 3GRWA 5DD1L 5F9OH 4F7MB 3M45A 2O93L 1IAKA 1ZEAH 1LDSA 5FUZL 5DMYA 3QUZA 2HKHL 2QV2A 2YD2A 4M43L 4KK5C 2GUOA 2B8OT 1L7IL 4UNTA 2X05A 4MA8H 2UWEA 2E7LC 4JVPA 4GW5B 1AQKL 3A6CL 3GSXB 5GRWA 4RMRA 5DJAB 1BP3B 2WZPD 4WTZA 3QHFH 3VWKD 2AABL 3L3DB 2J2ZA 3BPNB 1FL3A 1TFHA 2HT4D 3CC5A 5HHPA 3JTSA 3WN5A 3VXTB 5B8CA 1HXMA 1U8MA 5EBLA 3CDFA 5HD8C 4XCEB 3NOIA 4MGXA 4L3AA 4ZUWA 2OX5A 4GBXA 3GBML 5TGBB 4AJ0A 1N8ZB 3K3QA 2VWEC 5IB1B 5L6YL 4R0LC 3D39E 1MCWM 5DJCA 1UA6L 3UTTD 2HVKA 1YA5A 3CVIH 5D2LA 4JAMB 2HJKA 4KUZH 4NQCD 1MLBB 3FONB 3LS4H 4N8VB 5GISL 1JZ4A 2AV1A 1WQVT 5I1KH 1Q9WB 3BT2L 4KKLD 4X7DC 2Y6SC 3PL6B 2MPAH 2C4FU 1QBAA 1J1PL 3AMLA 1ULVA 5I76A 1MREL 4EUPA 5I8CA 5IMMA 4A2MA 3RTQB 3PWNA 4ZFGL 5E08H 1KBGL 3L5WB 2FB4H 1CDIA 1KCUL 1A1MB 4LPTA 1A21A 3ZDYE 5F3BA 1UZ8B 2NY6B 4G8GA 4YFDB 5D1XD 2NW2A 1YEHH 4HWZB 3TCLA 3WLBB 4XBPA 2P8LA 1EPFA 3E8UH 3TCXA 3CSPA 2APBA 3FQNB 4QRQB 2GCYB 3FOLB 5AUMA 1QFUL 5TF0A 1WZ1H 3DECA 3IFLH 2VQ1B 2HG5A 3T1FA 2G5RA 1NC2A 4XZUB 1S7RB 3FQXA 5C71A 2X42A 3GHEL 2GHWB 2VDRH 2XN9B 1ZLWH 2GJ6B 1W0WA 3RVUD 1R3KB 5KJRL 4FFYH 1UT9A 2N4IA 3NIDE 3AM8A 4PJIB 3QUKB 3TIEA 5TJWK 3DBXA 1V3KA 4Z7VE 3CZJA 2W38A 1L7TH 4M48H 4N8PA 4Z5RB 2ARJB 3SE8H 4ZTPL 5FXCH 1XF1A 2AEIT 1A2YA 2EYTA 3CXHJ 1LWRA 3EUUA 4HGKC 1OAKH 3IJSB 1DL7L 3T0EE 3RWDA 1D9KC 1AR1C 3THMH 2LU3A 3FFCA 4JREC 4XP4L 2WM0A 4EVNA 5JORB 3ZDZE 1Q9LA 1HCVA 2VMFA 4QRPB 4LCCB 1F45A 1H15B 1MNUH 3CVHH 1JPSH 4GG8A 3CSYA 4NFDA 4NN7C 2FATL 3BDBA 1VERA 3HMXH 3QULA 2UZYB 3B9KC 1LO4H 4LSSL 2PXYC 3NABL 1JGVH 2A74A 4JKKA 2XTJE 1MFEH 1A7NL 2NY0D 3IVKB 5DJ6A 3KLDA 1Q0XL 3GJFB 1Q1JH 4DEPC 3EDDA 2XZAL 1SHMA 2X9XA 3JTTB 5F7DA 3KHQA 1C16A 1DBMH 1F4YH 2OQJB 2R0WH 2OJZL 5CZVL 2AXFB 5AZ2H 2VR4A 4IMKC 3RDTA 4YGVA 4I0KA 4G9FB 3ZDXF 4BZ2H 4Y4FA 2R9HC 2VDOL 1U3ZA 3HPLA 4PJFF 4AK1A 2A2QT 1HEZA 5IB2B 4LLYA 3VFTB 4XPAL 1S5HB 2XKNB 3SDCA 5DVOA 3QNYA 4GG6E 2QADC 2K7PA 4RA0C 3PWUB 5T1DL 1JWSB 1IBGL 4N0UA 3KYMA 3MV9A 4ODUA 5A16A 4LCUA 3VFOA 2W1NA 3SBWA 5E9DE 5JHDD 4JJHA 2FHCA 4TTGA 2X70A 1JI1A 3WIIH 4DKEH 1FVCA 4M6OH 4MSWA 1CICD 3AB0C 4OQTH 1YEJL 3BD3A 5ALCH 4MLIA 2X09A 4G6KH 5CMAA 4NKDA 5B3JE 1QRNA 1W0YT 1JFQL 5IJVB 1YNKH 4MXQC 2IEPA 3IU4H 4JFHE 4YHIB 1ZS8B 1BVLA 3I50L 2X10A 3RIFF 3INUL 4ZMAT 4S1SL 3C08H 4P46D 5DJ8B 4AG4H 1A5FL 3MSPA 5C0NC 4PRPD 4CJ0A 3FO1B 5GRUH 3RWCA 1ETZB 1RJLB 4FFZH 3OGCA 3QIWC 2O5ZL 3HE6D 1INQA 4IOSD 5DJXA 4UTAL 4X8XA 4Y5VA 3V6OE 4XWOD 2Y9RT 4HZLB 2VISB 4L1HA 3LKNB 4LLVA 3HE7C 3BIBX 1TVHA 2PW1B 4U0RC 5I16B 5F3HB 2L7JA 1AGFA 4GOSA 1NEUA 3O6LL 4YAQB 3TA3D 5C0FB 2NX5D 4XC1L 1CD1A 4H26A 2CRIA 2F5AH 1NFDE 2P1YA 4GJTB 1CFNA 5MEPB 3STLA 3RX5A 1OAXH 2ZZUT 4EBQH 1KF9B 3WNLA 4ACPA 3L95A 4PV9A 4GW5A 3GSXA 4UB0H 4GW4A 4JN2B 3L3DA 4MQ7A 1WC7A 5EBMA 4AEHL 2DI9A 1S5IL 4KKNA 1YECH 1INEH 5I1HH 4BH7B 1P7KA 5F6IC 2QKIA 3VXTA 1A6ZB 3LN9A 2HLAB 4F7EB 1FDLL 4P5TD 4I0PA 1WK0A 1RZJC 4XHQA 1N8ZA 3OAUH 1JUFB 4TOYL 4KAQH 2J8HA 3O81A 1I3RA 4EDWL 1N0LA 1Q0YH 1FGNH 4NGHH 1QFWL 4NO2B 4ODTH 3TVMD 3WXVL 2WMPA 4GXVL 4KXZH 4LKXB 4YDVA 4G5ZH 1LP9B 3WE6B 4P23D 1OAQH 3KPSE 3FONA 5CSZB 4H88L 2ERJC 3C09C 5DK0B 3OKKB 3CLEH 3Q6GL 5BMFH 4ODVL 3PL6A 2CIIB 3TYGH 3MV7D 5DI8B 1ORQA 1T5WA 1J0ZA 3SGKA 1FG9C 1ZVHA 2ZUVA 1S7UA 4BFIA 3KYNB 1S9WB 1U2CA 3KPRD 4H1LA 5CEZE 3FQWA 1NQBA 3TESA 1ONQB 2M1KA