4L8DA

Crystal structure of the h2db in complex with the np-n5d peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
total genus 74
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8dA01
3BN9C 3L5WA 1OP9A 4J1UB 2VB5A 1AXSA 5EU4B 4R4FL 5C7XL 3V6ZA 3W2DH 2HJLB 3QPXL 3PGCA 3LOWA 5J7CC 4KQ3H 3BSZH 3C8KB 4N0FB 3HR6A 3WDJA 5ACZA 4NKDB 1NAMH 1YEGH 4JQXA 1KTLB 5HYJE 5I1HL 4H20H 5CJ8A 1JHKL 4XC3L 1T5WB 1J1OH 1IT9L 5I1JH 3L3DA 4M3KB 3MLZH 4Q2ZB 5FYLE 3UTSE 4L4JA 4ONFH 1N6UA 4Z7QE 3KPTA 5CINL 1CK0H 1W0YT 4XPTL 3VWKB 2I9TB 4PLJC 4WFHE 4RISL 4G6FB 5JR1L 4MA8H 3RKDC 2GK0B 4QKXB 5TGBA 1NCAH 5FDYA 3P30L 4CMMB 1Q9OB 2YOCA 3DIFA 2BSSB 4JDTL 3K46A 4ZQKB 1TZGL 4ZUWB 1V3MA 3VMOA 4AIZA 4WWKD 5ANMA 2GY5A 2YEZB 4XNYL 5I19L 4HLZH 2PW2B 2C3WA 2DWEA 3WFDL 5BQ7B 1NMAH 2KKQA 4OF0A 5C0DB 4QWWD 5CILL 5KG9A 4QXWA 1NFDE 2ZOLB 4JFYB 3F12A 5ESQA 1MCPL 4M4PA 1AO7A 4X6DF 3IJSB 5BJTA 3O2WH 4JFZL 3WNLA 2VLKA 1FZOB 4LPWA 4KVNL 5D7KD 5B4MC 4JCMA 3JWOH 2IFGA 3BN3B 2HVKA 3UO1H 2QQKL 3HI5L 5EU6D 3QG6A 1HQRB 5JOPE 3IFNH 1J8HA 3WN5B 3T4YB 2W92A 2LV4A 4ONHA 1T1ZB 3D6GA 1PDKA 5IIEA 5DK2B 4RFNB 5FUZL 4Q6YA 3IDGB 3ZZ1A 1CR9H 3TPKA 5F3BA 4ZUWA 1P1ZB 2ADFL 2B2XH 5MEND 3E2HA 4UT7L 3L7FB 1BFOB 4QOKB 3NIGE 3OKMB 3VFGH 3BZ4B 3WS3A 2R39A 5TGBB 1KLFA 3EDFA 5AAMA 5IW1B 1QSED 4MNQB 3VFSA 1XCTB 2NPLX 3C5JA 1MCIA 3CFCL 2IQAA 2I9TA 3QJFA 5BOPA 2A6JA 1RJZA 1INEH 5GGTH 4G8EB 3H3PH 4NT6B 4PJXE 4XP4L 3SE3A 3ARYA 5L2KE 5F6IB 4D0CB 5T3XH 4LCWE 3CZJA 4HSQA 3QNYB 3U7WH 4QHNA 4L9LB 4XVUD 3UC0L 4XVTL 3EO9L 3U4BL 1OSZA 1DLFL 1XF3B 2AI0L 1CLCA 1DBMH 3IDJB 2R0LH 2I07B 3DETD 1ZVSB 3QNZB 5IHZA 4H88H 4PRBB 4NUJA 1P53A 3UPRA 1S9KC 3W39B 1CTNA 1NGQH 4N0CA 5ACMA 4X99A 4JANA 3WLWD 3QFDB 4L8SB 3BEWA 3GSUA 1ETZB 4JREC 1EFQA 1EXUA 2D03L 3IDJA 4HK0A 4S0TD 1FL6A 3B2UD 4IRSC 1E6JL 4M6OH 2W07A 4K07A 3ORJA 1MIEL 4JM4L 5D2LA 1DQDL 1SY6H 1NANH 1WEJL 2GTZA 1RJZB 4XZUB 1OF2A 3PWLA 1N64L 1T1WB 3FO1B 1F6AB 1ZHBA 4GQ9L 4MNQA 4QYOA 2PTTA 4JZOA 4HXBL 2CRYA 3TF7C 3B9KA 4A6YA 3SO5A 4GRLA 4KK6D 3ZE2F 1NGZB 4Z7VE 3FO2B 3RY5A 4LMQE 3L5XH 3RWJB 5C7XH 4KTEH 5K9OA 1GAFH 1AGFA 4M1DH 1GXEA 5E2UL 3JUYA 1F4AA 4CGTA 2NY7L 4JR9H 1QG3A 4X6DE 4JVPA 4JO1H 1J9CT 2BDNL 3GRWH 1L7TL 3N1QC 4PJAA 4BSVA 4FG6C 4PLNC 1IM9D 4NQCA 1XCQA 1UXSA 2BVOB 1WISA 3GJFB 4ZO9A 2Q3AA 3VH8B 1DP0A 1A1MB 1T21B 3UTZB 5BV7L 4UV7H 4MA8L 3MRCB 1MHPL 3MLRL 5C0GA 1RUMH 4JY5L 4PGDA 4XAKE 5FYJD 1MOEA 4R4ND 1M7DA 1A6UH 1EA9C 3RGVA 1L9NA 4PREA 4EIGB 5C09E 2ZUXA 3OKEB 5DJCB 5ICZA 4MJIB 4JDVB 4Z77A 5CD5D 1QACA 3GSNA 2AABH 4AIZB 3WUWA 4D8PA 5F7UA 2XY2A 4YGVB 4LASL 4P57A 4QRQB 1ZMYA 5FFLA 2BSSA 5KSVA 4Q9RL 1W0WB 5FOBA 5ETUA 2OTWA 1RUAH 4U6XA 3AFLA 1UCBH 3MNZB 4GW1A 5JIKA 1T2QL 2XA3A 3UTTB 1X5KA 2VABA 4LF3A 4Z5RB 4NNYA 3SJVE 4TVPL 4XPGH 4NZJA 4U4BA 5GGUB 2D31A 3KNBB 3PWPA 3P73B 5DK3A 3SPVA 3V5HB 1FYHB 1I9EA 5I71B 1Z9MA 2CDEA 5ECJE 1I7UB 4Y4FB 3VXOA 2DQJL 3X17A 2PNDA 3TCLB 1NBZB 4LHUG 2QSTA 2XWJA 1GGCH 4L3EB 5F8RC 4DZ8B 3QFJA 4CNIB 1UZ8B 3RJQB 4OV6F 4HIJA 2EC9U 1LEKB 3CFJA 4FXKA 2R1YA 3INUH 3NABH 2FRGP 4PJDB 4XTRC 2XFXB 4UT7H 3QDHA 2I60H 1RZ8A 4N0UE 2IG2H 5IMMA 3X13B 4LQFL 1D7FA 5MERA 1LK3H 1AD9B 5D7JA 4QT5A 1KEGL 3WO3B 2Q76A 3ZKXB 4JPKH 4LDOB 3H7LA 5GSRB 3LVEA 4YC2B 5D2LF 2FSEB 4UUJA 4KV5F 2XKNA 5CJBA 2MKWA 3TVMA 2F5AH 5GS0L 4KFZC 4YWGH 1UZ8A 4ONFL 4U6HA 4Z76B 3VFMA 4XMKL 4ORGA 2BOBB 5HDQL 1OPGH 5ICYA 3MJGX 2H26A 2P5EE 4R97C 1XT5A 4JKLA 2C5DC 1P4IH 4XH2B 3RX5A 5F1NA 5HYSG 1LO3L 2BJML 4D9QE 1BAFL 1WBXA 2J1KA 2Y6SD 3TFKA 4UQ3A 1BZ9B 3W9DA 3S5LB 4R6UA 3HZVA 4KMTL 2DIBA 3DVGA 4C56A 2D2OA 3IDXH 3AVEA 3QHTC 1MUJA 4B53A 3QHFH 4PRDB 3SDXF 4JM2F 1OSPH 4I2XB 4NO0D 2GCYA 2VH5L 5D7SL 1VKXB 1KFAH 3OPZH 1GL4B 1W0WA 4HJGA 1MWAL 4G6JH 4Y1AA 4N8PA 4YBLB 1U91A 4OF8A 4Y5YA 3CC5A 4WU5B 2Q3ZA 2DDQL 5TQ2L 4TN9A 2APTA 2FD6H 4G8GA 1ONQB 3CSPA 5JIPA 1DQDH 1NFDA 2XYCA 1A47A 3O3AA 4NGHH 1U6AH 4ENED 4Z7WE 4BSWA 1R5VA 2P43B 4P2QA 5HYEA 3H7BB 1KNOB 4LEOA 1VFMA 4Y1AE 3R8BB 1OTSD 3ULUC 4RFOH 3X3FL 1E27B 4HF5L 1P5VA 3CLFH 3RL2B 3QUYB 5C08B 3IAQA 2H2PD 4Y4KA 3KYOA 2ZCLL 4Z9KB 3FQTA 1JMXA 3DWTA 2HTLC 4UT9L 1A1NA 3AREB 3I84A 3D39D 4V3DB 4FZEL 2NXYD 3THML 3QUXC 3VW3H 1FVEA 4ODXB 5TJWK 5E5UB 4M93C 1EBPA 3NH7H 4P2RB 1QLRA 43C9A 1BWWA 1DQML 4KJWC 3E8UH 4IHOA 4OM0L 1T7WA 3RZCD 3A6CL 5K33A 1Z9LA 3T0EC 3QUZD 4ZPVA 4FFWC 4YHYB 4P9HL 1LNUA 2AEPH 2AXGB 2PR4L 5DD3L 3FB8A 1Q9WA 5CCKH 3FO1A 3O8XD 4PJ8B 2EXWD 4X4ME 2APFA 1I1AA 4PD4K 1ZLSH 4Z18A 5BVPL 3QXDA 2ZCKH 1IBGL 3L3KB 3G6AB 1AJ7H 3QSKB 4QOKD 3WDIA 3BKCH 4JFEB 3VD9A 3F5WA 3WKMH 4WUUD 1IGIH 4YHNA 2CLRA 2BOCB 1E4WL 4M62H 3LRGA 1HWGB 4JN1H 1U3HD 5H35A 1J11A 1AGCA 2QBWA 3MRKB 4UUJB 4LLAA 2Q8BH 3V6OE 4Q9RH 4NRYB 5F7DA 4JHZA 2BY0A 4HKZA 3GMLB 5E2TH 3F58H 1RUKL 4GRMB 4PGCA 3LS5L 3GKWH 1A6VH 1OP5H 1MIMH 3UPRB 5K9KB 3Q6GL 4U1JB 1I7TB 1W72H 1KLUB 3PHOA 4P4RB 5ENWA 4HWEH 2PW1A 3O3EB 1UWXH 1U8PB 3NIGF 2CJUL 4NC0B 1JZ2A 1TJIL 4FQXC 1ACYH 2OI9A 3HNVL 4KKLD 3HZMB 2FX9L 2YN3A 3DMMA 3GI9L 3VGAB 3PWPB 2RAMA 2VZOA 1C5BH 3LDBB 1MWAA 3ULUH 1ZT7B 2GUOA 4UQ2A 3VXRE 3SY0A 3INUL 3HB3C 2BVOA 3HZKB 2FL5A 3BGFB 1IAOA 3VXRD 2IGFL 3UAJC 4MWFB 2R9HD 4AMKL 3E2HB 2P8LA 4C83A 4POYA 1SQ2N 3S36H 1YYMH 4LL9A 2DBLL 4YFDB 1UB5A 3I3BA 3C2SA 3RVXC 3D3VD 3W0WE 2R0ZH 4PB9L 1DCLA 1FVDB 1NKOA 3CZFA 4PJBF 5KOVC 1CYGA 1INDH 5FB8A 2YPLB 4MJ6A 3W0WD 4XWOD 3D3VA 4PJCB 4PY8I 3HNSH 1T7YA 1RZIB 2QKIA 1J7VR 1JZ6A 3VXMB 4MQ7B 1P6FA 1KIPA 3QNXA 4EQ3A 3EO0B 2G60H 1MJ8L 2HRPL 5GS1C 3MUY1 3D85A 3GI8L 4QTIL 5FK9B 4MNHA 5I1GL 4IRJD 3B83A 2AEIT 2J2ZA 3NFSH 5L7XH 1WV7T 2P7TB 3ARUA 3D3VB 3ARBD 2YWYA 3QQ9D 3OPZL 4XC3H 1A7OL 5E8NA 2Z35B 4NOFA 3FRPA 1CQKA 4JGMA 4QHKJ 1OGAB 1S9WA 3QHZL 3OGOE 1UWGH 2DDQH 1EUTA 5DMGC 2OSLB 4ETYA 1T2QH 1A3QA 1WCBA 2W59A 1FE8H 4O4YL 4HUVB 4OT1H 4PJFB 3FFCD 4X4ZA 2HA1A 4PRPB 1T6WA 3VWKC 2X09A 4JVUA 4OQTA 3KYKL 5IFJA 3U48A 3DGGB 3G6JF 3C2AH 3MCLL 2HLFD 3QCVH 4NP4H 1XF2B 4Q9BA 2FJFA 4NHUE 2EDXA 5DMJB 1KUMA 2O5XH 4Z7WF 1F58L 3T3MF 2ZUYA 3QCTL 4DFHA 4RX4D 1SJXA 2D7NA 1QQDB 4HUXB 1A7QH 5I15H 3RI5F 4X80H 4KDVA 1EDQA 1YEDA 1D6EB 1IMHC 5F9DC 1UM5L 4KJYA 4TPRH 1Z0NA 5FECA 3FB6A 1LE5B 4ZUTA 1PVHA 1ZLUK 3MRPA 1XGRA 3QEHA 4LVOC 4O9HH 5HHQA 1PKQA 1X9QA 2PR4H 4F80A 5GS1B 4FMFA 5E6YA 3SKJL 1ZOXA 4BQ6A 2C3GA 2MNUA 4ELMB 5DEFA 4KJQD 4PJGA 3JWNC 2PKDA 3JWDC 3KJ6H 1U42A 1Z5LB 1G6RL 2O5YL 1DEDA 5HYIA 2DQTH 4PJEB 3LMJL 4Z7QF 3GMNB 1D5XB 4GMTH 5C07A 5TFSL 5E08H 2BY3A 1FNHA 3LCYA 2P5ED 3Q0HA 1SEQL 5F97E 3ULVH 2E27H 4JB9L 2IAMB 2VN7A 4I4WB 1IQDB 4XBEL 4F7CB 4OZGE 1KXQE 2AK4A 4WY7L 4XMLH 2MCG1 3OKMA 2ZWLT 3KLDA 1DVFC 3HPJB 2AEQH 5EU6A 5EZIH 5GGTL 3UYOD 3GZKA 4O2EB 4JKPL 1T0NA 2EYTA 5BXFA 1S9XB 2R23B 1WCBB 2EICA 5D7IE 2CLZA 1A6ZB 1SJHA 2ICWJ 3TPUE 2CDGB 1RK0B 2FJGB 4IOFD 4S2SB 4FHBD 4MJIE 1NGYB 4HWEL 4CMMA 3H42H 1QEWA 4BYHA 1NAKL 3BUYB 2GK0A 1CFNB 4X7SL 1H3PH 3QUMB 4GH7B 5E00A 4RNRB 2IAMD 1WIUA 4IJ3B 3ES6B 4XMPL 3SKNA 5AUMB 4JGUA 1C5BL 4Z95H 4LHUA 3CLFL 3S96A 1R3LB 3KG5A 1CE6B 1MPAL 4G3YL 2BVYA 1FL3A 2HFGH 4KH2A 2Q6WA 2D03H 2GYSA 2B4CL 5FO9B 1OT2A 2XZQH 2AJUH 2AP2A 3OAZK 4W81A 2GI7A 1G0DA 2QSCH 3LAFA 1X5XA 4PG9B 5KOMC 1JPGA 1C5CH 1UM6L 4J1UA 4JM4H 1KB5B 4ZAKB 3HR5B 4G6ML 3LZFH 5LCVL 1YNKH 1WTLA 3EKCA 1CFSB 4KI5D 5E1AB 3V4VL 4DQOL 1BZ7B 2YUXA 4FQLL 4FFEX 2YHGA 2KQNA 4DN4H 2AEPL 4N0UA 4RDQF 1M1SA 3BKYH 3KYNA 3SCMB 2CDFA 5GJTL 1JGEB 4J7RA 4P2QD 1ZLSL 4L4TE 1XF4B 3VG0H 3IETB 5DFVD 2YUVA 4QY8A 5F6HI 3RIFK 1MWAB 4R4FH 3CFDB 4KKCC 4HIEB 4MXQC 5D5ME 3HLAA 3AS1A 1YMHA 1U58A 2X9YA 4NPYB 1JZ8A 3T09A 3ULUD 1XGYH 1MJ7H 4G7VL 2UZIH 3ALXA 5D1QD 1JWUA 4JFOA 4L4TA 1WVZA 2FX7L 4HJ0D 2ZP0T 1GZQA 3CX5K 4IS6B 5CINH 1EGJL 1MCOL 1RZIA 3MBEB 1I1AC 4WU7B 4OKDA 5I71C 1AIFB 1TZIA 5GSVA 4OLEA 4RA0C 4AIOA 2JJWA 3TV3H 2M2DA 3KYKH 4WRLA 3EYFB 1QRND 3IT8D 1TVDA 3FO0H 1DQTA 2R8SL 3MRKA 4NNXB 4KQ4H 3RUGE 2VDOL 4M6NH 2WIIA 2JIXA 5DRXB 1V7MH 1RHHB 3GGWB 4M43H 1AFVL 1BBDH 4CRPA 3OF6A 1W8NA 3FQNB 2ED7A 4FOMA 5CGMA 3WFDH 4WTZA 5EO0B 2IALA 1CGSL 1T2XA 4X8JB 5I8OH 4KVCL 4FQIH 1Q9WB 5ABDE 3FT4B 3GIVB 1RULH 3BRFA 5C09D 3UJJH 3HZMA 2J4WH 3QEQD 1AP2A 1RI8A 4YXKL 3BPOB 5JPNA 3VXQB 2OI9B 4NUGH 5K59F 1QFPA 1WQVT 3CDYA 1J18A 5ICXB 2GJ6B 2JJTC 5ALCH 1C16A 4HKBA 3BAEH 1EMTL 4W4NA 3QFJD 1K3IA 2AJZB 2DJUA 1V7NH 2R0WL 3V52H 4X5LA 1NFIA 2JCCE 5D2NC 3RVVD 1O7VA 3IF1B 1A1NB 3AREA 5HBBA 5BW7C 1MH5B 1ED3B 4YXHH 4EDXA 5GIRA 3CVIL 1ZHLA 2NY6D 3MRBA 2D7TH 3LD8C 4KUCD 5F6HJ 3FHQA 1OGTB 1MCKA 5I1GH 4JFXB 1FPTH 2CK0H 1OAQH 1D5IL 2DI7A 2ITCB 1X6LA 1MRFL 4APQC 2BOCA 4RMUA 4OZFG 4P2OD 3HCVB 3DRTA 1UWXK 3TPUB 2FHBA 1EHNA 1T04B 4QRSB 3ZKXC 4MSWA 3LH2L 1AQKL 2AGJL 2YWZA 4LAQH 4X9FA 1FZKB 3W0WB 5DZNA 4NN5C 1TENA 1JYNA 1A3LH 4LFHG 2W0LA 2J12B 1WIPA 1YDPB 1DLFH 2XZZA 4NN7B 4HGKC 1AGBA 3MLPA 2ARJQ 1H3PL 3RTQC 3VGHA 4PG2A 4MA1B 1Z6JT 1T66D 4ZOCA 4YDKL 4FXGB 3T0WA 3I9GL 4QHUA 4HUMB 2F19H 2DD8H 1BX2B 1H0DA 2E8YA 2GTWA 1QLRB 43C9B 5CJOH 1G1YA 5LXGL 3D0LB 1YMMA 3MYJA 3GMRA 1N6VA 4ZS6D 1E6OL 3QUMH 4QRRE 5T1KB 2EKSB 5SWZE 4QWWC 3PHSA 2EYRB 1QSFD 3HMXA 3QDGB 4GBXB 1J0YA 1DTUA 1UA6L 4WNQA 1MJJA 3AMLA 4MD0B 5JOPD 1ZTXH 3GIZL 3VFMB 2R4RL 4HKJA 4WCYL 3FT3A 2FDBP 4JRYE 4NGHL 5J06A 3R4DA 1FNGA 4OCNC 1I7ZB 3KPOA 3I3EA 2JB6A 4WI9A 3LKNB 5GJTH 4TQEL 2YXMA 4BQCA 1ONQA 1LD9A 4M5ZL 2X1QA 4ZUUB 4TSAH 5BOZG 2WINA 4XXDB 4LRIA 3VXUA 3VI3F 3L3IB 1RZJC 2NX5B 1NJ9A 2F53D 1KIRB 5DXWA 4K3EL 1HKFA 2VQ1A 3HTLX 3KXFB 1LEIA 4XBPA 4NQDB 5DI8B 4ZDHB 5DHYA 3BWAB 4MMZC 4UDUA 4NQVA 1C12B 5BZDA 3P73A 3SPVB 4WY7H 4J23A 4UQ3B 1KENH 1ORQA 3ZYIA 2LAAA 4PY8J 2QEJA 4LSQL 3CU1A 3RGVC 4QO1A 1TITA 4F7MA 2YUZA 2FBOJ 5FCSH 4NO3B 2APBA 1OOAA 4EN3C 2NX5D 5D96C 5FA4B 2XN9E 2VLMD 2EO9A 2ZCKL 2BRRH 4WUUA 1CE1L 2QR0B 5FM4A 3G5ZB 5DVKA 1MAJA 1DLHB 4KQ4L 3MQIA 3KXFD 1MAML 3M45A 4DK3A 3EYVB 2NXYC 3WL9A 3SDCA 4JDVA 1LK2A 5HYSA 1EX0A 4HS8L 5DUBB 1H8NA 5AWNL 2DQHH 4CU6A 2MFNA 5BMFH 4DGVL 4KMQA 4JHAL 1FAIH 4F33A 1YEIL 4RQQB 4U1GC 2DYPB 2FB4H 3GMOB 3MSPA 4FQIL 4C4KO 4F15C 4FA8A 4H0GA 5IB4A 3TH4T 5I73C 4HIJB 5ADPH 1EHXA 4JJ5A 4JFOB 1IAMA 4L4TB 4KZEH 1JWUB 2CUIA 4NQXB 1FO0H 1GVIA 3O41B 4ENEC 2Z8SA 1YN6B 3QO1B 3TN0D 3TCLA 1I9JL 1KLGB 1OARL 2Q7YA 4UT6L 1OQOA 2CH8A 2IPUK 5FYKL 3O9WC 2D4DA 4JO3H 1Z0MA 5EG6C 1KIQA 4XHJD 5F7FA 2AQ2A 2XPGB 3FOLB 1ZLVK 3OZ9H 2ZUQB 2EE6A 4P46D 3K8KA 5DD1L 5HVHB 1MHCA 3CDGB 2H8PB 3F8UB 4I0PB 2OTWB 1W0VB 2J7LA 1U93A 4YBHA 3B9KB 3WFBL 2AEWA 1MQKH 3NZ8A 5CLTA 1Y18B 2NXZD 1MHEB 2DQDH 2VISB 5I1CH 1YYML 5FV1L 3RAJH 1J1OL 1MJ7L 1QA9B 3VFVA 2NY5L 4ISVB 5FM8A 4M7LL 4MVBA 4LLMB 3QH3B 4CMHB 2KZWA 3F7VB 2VZ1A 1UJTA 4X0KA 4XHQA 2Y7QA 2Q6WB 4X9BA 4LPYA 5FXCH 4YE4H 1KN4H 1L0QA 3D0VA 2UZXB 3QEQA 1RZFH 4BA8A 1ZANL 1T21A 1BM3H 4X7CC 2PXYC 3L5WB 4CW1A 1XR8B 2CGRH 2ILLA 3NGBC 5I0ZA 3QUMA 5E00B 4OZFB 3DO7A 2Q86B 4LCYB 3KLAA 3EOYG 3IXAB 5IHUL 5BVJB 3PNWA 4MJ5A 2EDTA 2AXFA 4S2SA 5IJVB 5DVOA 3RY6A 3GO1L 1BPVA 3U0PA 1HEZA 3U46A 4L9LA 3RWDB 1KEML 5DFTA 5FUCE 3QDMD 2HG5B 1A7PH 1MCPH 5E8EA 4WCYH 5DWUH 1J1XH 3UJJL 2ZSVA 1KJMB 2OM5A 2QHLA 2NY0B 2CPCA 1K4CA 4UNTA 3BP7B 5KVGH 2HVJA 5DJ0B 5F9OH 1H3GA 4RGNE 4NC1E 3RUGF 4AL8H 2JF1A 5C70A 1EMTH 1XF5A 1DUZB 2MMXA 4BFEA 2Y06L 2VMFA 1VSCA 4BK5A 2V6HA 5JPMB 3G6JA 1G9NH 5DD5H 4ELMF 1MRDH 1WZ1L 5CKAA 15C8H 1U3HA 4TYUA 3BP5A 1S3KH 1FO0A 5L9DH 1KG0B 3L7EA 2PXYA 3MR9B 4HH8A 4WDIB 4FZEH 4WHYG 5IEKB 3G5YA 4KY1L 1FORH 4PGEB 4Z7WB 1UC6A 2CK0L 4PJEE 3VE0A 4KK9D 4YNYA 3QDJB 1G6VK 3SDDD 2VLKB 5JUEH 3VRLE 1YMMD 3BZEA 4LSVL 4O9HL 1KB5L 3QUZA 1FGVL 2ZOLA 4U1MB 4P3CH 2OQJA 3T65B 2R4SL 5FYLD 3FB7B 1HH6A 2F8XC 2XWTB 4H88L 1FIGL 1I3GL 5L8LB 2A6JB 3GMPB 3RWFA 3ILQD 1U0QA 2VR5A 2RFXB 1N5YH 1CXKA 3ARDB 4A2LA 4KRPB 1Y18A 4N1HB 1LMKA 5E2VH 4HH9A 3V4UL 1KOAA 1F45A 1J5OH 1FAIL 2YD3A 5B39B 4WI2A 3EHBC 5EZIL 5EA0H 3GB7B 1IGML 2GK2A 3DVFA 3BEVA 5D7LE 2XWBA 2R2HA 5DJZA 4GW5B 1JWMA 2ADGB 2WP3O 1WFOA 2ITDB 2D9QB 1P7QA 1TJIH 1I3RB 4L3CB 4NO5A 3C5SB 3D85B 1L0YA 4PRHA 2DMCA 1LDPH 2VITB 2IH3A 1I8KA 3GBNL 5ILTH 2R0KL 3CNKA 3F65A 1ZGLM 3PV6B 2HN7B 2BK8A 3O11A 5EUKA 5C6TL 1I9RH 4XNZB 3C6LD 3G5VB 1JFQL 3T3PE 3O4OB 4GRWE 2DTSA 5F88A 3VFOA 3LEXB 4XCNA 3MRGA 4DAGL 1GGIH 2RIKA 4R7DA 2MCPH 2MQ3A 1VGEL 1XMWA 4Y19D 3Q5TA 1C08A 3QDMA 3AB0C 3MO1B 3OAYK 1L7IH 1YC7A 5I1JL 4IMKA 3VDAA 4G9DB 4LCWB 3R0MA 2EDHA 4OD2B 4U7MA 4LIQH 3UTSB 4PDCE 4FQLH 3QUKA 3QZWB 3S4SG 3U36A 1JHLL 2OJZL 1OTUC 4UI2A 3VD7A 5CJ5A 1MNUL 3CXHJ 4ERSH 4MCZB 4UQ2B 5DMIL 1BOGA 1G7JB 3RRQA 3B9VA 4EIZC 1PYWB 3P0YH 1C12A 5BZDB 1IQWH 1S7RB 2F9BT 4QTIH 3L3OB 3BP4B 2BP3A 2DM2A 5ISZD 5KS9A 1SEBA 1JV5B 5E8PB 1BVZA 3MLYL 5E70A 4LFHD 2XN9B 3WNMA 2VLJE 4TULH 5FYLH 3PHQB 5DRZA 2DL9A 2O5ZL 5KSBE 3WO4B 4Y88A 2YD1A 3GSWA 3TT3L 1KJ2B 1RJYA 4U1NB 4LBEA 3BPOC 4M8QA 4R7NB 3EYUL 3WV0A 1WLHA 2V2TB 3BGFC 1AGEB 4YUEH 1TVHA 1BP3B 2XTJD 4TNVF 1XIWC 2FLRT 4NRYA 4S1DC 3GJEB 3D25B 3G5XB 4Y19E 1B2WH 4AENB 4P2YA 3UO1L 5DEGA 2K7QA 1IGFL 1QVOB 1T3FA 2F74B 4U1LB 4K55A 2X4RA 3T2PA 1CIUA 1UACL 1J8HE 4ZXBA 3MV7B 3LD8B 4O2FB 4OZ4A 4NM8H 3J8F7 3HHRB 3HS0B 4Y19A 3U0TB 2E7CA 2WWKT 3MV01 5IGXH 3I2CL 3RDTA 5E6IB 3RFZC 3VDBA 3ZKQD 3A6BL 4YR6B 2Y36L 4BFBD 4WEUD 4MLSA 1FP5A 3C6LC 4YXKH 4HQQH 4JCLA 3CXHK 5DRWB 1Q0XL 4UTAH 4UILH 3VI4F 2R2EB 4RZCB 2C3XA 5DA0B 1DZBA 5K9QI 5DD0H 4KMLB 5L2KA 2V2WA 4HUWA 3O3BA 4CVZA 5DJ2B 4PB0H 4ODTL 4XCCH 4DGYL 3TIEA 3RVUD 4PJXF 3P4LA 4H1LG 3ARFC 4KKAD 1A6PA 3IU3B 4GMTL 2WW8A 4OLVH 5TFSH 1ZSDB 4WW2A 1IEBA 3P3YA 4XGZA 1LE9B 1FL5B 1CU4L 1DUYB 1CXFA 4OGAC 1OHQA 3BT2L 3UAJD 2EIZB 3OKOA 3L9RA 3O9WA 4QLRA 2W9DL 3GSQA 3EJZC 1IE5A 3ULVF 4K8RH 1P69B 4XTRD 5DMGD 1RJYB 3P4MB 1JPTH 2VDKL 2OJEA 4M8QB 3GHEH 2H41A 1EEYA 5ESAB 3ARPA 3IGAB 2AJSL 2YPVH 4G43B 1U92A 1B0RB 3VFPA 4FFVC 3S8WA 4I0KA 1HHHB 1G84A 5K9JL 3H9SE 4RFOL 4P5TB 5E8PA 1X5FA 5C0NC 1N4XL 1PYWA 5ILTL 3O9WD 3I02B 3SKMB 3UJIH 2XY1A 4QRTB 1YQ2A 2NY1B 2GJJA 1T22A 5TQ0L 1DBKL 4MAYC 3MRDA 5B4MD 1RUPH 1HKLL 5T1DH 2BOBA 1UJ3B 3V0WH 1H15A 1UA6H 2L4OA 4PV9A 3TJEL 2FZ3A 4X6EA 3C6SA 4U6HB 2PXYD 1DQMH 3GM8A 1X4ZA 1RZKL 5HDOA 3L3HA 2NY0D 2FX8H 4P5TD 1GSMA 4MB4A 2ED9A 4MQTB 4OFVA 1QHPA 1RVFH 4PJBA 1ZAGA 4I3RH 1B9ZA 5EC1A 4N5UA 3DJ9A 2EDLA 3PJSA 4EBQH 3DX9B 3LQMA 4PR5A 4P3CL 4DW2L 1BEYL 2XFXA 3DUSA 5BVPH 3CFEB 1PD6A 4K94H 4MXQA 1IAKB 4M03A 4LNVA 2IH3B 5HGDB 4KROD 2A0LD 4CDGC 1UEMA 2VAAB 2A38A 4NZUL 4WHDA 3H3KA 3NGBB 3ZE1E 3N06B 4XPBH 3MFFA 3QXTA 2XXCB 4Q7DA 1YQVL 3H0TA 3L1OL 3V4UH 3WMSA 2JJUA 1JGUL 2NW3A 3WXWH 2R2HB 3MNWA 4PJDE 4R90L 4NNYB 1UCBL 4LLVB 3MGTA 1QBMH 5IR1B 2YKLH 1CTOA 3MREA 1AGDB 5I1DA 3GSOB 1EGJH 1BOYA 1DEEB 3MNZA 3ZTJG 3P9LA 1HILA 1P7KA 4XPGL 5MI0C 3G04B 3DURB 4QRUB 4JO4H 2PYFA 1BZQK 3MLWL 2H3NA 3O2VH 4QHLB 3VGGA 2ZOKB 1N8ZB 3MRMA 3KPLA 3ESVF 2OP4L 5EOCL 5AYUL 4APQB 1AD0B 2NQCA 2VN4A 3OB0H 5MHSE 4FNLH 4O00A 3GJFK 3PL6D 3U9PL 5DVLA 2G5RA 4Y5XB 1EEZA 1V7ML 3UTTE 4PP1C 4PREB 1IEHA 1WC7A 1KTDB 2NR6D 4XCEA 3ZHKA 5CEYB 3FB7A 2X40A 4I77H 2AJXH 4WWKA 4GAYB 1JFQH 3LKSA 2BNRB 1G7HA 4F3FB 3OL2A 1VACA 1YJDL 3RTQA 3V4PH 3DRQA 1MCQA 4AQ1B 1W72B 1OW0A 3S96B 2O61A 4JO2H 3UBXA 2MCPL 4V1DA 4D0BA 4ZYKA 2QHRL 4U0QB 2EE9A 4TSCL 2DL2A 3WLWC 4HGWB 3U2SA 2J8HA 3BE1L 1IM3B 4BZ2L 1AKJD 4PP8C 2L7JA 3ILPA 3RBGA 3IDYC 5K9OB 1G7QA 4MNGE 1JHLH 4HUUB 2ORBL 3MLXL 1P4IL 1KC5H 3MACL 3BP5B 1LO3H 3RJDA 3RU8H 3G9AB 2VWEE 2IPTH 4HHAB 2XNAA 1R24A 4Z7UF 1N6QL 2EEBA 1H3WM 2E6JA 2XXMB 1T7ZA 1QRNA 2W9EH 3LPWA 5INDB 3OB8A 4MXQD 3GUTB 1A4JA 1M71A 4MNGB 3QJHB 4LVHC 3WFBH 2C7UB 4XCFL 1NMBH 4UDTA 4U6YB 3AMKA 1K4CB 1ZS8B 2YSSA 1D5XA 2Z8WC 5C9KA 3DTXB 4PRAA 5DGQA 5C0CB 1FCGA 3V2AR 2CKBB 1ADQH 5GZOD 3GSNL 4NYLB 2V5YA 2G9HB 2V9QA 3RQ3A 2VDKH 1QRNE 5KSBF 5C07E 1LP9B 2ZNWA 5JZ7D 3QWQB 1A3RH 2GY7B 4XCYB 3ZDZE 3B5GA 4PFEA 4JHBA 1ZA3B 25C8L 4HC1L 5GRJH 4HJJL 1HK6A 5ESVA 1CDJA 3RKDD 3T2NL 5A2JH 4PJ7B 3DX6B 4AZ8A 2Z31A 3E6FA 2YD5A 2OXHA 1ZT1B 4HAGA 2BZDA 4XNUH 2IQ9H 1JF1B 5L2JA 3P77A 3VFUA 1PG7H 3OAYH 3DX8A 4Y4HB 1JWSA 3DRQB 1P4BH 1OTUD 4RFNC 4S0SD 2VE6A 3QUML 3QIUB 3DO3A 3MA9L 3DVNA 2CO6B 3QULA 4O2CB 2KBGA 4GT7A 4HS6B 3HC0A 4HS3B 2JLLA 3S35H 4Z7VA 1ND0A 4RA3A 3P0VL 2DLEA 4U7KA 3S4SA 4PY7A 2YD4A 1IFHH 3Q6FB 1S78C 4JFQB 4JPWH 4WHTA 4LPTA 3HAEB 3NTCL 1Q0XH 1U8OB 2CO7B 5CKGA 2FEDC 5DK0B 5IUSA 4X5XB 3N1GC 3FAWA 2QTEA 4WFFE 3BPNC 5C2BH 1BHGA 2NMSA 2H8PA 4LHUD 4GLRI 1P7QD 4MQXD 5DC0A 5IBUB 3ZHDA 5IIEB 2X89D 4WI3A 1IBGH 4KRPC 4XI5C 4JG1L 3HG1B 1GAFL 1R6VA 1J8HB 4M1DL 4RAVB 2OTPA 3WN5A 3IKKA 1DQQB 1HQRA 2Z35A 5I76A 2Y4SA 3BW9A 2EDFA 1IKFL 4OCXL 1GOFA 1D9KD 3FZUD 4JKMA 3ZTNH 4JPVH 4LVOB 1HXYA 2BSTA 3RA7H 2EDYA 1YN6A 1AO7B 4WGVB 2ZUQC 2HH0L 4OAWA 5A2LH 3RNKB 2HKFL 5F7HA 2BC4A 5DD3H 1F6LL 3WCYA 4F7EA 1MIML 2K1MA 3QQ9C 1FYTE 2DYPA 2VIRB 3GMMB 2DWEB 3OJ2C 5EC1B 2A9NL 3OKNA 1FVDA 3U30B 3ULSA 2H45A 1CE1H 2XTJC 1PEWA 2DWDA 4S1SL 2X7LA 1G7MB 3FAXA 4E41D 5FOJA 3T1WA 4MAYA 3U9PH 3EYVA 1KJVA 5IMLA 5EOCJ 3WE6A 2FX9H 3QXAB 3BH9A 2RB8A 5JHLL 4HLJA 4JRXB 4PJCE 2XRAH 4WUUB 4G59A 1M7XA 1UH4A 5KANI 2AJ3A 4OI7A 2DB8A 1NGXB 2HLFC 2ICES 4P3DA 1A6TB 1BIIA 3G9VA 3TIDB 2C9AA 4WO4C 2V17H 4GRLC 3RIFF 3ETBF 1AY1L 3M17B 4E41B 3WIFA 1T5WA 4X6FA 2YPKA 2DBLH 1YNKL 3ZHLA 5D9SA 5L8KB 5GGSA 3C8KA 1NJ9B 2B20A 1IC4L 3NN8B 4I18A 5IBTL 4NKOB 5IV2B 5DHXB 5I8CB 3FCTA 5I1EL 2UWEB 4DW2H 1KYOJ 2Q1EA 3QRGH 2P5WB 1N6QH 4IRSA 1G0YR 4FQXA 2GITB 4HFWA 5EBMB 5DHVA 3PWPD 1FLRL 3OGCB 2FH6A 3TA3D 4JE4B 3A6OA 4KRLB 5JW4M 3IFPB 3UBXI 1I7ZA 3FJTA 2ED8A 4IBLT 1HH9A 1KPVB 2JB6B 3WUZA 1EH9A 2VSCA 4OZIE 3B2UC 35C8H 5I1HH 2JCCA 2A77H 3IB4A 3EGSB 1QO3B 1IT9H 2FO4B 1IEBB 4CJ0A 4YWGL 5TE7H 5D5MB 4P4KC 5F7LB 4EOWL 2UY7A 3QXDB 5JLZA 3REVB 4DCQA 3AB0B 3TZVA 1A3RL 4PRIE 3ARBA 5IVXE 1A7RL 5DYOB 3ZYZA 1JN6B 5DF0A 3EYQC 3LQAL 1I85C 3RWCA 1BAFH 1HHJA 1MF2L 2DI9A 5IMOB 4PRIB 4RWYH 4ZPVB 3D0LA 3GSVA 1MRCL 3MV7E 3P0YL 2VZSA 4L3AA 5AYUH 2ATPB 2G2RB 5C0CE 5IBLD 4WI6A 4I8DA 1AGBB 3U4EA 1GGTA 5BCAA 1DBAL 3QISA 2OTUA 2P46B 2OR7A 5TH2A 5E6IC 1D5ZA 4OFYD 1FDLL 3V95A 3V7AG 5JW4Q 5CILH 5EU5B 3S37X 1ZLVH 5CAYB 1NFDF 1OAKL 4NO2B 1A6AA 3S35L 3C5ZB 2EXWC 4O4YH 3OAZH 1KXTB 1YNLL 3CMOL 4OF5A 3KHQA 4OM1H 1KCKA 4JPWL 1HSAB 1U8NA 3MJ8B 4JN2A 3TBTA 5FEBA 4GG6B 3U7AA 3MV9B 5DS8B 1F6FB 5I2IB 5F9OL 1MCJA 4BFGA 1YEEH 5I0DA 1XIWB 2EDKA 2WSKA 3WKNA 2E7LE 5J3HC 3DYPA 4FQQB 2HFTA 1IM9B 2I26N 1NBVH 4DKAA 1SJEA 4GLRH 4KI5C 3ZE0E 1NDGA 5DMKB 4M6AA 3W5MA 5HGBA 1L8JA 1JK8A 1GHFH 3CSYA 4HKBB 2FYYA 1NEZA 4LLYB 1SEQH 5B22A 2XN9A 5D9SB 1R3JA 3MV8E 1EHLL 4PJIF 4OB5L 3DX7A 4OLXL 3KJ4B 4M7ZC 3ZT5A 2A74A 3HZVB 4HBQA 5DJDB 3NPSC 4XPAL 2KH2B 1CD0A 3V5DA 4YFLF 1Z3GL 5SV3A 4M1GH 1GGBL 1YNTA 2VDLH 4MJID 1KB5H 1RIUL 2Z31D 3EIFA 5IVZB 1VGKA 2AQ1A 2F8OA 5DLML 1BBJB 3OXRB 4LP5A 3RBSA 1L4IA 4NZRL 1XGTA 5SX4H 5T1LB 4H8WL 4DVBA 4ETQA 5D7JC 3HMWH 4PRNA 5FV2A 4FABL 4FTVB 4N90E 4WW1B 4G9DA 1GH7A 1REIA 4LCWA 3T3ME 2NY1C 3UTTD 5IF0B 5JHLH 5EBWB 3LS4H 4QT5B 5I1IL 2BNUA 1DFBH 5E9DA 1F4XH 2WWKO 1S5IH 1E6OH 4PYHA 5CJXA 5GXBB 4K94C 3MBEA 1B0GB 3PWNB 5C9JA 2JK5A 3C08H 4WV1B 4R26H 4S11A 3NCMA 4RIRB 4PJIB 3NZHH 3QIBA 1T0MA 3Q3GA 1X7QB 1N64H 3MOAH 5F89A 4ALAL 1WFTA 1I3RA 3TBYB 5J6GA 3QUXB 1FYTB 2IMNA 4FQ2L 4HXBH 3SJVD 3DHMA 1H3XA 3BZFA 4MDJA 4N5EC 1X5IA 2E6PA 2BMKB 3STLB 2QQQA 3BP6A 3DBXA 1HNFA 4QY8B 2WUBH 5IMKB 1ERNA 4PJBE 1KACB 2YUWA 4JFFE 4IOSD 1OAUH 5E8DH 1KCLA 1PZ5A 4OLZH 4KV5E 4YPJA 4LCIL 4LEXH 3SKOB 1GIGL 3JWDL 4JLRA 1K8DA 4JO1L 5T3ZD 3U79A 1ZHNB 3LIZH 1FBIL 1D5BA 3J7HA 1KT2A 3ARED 4EI5B 3SJVB 4JGJA 4LSTH 3RA7L 5I30H 3LHPH 4Y1AD 1CK0L 5D1ZD 2FGZA 4X4XA 3U7YL 3PL6A 5KJRL 2CRZA 4HS6A 4S1QL 3RNQA 3JVGA 8FABB 3BDYL 5J4MA 4F9LC 3TYFB 3CU7A 3MRIB 3N1FC 3MRCA 3D2UB 4C56D 2CIKA 1MNUH 4K71B 1DQJB 1JUFB 1MJ8H 4UTBL 3QPXH 2X4OB 1MVFA 1RIVH 4MDIB 3T1FB 5IEHA 2GFBA 4KQ3L 3HRZB 1IQWL 4P5MB 3PDDA 1YPZE 3K2UH 5EBLB 3TO4C 3V9FA 3T2QA 3VG9C 4GFTB 1CG9B 4L8CB 3MZTA 3IFOB 2R56L 3V79C 5J1SC 4RMVA 3CFKB 1OB1B 1UVQA 5HI4C 4GG8A 3EUUA 3UTPD 3DMMD 4UOW0 4RBPH 3OKKB 2KDGA 1OAKH 3QI9B 1DN0B 1AQDB 2JIXD 1NGZA 5I8EB 5C0AB 4TVPH 2XT1B 3T0ED 1T5XB 4WTZG 1RZJL 1JF5A 1NCAL 4HPYH 2G75B 4JZOB 1UWEH 4DGIL 4ZS6C 4UIMA 1AHWA 5J6HB 5E5MA 1C5DB 2NXYB 3C2AL 2AKRA 5DO2D 4BUGA 4UDTB 1F90L 2FHFA 4IMLB 1IGFH 5E94A 2EDJA 2RHEA 1IC4H 3TYGL 1QRNB 1GZPA 2LVCA 4P9ML 4KK6C 3RWDA 3W9EA 2AJYH 4NSKB 3WNKA 1K4DB 3O3DA 1MEXL 4HUUA 2A6KB 4RAUA 5GGVH 5DEFB 1FLRH 4Y5XC 5E24E 1OP5K 5KBNC 4M61B 1VENA 4P23B 3CFKA 1BQLH 4HIHA 3MRPB 35C8L 2X70A 4YXLL 3RUGB 3EOAB 1G0XA 3OWEA 3RAJL 2F5AL 5GS0H 1AE6H 3TNNA 4L9LC 1YPZF 4C54A 4NDMB 4IIQB 3KVQA 3JV6B 4M1GL 5FKPB 3IXTA 4XP4H 1RIUH 1FSKB 4BH8B 1WIOA 4S10A 1RFDL 1VADB 1VACB 3RTQB 3PV7A 3LSOA 2H2SD 1S7SA 4QHNB 4RGOL 5IB5A 1GOGA 4F8QA 2A73A 1T80A 5SWSD 4H1LB 3N9GH 2X4PA 2J3SA 4EUPA 4KHTL 4PJHB 2ADFH 4PB0L 1SJVA 5EU7E 4NM4H 4UU9A 2UWEE 3VFGL 3QI9C 2QQNL 5L0QC 2V5SA 4OLVL 1JRHI 4JB9H 4P49A 3HPLA 1RHFA 4O51B 3SN6N 4IRZH 3GBML 4XRCB 3WEXB 1M05A 4MXWL 1W0VA 4OJFL 3EDEA 5DT1H 1CICA 4P4KB 3WLBA 1T20A 1T5XA 2X4NA 1AQKH 1ADQL 2AGJH 3BI9X 2IANB 3U9UA 5C0IA 5T3XL 5D72L 3IU4L 5FYJE 3C8DA 1CDHA 4HKXB 1EAPA 4WVRA 5HJ3A 4NKIH 3NZHL 5CGYC 5E7FA 3MJ6A 3MRNB 4ZO8A 1OB1A 4OM1L 4PRID 4Y8AA 4HJJH 3KLSA 2XZAL 4LLWA 1Q1JL 1T89C 3O4LE 2NR6C 3FFCB 2XOTA 2I27N 4P4KD 2IF7A 4NO0A 4B0MM 4CBPA 1MCRA 3DUUA 4DZBB 5DRNA 4OTXL 1H5BB 5C2UB 4YHZH 1EJOH 5H94B 2JTDA 4QNPE 1H3UA 1SMOA 2Z4QB 4IDJH 5TDNB 4LOUC 3FONA 2MTPA 1CN4A 1QHOA 2EYSB 5EO1B 1K2DB 2DQUH 3V0WL 5E2WH 3FN0H 5EC2B 4H1LH 3TA3C 3NVQA 4LSDA 5HGHA 4GRWF 4OZHA 4C59B 1MSPA 1BJ8A 3WL9B 4KKBC 5C0IB 1UKSA 4X6BB 2IANA 4F57H 3M1BA 5I66B 1RVFL 3VFRA 3NTCH 1SBSL 1P2CB 1QLEL 3H9SB 3O6KH 5JTWA 3RPIA 3P4NB 5CCKL 1IAOB 3SQOL 5DZLA 1FIEA 1DBJH 1QFWL 3MCKA 3B9EA 3BD3A 1S7XA 4RSVA 3WHE0 1K8IB 2YN5A 1TNMA 4NZRH 3SDAA 1OGAD 4E42B 2R1WA 1SYSB 2MHAA 3BP6B 3GHBL 2BMKA 2JJVA 3BKCL 3I02A 3RIAK 2X9WA 1N7MH 2C3VB 2H2SC 4IRSD 5D2NE 4CAGA 2VRAA 1S9YA 1LO4H 2XG4A 4XVSH 4KXZH 3AM8C 3WBDA 3SGKC 4BZ1H 2I25N 1LO5A 4ZPTB 4YPGA 2CMRL 5ENWB 2ATKA 1X7QA 1TIUA 3MLZL 2PW1B 4D9QD 3V8OA 4HBCL 1U92B 3WXWL 1AXSB 1NL0H 4JFPB 1OAZL 5F9WC 4AQOA 4IJ3C 4GKNA 1R3KB 5FCUH 4JEGB 3VFTB 2WP3T 2IBBA 4NRZB 3MRHA 4PGCB 4Q74A 3MRFB 3P9MB 2X1XR 4UOW1 4K3HA 4KK5D 4N5EA 3EOBA 2IPUG 5D4QA 5EBWA 1H5BC 1IEAA 4FTVD 1P84J 2A83B 1F4WL 4IMKC 4X83A 4M6NL 4JO3L 3RKPA 1OT1A 3OF6D 3FMGL 3G6AA 3EYQD 4L1DA 5CWSB 4ZAKC 1CT8B 4JHWH 1YEIH 5D6DA 1JHTB 2C1OA 3C09C 1PG7W 2IG2L 3OHXB 4LCIH 1N59B 5J1AB 1U8LB 3ILQC 4FFZL 1TVBA 3KPQA 4HDIB 5IK3A 1N2RA 5HSFA 4JKKA 2HJKB 2DLFH 2FJHA 3FTGB 1DN0A 1E0OB 3LRHA 4M8VA 3DV4A 1HHJB 2R0WH 1GGCL 4O58H 3SE4A 4ODWA 1D9KA 3OMZA 2ADJA 4ODXA 1YDPA 4CADB 1T6VN 1C7SA 3HS0A 1B90A 1RZGB 4EXPX 3O6LH 5I16A 4YE4L 3RWHB 1W8OA 1KN4L 3BGMA 3MV8A 1CFTA 1U9KA 1ZANH 1CICC 4RGMC 1R5IA 3AAZA 3IDUA 3FN3A 5C08A 3QWOA 5KSAA 1KGCD 2ZUSA 3O2DH 2DQFA 2QV2A 1NCNA 5KN5A 1K6QH 3LPGA 1SYVA 4JY4B 5CP7A 1WK0A 1X5AA 4GRLD 3BPNB 3QWOB 4FP8L 5KSAB 5IVXB 3D25A 4OJFH 4XBGA 3S35X 4HK3N 5D1ZB 1UWGL 4P59H 1NFDB 1ZHLB 2J8UE 5DTFB 3CVHH 3F6LA 2BHYA 3HUJF 5BZWB 3VXTB 2EH7H 1JPST 4TTGA 3ARGC 2YPLE 4KHXH 5JW3H 4A6YH 2O26U 3IAPA 4YBQC 1ZXQA 3CH1A 5C08D 5C0ND 2FWOA 1ITBB 4N1CA 1BF2A 3E0GA 4WW2F 4OZIF 4U0RB 1AHWC 4GS7B 1N0LA 1FRGL 1SVCP 3K7UA 3BIKA 3U0WH 2A1WL 1HXMB 3VXSA 5AZEH 5EZLA 1S9VB 2ZCHL 4P3DB 2DN7A 1IGCL 5TDOA 1MCWM 3S88H 4ELME 3SGEH 1YEHH 1A7PL 3G6DL 4KPHL 4X98B 3FQNA 5ADOL 4NKMA 1VESA 3SCMD 4JVWA 2EXYC 3OG6B 1QNZH 3ZSTA 4NJ9L 3VXRA 1YA5A 2UUDK 4HQQL 2NW2A 3PGDA 3QDMB 5JUEL 5MHSD 1ZWIB 2FEEI 2LFGA 2C4XA 1P7HL 3FB5B 4WFHD 1OL0A 1GOHA 5F88B 1DBJL 2D0HA 2D4FA 4OIBA 1ZWIA 3ZDXE 1N3NB 3LN5B 3HUJE 5CGTA 2VQTA 1M7IB 1PKOA 4TSAL 4NKOA 5IV2A 3ULVE 4DZ8A 5D93B 3SDXB 4OZIA 1O5DT 1BMGA 4NN7C 4EI6B 3QEUB 3RWEB 3VH8G 4PLJD 2NTFA 1S9YB 3KPPA 1IKFH 4OCXH 3BRGC 1EHLH 3KDMB 2GT9B 1F3JB 5B3JF 4ZSOB 4RRPG 5EOQH 2P42B 3KNBA 3GBMH 1YUHB 2C4FT 4JKPH 4JFFD 4POUB 1GGBH 3LS5H 4ELKB 1KPUB 3EFFA 4N0CD 2V2XA 3IJHA 5EFIA 3NIFE 3IU4H 5DFWH 2X1OA 3P4OA 4I18C 5SWSB 1NCBH 1NEZB 4LLYA 1ZKAA 2ADIA 4H8WH 3H9ZA 4BQBA 2SEBB 1S5HB 3I6KB 5A16A 4K7PL 4QCIA 3GBLA 1JIBA 4YAQB 1J0KA 2Q7NA 3VXTA 5JDSA 2VLKE 4GKZA 5E2VL 3MOQA 1F00I 2OCFD 3VWJC 4OGYH 4F9PC 1FNLA 1TDQA 3FONB 2VC2L 1TQBC 3CSBA 1LO5B 2IAND 5DS8A 4PJ9D 4YK4C 3GKWL 1OTTC 2B1AL 3OX8B 2CXGA 2ZJSH 4NHCL 1NLDH 3GSRB 1A1MA 3FN0L 5CD3A 3S36L 2DI8A 4C4KT 2BNRE 1XGUB 1K8IA 5BRZA 1YY8B 1L7IL 2F54B 3MCKB 5HI5D 4NQCB 4OGAD 5DJ8A 5DC9B 4BKLB 2J6EA 3Q48A 4MYWB 4Z7WA 4J3XA 1JFMA 2J5LC 4HFUH 3S36X 1ZA3A 5FKAB 1AGFB 1T83C 3SQOH 4YFEA 3ZDZF 4X6DA 1AR1C 1FG2A 3QRGL 3TBWB 5BXFB 2VLME 2X4NB 1HNGA 1A9BB 3LKPA 3GHBH 1U8LA 1LILA 3C60A 1KXVC 1O7SA 2AK4B 4N90D 2EO1A 3SDAC 3JWDH 1P84K 3RWCB 4H20L 5HHMB 2IEPA 1EERB 1ORSA 2F54D 5D2NB 4KUZL 3H9HB 4RWHA 2D7OA 1I4FB 1Q0YH 4FQ1L 5F21B 1EEUA 1A5FL 1M6OB 3PQYA 5DRNB 2EECA 3CFBB 1EGJA 2F53B 3CVHL 4HWZB 4YIQA 1HYRC 1X5GA 5D5MA 1D5MB 3VWJB 5KSBA 5EO9B 3D9AL 3T4AB 2YK1H 4LDLB 3QIUA 2A73B 1FC2D 3VDCA 3R1GL 4OZGF 1EXUB 3B4NA 4JO4L 2B8OT 4S1RL 5EOTB 4K3GA 1CDIA 4PTUB 4LSRH 1BM3L 2YZ8A 3OGCA 3IJYB 1B88A 4P5TC 1MCLA 4HFWB 5GZND 1QSFB 1YEJH 1RY7B 5BO1H 3RUGA 4K7FB 4WFFD 3SGJA 4MX7B 4HIHB 5I9QC 4TULL 1A7OH 2HT3C 4JFPA 1NCTA 4PRBA 1YEDB 2P49B 3QHZH 4M61A 1UACH 4XRCA 3WEXA 1FFNA 4O5LL 4RGNC 1EZVY 5C71A 1H8SA 3TT3H 3BYTA 4FFYH 3MRLB 2I9LA 3T04D 4X8XA 3TBVA 1FE8L 4DTGH 3VXNA 3V4PL 1FFRA 5HI3D 5DDHB 4I0PC 4HWZA 4U3XA 1SVZA 4NQEB 5HY9A 4YHML 4TRPH 1UM5H 4RDQG 2X41A 3SDAB 4FQXD 2BCKA 2R29L 3HI5H 1UB6B 1ZE3C 2XA8H 5J9PA 3MUHL 5HHMA 2ZUUA 3K4ZA 2BHZA 2H3NB 4OLYL 3WS3B 3GMQB 5IHBA 2Y06H 1CL7H 4K9EL 4HWBA 5C0AA 5HVFB 4ZUSB 5FO8B 5HVGB 4H0HB 1FZMA 3KJ6L 2DIJA 4MCYA 5I15L 2XPGA 3FOLA 4FQJL 3ULSB 5GRVK 1UVQB 1CG9A 1NCCH 4LLDA 2P8MB 4OZGA 3BIBX 3I6GA 1K6QL 2P7TA 2EDBA 2W1NA 2RQ8A 4MNHB 1YN7B 3BX7C 4XPAH 5GS2H 4PJHE 4UILL 2OLDA 4P59L 1CD1B 4TNWF 3SKJH 4PPTA 3DXAB 3ARVA 1OLZA 5BW7A 1RFDH 3QXWA 4MQ7A 3DUSB 3HE6A 4R4BB 5HHOE 4RGOH 5D2NA 1VERA 2XV6B 4KHXL 4JFDE 3KGRA 5HHOB 1WCQA 3ZE0F 1GCFA 3DROB 1T0PB 5BS0D 1NAKH 1QPPA 32C2A 4Y5XA 3CZFB 1KCSL 1FNAA 4JZJA 2FCBA 1MFDL 3PXHA 3HNTL 3NPZB 4PLKC 4FN0A 4L8BB 2MWCA 3BRDA 4OLWH 3C60C 4W68A 3KXFE 4JFDA 3HC4H 3TN0B 3G04A 4AT6A 1LP9E 1UGNA 1NEUA 3LKQA 3NFPA 3B6SB 2ZJSL 4NHCH 4Z7OE 4GSDL 3BWUC 3K74B 1HQ4A 3MXWL 5IEHB 5BS0B 2Q8AL 5ADOH 3C08L 5DJAA 2NW3B 3SO3C 4G9FB 1F3JA 1IGYA 3GK8H 2X4UB 4PGJA 3CUPB 2XI9A 3AC0A 1MCWW 3PWVB 4NRXB 4F8TA 5C2BL 2IH1A 1FFNB 3B9AA 1CS6A 3PGCB 1RZ7L 3MRJB 4U1JA 1T4KB 3L5XL 1FNEB 2AV1A 4HZLA 4YAQA 5MP6L 1LEGB 4OKVA 3KWWA 4PJ7A 5CIPA 3ARTA 1MI5D 4XNMB 4Y0GA 4Q0XH 2G5BA 4KRNA 4HCRA 3O9WB 1JNLL 3V5KA 2WBWB 1BVLB 1J86A 1I3VA 1C5CL 2WM0A 3PGDB 3GEWB 1DANU 5F1KC 5C0BD 2Z9TA 5H35B 5I1AB 1BQHA 1EV2E 3ZYOA 2YRLA 3R06A 4XP1H 4LK4A 1UH3A 2P8PA 4HLZG 4I3RL 4MD0A 5SWZD 5EH1A 1TZHA 1INDL 4PRAB 1NSNL 3MC0A 3BKYL 4UZGA 3TVMD 1E4KA 4IMLA 1I4FA 5B39G 2VDMH 1IGJA 2HWZL 3AXLA 3QIWC 1A6UL 3BDYH 1WBYB 3RWEA 1HXMA 3VXSB 4N9GB 5J57B 2E9WA 3GMRB 1LO2H 2VLKD 5IBLC 3C60B 1XGQB 4WFGE 3FT2B 5GS2D 1QZ1A 5AG8A 3WS6A 5IQ9A 1INQA 5C0BB 3RL1B 2PYED 3IFLH 2V9RA 4EDWH 1KB9K 1RK1A 1MFNA 5D7IF 3UPCA 3QIWA 2E9BA 2P44B 4NNPH 5D1QA 1P4LB 3MJ9L 4N8CL 5KVDL 3VFPB 1VPOL 5C09B 2K3TA 1C1EL 3UCRA 5F9JB 1OAZH 3RVTC 1NUFA 4P5KB 2F54A 3NFNA 1DE4B 4P3WA 4QRPE 4TSBH 3WSQH 3C60D 3KYOB 2YBRA 2O61B 3T08A 2X4QA 1Y6MR 3OKYA 1WUNT 3KHOA 4DEPC 1QR1B 2CIKB 1CGXA 4N9OB 3LN4A 2EDOA 2PYEB 4UT6H 3RWIB 5K59E 1HCFX 3OX8A 4QRRA 4NZDA 3SHSA 1U8JA 3JBG7 4MMXC 1YYLH 1R3IH 1Q9LB 3MV11 2O5XL 3TYGH 3AU1B 2VXTL 4FZ8L 1CGSH 4PP2A 1AD0A 2SEBA 4P2OB 5TH2B 4MA3A 4TVPE 4Y2DA 4X7TB 4LPCA 1JK8B 1DSFH 4O02H 5LBSL 5EIQA 3EHBD 5SWQB 2GJ6A 1HWHB 3CPLB 2VSDA 4R3SA 2QJDA 4XI5D 3ARFA 4LPVA 3JTSB 3L5JA 1N59A 1BOGB 3IVKB 2EH8H 5IVXA 4X7DC 3ARDD 5A43C 2FHCA 4G8IB 2UY6A 3HZYA 3SEPA 6CGTA 1NQBA 3RWIA 3REVA 2PYEA 4DCQB 5E8OB 1NAMB 4KKLC 4LSPH 1OP3K 2J88L 5I75C 3UTSD 1CF8L 1IRAY 4YQXH 4RWYL 3MYZA 2LQRA 4LKCB 5IG7A 2VXQL 3MROB 2DD8L 1I7RB 4R0LA 5CJOL 3JWOC 1R3HA 2GEEA 1BVLA 4XXCA 5E9DB 3IFPA 3MRGB 5SWZA 2BNUB 2B5IB 2I5YL 3TJHD 3VWJD 4G8GE 4R0LB 5EIIA 2BY2A 4FFYL 4PGZA 1JPTL 3MROA 4JM2B 2EH7L 2HLAB 3ALWA 5IG7B 1J1XL 1TVBB 3FT2A 4ACPA 1FCCA 4YDVB 2APWA 1IC5H 25C8H 2WBJA 2Y5TA 4P23C 5HHXH 1TCRA 5GRJL 3SOBH 2VZ3A 1MI5A 3C6LB 5EWIH 1WWAX 3F7QA 1LO0H 5J13C 2YPKB 4L29B 1U58B 5E9DD 4Z95L 1T22B 4S1DD 2VDPL 1G7JA 4WIQA 5D93C 3STZB 4BFIA 5ITFA 2QQLH 3IETA 2DLIA 4RGNB 1WTGT 2A74B 5K9QG 1MFEH 5EIVA 5D7KE 4V1DE 4JM2D 2VXSH 3QO0A 4G80A 4Z0BH 3MGOB 3SCMA 4FQJH 3V5KB 5D71H 4NQED 5HGBB 3SDAD 4JM2A 5F8QC 1HHGB 1PG7X 3PWPE 3BQUC 1EVUA 3FCTB 1BJ1J 2EDRA 32C2B 5I8CA 5MENE 3O0RH 3QYCA 2DQGH 3DROA 3QBTB 2R69L 5ICZB 2FO1A 4LSQH 2F5BL 4U1HB 1QLEH 2X4TA 4RGND 5JIHA 4BJLA 1MFAH 3BH8A 4A2MA 2VTFA 2L7UA 4G6FD 5JHDA 1WAAA 4J6RL 4YX2H 2XN9D 2AJVL 2GSIA 4J8RA 3TM6A 4F2MA 2BC4B 3LN9A 3FFCA 3QAZC 4JG1H 1CE6A 5MENA 4KAQH 1N5YL 1P7QB 3GJFA 3C5ZA 5DURD 3FQUB 3NFNB 5DJ2A 1UZ6E 4DWHA 3KS0J 4NNPL 3U1SH 2LTQC 4AT6B 5I76B 3L1OH 2PCPA 3IS1X 3F58L 1H3TA 2V5MA 3W11D 1CGTA 2FX7H 4NWUL 3FTGA 3MJ9A 5JR1H 2CLVA 4WEMB 1XF1A 2NXZC 1S9XA 2R23A 2WQRA 2N1KA 1JTTA 1B6UA 1OAXH 3EOTL 3QDGE 1AO7D 4OF6A 1XGQA 3EJZD 4PRIA 3I50H 4A6YB 4O51A 5T1MB 3OKNB 3O2VL 1WITA 4HWBL 5IOPB 2CIIB 1MAMH 5DQ9A 5FDWB 3S34H 4K7PH 5HYJB 5IW6B 3DXAA 4ORZC 2AERT 4AIXA 1L0XA 5EUOA 4LCCB 1Y0LB 3BFOA 4ZFFA 5B8CA 3B9KC 1DN2A 4PJGF 2VZTA 2WQ8A 4I48B 2WUCH 5KVFL 1UM4H 3L3GB 4WFEE 2WANA 4L8DA 4DAGH 1NMCC 3UBXG 5FKPA 2XQYK 1FBIH 3CVHA 2NY1D 4LARL 5EU3A 4JRWA 4U1NA 1ZK9A 3UJTH 1A0QH 4NFCA 3G5YB 1QD0A 3QNZA 3QEGH 3M8OL 1YEKH 2W65B 1I8MB 1NSNH 4BZ2H 3KLHD 5GGRA 2FIRT 4RMTA 4NSKA 1FV1A 3HAEA 4ZD3L 1KJ3L 5J9PB 1A7RH 1MAKA 1RK1B 4B7IA 3EDKA 1HIML 1FVCA 2VL5A 3O6LL 5DJYB 4WJ5B 5MI0B 2F53A 3QB7C 1RIVL 3VXUE 2D7TL 5J1TC 5DJXA 2YSSB 5C3TA 1KULA 1K3ZA 4HEME 4EDWL 1RAMA 1IILE 2VISA 1FV1B 2JKXA 1A7NL 3OJVC 3NCCB 2O5ZH 1S7VB 4HIXL 3X12B 2PUQT 4J3VA 4K9EC 3TBWA 1C1EH 2DTML 2V9TA 3BH9B 1HOCA 3BJLA 1U3HC 1MHCB 4NBYB 3TNNB 2ESVD 1EEQA 2YK1L 5I17B 2E9IA 2D7PA 5ISZA 3N1PC 4WFED 1EHAA 5FUCC 1T1ZA 3TH3T 1UWEL 4DGIH 3CDCA 4L8DB 5T5FH 5IB1A 4OCWH 4RAUB 4R4BA 4ZYKB 1RMFL 1FFPA 4V1DB 4D0BB 3V6FA 4X7EC 3VD5A 1NMCB 5LXGH 1DQJA 5L6YH 3K3QA 5H2BA 5C0RH 3C5SA 2JJTA 3PWJA 3VD4A 5AZEL 1OGAE 3SE8H 4BK4A 4TUKL 1ORSB 4K8RC 5FHAH 1EBAA 5GGVL 5BRZD 4EN3D 1NC4A 3PL6B 1MCCA 4KY1H 5T1MA 1WC7B 1KSRA 4Q6IB 1EEZB 5HYQB 4IOIA 4DEPB 3RVWD 1FZMB 2MQ0A 3GB7A 4JZNB 5GGRB 4NOBA 4HGWA 1JPSH 3U2SB 1Q94B 5GZNC 2AV7B 3IFOA 4NC2B 4LSUL 3ZT6A 3ECBB 3QDME 5T3ZL 5KSAC 2E7MA 5HYQA 3ARGB 2IWGA 3B3IB 2Z8VC 4AY0A 2B0SH 2VXVH 1NC2A 5HHOA 1NFKA 1T7XA 4JN1L 4UDUB 3VG9B 5IW3A 1X5JA 3LRSA 3T0VA 3DVNB 3T65A 2QL1A 4G6AC 4YEFA 3EW3B 1J5OL 2NY2D 4OB5H 5JDJA 3T8XB 1HYSC 2WNGA 5B21A 2VAAA 2Z92A 4NCDA 4GKZB 4JY5H 2ZSWB 1TTGA 1B0GA 2JJSA 5FDWA 2OL3A 3GHEL 1PX3A 3I6GB 5IJKA 2IPKB 3VRJA 3Q6GH 5I73B 1MHHA 2W0FB 4JQXC 6FABL 4JPIA 1JZ5A 5HI4D 4NQDE 4PTUA 3SKOA 4YGAB 4ONGL 3WJJA 4PJ8C 3MGOA 3RVVC 5TE6L 4FABH 3HE6D 5EWIL 2YC1A 4UAOC 1F11B 1HSBA 5FO8A 1NGQL 3MOBH 3B5HA 5FYJL 3WHE1 3O4OC 4N1EA 5IR1A 5KSBB 3VWJA 2ID5A 3STLA 4DGVH 2J8UB 2VLLB 3T3PF 4ZSOA 5FA4A 4LVNB 1NC4B 1DDHA 1JMZA 1XF5B 3MBEC 1I1AB 5F7WC 5HVHC 5DHVH 1JVKA 4U33A 1PLGL 5FGCE 5T1KA 4NCC2 4JQIL 5IESL 5JW4N 4I9WD 5ADPL 4M6OL 4AMKH 2ZSVB 4NQEA 1AKJB 4OCSH 5DJYA 4NC1C 4WFGD 1N26A 2E7LA 3WFHA 1I9JH 1JRHL 4MS8C 4QRPB 1F4YH 4PB9H 1R5WA 3U46B 2HFEB 5M95B 5FO7A 1YEKL 1CWVA 1LDPL 5DMKA 1R3HB 4LSSH 5CIPH 1HIMH 4J6RH 4YX2L 4XPFL 4OGXH 1X5LA 1I9RL 2BFVL 5I17A 1TQCB 5F7EL 4JJHA 4WENB 5JOFA 5CGYD 5C0BE 3UBXB 1CLYH 5LKNA 4K2UL 3Q1SL 1GIGH 2HT4D 5FA3B 1BFVL 2Y7QB 4UBDC 1XGYL 5C6WH 2MJWA 1IVLA 4RRPA 4P46A 4WWKB 5GQBA 3IU3A 3GFUA 2FECL 3SE9H 3CDFA 1AC0A 4X5WA 5D70H 3VGDA 4X4YB 2XTJB 4UINL 1ES0A 3ZTJH 4EOWH 4C58B 2UZYB 3EYUH 3MLRH 4UAOB 1F3RB 4HW6A 4QCIB 3MRRB 5HGAA 4KJPD 1XZ0B 3HI1A 4F37F 4M9OA 3B5TA 4Y1AB 3MYJB 4KUCF 2W65A 3I50L 2X4SB 1UQSB 3D5OF 2D9CA 2FECI 3DURA 3K1DA 3MX0A 3QCVL 4NP4L 1MRCH 5CUSH 3ARDC 3RZCC 4B7LA 4DFIA 4NHUB 3D2UD 4OGZA 4C56B 3S97C 1QBBA 5D1ZA 5JORA 3QCTH 3NAAH 3WHXA 3ZKNC 3GIVA 3VFWB 3TWCL 3RY6C 5BV7B 4NQEE 4PYGA 1DJSA 4C55A 4LLUB 1NBYB 1GC1C 1A9EA 4YUEL 3HE7A 3TPUA 4UBDD 4HC1A 5HGDA 3ARQA 2ZUTA 1RHHA 3F62A 1JGLH 3OAUH 2ENYA 4AEEA 5IB4B 2VAJA 4DKFH 2R29H 3L3JA 3KS0H 2ZG3A 3WFEL 5DR5L 1P9MC 2A6DA 3OR7A 1YYLL 4PJAF 3BO8B 2H32H 4FFWD 3ARFB 5E99L 4UNVA 2OMNA 3BIAX 3SKUD 3IDIA 3ZL4H 1X5YA 4QRRD 2YD6A 5C0BA 3DI3B 1JNHA 1QBAA 4I3GA 3VW3L 3MLTA 2DQTL 4LCUA 1U8MB 3T0XA 1FORL 2A9MH 3A6BH 2QQNH 3FQWA 3RVTD 4CMHC 1NMBL 2PYEE 1NBZA 4MAUL 1FN4B 1BJ1H 1SHMA 1CZ8H 4H5SA 1G7LA 3D18B 3NCBB 3V6OC 1JTOA 1YY9D 3PIQA 3U4AA 1N5AB 4OZHE 4X5WB 4X4YA 3GSNH 3MLSH 3FQXA 4QTHB 4EZMA 4H0IA 5DD0L 4QRRB 4E0RA 3UTTA 3TH2T 2FO4A 3CX2A 2YXFA 5EO0A 2ICEB 3QZWA 2X4QB 3GDBA 4MVBC 1XEDA 4ONOA 3VFRB 4NN6C 3EJJX 2A6IA 2H9GA 3WE6B 5F96L 1DL7H 2CKBH 5D5MF 2B1HH 4ZS7H 2DM3A 1AR1D 2OK0L 1R0AL 4R96B 4M3JA 5DUML 1KB5A 4Y89A 4ZAKA 1NH6A 3BN9D 3P11L 4OLUL 3HE7C 5IB2B 3WUWG 3LEXA 5L88L 4K7PY 1TETH 3UXFA 2A6DB 3EDJA 4N8VG 2W0KA 1G9MC 2VXUH 1UZ6F 4QRPA 2VDNH 5HDBF 3JZ7A 3TBTB 2WLZA 5D72H 4Y16C 1EFXD 1IGYB 3WNNA 1QBLL 2UWEF 4HKJB 3HA0A 3STZA 4OI8A 1VEMA 5FGSA 3UTZA 3ARSA 1JRHH 2F15A 4WNQB 2J8UF 4PJ5D 1P9MA 3W11C 3D39A 4G8IA 1CXIA 3A67H 4ODBD 3IVKA 1KCUL 4JRXA 5E4EC 3CFDA 3VGBA 2R2EA 5DVNA 1MQ8A 3LPFA 4YJZL 3F7YA 3WIIL 3PE9A 1F11A 1HSBB 2CLZB 2E6QA 1DBBL 4R3SB 4YHZL 3IDMB 4Y8DC 3NBNA 1UKQA 3BDBA 2OYPA 4QGTA 2XG5A 1HKLH 4YZFE 4YR6A 4Y2DB 4DKDC 1K2DA 1NAML 3DSNA 1CGVA 1BFVH 1GGIL 1MHHB 4XVSL 3SGEI 1G6RA 5DYOA 5D8JH 2OL3B 1T03L 2FEEL 3ARBB 3ARDA 3MZGB 4JPVL 5C8JA 4PJGE 4MA7H 3S4SB 1IARB 5I74B 4JFDD 3RNKA 4Z7VB 1KGCE 1FLTX 4NRXA 2A2QT 4PJHA 2BSTB 2IBZX 2MPAH 1NAMA 1U8JB 4G5ZL 3CUPA 3HNSL 2RCSH 4LLDB 4YHLL 2E7BA 4P2OC 1PEZA 2C26A 3D1MC 4L5FH 3SDXE 5INCB 4BH8A 4F7PA 4Y2DD 3KPSD 3VI4E 3FFDB 1ZGLB 4NZUH 3HUJB 1TJGH 4GS7C 1JI1A 2V2TA 1R3KA 3UZQA 1OP3H 1E4XH 1LO4L 1AI1H 2P5WA 1KJ2A 3S3JA 1OD7A 1CFNA 1NDMA 3JVGC 1HE7A 4GRWB 5LGHH 3GMQA 5TDPA 2V5RA 4DVRL 3MMEA 1BD2D 2A6KA 1LGVA 1R5WB 4HAFA 3BQUA 4KVCH 3RL1A 3RGHA 1JGVL 1ZV5A 1PW3A 2P5WE 5F1SA 3HFML 1Z9OA 2XWTA 4X7FC 3VJ6A 2DQCL 2EC9T 3R8QA 1IAIM 5J89A 1UH2A 2B7DT 3HE6B 2VE6B 4MD4B 5B38A 2A0LC 5H2BB 3DGGA 1VADA 1XH3A 3S34L 3DSFL 4LHJB 5CSBA 1PBYA 4JY6B 4R0LC 4JG0L 2HG5A 3MLXH 3BPLB 5JOFB 3FRPG 3QDJA 4XPFH 2VXTH 1SBBA 3QUXD 1YJDH 2AXFB 2WBJC 4P23A 3SDDC 1HZHH 3QIBC 5GPRA 5BVJA 2QADB 4MAUH 5FO7B 2W0FA 2P5EB 2NY0C 2DQDL 1PZUB 4PRPE 3VFTA 5GGRY 3G5VA 1FO0B 3N50A 1TPXC 4U05A 2Y9RT 2NY5H 1FNEA 3WNPA 1INEL 4LQ1A 3QWRD 1BD2A 4NO0B 2FBJH 4Z6AT 3IJSA 5BJTB 1AKJA 1WAAE 3BE1H 1M6OA 3PQYB 1A1OB 4XC1L 4YPGB 1JPFA 3AREC 3ARZA 5DJ0A 3X3GH 2DRUA 4R9HA 5CZXC 1KTDA 4XCEB 1AR2A 3HLAB 4WUKL 3P30H 1X6NA 3JV4A 4LSRL 5EU7C 5F96H 5E08L 3VXNB 2XNAB 4HHAA 3O4LB 3BEVB 3OKLA 7FABH 4APQA 4N0YH 4MGXA 3QIUD 1OW0C 3NPSB 3NCYP 1I1RA 5LVEA 3P4NA 3HN3A 1MFBL 4MB5A 3KLAB 4JPIB 4JZNA 1SY6A 5I6XC 3JXAA 3LY6A 3O4LA 4OBSA 3DBXB 1PSKH 2IFFH 1A8JH 1ND0B 4TOYH 3H42L 3RX7A 1IFHL 1QSVA 1PX4A 4Q2ZA 3O4LD 1Q72L 4HMEA 2HMIC 4I48A 4F58L 2Q7YB 3TYFA 4KZDH 1JPFB 4Z7NE 3MCLH 3QH3A 3EAKA 4D9LL 4AEFA 4RIRA 4WHYH 3KYMA 3B3IA 1OQXA 5JOEA 3EO0A 3UJIL 1J8KA 1IAKA 3HC3L 4NDMA 1F58H 5LG1A 5K9KA 1F3DH 3RX8A 2QKIB 1XR9B 4EI5A 4KTEL 4PJ8D 2ZCHH 1DQLL 2P5EA 2B2XL 3NZ8B 4WV1C 5T1DL 3KPRB 3W81A 4HKZB 4YHOH 1F2XK 3TFKD 5F7DB 2FGWH 3BKMH 4NQSB 4I0PA 4KKCD 1NCCL 2ARJB 4CUCA 3MGAA 3TZVC 3O2DA 1B0WA 4X4MA 4ZFGL 5E4IA 2P8LB 4C83B 5BV7H 1KENL 4JZJB 4JY6A 4JFEA 3WIHL 2NY6C 5FKAA 2QR0A 3S3PA 3OG4B 2UV3A 4Q6IA 4HULB 5C0CA 1DR9A 1UYWL 1Y6KR 3L3KA 2B5IC 4B5EA 5AZ2L 2RCSL 4MD4A 3H0TB 1BBJA 3OXRA 3D39B 1SM3H 5T5NF 1C5DA 3DVIA 4I9WE 4TUJA 1D3CA 5C0FB 5MENB 4JDZA 1T0MB 4QF1A 5C07B 2X1WL 3S7GA 3LMJH 2JK5B 5A2KH 3TBVB 4KAQL 5I6XB 3RZCB 5C6PB 4PJGB 5F3HA 1YQVH 5A2IH 3P11H 1I8MA 4X9HA 4XBEH 1U8QB 3PNWB 4LGSB 1LHZA 1FVEB 2YD2A 1QBML 4BZYA 2HKFH 2XKSA 1HHGA 4FQQA 5E7BA 1AXTH 2EE3A 5C07D 3OKOB 5A3IC 1MIEH 1D6EA 2ADIB 4EVNB 5T3XD 2EDQA 1CBVL 3P4OB 5SWSA 1FGNH 4OD1H 3UTQA 2K7PA 2BCKB 3MRDB 4QTHA 3D39E 2VDQL 2VLJD 1GZPB 1J0HA 1CLOL 3SKMA 3TA3B 3ZDXF 3VXME 3ARRA 5DDHA 1CXEA 2FJFB 3KPPB 3DGCR 1EAJA 1QA9A 4BELD 4ODVL 3MRLA 5DQ9B 5DI8A 5FGBA 1TCRB 5EORL 2Z91B 1HZHL 2B1AH 2P47B 3VXMD 5HYFA 2NY6B 5J8OA 1RD6A 3TCXA 4LP4A 3U4EB 2R15A 1NDMB 5ERWA 4RMQA 3RTQD 3RVWC 3O81A 3IDMA 5LQBL 1MUJB 4IHOB 3EFDL 2FNBA 5JIIA 4WTXA 3GSOA 4I13B 3DYOA 5LCVH 5DTFA 2D7QA 3BVNB 3LHPL 3CVHB 3QP3A 2LE9A 1CFVL 1PQZB 1OPGL 1KN2L 5JW5B 3S9DB 4PBVC 5EN2A 1B3JA 2EKJA 4HFUL 1TTFA 2LABA 4MZ2A 1HHIB 5DJ8B 5H37G 4BKLA 3FL7A 3E3QA 5HHPB 1J10A 1RIHL 3MJ8A 4JN2B 3VXRB 1G7IB 3MFFB 3R1GH 5JW4R 4KRMB 5IFHH 4Q6IC 4Y4KB 3AROA 3O41A 4YIQB 3QEQE 4LLUA 3H9SD 2NY3B 3IDXL 2EZ0C 1OM3L 4DN3H 5BO1L 1S78D 3MODL 3T0BA 1YEGL 1OAQL 4MJ4A 1TLKA 1A02N 4CADA 4WW2C 3UMTA 1Q0YL 4FQ1H 5IOPA 5JMOC 3SE3C 4NWTL 1TCMA 2UZIL 12E8H 2Q76B 4OCYH 3ULUE 3DPBA 3AY4A 5DQDL 1QSFE 5DRWA 4IRSB 2ATPA 1MCOH 4WW1A 3SDYL 3F7YB 5KTEH 3MXVH 3GSVB 1DLHA 4P2QE 3NCJH 1WWWX 4L3EA 2MQCA 1YY9C 1NKRA 4NQTA 2BVTA 2W91A 3WN5C 5C0JA 3C09B 1TZGH 4DOHE 2IAMC 8CGTA 4OV5B 5CHNA 4AH2A 5JHDD 4AG4L 1KPUA 5DFVC 3IS0X 1R3IL 3M17A 2EIBA 3BKJH 1G9NL 4GAJL 4BFIB 3RWGB 1FQ9C 2D31B 1BZ9A 3W9DB 5CD3B 3WD5H 2FH8A 4XWGL 1Q9LA 1J1PH 2Z0BA 2F74A 3HB3D 1G7LB 3D18A 2EEAA 3EYOA 4U1LA 4UT9H 1FDLH 1P4BL 3QIWD 3V7MA 4P5TA 5FM5O 1FN4A 4ZDHA 2EIEA 5ACLA 1LK3L 4MB3A 1DSFL 4QXGH 3GIZH 4GRWH 3HAEG 4YXLH 4OFKA 4NQDD 4P5KA 1U36A 4P0DA 3VGFA 4Y4FD 3O8XA 4LSVH 3DV6B 1NGPL 1TXKA 4OSUL 1JNNL 3WYRA 3NN8A 1UYWH 4LMQI 5DR5H 1XIWA 1NANI 5GRUH 2OR9L 4G7YL 1JPSL 3RZCA 5M94B 5IF0A 2VERN 1IC7L 1B4JL 4W6YB 4LSPL 4ELKA 5C08E 3ULVC 1FIGH 1I3GH 5C3LD 3SGDI 3CVIH 1IGIL 4PJXA 3VH8A 4MCZA 2GT9A 7FABL 1JZ7A 3HNTH 2F58H 4YDIL 3VFWA 2NTFB 4PJXB 3CFCH 3MV9E 4OLWL 3WHXB 2AXGA 4XNXH 3QAZB 5ALBH 5DRXA 2DBJA 4R8WH 5TQ2H 3EJYD 5DLMH 1RURH 2HTKD 4GW1B 4UIKL 4J4PC 1HINL 6FABH 2KQMA 3S98A 4OZFH 3HMWL 1AH1A 3RDTB 1XZ0A 4QRQA 3QPQC 4OUUA 3L3JB 2CKBL 3AU1A 3MBXL 1T4KA 5DZOA 1T1WA 4MJIA 5BS0E 1CLOH 5AWNH 1ES0B 1GZQB 1JPGB 1WWCA 3GBNH 5D2LB 4YH6A 4NKMB 3BPLC 5JXAL 2ZCLH 2XRAL 3PP3K 1TETL 3WIHA 2FB4L 4OLZL 5L8JB 1XAUA 5DEGB 1QO3A 4GXUN 5HDBE 4PJIE 4QXUL 4P2QB 1PLGH 4GSDH 1HHKB 5L2JB 1TJHH 2YBRB 4KZEL 3BIKB 2V17L 3BESR 5BS0A 4KGJA 3RDTD 1FO0L 5FGRA 1TVHB 4CVXA 1EAPB 2FX8L 1S7XB 2GITA 5B38G 2WBKA 4EDXB 3B6SA 4CU8A 2UWEA 5J13B 4XP1L 4F57L 1U91B 4CVUA 2FWOB 1NFIB 2PTUA 3CH1B 1A14L 4X5XA 1J87A 3M1BB 2C1PB 4ZNEE 5I66A 4P2OA 5DRZB 3P9WB 3STBA 2WUBL 3ZKMD 1OSZB 5MEPB 2HJKA 3TEUA 1WT5A 3FO9A 5DVMA 4EUPG 2G2RA 5IFHL 3FFCE 1T0NB 2EYTB 4X6FB 5KSAD 2PETA 1ZLWH 4HDIA 2AW2A 3PDGA 2CKBA 5J1AA 4G8EA 3NCEB 5E2UH 5HVWA 1OM3H 4DN3L 4NFBA 4LNRA 3QJFB 4QYOB 1JN6A 3QQNA 5CP7B 4LRNL 4HPOH 1QKZL 2AJ3B 1DDHB 2CMRH 5GRWA 3TZVB 1A64A 4KI1A 4MJ2A 5FO9A 5C0AD 5FA3A 4XP5L 5CWSA 3MUZ1 3QUZB 3MJ9H 4I5BB 4LLQA 4N8CH 4U2ZA 3DHJA 2R1XA 3A0OA 3BGMB 3MV8B 1BQHB 4U2YA 1ZT1A 3CX5J 3CSGA 1MHPH 1VEOA 1A6VL 1LVEA 2MPAL 3SDYH 4TSBL 2ZPKH 2VWEC 4YHLH 3DLQR 4HPYL 1E4KC 5EN2B 5C09A 1WF5A 2H32B 1QEWB 3OXSB 1AD9A 4UTBH 4LVNC 5D7JB 2VLRA 2OS7A 4LVHB 3D69A 4WDIA 1QPXA 3KWWB 1LEGA 4OKVB 1KJ2H 4PJCF 3UYRH 2RGSA 3TZVD 2KL6A 2ZSWA 3BKJL 3IFLL 3BQUD 4UOJA 4ZTOL 2R56H 5I1KL 2CK2A 5ISZE 5KVEH 4G8FB 1XH3B 5LGHL 5F6IC 3QWRA 4PJ5E 2AJXL 3PWVA 2Z31C 1ZS8A 2QADC 4D94A 4Y5YC 4ODHH 2VLRE 2J6EL 3BP7A 5KVFH 5CEYA 4NPYA 1KEMH 4DTGL 3GUTA 1TZHB 3WSQL 4PJEA 1BQLL 3PWUB 2OL3L 4RAVA 4Z7NF 4E42A 3RGVD 2MOVA 3VMNA 1RJLA 3UTQB 1BIIB 1OLLA 3BQUB 1NGPH 3QDJD 5TE4H 2ARJA 4JZJC 4PJ9B 4M7KH 4JFHD 2CDFB 1T1YB 5FYKH 4PRPA 4KDWA 4HUVA 3ESUF 2G5BB 4CU7A 3HMXL 2IPKA 4GBXC 1G6RH 5IVOA 4GKNB 2J88H 5F1OB 4WI4A 2D0FA 3QEQB 4ZFZB 4PG9A 1KEGH 4O02L 5DJ6A 4O2CA 5LBSH 1KELH 2H1PL 3LRSB 1FZOA 4FP8H 4XNXL 1CD1A 5DJAB 1CLZL 2HJLA 1T7VA 5KZCB 1U2HA 2DTMH 3SJVA 3ECBA 3E6FB 3VI3E 3L95B 1XF2A 4PR5B 5D6CA 5I9QB 3BW9B 3N9GL 4HXAL 4F33B 2BJMH 4MXVF 4X7SH 3NA9L 1P2CA 1EK3A 4M48L 1B4RA 2UYLA 5I8EA 5ITBL 4L8BA 3SDCB 1DL7L 4ZS7L 3FRUA 1H3VA 5IMKA 2IQ9L 4QHKI 2G9HA 3WFCH 2VDPH 2RBLA 3ZKND 3SDDA 2AJUL 3HC4L 1GYAA 1QYGH 2I5YH 5ELIA 4QXUH 1A7QL 2IAMA 5DQJB 5AAWA 4P5MA 4GQPH 2C7UA 4K7PX 1CGYA 4PY7B 2X42A 3Q3GB 3TJEH 4XZUA 3MXWH 3KYMB 4LU5L 1FFOA 4QXGL 3V6FB 3HC0B 4WGWB 1CDGA 1HI6A 1KIPB 4IRJC 5DJ6B 3BH8B 5JHDB 2AXJA 3IAGC 1JWSB 1B0RA 3L3IA 4PJ7F 2OJEB 4F15B 4M4RA 1EJOL 4W4OC 5A16B 1GRWA 4I0CC 1HCVA 4U31A 2BNQB 2DM4A 5F9AC</