4L8DA

Crystal structure of the h2db in complex with the np-n5d peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 74
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8dA01
4KKBD 3OR7B 4OZFA 1BF2A 4JKWA 4WO4A 3DETD 4DKAA 2X4RB 1YEHL 4U6XA 2C7UB 2RCSL 3KXFE 4PRBA 5CS7A 4LRNH 4Q97A 2PNDA 2EDYA 1U3HD 4EN3D 4HLZG 1VA9A 4RDQF 5E5RB 4KKAD 4NYLB 1SJEB 1K2DA 1N59A 4UDTB 1XCQA 1VPOH 5HYFA 3D1MC 1K4CB 3SOBL 4KKCC 5D7KE 2YZ1A 3TWCL 1QLFB 3MOBH 3OXRB 2BJMH 3M17A 3TBVB 3JV6B 3MUZ1 2RCSH 1DQQA 3C09B 1C5CL 4PRDB 3W5NA 4PRHB 1YQVH 2ADFH 3QI9C 4MAUL 4S1SL 4HAFA 3SKMB 3PHQA 3RGVC 1GRWA 3QUZB 5J1SC 1CXHA 1YC7A 4WO4B 5DMIL 4PJIE 1DBKH 1BZQK 1QRNB 4HIIA 4NUJB 1JWMA 3EYOA 4LLMB 4KHTL 5DJCA 3AREA 3L5XH 3SOBH 3EOYG 1CFQA 5D1ZD 1KLGA 3O9WC 1BMGA 4LIQH 3FFCE 3VG9C 4OZ4A 3AY4C 5JW3L 2HLAA 1LO2H 3CSBA 3DHMA 1IAIM 3QDGA 4K7FA 1HHGB 1LEGA 4TNVF 4NWTL 2VXTL 5AYUH 4U0RC 3O41B 3UP1A 3WLWC 3ELAT 2O5XH 2A1WL 1ZEAL 4PJ5B 5JR1L 2H2SC 4MNHA 2ATPA 3FFDA 2C26A 4HBCL 1QLRB 5F97E 1A1NB 4UDTA 5IP4A 3NPSC 2EE3A 4IIQA 5IB3B 2DMKA 5F9OL 2I9TA 2GSIA 5GS0C 1FVCB 4GS7C 3LN4B 3EO1A 2O61A 4KK8C 1ND0B 1ORQB 2AK4D 1O7SA 1WGOA 4XH2B 3ES6B 4XXDA 1J1OL 3KGRA 3IGAA 3C8HA 4YPJA 5B8CC 3L3IB 1RAMA 4KTYA 3U4BH 4UV4L 4RFOL 3SKUD 1CL7I 1C7SA 5AAWA 1KN2H 1H3UA 3CXHK 5SX4I 3TBWA 4RX4A 2KQMA 1W0YT 2YN5A 3DSFH 4JQIH 4NRXB 4X4ZA 2R69L 5D72L 3EYFA 5DRZB 4IOIA 4JFEB 4RNRB 4M1DH 2CXGA 3KS0J 1FRGL 1CDJA 5KAQF 4JAMB 4PREB 4UV7L 4Z7WE 1OCWL 4PRIE 3DO7A 1U58A 5T33H 4YDKH 2R2CA 4QTIH 5BOZG 3MFGB 5I66A 2OCFD 3H9YA 1HHHA 1JPFB 3D2UD 1WT5C 5K9KA 4JB9H 5T1KA 2EDLA 4LVHC 5F7WC 3RWEB 1LQSR 5DVOA 5BRZE 4YDLB 2BNQE 1IL1B 1U8LA 4XCNB 2P48B 1PG7L 4AY0A 4XNMB 4JG1H 5T3ZH 2XY2A 1M71B 4WEUD 4D9RD 3HMXH 5DHVH 1D9KC 2Y5TA 3DMMA 3OAYK 4MNQE 4OZHE 3V5KB 4K9EH 5HJ3A 5B4MC 2Q76A 4YH6A 5JW5B 2MHAB 1FAIH 3SCMC 1QR4A 1M6OA 4JM2F 3K2UL 2QQLH 3ECBA 4ZAKA 3MRFB 1A6AB 2AEPH 5DJZB 4PJHF 2MMXA 2PTUA 4C58B 4NFBA 4PRIB 4NFCA 5DQJA 1K85A 4PG2A 1KPRB 4OCXL 1NCBL 3P4MB 4F7EB 1UWGH 4HFUH 1I7UA 1NL0H 4P49A 2KL6A 4JRXE 1J05A 1PGRB 3NA9L 3MNWA 3X12A 5EOQL 5CGMA 1KIRA 5B39B 4J12A 3K4AA 4JRYD 2NY1B 4Z78A 2JELL 2PYEA 2V17L 4JO2L 3S37X 2P7TA 5KTEH 1UQSA 4LAJH 3OJ2C 1F11A 4HDIA 4UMGA 5E03A 4LHUG 1LNUB 4ZPTB 1MCQA 1P6FA 3NIDE 3SE4C 2IALB 1FO0H 3D3VA 3TESA 1CICD 3TBSB 4H88H 2XTJE 1CIUA 4Q58C 3ZKNC 2G9HB 3C6LB 5DEFB 5EO1B 5F96L 5F9AC 5ELIA 4YEFA 1QBLL 3QDJE 2CMRL 1AGCA 2A73B 4JZJA 5C0BB 3L9RA 1I8KB 1RZIA 4D0DA 2V5YA 3W2DL 1BZ7A 1QP1A 4P4RB 5C07E 3VFRB 4BQ6A 2AK1L 4WFED 4I3RH 1NSNL 3ZT5A 4KV5E 1HDMA 4CKVX 4UNTA 3QIUA 1T89C 2BVPA 2ED8A 2L7UA 3CLEL 4R7NA 3MXWH 1JZ2A 3BIKA 2ZNWA 4M1GH 3MRQB 2Q8BH 3QUML 2VDOH 3S35L 1CDHA 1A6TB 3VGAC 4PRHA 4IDJH 2XRAL 1BQUA 1PLGH 1YEDA 3LQAL 1I9JH 4ZFOL 2CRMA 4JO3H 5I1DB 2JLLA 1HINH 1AGBB 4YO0A 4PB9H 3EOAA 4MMZC 4HT1H 1GZPB 4PGEB 3HA0A 3HE6A 4KMTL 3VDCA 2DDQL 1PZUB 5EZOL 2CLVB 2DOCA 5BZDB 4KRMB 5LAXA 3WN5B 1R5WB 4NT6A 5FKPA 5TFSL 5BS0A 3HAEG 3WXWL 1M7DA 3O8XD 4P23D 4OFYA 1MWAH 2EYRA 1OSPL 2OTWA 2NY1C 3HAEH 1AGDA 1UB6B 4R4NC 3MOAH 4PRBB 5GZND 1MCIA 1T1WA 3C5SB 4ENED 2ZUWA 1A6VH 1IGCH 3CK0L 3REVA 3EDFA 4QOKD 4LSSL 4S1SH 5I1IL 5JMOC 1EGJA 3K7UA 3VDAA 1U41A 5IW1B 4BK5A 5IVZA 1WZMA 3REVB 4YHKH 1BFVL 1G7IB 1IAOB 5ACMA 4XCYA 4G59A 1JP5A 1DR9A 1Q9KA 4B5EA 2XG5A 4NZTH 1DVFA 1U6AL 3ZL4L 3GBNH 3CFDA 5DLMH 4J8RB 1XIWB 1L6XA 1R3LA 1CICB 3GHEH 2ARJA 2FD6L 1T6WA 2GW5A 4PJFA 2PW1A 4Y19B 2FB4L 4LRIA 5LXGL 3KPOB 3D0VA 2VDMH 4QHMB 1CFBA 3B6SA 2VUYA 5I1DA 2Y25A 4O2FA 5C6TH 5B38G 4JVPA 5LCVH 3U36A 4DZBA 1J1OH 1NGPH 4EEEA 1IM9D 4Q6IC 4FTVB 5J11C 5FUCC 5SWZB 1L0YA 5DD0H 1JNNH 3KS0H 2HKFH 4NKDB 5DK0A 3MRKB 3MLZH 5DYOA 5I1JH 1UM4L 4JE4B 4NQCE 3V52L 1DBJL 3EGSA 2HJLB 2O5YH 2COQA 3S34L 2NY3C 2EDQA 4XVTL 3O6KL 1CLCA 1SY6L 2LAAA 4Z8FH 5T5FL 4G8GA 4NNYB 1F6LL 4HKZB 2B7DT 5JMRA 1K3ZA 3HG1B 4XBPB 2FHCA 4P57B 4PGJA 5HHME 1JGVL 2XN9D 4J3VA 3PV6A 1QLEH 3D0LB 3UJIH 1F6AB 3IAGC 1VGEL 3GSRA 1OP5H 4PTUB 4WFGD 4PFEA 1INQB 3I50H 4GG6E 5EBLA 1Q0XH 4LQFL 3RVXC 5T3ZE 2OK0L 1SJHA 4M8VA 4POZD 3ARDA 1ZHNA 4N0CA 2IPKA 4MCZA 2J88H 4LSTH 4PJ8C 5CZVL 4FRWA 1MCEA 5F6IB 4MD4A 4JN1L 5HGDB 4WNQB 5D2LE 3N1MC 5ERWB 4N5EC 1XAUA 3RPIA 35C8L 2H2PD 5ICYB 1CGTA 1VFAB 4DJMA 2W91A 4ODWB 5BV7H 3LKSB 2YPVL 4LARH 3UTSA 1WF5A 4OGXH 1R6VA 5BO1L 4AEIH 3AMKA 3PQYE 1H5BA 3MBED 1LE5B 4WFHE 3Q5TA 1MJUH 1Q9OA 4L29A 4A6YH 3OKDA 5E1AB 4IRSD 4M6NL 1G7JB 2ZJSH 2OP4L 2X1XR 4X6CB 1XF1A 3ES6A 4WUUE 3C5SA 2R2EA 4X80L 4JJ5A 1S9WB 4U1JA 1OY3B 4P4KA 2FWOB 4ZD3H 3HKFA 1J0YA 2Z8RA 3BPNC 1KJMA 5IMOB 1MFNA 3J7HA 3T0EA 5IB3A 5LAXB 5I1KH 3HNVH 2J8OA 2Z31C 3KJ4B 5EOQH 5J6HA 3O3DA 3FRUB 1FGVH 5EZJB 1AGFB 1RK1A 4BSVB 1N5AA 3QEUA 3WHE1 1DQDL 5L7XH 4XI5D 3MRRA 3KPRA 4HCRA 1LE9A 4G6KH 3LMJL 4PS4H 2W65B 2ZPKL 5CEZL 3UCRA 4R96A 5ALCH 4OZ4B 3STZB 1A4KA 2APWA 1A3RH 3QDJA 2XZZA 2D03L 4JQXC 5SV3A 4R4ND 1JWMB 1IGIH 3EYOB 2I60H 1N3NA 4JFFA 4LLMA 5KS9E 3CFEB 4OCRL 2WMPA 1MJ8H 3FOLB 1GIGL 5MEPB 2Q8AL 2ZP0T 3CVHB 2IANA 3QNYB 2M2DA 5DRWB 5CEZH 2HTLD 4GMTL 3KPNB 5JW4N 3SGJC 3CZFB 3DO3A 4R90H 5KG9B 2BC4B 5C7XH 3SHSA 5E4IA 1YUHA 3BQUC 1DTUA 2ED9A 3QB7C 4NKQB 1I7ZB 1MJ7L 3L3HB 4M4RA 2F54E 1A7QL 2W9EL 1NMBH 1VGKB 3FT3A 3N1QC 1DP0A 2C4FT 3EFDH 4LIQL 5IQ7H 3MV9A 3UBXB 4K71B 4PG2C 1HYRC 4LSUH 2MQ3A 5J12B 4JKMA 1QBBA 3C60A 1RZKL 1F2XK 5BZWA 1YEIL 3MRHB 3I9GL 1JPGA 3MJ8A 1A7QH 4K94C 2FYYB 3N06B 5DQJB 1M7IA 2R0LL 5E8OB 3M07A 1FO0B 2AAVA 2EZ0D 4KK6D 5HHPB 4NQDB 4LLDA 1IAMA 3MO1B 1YQ2A 3VWKB 5HXMA 1BQSA 3WKMH 1CT8B 4HG4K 4ZAKB 4AT6B 2ERJB 1II4E 1VEPA 2WLZA 4PJHA 4RAUA 1BIIB 1ORQA 5ABDE 4WI7A 1YEIH 4JRXA 4WI4A 1A9EA 4XRCB 5JUEH 3GIVB 5D9SB 3K8KA 2IPTH 4KPHH 3UYOD 3X3GL 5ADOH 2VLJD 3EBAA 2OL3A 1ORSB 2HKFL 4OZGE 4PB0L 1J1PH 4G7YL 5DC0A 5FDYA 3VXRB 2HH0H 5DZOA 4WI9A 3ME0A 5F71A 4IS6B 2W0FA 3PGFH 4ODTL 3QDMB 2ERJC 1D9KB 1DQLL 2R1YB 3GHBL 2XWTA 4H5SB 1OOAA 3BGMA 3T2PA 4WW1B 2EKSA 1TPXC 2HVKB 3GBLA 5B3JE 3P0YH 4MA1C 4PY8J 2X40A 4JR9L 3WDHA 3LPGA 1CF8L 5C0AE 4P99A 3UXFA 1IZJA 2M8XA 2YUWA 3UTTB 5HYJA 5I8CA 3G5YB 2YD5A 3ZDZE 4I4WB 1KENL 4V1DE 5EC2A 1MWAA 5E8OA 3QJHB 4P2RD 5FB8A 3E6FB 3PGFL 1OAYL 5SX5K 1MJJB 3JBG7 3PGDA 1OTUC 2FX7H 1UH4A 4K55A 2Y7QA 5HHVH 1ZT4B 5TJWK 3U46A 2AQ1A 2WQ8A 4KI5C 3QG7H 1ES0A 3IFLL 5FV2A 5FXCH 4JPIB 2DIBA 1HHIB 3M17B 3TBVA 3QFJE 3FRUA 4WEBH 4JQXA 4UOW1 1F5WA 1A6ZA 4HXBH 2UZIL 5SWQA 3U0TB 3MC0A 3DI3B 1KJVB 2XTJD 3R0MA 2AV7A 1SVZA 5KN5A 2ICEA 3IKKA 3DX9A 2FX7L 2P1YA 4I0PC 1V7MH 5F7UA 4F15C 5DMKB 4OFPA 1X5FA 4K7PH 1RUMH 1Z0MA 5C6PB 4V3DB 3DSNA 5AZ2L 3VI3E 1G7JA 3X17A 1BQLH 2FJHB 3OKOB 1DVFC 2OR8A 3GRWA 5EBGA 3QEQD 4TOYH 3FZUD 1E4WH 4JY6A 4K8RC 4QRQB 1MVUB 1PBYA 4G80B 1T2QL 4MVBD 1INEH 4U05A 4LPYA 5CEYB 3RVUC 4QRSA 3ZLQC 1A4KB 3ZTNL 3MLUL 3WUWA 3MLWH 4PJBB 2BNRE 3UTTE 4D9QD 5DYOB 2YHGA 2ZUUA 4WW2A 5I0ZA 1EEZA 1CDYA 1NEZA 4NJ9H 5C8JA 2HVKA 2YK1H 1MI5E 5KSUA 4HJJH 1RJZA 5E5UB 1E6JL 1V8HA 2BSSB 2NY0B 2PO6C 3UTZA 4ZDHA 5JDSA 2NYYC 1DL7H 3MYZA 4NM4L 3NIFE 1RIUL 2CKNA 3ARTA 2ZSWB 1RZJH 4EVNA 1J8HD 2AEWA 4ODUB 5C0JB 3IXTA 2PXYB 1MCBA 5GS0H 5D70L 1W72H 3N1FC 1EPFA 3DYPA 4QRPB 1F58H 5E2UH 1KELL 3F5WA 4KKCD 3L7EA 4L4VA 3KLHC 3T4YB 4DW2L 4OCRH 1CGYA 2ADJB 2DQEL 3GKWL 1D5IH 3L3GA 4JKPH 4PV9B 4UI2A 1YECL 3VRLE 5HYJE 3CFBA 4PLJC 3B8SA 3GSXA 3NCYS 3MRJA 1I1FA 2C3HA 3MRHA 3QUYB 4X6CF 3HPLA 1KELH 3QFDA 2LFGA 4UT9H 5KSAC 5DHXB 1HYSC 3BEWA 1XT5A 3HZYB 3MV8D 4ACPA 4PBWD 4XP9H 2YXMA 3VRIA 3CDYA 5FYLE 4DGVH 1QHPA 3EYUH 5GGUB 3OBAA 2OI9C 1MCPH 4KKAC 4I77H 1KC5L 4OLZH 1LDPL 4YO0B 4OCSL 3C9NA 3HC0A 4R26L 4E42B 4LLYA 3DPBA 2IH3B 3VRIB 1N6QH 4QHKJ 4Z6AT 1G1YA 4XVUC 4R7NB 2LABA 3EJZD 2BVQB 3ULUD 1IAIH 4XP9L 2WUCL 3UTSE 5CSZA 2BXYA 5D93B 4F7MA 1MCPL 4NQCB 2ESVD 2YWYA 1FLRH 1BZ7B 2NY7H 3U48A 5DO2C 2FX8L 3X14B 5F1IB 4PJDE 3T08A 5DSCA 5ICXA 3O3AB 1QPPA 5C0GB 4X8JB 3S97C 3RWGB 1CU4H 4MNQB 4OZHB 4W4NA 1PKQA 4KPHL 5DMJB 3MUGA 2R1XB 4X4ME 4PRNA 5T3ZD 2IQAA 1T83C 4HC1L 3TZVB 3ARYA 1MFAL 4ZPTA 4EOWL 1F4WH 2DI9A 3MCG1 1CG9A 1CICC 3DYOA 3FN0H 1BOGA 4XNUH 1RMFH 3PWLA 4TTGA 5MEQA 3O8XC 4P23C 5ANMB 1NC2D 5T1LB 2X7LB 5IFHL 1FYTA 4M7JL 3OL2A 5SWSA 3PDDA 1MCOL 3VFTA 1F4YL 4IRZH 4PTTB 2DQUH 5KZCD 3R06B 2HT3D 1R5VA 4MDIB 4ZOAA 3PQYD 3PE9A 1J05B 4KMQA 4MS8A 1KTDA 4M6MH 1UG9A 4Z7UB 1EEYB 3TV3L 4HW6A 4QRRD 3TO4A 4UBDD 4HFWA 3TPUB 4G9FB 3HPJB 2AABL 4RIRA 3V4UH 3ZE0E 3ARPA 2A9NL 3VXUB 4C56D 3UTSB 5DHYB 2E7BA 5KSVB 4LCYB 4KDWA 3BZFB 1JGUL 3FB6A 4U6HA 3JUZA 3AXLB 5DMGC 4LCUB 3E3QA 2EXYD 1UH2A 4I3SH 1Z2KA 4XNXL 5D7JA 5IVXB 4C83B 5B4MD 2ZSWA 2P8PB 5JIIA 3CDFA 3SEPA 2Y23A 5T1KD 3CDCA 1EUUA 2A38A 2YSSB 5I2IB 4MCYB 3W0WE 2W0KA 4YEEA 1FSKC 3GMQA 1RV6X 5TQ0L 4HUWB 2J8UE 3MGTA 4NGHL 1FFPB 4X6EB 5FUZH 2F54A 4AQOA 4M9PA 4EDXA 1YPZA 4JCMA 5IESL 3Q3GA 4XZUB 4YXLL 4NO3B 4KROC 5E6IC 1R0AL 5DJ8B 4X0KB 2FEDD 3WUWB 5ADPH 3IDIA 1G7IA 1TZIA 3KXFA 3KLDA 5B3NA 2Y5EA 2W0LA 4LEXL 1KTKE 1RIVH 2P47B 5F1IA 1ACYH 3K74B 4EBQL 1CYGA 2RGSA 3CLEH 4JHAL 5IVOA 4BH7B 4HH9A 1T03H 3UO1L 2AS5M 4MXQA 3WIFB 3P0GB 3X11B 3IKCA 4JDTH 4O2EB 3N85L 4YUEL 2I27N 3ARWA 5DMKA 1IGJB 2JJUA 3D87B 1MELA 1A9BA 2VR9A 2VLRB 4QNPF 2VXUL 5SX4H 4OD1H 2BCKA 4TYUA 4MVBA 4J1UB 4M5YL 4M9OA 1U8KA 5CD3B 1CLZL 1KJVA 5HHOA 4OCYH 4ALAL 5EUOB 4PJFB 2GUOA 4ZXBA 4JRXB 4QO1A 3H7BA 3PHOB 1L9NA 1YY9C 3QDGB 4RAVB 4Z7VE 3EDJA 5F3BA 3QWOB 3DV6B 3LKOA 5E6ZA 3FO9A 3T2NL 4OF7A 4XNQA 4WFGE 1EHLL 5DRNB 1AY1H 1KPRA 1P4IH 2IFGA 4KXZH 4EKXA 3ARED 1CR9L 1KLGB 4R7DB 3QPXL 1C08B 2F15A 3QBTB 4POYA 3UYRL 3ULUC 3MJ8B 4NJAH 2VDNH 3EJZC 4BZYA 3B83A 1EX0A 2EXWD 3MUY1 4NO0D 2NY2C 3T3PE 1N6VA 4LVHB 2EDBA 2GT9A 4XHJD 4JFZH 4RGNB 4PGBB 4WV1B 1KSRA 2H45A 2DBJA 3Q2CA 3UBXA 3RVTD 4B0MM 4NZDA 1M71A 1GOFA 3QDMA 2HJFA 5TGBA 3MLXL 3MRIA 4U2ZA 1EZVY 3TFKC 4GOSA 1VFMA 4WFHD 5J1AA 2DBLL 1WT5A 5K9KB 4EUPB 2HJFB 4EI5B 4Z78B 3GMNB 2Z4QA 3NPZB 1OARL 3V6OE 3OAYH 1A6TA 4ELMF 1K6QL 3CAFA 3JV5A 1QA9A 3E2HB 3SE3A 5D1QC 1F8TL 5IB2A 1KJ3H 1JF6A 3H42L 2XACC 2C1PA 3RVTC 1EIBA 3MA9L 4TRPH 4GAJL 5E70A 4OLXH 1T5WA 3RHWF 4OD3H 4KQ3H 4LHUB 2P4AB 4PJGE 4AEHL 4OLUH 1BBDL 1W72B 4J3UA 4HBQA 3UTTA 2VE6B 1GSMA 3DGGA 1LILA 5C0BE 3ZHLA 1F90H 5I1AA 1L7TH 1IGTA 4LSDA 5FV1L 4JREC 1SEQL 4N0CD 3V5KA 5F88A 1UGNA 3RX7A 1MCSA 4HUUB 3E1F1 2DYPB 5KAQG 1AGFA 1ULVA 4APQA 4HKJA 3FT3B 3ZDXF 1KCRL 4DKEL 3A6CH 1OL0A 3RWHA 1MCRA 1RZ8B 1ORSA 5F6HJ 1P5VA 3QUMH 3O6FD 4PJXF 4WI3A 3FQUB 5C0CE 1OM3L 3RIAK 4M3KB 5CJBA 2R0WH 3ULUL 1AFVL 4Y16B 3DO7B 3QDHA 2A77H 4MVBC 2C7UA 5I18H 2X1WL 5H35A 2BNRB 1ZT4A 3NCFB 3NZ8A 3U46B 3GSWA 1NQBA 3ET9F 4XPTL 4QRPE 1FBIH 5FO8A 5KSAA 1JWUA 4QLRA 1KIQB 4HUXB 3BKYL 4Z7VF 1WIOA 3A6OA 3C09C 4Z95H 3LEXA 4I13B 5EC2B 2PO6B 1CL7L 1T3FB 1T5WB 1AJ7L 1RHFA 3QUZC 1JWUB 3C60B 1FGNL 2R1WB 2HG5A 3EJYC 4NKMB 5HHMD 3QO0A 5C0EA 4Y4HA 1PX4A 4YHNA 1PYWB 3ORJA 1ZLSH 2NMSA 2D31A 2F54B 3CFCH 4NOBA 5I9QC 3FCTB 5F89B 4AG4H 4XB7A 3ZT6A 1Q94A 5J1AB 1Z5LB 3TJHC 1IKNC 1LEIA 1SYVA 1WBXB 1FFRA 3DVGB 1YMMB 1F3JB 5LGHH 2VZ3A 4ODVL 4F15B 4NHUA 2QV2A 2XZQL 5IOPB 2A83A 2I07A 4Z7OE 1FE8H 4K7FB 4NN7C 5GSVA 5L2KD 1FFNA 3OWEA 4XPFH 4AZ8A 2BFVH 1CT8A 5DQDL 4OQTA 4GMSH 4DGIL 2NXYD 4ETQB 2NZ9D 5GISL 1LE5A 1CZ8L 3IETB 4PJAB 3K1DA 1YMHB 1JGVH 3QXAA 4HV8B 2NXZB 3GDBA 4PJIF 3V52H 2F19H 4ODVH 2F5AL 4ZO6A 5D1QB 3K4DA 5DFWH 4N68A 3RWIA 3P11L 5A1AA 5ICYA 1R5VB 1QEWB 4JN2A 5TPWH 4K3EL 4BKLA 3PDOA 4OF6A 5JHLH 1BGXL 5T5FH 2AW2A 2HAZA 4MA3A 4PRPE 1MRCH 1NFDF 1U8PA 5GGVH 5CZVH 5IMLB 2A9ML 1KJ2L 2X5PA 1ZLVH 3C6SB 4E41E 1YQVL 5CWSB 3O3EA 1UJTA 4LP4A 2PW1B 3VXUD 1CD0A 2P8MA 5CD3A 1CXEA 4ZUUB 2IPUK 2JK5A 3GNMH 4QHUB 5TGBB 4CL7A 1OWRM 4UTBH 5IB1A 2DWEA 2PYEE 2P8LB 4UIMB 4DGYL 3NMEA 3H9SD 4ELKA 3FQXB 4MHHG 3QFJD 1XGQB 1CE1H 5A2JH 3LAFA 1FZMA 1SBBA 4JZNB 1P9MC 1RZFH 5DMGD 4Y2DC 1CE6B 1EGJL 2FL5B 1DUYA 1NC2B 4PRPB 5D5MF 4OD2B 4WI6A 2XV6B 4IMLA 4P5TD 3T0ED 4NZUH 1EEYA 1QFWH 4UIKH 5BVJB 3IDXL 4NO3A 1FPTL 4LPVA 5E2WL 1S5HB 3BIAX 2PCPA 4CVWA 4PGCB 5GS3A 5HGDA 5DDHB 4FQHA 5SWSB 5IMMA 5GRUH 2W92A 2CLVA 1RK1B 1DQLH 4F80A 1MCKA 1BECA 1MHHA 3UJTH 4G8FA 2CK0H 3UPRB 1IM3B 5IV2B 1GGCL 3ERYA 4GRLC 2HRLA 3FO1B 4O58L 2DQDL 5KOMC 1Z9MA 5ANME 3NIGE 5HVWA 1HQRB 3PF2A 5IT2L 1F2QA 1H3PL 1A1MB 1GPOH 3D39A 3HI1A 5J4MA 4DK6A 1AIFB 3HNSL 2OJZL 2WINA 3ARGB 1TNMA 1GOGA 5FCUL 1BJMA 3MUGB 4FQXC 1LP9B 4X6CA 5HYJD 3RY4A 4M1GL 2ADGA 1EHAA 3UC0H 3AU1B 1CLOH 4UAOB 5DC9B 3OKLA 5M7QA 2YR3A 3N50A 4AL8L 1NAMH 2B39A 4P2QA 5DZLA 4ELMB 5C0FB 1YPZE 4YHOL 3ABZA 3FRPG 2AJZA 3QUMA 4LSVL 4GSDL 2BVOB 1DSFL 5KVFL 3OJMB 3S4SB 3H9SB 4JM4L 1IJ9A 5AWNL 3NCBB 4NUGH 3LS4L 2X4SB 1VFBB 2DQHH 3MBXL 4KY1H 3ZDXE 1BQHA 3PXHA 3QH3B 4M93C 3QIBB 3KYAA 1P1ZB 3DWTA 1UB5A 2D0HA 4LLWB 5HHOE 1OAZL 3RA7H 4M7KL 5I8EA 5T1MB 3WFCH 4O2CA 1FN4A 1NEZG 1UM5L 2ITCB 4L4JA 3TN0C 5DTFA 3VFVB 1T0MB 5H2BA 5JDSB 5FO9B 2IBBA 3KHOA 4WTXA 4OZGF 4R97B 4IRJD 2P5WD 2MPAH 4X6DA 4W70A 4H8WC 1ZA6B 5CZKA 3RTQA 3VFWB 4OB5L 1AE6L 1JGLL 3L3KA 4EUPH 2P49B 2WY3A 4HKZA 4FHBD 1P4BL 5GHWH 4LKCB 1FG2A 4F58L 1MCCA 4YFLI 1JIBA 1Z6JT 4PGDA 1S78D 5E56A 1M05B 3DIFA 2VXTH 5AYUL 3ARFD 2WNGA 4CN1A 5F7NC 2AI0H 1NGPL 3MLPA 3MRDB 1INDL 3FTGA 4POZC 5CLTA 3RZCA 1C5BL 1J1PL 4G7YH 3RVXD 5DJ0A 4LHJB 4FQCL 1KXVC 2PTTA 3PDGA 1IC5H 2Y4SA 3KPLB 1AGEA 4F57H 1BWMA 2B1HH 5T1LA 5FHAH 4OQTH 3BZEB 1G7QA 5BRZD 4LEXH 1YNTB 3BQUA 1IBGL 2DAVA 3OJDB 1QOKA 3O81A 3TFKA 3C8DA 4Y19A 1NGXA 3W39B 1B0GA 1NMCC 4YDLC 4R6UA 4WY7L 1HK6A 3IJYB 3TZVA 1U8QA 2CMRH 5E8EA 3BIKB 3LDBC 4CADA 4QRRE 5D1XD 4YHNB 2DQIL 1KBGL 4TQEH 1A7PL 3RWIB 4K3JH 2F74A 1J10A 1CFTB 4P2YA 1U36A 2EH7H 3B3IA 2YMXH 3ZE2F 4GG6A 3L3GB 4NQEB 4P9HL 4Z0BH 3V2AR 3ARQA 3DRTA 4O51A 5JORB 3BAEH 5A2IH 2Y6SD 5FDWA 4GKZA 5GGVL 2D0GA 5FGBC 1EJOH 5TE6L 1AO7A 3T0WA 4AIZB 5I6XC 1OAYH 1UC6A 1YPZF 3F7PC 1NCWH 3O6FB 3TYFA 3FO1A 4P2QE 5I8KH 5BZDA 1MUJB 4PV8B 3JWDC 5ID0A 1IGML 1IRAY 2QSCH 4GS7B 4I48B 3VG0L 1BD2B 4P9HH 2I5YH 5B38B 1QYGH 2IG2H 3RDTD 4NM8L 5K9QI 3P77A 4L5FL 3RJDA 5ISZD 4QXUL 2EE6A 4JAMA 4OIBA 1CIDA 1TJIL 3LKRA 4QRRA 4OLYL 3TYGH 2QJDA 2XA8H 4Z7QE 2EDNA 3QDJD 3O6ML 1KEML 4U6YB 1NDMB 3QDMD 4NZTL 1KTLA 1R3KA 1U95A 5IWLA 4QTHB 4R3SB 1N0XH 3OR6A 2A74B 3OHXA 3IGAB 3TT1L 4ONHB 4F9PC 4LBEB 4NWUH 2V7NB 4XNUL 1I3GL 1BAFH 1NGWA 4XPHH 4PP1C 1UACL 4ZSOA 3TBSA 4MZ3A 5F7HA 2R4SH 2GSIB 3KYNA 4RX4D 3CX5J 2E7HA 3ESVF 1GPOL 1YZZA 1LK2B 4ZS7H 1XCQB 4F37F 3G5VA 4NP4L 1UA6L 1OAUL 1VEMA 3U7WH 1DBJH 3MJ6A 2YRZA 4GAFB 2BY1A 4YBQD 4AMKL 3HB3D 3VXMA 3DBXB 2D2OA 2GIYA 3OB8A 4OFVA 1P7KB 4HQQL 4RBPH 4K94L 4TTDD 3QISA 3MNVA 3QJFB 4JPWL 5HYSG 1MHCB 1H3PH 3VWKA 1MI5A 2NXZD 4MLIA 3W5MA 3AREB 1MLCB 3QDJB 3EO9H 3NCCB 4R8WL 4TN9A 4GQ9L 1S7WA 2VH5L 3TJEL 4D0BA 2CGRL 5IB2B 1ZT1A 5C07B 1NUDA 4NO5B 1FZKB 1Q72L 1HXMA 1RK0A 1FVEA 4OSUH 1NAML 1ND0A 3DBXA 4HEPG 1NANI 1K9TA 4F7PB 3MXVL 2AXFB 3SGKA 3BH8B 1NGZA 1A2YB 3OAUH 3L5WB 4N9GA 4EUPA 5BQ7A 3IDYC 2XICA 3RU8L 1EFXD 3PWPD 3DXAD 2AJVL 4KGLA 1MF2H 1JTPA 1J5OH 1FL3A 1PAMA 2GJ6A 1PKQE 4MJ5A 4XNYH 4G6FD 3V6OC 4X7TA 4LAQH 4RISH 5IKCA 1HHGA 2RHEA 4JZOB 4UT6L 2FRGP 3IKCB 1PYWA 4LLVA 3BQUD 2XWBB 1KJ2A 3ZHKA 1IC1A 1KIUA 4IOFD 4P46C 4U1SA 5JXAH 3DI2B 4RGNC 4WV1C 3I75A 4HIJA 4BSWA 5FYJL 4NC1C 1KTLB 5JR1H 4XI5C 3R1GH 2XTLA 3WL9B 3L3DA 2IH1A 1AE6H 1MI5B 3RWDB 2OI9A 2G5RA 3QXDA 3JTSA 3V5HB 5DLML 2F74B 1CBVH 4YXKH 1WEJL 4NPYA 4FQCH 1WVZA 2ZCHH 2Y9RT 1YJDC 3WSQH 3U2SB 4GKOA 2CLZB 2YRLA 4CW1A 1CDIA 4Y16D 3P73A 1FE8L 6FABL 1A64A 5DT1L 3KLAA 1A6UL 3HHRB 4PD4K 3G5VB 3TO2A 4HEME 1AGEB 3WNOA 4BQ9A 1CXIA 1INQA 1N8ZB 4Y19E 4FFZL 3MRIB 5L8JB 5IBLC 2FO1A 3KPQA 4N1HB 3O2WL 4J4PD 5GGRB 4ZSOB 3C8KA 4OQTL 1OGAB 4Y5XA 1S7XB 4BQBA 2GCYA 2HLFD 1FZKA 2F5BH 4XP6L 4Y5YC 5H37G 3FB7A 4GKZB 3VFOB 3BAEL 3QYCA 3S7GA 5L2KA 3EZJB 5C6WH 4JM2B 4DKFL 1JNNL 1S7TA 5FYLL 1PDKA 1ZHBA 4TUKL 4R7DA 4KTEH 4C54A 1S3KL 4Z7WA 4HIIB 4NUJA 3U4AA 4P48A 4X8XA 1IT9H 1Y0LB 5DK0B 3GJEA 4DN4L 5K9OB 1EO7A 2OBGA 4HKBB 1UADC 1HKLH 1LO5B 3BP5A 5AZEL 5HPMB 4EI5D 4PJIA 1BEYH 4P3DA 5J9PB 2AXGB 5GRZA 1RFDL 3PWJB 4U6VH 3UTSD 3HLAB 5C0NC 2Q7NA 5C0DA 1MUJA 4PV8A 2W9LA 1NCNA 2DWDA 1EBPA 1URLA 5J3HD 5FYKE 4KTDH 1E4JA 2R0ZL 4FQQB 4UIKL 4KI1A 1UWXK 4KJWC 5DEZA 4XNZB 1G6VK 2ZCLL 4UUJB 4I5BB 4HK0A 4NCC2 1TVBA 3PWVA 1D6EB 3LH2L 1EEQA 4NO0B 4LCCB 3S37L 3RIFK 1XGPB 4NNYA 1S7QB 2AKRB 2BOBA 4TNWF 2WANA 3OG6B 3MLSH 4X80H 4HFWB 3TPUA 1S9VA 3SO5A 5E4EB 4DAGH 2E6PA 4PP8C 3DVNA 3INUL 3EGSB 1OSZB 3MX0A 1PJ9A 1N5YH 2VAAA 4GXVL 1ZVYA 2CO7B 4JPVH 3MTRA 4QEGA 4TPRL 3WIHL 5EC1A 1JHKL 1XIWD 1S7UA 1YJDH 25C8H 5JOPE 1XGRA 2HH0L 5D70H 4HWBH 4RGNE 1FH5L 4OF5A 4F8QA 2VC2H 3O11B 4JRXD 3LRSB 2GUOB 4AMKH 3RZCC 2XQBH 4UINH 1MOEA 3ZKXC 4X4XB 1FNAA 1BD2A 3HZKA 4U1MB 3SDDC 5C9KA 4OGZA 3G5ZA 1MVFA 5F8QC 3HZYA 5IJVA 2IAMC 1UXSA 4G5ZL 4Y16C 2X4TB 3M8OL 1S9WA 5KSBB 4NQSA 4LCUA 3QXWA 3TZVC 4PJ9C 1G9ML 3O6LH 5D1XA 2NTSP 5K9QG 2C5DC 2YUXA 3FN3A 5BRZB 3O3AA 2X10A 4EDWH 1DUYB 1T2JA 4PRPA 1IEHA 4KK9D 4WWKC 5ISZA 2EO9A 5IF0A 4YBHA 2ADJA 3RKPA 5L88L 3VI4E 1UCBL 4OLWL 5BRZA 3U0WL 2AXJA 4RSVA 4F7MB 3LB6D 1G9NL 4W4OA 4EIGB 3GB7A 3ULVH 4WTWA 2JJSA 4U0QB 2HMIC 4DUXA 5DJYB 3OQ3B 3HB3C 3CH1A 3SQOL 1KG0A 2YC1B 2A0LC 3QUYD 3P0VH 4PGEA 2VSCA 3HI6H 4R4FH 1U8NA 5CJ8A 3AS0A 4CDGC 3T0EC 4DVRH 1HILB 3T0EE 4Y5VB 5EOCH 1RJYA 2J4WH 5IMKA 5B3JF 2RBLA 3MRQA 4GAJH 2ED7A 4IRJB 5D6DC 2XPGB 4UTAL 3MQIA 1NCAL 3QUXA 4F9PA 4C4KO 1HI6B 4ODSH 3NFPA 4LKXB 1C16A 5DHYA 3QUYC 2UVFA 5IW1A 3KVQA 2EICA 1A7OL 5EU7C 4X99A 1QSZA 3KPRD 4G9FD 5HDQL 4OTXH 5E2VL 3ARGC 5HD8C 1U8HB 1EFQA 4WFFE 4GBXB 3GSNB 3VFUB 2F53A 5SWSE 3U4EB 2I07B 2CRZA 3QCVH 3MRKA 5KSBA 3P9MA 4PJHE 4CVXB 2OXGA 1JTOA 3STLB 3ZKND 1B0WA 4MJIB 2X4QA 2BSTB 2M26A 2DLFH 3O2DH 2IWGA 1XIWC 1AD9B 3O3EB 1JNHB 2IAND 4LU5H 4ZO8A 5I17B 4LLQB 6FABH 4HWBA 5FYKH 3S3PA 4KUCF 4Q74A 4NN5B 4ZFZA 1CN4A 4J8RA 1WCBA 2Z8SA 3CSYB 1GHFL 3PDOB 4YDJB 4U1KB 4YFLF 3QDME 2R1XA 1XGTB 3TIEA 3WIHA 7FABL 3QA3B 2FIKB 4PY7A 3MJ7B 3GMPB 4S1RH 2XKNB 1UWGL 4PJ7E 5FM5O 3B4NA 5B39G 5CJOH 2VDQL 4PJAE 5L8KB 2VABA 3IDXH 4N8CH 2EIZA 3PWNA 3WL9A 1ZGLB 2X9WA 3G5YA 1WISA 2B0SH 1UENA 1AGCB 4Q9RH 4KJWD 2MCPL 3BRDA 3LKNA 3BPLB 1ZV5A 2P5WE 2RR3A 1JN6B 2CKBL 4DKFH 4S1DC 3CVHL 1Q9LA 3BKYH 4N5ED 1GXEA 5JW4M 1S8DB 1S7SA 5TDNB 2VLLA 4G8IA 1OGAA 1T0PB 2G75B 4P5TB 3VA2C 5HYSA 2UWEB 3OMZA 2CIKA 4E42A 1OB1A 3CFKB 4NNXB 5CJQH 4RWYL 4ELME 2EDHA 1FORH 2KBGA 4OGYL 5SWQB 2VQTA 3QFJB 4P3DB 2JE8A 5BJTB 1NLDL 1MIMH 1FC1A 5I30L 4EBQH 2YUVA 4U3XA 3BXNA 2W07A 1JF1A 3FCTA 4M7ZB 5BS0E 5I66B 4PYGA 3O11A 3U6RA 5CSGA 3MRCA 4ZFOA 3S37H 5FOBB 1RFDH 4WHTA 1JWSB 2DJ4A 4JFHE 5E08H 1EXUA 3NABL 4X5XB 1WZKA 1X7QA 4FQ1H 3F7QA 5FKAB 2VLKE 5EU4A 5KTEL 2QLVB 1RIUH 3ARFC 1JI1A 2M1KA 2APXA 2H9GB 4GSDH 3QJHA 1E4XL 1CFQB 4LHUD 1ZHBB 1E4XI 1JHKH 3VXRD 2HLFC 1X5AA 2YK1L 4ZNCD 1W0WB 4J4PC 5AYQA 4YDKL 4X9HA 3KR3H 4FXGB 2YEZB 3FQXA 4NNPL 2Q86B 5EULV 3VFGH 4OFDA 1YDPB 1T2QH 1FAKT 4IMKC 4BZ1H 1FIEA 2J5LB 4MA1B 4Y5XC 3WXWH 5DVMA 4XP5H 3V4PH 1A3RL 3QI9D 4HJGB 2Z9TA 5HHXH 3MV7B 4I3RL 2XKUA 3BSZH 3L3HA 4YZFF 4BA8A 2G5BA 1Q94B 1NGZB 3PNWA 1HZHL 1XCTB 2E9JA 2A6KA 1MFDL 4UQ3B 5IBLD 2RAMA 3MACH 4U31A 1FNLA 1BX2B 1QSFD 1RZJL 4Y0GA 1TVHB 1BLNB 5D1QD 2WBJC 5BVPL 2W9DL 4Z77A 1T3FA 2PO6A 4WHDA 4YHML 3WS6A 4PJAA 3AUVA 2VLRE 1QQDB 4E41A 3O4LB 4PJXE 4MXQD 2E7LC 3MJ9L 3NZ8B 1LD9A 2V17H 4JO2H 4MAYC 3QDGD 5JPMB 4DOHE 1CLYH 1MPAH 4I0CC 5GPRA 2Y5TB 1KLUB 2JIXA 1ZLUK 2Z4QB 3SDAA 1KEGH 4YNYA 3VFNB 1G9NH 3WFDH 4K71C 3T65A 4NFDA 2WUBH 4NKIH 3MA9H 4P46D 1DBAL 3RVVC 4KJYB 4PJ8B 2HFGL 4XC3L 1UYWL 1B2WH 1IAIL 5BMFH 3SJVA 3WFEL 4G6FB 4DQOH 5KG9A 1KCSL 2F54D 2KKQA 1L7IL 2NW2B 2NR6C 2AEIT 4RZCB 2XT1B 1W8NA 3MLVL 3FJTA 4U6XB 5DD3L 3QXUA 2NXZC 2MNUA 1A7RL 4U7SA 3U79A 1AO7E 1NGYA 4KKNA 1EFXB 5CCKH 5CEZD 5JA9A 4F37K 4F7TB 1I1CA 5C0AA 4L9LB 5I0DA 1JFMA 2CD0A 4TUOA 1FG9C 5GGTH 5EBMB 1FNSH 5KBNC 1P9MA 3NTCL 1NJ9A 1E6OL 2EO1A 1EFXA 5T3XH 5FO8B 4ZTOH 5KSAB 3HTLX 1QNZH 4YBQC 2X6MA 2BSED 1WC7A 4M5YH 1AXTH 3IDJA 1P4LA 1BX2A 5EWIH 3U7YL 2QR0B 4OI9A 1WFOA 5J6GA 4JRYA 3LN4A 3D48R 2YD9A 2O61B 3L3OA 5DFVC 4XPAL 3WXVL 3QHFH 3V0WH 3BH9A 1G7HA 5CP7B 1OSPH 3BESR 1ADQA 2VXVL 2P8PA 4LVNC 1CL7H 4Q9BA 1YUHB 3MLTB 1T1ZB 3O3BB 4XWGL 1D5BB 4HPOL 4YZFE 3I50L 4KAQL 4DWHA 4ZAKD 3RAJH 4C56B 1UH3A 1JFQH 4LHQB 2DF3A 2XOTA 3FQNA 3RUGB 5GRXG 1TTUA 4NGHH 5FUZL 4YHPA 1J12A 4UNUA 2AQ2A 2C1OA 5JNYB 2VOTA 1YY8B 5LQBH 2UUDH 3U0PB 4L8DA 1IBGH 3A6BL 3MRCB 1ZT7A 1FGVL 3O2VH 2DQFB 3BGAA 4OAWB 5JHDE 4ZG1A 3IT8D 1JGUH 2EDDA 2HKHH 3QCUH 1DFBH 1E27A 2HRPH 1F3DH 4PJGA 3ZE1E 4DK3A 2YSSA 3BWAB 3U4BL 5DJAA 3QSKB 3WS3B 5ADPL 4HJ0D 3O8XA 4P23A 4TSBH 1NCDL 3DSFL 4KVNL 4ZUTA 4G9DB 4H1LB 2YPLA 5AD0A 4HIEB 1CGWA 4ZFGL 4OIAA 4M4PA 5DJXB 3JWDL 2G60H 5MEOA 4FXGA 1KYOJ 4GUPA 4X8JA 1CK0L 3KNBA 4UU9A 5HI3C 3RNKB 4UILH 4YHYC 3M1BB 2VH5H 1IM9B 2DI8A 4IJ3C 3EYQC 4FQ1L 4KROB 1T04A 3C2AH 3GSOA 1LO3H 3SDXB 4MZ2A 4LMQE 5IUSA 1XGTA 2WZPD 4L8SC 1ZHKB 4UTBL 2AJSL 5GGTA 1KB5L 5J56B 1U8QB 2W38A 4CNIB 4XX1G 1G9MH 3O6LL 1U0QA 2FZ3A 2YPKA 4G42A 3WDIA 3MROB 3K81A 5C08B 1X5ZA 5C9JA 3BKMH 3D0VB 1OAXL 1VB9A 4X4XA 1ZWIA 3O6FA 1KJMB 1GC1L 1YEGL 1JPSH 5IMOA 4AEFA 5D7JB 3PV7A 2P45B 3QQ3B 4LQ1A 5IFAH 4Z7VA 4QXTB 4AEIL 1GH7A 4GRWF 3EDEA 5EFIA 1N64H 2V7HB 3QDAA 5SWZE 1MFDH 4KMLB 5JW4Q 1V5JA 2JCCA 1CLYL 4JKLA 1X5LA 1HXYB 4QT5A 4G6AD 3OKYA 2EC9T 4QXGL 2PR4H 4CU6A 3MJ7A 2DTMH 1GJIA 4Y4FD 3TN0D 3VMPA 2JTDA 1G1CA 1QPXA 3V5DB 3VFTB 12E8H 1ZANH 4MD5A 1V3LA 1R5WA 5FKPB 2Y36H 3WO4C 4X6EA 1ZMYA 4L3AA 3T3PF 3TT1H 4NZRL 1HSBB 3OJDA 2AJYH 5CUSL 1I1AB 3UTOA 2FJGA 3WD5L 4JRYB 3Q6FA 3WYRA 3U0PA 1LEKB 2DICA 5IB5A 5JTWA 3BVNB 3V6ZA 1F42A 3CZJA 3GSRB 3S36L 1IEAB 1RJLB 2QQKH 4U1NB 2Y36L 1S5IL 2AJXL 4JHZA 3B5GA 3PWUA 4KKBC 3DVNB 3G08B 3WFEH 1S7VB 4P59L 3DIFB 5DI8B 5ILTH 5HYQB 4Q9QH 4LGSB 3L9RB 3WD5H 3VH8B 1HINL 4KRPB 2BVTA 3UTPE 3GSNH 2RQ8A 4PUBH 3WIIL 5I18L 2HJLA 2ARWA 1NMAH 4ELKB 2APTA 2GCYB 4KQ3L 3FMGH 4S0SD 4DFHA 3QQ3A 2EYSA 3KPSE 3IXTB 2E6QA 1F3JA 4M00A 4FTVA 5LWYL 5L2JA 1RULH 4XCEB 2DQGH 4M61A 2VDKL 4KJYA 3HMXL 1IQDA 2X4PB 4QGTA 3ZE2E 1LQVA 4YAQA 4Y19D 3TFKD 2BXZA 1KPVA 1HHHB 1A7NH 2E5EA 4FABH 5ESQA 1CE1L 5JQ6H 2IQAB 1NBQA 3U9UA 3OXSA 5EA0L 3TCLB 2DD8L 3LVEA 3U9PH 3QO0B 3H9SA 3QPQC 4JFEA 4LRIC 3BUYB 4JRYE 4XGZA 3V5HA 1G9MC 4F9LA 4N0FA 1MVUA 1T22A 3RWCA 3OKLB 3VG9B 5SWSD 1YEJH 2ILLA 3FQNB 5M95B 1XZ0A 3TF7C 3IDUA 4U1SB 1GC1C 4R4BA 4NQCA 3KNBB 2OM5A 3ARRA 1NLDH 4UU9B 5I16A 4U1HA 5CZXC 3C6LA 1ZXQA 3QCTH 3QEHB 5DEFA 5EO1A 3ZT7A 3D2UB 1Y6KR 3ZSSA 2K9UA 2UY6A 5FGCE 1UB6A 2VXQH 4GG8B 3HZMA 3KPTA 3VXME 3O8XB 4HZLB 4P23B 1CBVL 5JOFB 3DX6A 5T3XD 2F19L 4KVCL 3WMSA 5JXEA 5MP6L 4RQQB 1JBJA 1P84K 1ZLVK 3B9DA 4NRYB 5BQ7B 4UQ2B 5HDLA 4LVNB 4XC1L 3C6SA 1QSFE 3PWPE 2VZSA 4PJBE 2N1KA 2BFVL 3VXPA 1MJ8L 5TF0A 5F6IC 1TQCB 3GJFH 2UV3A 4KJQC 5HGAA 1QEWA 3O45A 4JN2B 5EIVA 1UCBH 3RL1B 1FYHB 1OTTC 4Z7WB 2EECA 5HI3D 1DSFH 1VFOA 4EXPX 2NY0D 1CLZH 5GRWA 2VJXA 3TA3A 3S35H 3VFOA 1ODAA 2ZUSA 4ZQKA 3B2VL 3IFPA 3C6LD 1X3DA 2A9MH 3VFSB 3F5WB 5ITFA 3WBDA 4IBLT 4UQ3A 3MACL 3BZ4A 3QG6B 4OLVH 2P8LA 4KHXH 3D3VB 5EO0A 1RIHL 1Q1JH 5DVKA 5DMIH 5KS9A 2DWDB 3FOMA 3BP4B 4E5XB 1WBXA 5INDA 1AY1L 1P4IL 2EC9U 4HJGA 2DLEA 3VXNB 1K2DB 1FNGB 1PSKL 2NY5H 1MNUH 4GRMB 3EJYD 5LBSL 4J3TA 4ZDHB 1QSFA 4NSKB 5CEZE 1I9RL 4L8DB 2EXYC 5DURD 3LPWA 5GRUL 3MNWB 5J11B 4LNVA 3EDDA 4OM0L 5I1AB 2F53E 1YYLL 2EIDA 3TJHD 3GI9L 2XTJB 3E3QE 1H5BC 4NRXA 1JV5B 3P9LA 5GS1C 5GJTH 3S88L 3QT2A 1B90A 4HF5H 1PVHA 1U93B 1NEUA 4BFIB 2XKNA 4F7TA 2V5MA 3HNTL 3L3IA 1Z3GL 2F8XC 5EU4B 4TNVK 3FO9B 3HCVB 2MHAA 5JPNB 3QRFM 8FABB 4PBXA 2I25N 2EDXA 3PXJA 3GO1L 1G7MB 1N4XL 1N7MH 1JF1B 3MLTA 5DFVD 3UTTD 2PN5A 3PQYA 1ZTXH 2ITDB 1BVKA 1RZ7L 2JCCE 3G6AB 1QD0A 3T4AB 4OD3L 4TQEL 1NUFA 3P4OA 4XHQA 1JPFA 3BH8A 3LS4H 1OP9A 1A9EB 4XRCA 2KZWA 2VL5A 5MENB 4D9LL 5HVHB 3QRGH 2R9HD 4I2XA 5FF6A 4JKPL 3CVHA 1JN6A 4IOSD 5FM4A 1AHWB 2MCPH 3WIFA 1BJ8A 3X11A 4ERSL 1RURL 3MFFB 3T3MF 4RNRA 4D3CL 2A9NH 1Q9WA 3VXSD 3RDTA 4YHOH 1KB9K 4TULH 2H2SD 1T7WA 1VDGA 2VZUA 4P2CG 2VABB 4TUOB 4CU7A 1EA9C 5J12C 1CD1B 4YK4C 3DECA 4TUJA 5TH2B 3SE3C 1C7TA 3L5JA 2R2HA 1MQ8A 4ZOEA 5FECB 4JHWL 3O45B 1MF2L 1PLGL 3LQAH 1YPZB 3MRLB 1ZS8A 4D3CH 2ADFL 1CGVA 4K7PL 4BZ2H 5FYKD 1FCCA 3RVVD 2JJWA 2IPKB 4Y5VA 4LSUL 1PZ5B 3FO0H 1S9XA 4HMCA 4XCFH 5J6HB 1AD9A 1JFQL 4NWTH 4JM4H 2IEPA 1U8KB 5D7LB 5BOPA 4Z76A 3DURA 2CDFA 4W81A 4CVXA 1GYAA 1IAII 2DYPA 3F12B 1EH9A 1KB5B 1RUQH 1NGWB 4R4FL 1MIEL 4M7ZC 1RIVL 1S7SB 1G84A 2DQTL 1DBML 1ZT1B 5F9JB 4JHAH 1EO5A 3AREC 3HG1D 2WSKA 3FQRB 2WBJD 1RZJC 2XI9A 4HCRL 4KH2A 3MV9D 1IMHC 4JDTL 1T4KA 5E7FA 4KWUA 1RUKH 5HGHB 1WITA 4Y1AA 5JLZB 2BERA 4QWWC 1FO0A 4XVSH 1ACZA 3B3IB 3NFPB 4CAGA 1YYML 1SMOA 4K23L 1QRND 5LGJA 1QRNA 3CX5K 4JO1L 2AK4E 5I1EL 4TSBL 2DQCL 1ZVSB 2ZSVA 1U2HA 4MQSB 5JZ7D 4DCQB 5GS1A 5M94B 5KW9L 3PABB 3UDWC 1DQQB 3KPPB 4M1DL 43C9B 4A6YA 4M7JH 4YC2C 5L9DL 1T83A 1JZ3A 3S5LG 4D9RE 3D85D 3D3VD 2NCMA 4KTEL 1U3HB 3AMLA 3TC9A 2YXFA 4PPTA 2NY2D 3FONA 4XCCL 2D7MA 1T66D 4DUWA 1GGBL 1SBSH 3KJ6H 4KI5D 3PV6B 3LN9A 3R8BB 2FJFB 4KJPD 4L1HA 5FUCE 3IFPB 3OHXB 5ITBH 4U33A 3LKNB 4X6DE 2FECL 3BHBA 4WEBL 3SQBA 3VWJD 4GG6B 4ETYA 5FYJD 4YBLB 1XR9B 1KIPB 5GGSB 4FNLL 4RGMB 3MV11 5D7IF 4ZFFB 4HK3N 5J8OA 3G5XA 1M4KA 4N8CL 5JIHA 1A3LH 3MMEA 1A6WL 3VG0H 1U3HA 4QRTA 4ZFZB 3HUJA 1U8OB 3G5ZB 4S1QH 1WWAX 5DJAB 3B9KC 1F3DJ 4NQUA 1SJHB 2MWCA 3U1SL 4UT6H 2WBWB 4TOYL 3OG4B 3VA6A 1QSVA 3GI9H 1DQMH 2UWEA 4RMSA 1CQKA 1AD0B 1A3LL 4U1LB 5I8KL 3RY6A 1CU4L 4ZUWA 1I9IH 1KF9B 4HFUL 5IQ9A 1ADQL 4JJ5B 3MLWL 4FMFA 3OZ9L 4JPVL 4TPRH 3WIHH 4X98A 1T7XA 2CLRA 4XCYB 3MRJB 1VENA 4IRSB 3SE9L 2IQ9L 5EZLA 4CN4A 3D5OF 4TSCH 2D7QA 2C4FU 1G9EA 4X99B 3ALXA 4NC0B 4WW2F 1V3MA 4OZGA 5DQ9B 5E24E 5IJKA 1YYLH 2EDEA 5DI8A 4YQXL 5IROC 3ROOA 4WIQA 2XXMB 4Q0XL 2XN9B 4Z0XA 2XG4A 2NZ9C 4FN0A 1U92A 3QDGE 4Z7VB 5EU3A 3DOSA 1TCRB 2CQVA 2EH8L 3ZTJH 5HHXL 1T2XA 2QHRH 3BVNA 4J6RL 5BXFA 3BGFC 4GW1A 1Z9LA 1R24A 4MAYB 3IJSB 2HT2D 2IADB 4JFYA 4UBDC 4OQ1A 1IFHL 2ARJQ 2X7LA 3GHBH 1MQKL 1PW3A 3UPRA 4YX2L 2OZ4A 4PJ9B 3FAWA 4GQ9H 3AVEA 2AV1B 1LDSA 4K94H 2IADA 4JFYB 5DD6B 3W2DH 3MBEA 5IWLC 4OLWH 3C5ZD 4OCNC 5FM8A 2NLJB 5SWZD 1NEZB 3IDJB 1X5YA 2VMFA 4J4PA 3BISA 1I7TA 5C2BL 4AM0B 1J88A 1MHEB 5C09B 1UEMA 2BY0A 1OPGH 2H3NB 2X4NB 2QTEA 3VFPB 1WZLA 3V7AE 1AO7D 3H9HB 4YHIB 1UZ6E 1U8HA 4G80A 3VXUA 5A2LH 2QSTA 4IDJL 4KK6C 5E8DL 1QBAA 3GK8L 3NCJH 1WV7T 1MFEH 5DUPL 7CGTA 3IDGA 2J12B 4H26A 3CVIL 5E9DE 4FQXA 4MJIE 4R9HA 2FJFA 5GRJL 3TA3D 4PJ7B 1T1WB 1HKFA 3MRNA 4JFPA 4MNQD 4HBCH 5E4EC 3LN5A 4QHNA 2RFXA 1SQ2N 4Z95L 1T21A 4Z18A 3FQTA 3WE6A 3R8QA 4L4TD 2FJGB 1FP5A 1Z5LA 2ITDA 1OAQL 5DTFB 3IFOA 1MFEL 2BRRL 4AIOA 1UM6L 1T1YB 1P5UA 3NAAL 5IEHA 4TVPL 4NO5A 2FHFA 5DUBB 3U30C 4OGAC 3ARUA 4GKNA 3P4LA 4WWKD 4EI6B 1JUFA 2GFBA 1NJ9B 1XR9A 1J8HA 1J1XH 4Y4KC 1PQZB 4EOWH 3MRBB 3AM8A 3MREA 3MGOA 5I8CB 3GKZA 1IM9A 1OLLA 1NFIA 4QOKB 3ZYIA 1HHKA 2WK2A 3F65A 4XC1H 2IAMD 3L7EB 2X42A 5GIRA 2GTWA 4YR6A 5FF6B 2J7LA 5HJ3B 4LIQE 4WW1A 3FO2B 1IEBB 3AB0C 4FQJL 4UZGA 4P2OB 3G6JB 4JHBA 1NDGA 1K3IA 4M43H 3ZKQD 3V6OA 1V3KA 5T3XL 4U3CA 5T3ZL 3DVGA 2NY4B 1BBJA 4CMMA 3CXHJ 4K3JL 2YBRB 3MV7A 3O2WH 2F58H 2Z31D 4X6FA 3BO8A 2R69H 4R0LA 2CJUH 5F3HA 3W9DB 2CUMA 4I9WE 4XP6H 1UJ3B 1TQBC 3CLFL 3JWNC 1MH5B 5GRYA 1B0RA 3GMRA 1NBVH 4AH2A 3UROR 2LU3A 3C08H 4GRWH 3X12B 1HOCB 3OGOE 2ZG2A 1UWXH 4P5MA 5TE6H 4K8RL 3DXAA 3GZKA 3UZEA 3MLXH 1T04B 5LQBL 3OGCA 3OKEB 4I0KA 1WCQA 3V4VH 3VI3F 5I8OH 3I2CL 2WM0A 5CHNB 4OGXL 1M6OB 1KJ2B 4WO4D 5MEOB 1U8MA 4XP1L 2HKHL 3HR5B 3JTTB 1PEWA 4PRHD 1EEUA 5ICZB 2VZTA 3D85B 2ZUTA 4XBGB 3DUUA 3PNWB 1NBZB 1H3WM 3RWHB 2OX5A 3QIBC 1Q0YL 3FFDB 1ADQH 2ATPB 3OPZH 1I7ZA 1PKOA 5I8OL 5ALBL 3VFMA 4PJDB 4XBGA 4GW5A 2YKLL 4QYOA 3X3FL 5F7DA 3VXSE 5I1GL 5I15L 5L0QB 3KPSB 4M5ZL 4Q9QL 4ZOCA 5B22A 5KS9F 4X5WB 1T0NB 4X7SL 4OV5A 4FOMA 1DVFD 4O58H 3UDWA 3CSPA 4PRID 4LVOB 3LEXB 4GKSA 4MXQC 5AWNH 4PRAA 4M7LL 1M7IB 4NJ9L 3K4ZA 2IFFH 1Y6MR 3WUWG 5C0IA 1RSFA 5E94A 2D0FA 4TSCL 4R2GC 5F70A 1OTUD 2XFXB 1MHPH 2X89D 4OF8A 5H35B 4XH2A 3PGCA 4WHTB 2A83B 4DAGL 4MJ5B 3LD8C 2R1YA 3IAPA 3O3DB 1CTOA 3HMWH 2J8UB 3JZ7A 3ZYZA 1N2RB 1H8OA 4DN3L 2EH8H 3BPLC 4U1IB 4KHTH 3RWEA 4KQ4L 3V0VA 2E3VA 2J6EH 2YRPA 3SKNA 3AS2A 1QZ1A 1QUNA 4HXAH 3FTGB 4YFDB 1NC4D 5ENWA 1WLHA 3GK8H 2Q1EA 4CMHC 5DD1H 3GBMH 3VGHA 5I1CL 1N3NB 4V2CB 2AJ3A 4FZ8H 1XR8A 3UX9B 4KZDL 1QR1B 3HAEA 3F6IA 5HHPA 5TE7H 4WO4C 3LKSA 2CPCA 2DI7A 1I7RA 3I9GH 3GM8A 4HMDA 4XC3H 3STZA 3ZKXB 1DN2A 2NY6B 2VXSL 4YPGB 2J8UF 4X5XA 2WUCH 4G6JH 2AK4B 5E8PB 3VWJB 4P9ML 4OIIL 3VI4F 1N5AB 3CU7A 2HT3C 3EOTL 1FVCA 1MH5A 3O9WA 4I18C 1BM3H 1L6ZA 5HHOB 1UKQA 1I1YA 4LLUA 3DROB 4ZYKA 5EBLB 4MXWL 1TZHB 5D7IA 3T3ME 5GGSY 2DQIH 3OSKA 1UM4H 1H3GA 1Z0NA 3PL6C 3KYNB 3EFFA 1YEKH 1A9BB 3GBNL 4LCCC 1F6AA 2VITA 5D93C 4OIIH 5DS8A 4APQC 3O4LD 3GSNA 4X7CC 5JPMA 2WBKA 4ONHA 4U6TA 3FOLA 1MREL 5CKAA 1UKSA 4PRAB 5E6YA 4LHUA 4U6YA 3F62A 1XGUB 1TZIB 4IRZL 1EK3A 2EEDA 2PKDA 3TP4A 1TJHH 4XNQB 4DVBA 1MHEA 2BNQD 3IU3A 2YZ8A 3HI1B 3D39B 1AFVH 4QCIB 3PL6B 1WCBB 3MV9B 3U6RB 1XEDA 1ZLUH 2JJSC 1KLFA 3QUXC 1X5XA 4IIQC 3MUJA 1VESA 1F4YH 4PP1D 5I9QB 5IFJA 3U9PL 4X9GA 2ARJB 4JKKA 3AAZA 3QXVA 3TV3H 2DLGA 1HEZB 1D6VH 2W60B 1MFCL 2Y06L 4X9BA 3ARSA 3P9MB 4U1JB 2FO4B 1SEBB 2CJUL 1RJCA 3BP7B 1NCWL 3G5XB 2H41A 5JIPA 1OSZA 3QNYA 4JG1L 2R56H 1TVDA 1QFHA 4POUB 1UVQB 1DDHB 4YHLH 2NY6C 4M1CC 4R4BB 1NC2A 4GT7A 2VNCA 4N0UA 4DGVL 2X70B 5J13C 1V3JA 1R3KB 4L5FH 4I0PA 4JFDB 4AG4L 1ZGLA 1IAKB 2R8SH 1BQLL 4HIHB 1F4XL 4LASH 4K7PX 5HI4D 4G43A 1VFAA 3JVGC 35C8H 1KACB 3B9KD 4KRNA 2XN9E 1IEAA 1DANU 4M62H 5EORH 3MBEB 5HHNA 2H6PA 1JYWA 4L8CA 4XP1H 3BEVA 3HE6B 1UWEH 3SY0B 4Y89A 5T1MA 4NBXB 3C5ZC 3UO1H 1KV3A 4M61B 43CAA 1U91B 3NBNA 2APBA 3N85H 4QNPE 4CNIA 2VISB 1DBBH 4HWUA 3V5DA 1DVFB 4OD1L 5EO9A 3MRGB 1QBMH 2F53D 3ZKMC 3SDXA 4MGXA 1MCDA 3DX7A 3DVFA 2CDGA 2R0KL 1W8OA 3QZWG 1OCWH 2VWEC 2Q8AH 1CDCA 4U7MA 4ZNEE 3T0DA 5F1NB 4N0FB 4X7SH 4JB9L 5C0CD 2DDQH 3V79C 3FZUC 3TIDB 1YECH 3CMOL 4LCWE 3Q5YA 1B6DA 1NMBL 5HHQA 4V2BA 5IB1B 2NLJA 3CXDH 1UKTA 2AJVH 4FXKB 5IEHB 5GS0D 3MGTB 3VXOB 1YMME 4O2FB 5T3XE 1MEXL 5HY9B 2VDOL 1YNTA 3GRWL 3OX8B 3MROA 1DUZA 1NUGA 4O5LH 3V4UL 5HI4C 4YDVA 5FEBA 9CGTA 1BQHB 3QQNA 4PB9L 4GQPH 5CJXC 1QFUH 2V2TA 3E0GA 5GRJH 4GRLB 3SGDI 5DGQA 4S2SB 3QI9A 2Q3AA 1KFAL 4OFIA 3CFBB 3WKML 2VDLL 1IAKA 4H8WL 2P5EB 1WAAE 1T4KB 1F4HA 3LHPH 3QIUC 1D6EA 1G7PA 1V7NL 3O2VL 3L3KB 1ZEAH 5AUMA 5FUOL 4CRPA 3U7AA 5HBBA 2ADIB 1CFVL 1A6UH 3NACH 5CBEA 1CFSA 5CCKL 3FONB 3ILPA 3CFJA 3GMMA 2YD7A 2X4UB 5J13B 4XNMA 3EHBD 1HH9A 1X4YA 3MCLH 5IHZB 4XCCH 2AV1A 4OZFG 3LQAC 1MCHA 1L7IH 4HHAB 5GZNC 3ARDD 1OD7A 4LLWA 1A21A 2J1KA 3SDXF 2HJKB 4GW1B 3H6JA 1BVLA 1ES0B 3THML 3GJEB 1FL6B 3IFNL 1WC7B 4PG9B 1FV1A 5EIQA 2R1WA 4NKMA 5DRZA 4FQJH 15C8L 1Q9KB 3HG1E 5CBAA 4P5KA 3SO3B 2YD4A 3NIGF 4TUJB 2O93L 4YXHL 3BP6A 5FB8B 2X09A 3V8OA 5AEAA 1CWVA 3QRGL 4Y4KB 5I76A 3LIZH 1FDLL 4L9LA 4APQD 2NW3A 2F58L 5EWIL 2GTZA 1KCKA 3ECBB 3SKJL 2G9HA 2YD6A 4MA8H 4MNGA 5FA4A 4WUKH 4L4TE 4Y4HD 3NH7L 2W0FB 4G8GE 4Z76B 4DTGH 1B4JL 5ACLA 3HLAA 1TZHA 5D7IB 2GJZB 4WCYL 5TDPA 3IVKA 1RZGA 2L4OA 3SJVE 1JGEA 1E28B 1A2YA 4N9GB 3TVMC 2HT2C 4D0CA 5HGGS 1PZ5A 2NTFB 1QKZL 3JWOC 5F72S 3HE7A 4GLRH 4X7FC 3SDYL 4NN6B 5IG7A 5E5MA 3PP4H 4MS8C 2VKXA 4XAKE 1TLKA 4WI8A 3TO4C 3HPLB 4AT6A 5EH1A 3DTXA 2UZIH 4EUPG 4MMXC 2VE6A 1ITCA 5DR5L 4QTHA 4P4RA 3QNXA 1N5YL 3SCMD 3VGGA 1FGNH 1O5DT 3ARBC 3KYKH 2CH8A 2DQCH 3IETA 5FYJE 2KH2B 1AC6A 4XAWL 2HTKD 1ZSDB 4F2MB 2YPVH 3RL1A 4N5EA 1EHNA 5ALBH 1BFTA 2KUTA 4PJ9D 2EDWA 5TQ0H 4XPBH 5LCVL 3OJVC 1KCVH 2NX5E 3LQZA 1CK0H 3H7BB 5HYIA 5I19H 5CP3A 4H5SA 4G9DA 4LASL 3P77B 5J06A 2BK8A 4FFZH 5MERB 4GRMA 2CR6A 3KYKL 4YGAB 4H0HB 2F5AH 4OKDA 2MCG1 5FCSH 3ZTNH 3DX6B 4FQIH 4YNYB 2X1QA 1T5XB 1NFDE 1CDUA 4R2GD 3MODL 4PLKD 3CCHA 1NDGB 4G3YL 2BSSA 2D31B 2PW2B 4J7RA 1RK0B 1ETZB 3TGXA 2B2XH 1CGXA 3EYSL 5L6YH 1P69B 1HHKB 4FS0A 4R90L 2VLKA 4LFHD 3BD4A 3OGCB 1IT9L 2DN7A 1T22B 4D94A 1XF5A 4IRSC 2MKWA 4Z77B 2C3WA 2DMBA 3TN0B 1MCFA 1MWAL 2AJ3B 5E0QA 2XA3A 4LSPL 3TWCH 1F58L 2Q76B 3IU4H 3QHTC 5TQ2H 3ULVE 1MEXH 3EAKA 4LCWB 3IS0X 4XNYL 3ULVC 1RI8A 3MRRB 3C2AL 3EO1B 1B0RB 4L9LC 1NGQL 4YAQB 4XX1E 4L8BA 1OTSD 4B53A 3B9KB 5ID0B 5GJTL 3U0TA 3S9DB 2UZYB 4KRPC 4CU8A 2DTML 4EI5C 1U3JA 1JNJA 3A67H 4YDIH 4WDIA 2X4UA 1A4JB 3NN8B 5F89A 4MD0B 3QEQE 3ZL4H 4KK8D 1NFDA 3WNKA 3ULVF 3RI5K 3ARVA 3LQZB 3FB6B 4U6HB 5ITFB 2GK0B 3IJHB 1TZGH 2V6HA 2HG5B 5C0EB 3MLYH 3B5TA 1BAFL 4WEMB 1W0WA 2BMKA 4IEFB 5FYJU 1N7ML 1O7VA 3E6FA 5L8LB 1BF8A 1RZKC 2NY2B 3WLWD 1IGFL 1I8LC 2F8VA 1FO0L 4P5KB 2BMKB 2MQCA 2ZOKB 5FCUH 1F4WL 4HUVA 1TITA 1ETZA 5LXGH 5I1LA 4P3WA 3OKMB 4ZFOB 1RU9L 2EIEA 4CVZA 1L7TL 4D0CB 4JPKL 5FK9A 4UQ2A 3FL7A 1U3HC 5ID1A 5D8JL 1CGUA 5HY9A 3CUPB 3H0TA 1DLHB 2X9YA 1LK2A 2XWJA 3V6FA 3GMOA 3B9KA 4UOW0 4Y4FA 4PJFE 1R24B 4MAYA 1NBZA 1KG0B 4KUZH 3CDGA 2N7AA 4F33B 4HZLA 3QULB 1BQHG 1OP3K 4P4KB 5I1HL 2ORBH 3BZ4B 2Q8BL 1TJHL 3FO2A 4Q6IA 5EU6E 1DZBA 3VD9A 2RJMA 3VWKC 3RY6C 4HULB 1QFWM 4I3GA 2YUZA 1Q72H 3TBYA 3OR7A 5T5NF 4MAUH 3REWB 3S36H 2HWZH 1AI1H 1A47A 4P2OC 1CD8A 1ZGLP 4NQVB 4LGRB 3H9HA 3UPCA 3L1OH 5D7LD 1KTDB 4AYFA 1KPUB 4FP8L 4R96B 4JQVC 2R0ZH 1P7KA 4LSRH 2ZUYA 4HGWA 2E9BA 1QYGL 3KPSA 3D25A 4MD4B 3RX5A 4DVRL 5E5MB 5CD5D 4NM8H 5DJ6A 4CUCA 3IDNB 4ZOBA 3W9DA 5EIIA 5LVEA 3QFJA 1P7HL 2OZ4H 3GI8L 1J0IA 4ZUVA 4BFGA 4YJZL 4YHZL 1RUKL 4L8CB 4UTAH 4C57C 3R1GL 2G2RB 4MD5B 3SBWA 3CFDB 5EC1B 5HYSB 3D69A 2IGFH 1IGJA 1KEMH 4HS8L 3CC5A 5EU3B 1U8JA 3I84A 3WJJA 1X5KA 2OR9L 4WV1A 3D2UA 3GHEL 4FQXB 3OKNA 4KVCH 3FAXA 4ZO7A 1PG7X 5CP3H 5E2VH 2VIRA 3BJ91 2A74A 2CK2A 5C6TL 3O4OC 4LGPB 1JCKA 5L7XL 2E7CA 2EDJA 3W81A 2HRPL 4G6KL 4BUGA 5I75B 2YPLD 3GMPA 1SEBA 1BPVA 3DV6A 2NX5B 4KXZI 4UIMA 2DQJH 1BIHA 3HNVL 1JNLL 2YMXL 1GGIL 4NT6B 3VXUE 3S6CA 1HZHH 1FFPA 3UZVB 5E2UL 4CGTA 5D2NE 3CX2A 5FO9A 3GMRB 4PLNC 4G3YH 4P4KC 3C9NB 1MCWW 4OZHF 3BD5A 1QBLH 1EAJA 3VDBA 3SY0A 5ESVB 4J3XA 4WHCA 2BSTA 2R23A 5GGVY 3QH3A 3IXAB 1M7XA 3CNKA 4C56E 5D72H 5BV7B 3DUSA 1Y0LA 4TVPE 3U4EA 2C3VA 1IAOA 1A6WH 4RFNB 2VDNL 1TCMA 2BSRA 2GTZB 1X9QA 1JZ5A 1XZ0B 4Y4FC 5HGHA 1I8KA 4HJ0C 1H5BB 3H3PL 4N8PA 5DK3A 1CFNB 4KDVA 3UZQA 3VXTB 4ZMAT 4QXUH 4ZNEA 1S7VA 5FYLD 1EO8L 1Y18B 4R26H 5D1XB 4NC2B 2H3NA 3QUXB 5EO9B 3R06A 1DBAH 1IGMH 1IE5A 5AAMA 1QTYT 2V2TB 1LEKA 5GRVL 1D5ZA 1AR1D 2OMNA 5SX5H 4ZUUA 2ICWJ 43CAB 4WENB 4HWZB 5F1OB 5ANMA 3CK0H 1TTFA 4JFOA 1NCCH 5EN2B 4Z5RA 5D2NA 2VO5A 3EOAB 3ETBF 4LF3A 2ZG1A 1UEYA 2OSLA 4AK1A 1P7QD 4PTUA 1LDPH 4NDMB 4HGWB 1V7NH 2VDPL 1ZVSA 2Z92B 4QXGH 4GBXD 1EEZB 1AQKL 4S10A 1HWHB 2XN9A 3P4MA 4P57A 1ZLWK 3I3BA 3GSOB 3RWGA 4IMLB 4JO1H 1TFHA 1WWCA 1B2WL 1FH5H 4EJ1C 2XZAH 4JFHD 4PLOB 1YEFL 1RMFL 3NOIA 1WK0A 3WO3B 5E1HB 1P84J 2ZKHL 3LDBB 1EMTL 1Z9SA 5EFIB 5D1XC 5GGQH 3V0WL 1KTRL 3V4PL 1NMCB 3QWRA 4YBLC 5MENA 3UAJD 1F6FB 2W60A 1SJVA 2UY7A 2UVEA 3ULSB 3U7WL 4P2RA 3VD7A 3MR9A 4KUZL 2BJML 2XZAL 5DD5H 4K3GA 3I6LE 5JZ7C 5DEGB 5KVDL 1GIGH 2FR4B 2V2XA 2PYEB 1XH3B 2YA0A 3QG7L 3PABA 2PXYC 3MV8A 4M7KH 4ODXA 2FIRT 4RGOL 4V3EB 2K7PA 4G8EA 2X4SA 1HQ4B 4LDOB 3QFDB 5C7XL 1C8PA 3I6GA 1AI1L 1KPUA 4WWKA 3DGGB 1S3KH 2D9CA 5CEYA 3TN0A 2V5TA 4IHOA 1JYNA 1B4JH 2NY0C 4QF1A 5KJRH 2X70A 5HYJB 2B4CC 1C5CH 5JQHC 1BREA 3GSWB 1MIML 5I30H 1QRNE 4XXDB 1DBMH 3PWVB 4JJHA 1NH6A 1BEYL 2BDNL 5JQ6L 4NKIL 5IEKA 3BGMB 5TF1H 3DARA 4O9HL 3MYJB 1HQRA 4MQXC 1BFSA 2EIBA 2I9TB 5BS0B 1CI5A 1R0AH 1CXFA 2ID5A 4X83A 4NN6C 4WGVB 1V7ML 4R2GB 3H0TB 5IK3B 2WP3T 2SEBA 5C0CA 1H0DA 1SMAA 1VEOA 2JB6B 3HN3A 2FLBT 4Q2ZB 3EOTH 4FFVC 1HH6A 2OTUB 1U58B 3DNKA 1VSCA 5I1LB 3MRLA 3BW9A 3UBXG 3QCTL 3QEGH 1BOYA 4U2YA 1E4WL 3D9AL 5L9DH 4NZJA 2JKXA 4XPHL 4ZFFA 2FATH 1E6OH 1YNLH 1C08A 4B41A 4PYHA 1RUQL 3QQ9C 2IH1B 5CEXB 2X41A 5DJCB 1S7TB 1QR1A 3QEQA 3UMTA 2VLKB 3WKNA 3E3QC 1QHOA 4NC1E 4ZFGH 4LLVB 1AC0A 3P4NA 2MJWA 5DJXA 3RWFB 3WJLA 2Z35B 1OT1A 4KRPD 2AJUL 3KPRB 4Z0BL 2GJ6D 3CC5B 1GGYA 1HH6B 4EZMA 1K4DA 5A2FA 4WW2C 4HX1B 2F9BT 1JRHH 4OUUA 2ZPKH 2DL2A 1TJGL 4OBRA 2Q6WB 5IHLB 2YD1A 2BHZA 1EAPB 1GC1H 1MRDL 1JGEB 1YEGH 1KCUL 1YY9D 3Q5OA 3ARDC 4NRYA 4Y4FB 5D7LA 3TF7A 4H1LG 4JFDE 3UJIL 5CD5C 4FFWD 4ZUVB 1DCLA 4MNHB 2ICWI 1I1YB 4LLUB 3LSOA 4QXWA 2A2QT 4MDJB 4HWNA 3D85A 4OI8A 2IBZX 4N0YL 5ITBL 4PJ5E 1KIRB 3CMGA 3FT2A 4TSAL 4I1NB 1I1AD 3TJEH 4P2OD 4L3EB 4Y4HB 5JXEC 2ZOKA 5F21B 4PDCE 2HFFB 1MCWM 1MFCH 2Y06H 4QF1B 1NL0L 2Q7YB 5J0BA 3NACL 3S36X 2EYTA 3B5HA 2FYYA 4WI5A 3RKDC 1H8NA 3RNQB 4JO4L 4XGZB 1JMXA 2PF6A 2V9QA 5DJZA 1HCFX 3LRGA 5EU6A 5AZEH 5BO1H 2FX9H 5LBSH 4U1KA 5ECJE 3VXSA 3BW9B 5DS8B 1AR2A 3WN5C 3SE4A 2HJKA 2J5LC 3MA7A 4RMQA 4KI5F 1FL3B 4MCZB 1KJ3L 1QRKA 1TZGL 4Y8DC 2FR4A 3O4OB 2XQYK 5D7IE 3F58L 1A7RH 2ICEB 3EKCA 5E2JA 3VXNA 3PIQB 4X6FB 4JFXA 4NNXA 5CP7A 1FFQA 1J0KA 3KPRE 4XCEA 3I6KB 3LEYH 3TT3L 4Z7OF 4W6YB 4L9DA 2B4CH 4LCIH 3ULSA 4M7LH 1KCGC 5TDNA 2Z35A 1J7VR 5C07A 4Q6YA 4CBPA 2P42B 4NNPH 2GT9B 4U1HB 5E6IB 4Z9KB 5JDJA 3WJJC 3TA3B 2L0DA 1MAKA 3QIWB 4PUBL 1N4XH 3INUH 1U93A 4XPGH 2GAZA 3H42H 3ZMRA 2Q7YA 1ITBB 5IT2H 4ODWA 4LKXA 3OAZK 3QIWA 4M6AA 5D96C 3SE9H 1F13A 4S2SA 4WTZG 3K8MA 2XQYG 3HR6A 3WHE0 5BW7A 2VDKH 2GK0A 3U9UB 4XBEL 2I60L 4ZTPL 3GRWH 2Z0BA 4YQXH 5MI0B 4BSVA 5I17A 2E27L 3DXAE 2YD3A 3VU2A 3FQUA 3B6SB 5DUPH 4XVJH 1IQDB 2X4PA 5D2NB 2MPAL 1U42A 2Z91B 4J6RH 3IF1B 2HFEB 3KWWA 3T65B 4RRPA 1QLEL 1TMCB 1KCRH 4UT9L 3ILPB 2OMBA 2QBWA 3C60C 3JTTA 2RIKA 4XP4H 4MYWB 2WBJA 2KPNA 3C5JA 4G6JL 5IQ7L 1OAQH 5T5NG 4DEPB 4HK3J 4RA3A 2X9XA 3S3SA 2Y1VA 2NW3B 1FFOB 3HMXA 5DHVA 5IB4A 3GSUB 4GKSB 1JJUA 4JN1H 1G0YR 3RU8H 3SDDB 3OKKB 1MAMH 3X13B 2D7TH 4XWOC 3G6DH 2A6JB 4LNRA 2VDLH 2CSPA 1J0ZA 2BRQA 4MXVF 1NCDH 2GKIA 1A1OB 3L7FB 3SKMA 1M7DB 1LE9B 2HVJA 1CDGA 1UM6H 2FEEL 2OSLB 4XPFL 4PJDA 4GBXC 4GLRI 1LK3H 1K4CA 3L6FA 3TM6A 1EVTC 3SE8L 4JFQB 1P1ZA 1BBJB 1I3UA 4HC1A 2Q6WA 3FT4A 5BXFB 2ICWB 2R2BA 5F7YC 3P11H 4P46A 1OW0A 3B2UD 5EBWA 5I1EH 1OLZA 1I1FB 2V2WA 5MP6H 1P53A 2WLYA 5FHAL 5EU7E 3MGAA 4OUOA 1OQOA 5C1MB 2FL5A 3MUHL 2F5BL 2LTQC 2R39A 4JFFD 3BKCL 3MRBA 1H3VA 4HIXL 3A6CL 4LPTA 1X6NA 5CSZB 3NCYP 4E41D 1Q8MA 4JVWA 4PJCE 4PJ8D 3MRGA 4DTGL 1U8JB 3I6GB 2QL1A 5I74C 1B3JA 4DN3H 2PXYA 3V6ZB 1A14H 1Q0XL 3S96A 3WLBA 2Q87A 3KLHD 5SWZA 1HYSD 3KYMB 3IJYA 1BD2D 4H20L 4N8VG 4OJFL 1U91A 3G04B 5JO5A 1IILE 4L4VE 1XGYL 2V2XB 1IM3A 1CGSL 4OV6F 2X89A 3I2CH 4LLAA 2DD8H 3SDCD 2DQFA 3H7LA 3HZVA 3W0WB 3KPLA 5DD1L 1ZA3A 1AJ7H 4FZEH 1H9VA 3JWOH 4E0RA 3PWPB 2VLLB 5CBEB 3KPMB 1LP9F 3D3VE 2VYRE 4LFHG 1G6RA 4MNQA 4OZHA 2IMMA 3DJ9A 5E1AA 2VRAA 2DL9A 5DURB 2Q3ZA 3GSUA 3ZKMD 2BOBB 2PUQT 4PV9A 2JJVA 4FQPA 3RGHA 4OLZL 4Y4KA 5C07D 3RNKA 5FHBH 3OTTA 3RL2B 1WSST 3DX7B 1TETL 1F8TH 1KEGL 2WBJB 1SYSA 4UUJA 3QI9B 4YC2B 5IOPA 2ICWA 5CJQL 3OXSB 2CDFB 3BDYH 4Y2DA 1D5XA 3EUUA 3VE0A 4ODXB 5F7EL 2HFEA 1T1YA 3ARBB 4LLQA 4ODSL 5I15H 1IGYB 3VFVA 3L6FB 4NBZB 5T1KB 3HZKB 3HNTH 2BHYA 5ID1B 1E4KA 3BPOC 3F7RA 3RVUD 5CSBA 3BEVB 4G42B 4JANB 1PX3A 4W6XB 4ERSH 3ARBA 1GOHA 5CAYB 3VXMD 1OGTB 3OAZH 1RJZB 1NCUA 4QRTB 4PREA 2H8PB 2R29L 1AH1A 4HAGA 5FO7B 1R3IH 3D0LA 5T1DH 4XAKD 4RCAA 4JLRB 1FVDA 5BVJA 4ZS6C 1AKJD 4GBXA 4MQTB 3MXWL 3WFHB 2NY6D 4M1CD 1KIPA 2NY3D 1RZ7H 5GGSA 3SDDA 4LSPH 4DKDC 4ZTOL 3HNSH 3SPVB 4X6CE 4YHPB 4LL9A 4M93B 4UOJA 5CINL 4I0PB 2BHUA 5IM7B 5DD5L 5I73C 3X14A 2XY1A 1X4ZA 4BSJA 4G8GD 3CU1A 5F44A 4L8SA 2ADGB 4MJ6B 3MNZA 3AS1A 4L4VB 3PWUB 2C3VB 4IM8A 5KZCB 1D5IL 2CLRB 5EBWB 4JZOA 3SJVD 4XPTH 2EKSB 2GHWB 4ZUSB 2IBZY 3PWPA 4AM0A 3C8KB 1UFUA 2XPGA 4OT1L 4YHZH 4PTTA 4LK4A 3HS0B 1A1MA 1L4IA 4KQ4H 3F7VB 4GFTB 4PBVC 1TMCA 3EFFB 1WIUA 1KENH 3RFZC 3MOAL 4YHYB 3HC0B 2XWJB 3S4SG 4JFXB 1UQSB 3OB0H 2VDQH 3QIBD 5EIIB 2IAMA 1K5NB 4YHLL 3MLYL 4NOFA 3RAJL 4ONGH 3OKMA 1RZKH 1YC8A 4BQ8A 3BT2H 4PRNB 5FYJH 5E00B 4PJXB 5EU6D 4Z7UE 2AI0L 5FA3B 4XCFL 3VCLA 3FHQA 2VTFA 1L9MA 3BPOB 1U9KA 4G9FE 5JHDD 5JHDA 4M8QB 5ICXB 1MSPA 1JV5A 4W4OC 5GRVK 1XGPA 3NZHL 5HGBB 3DHJA 2QADD 2QKIB 1EBAA 5F9JA 3QUZA 3QUKB 4NN5C 3X3GH 2WUBL 4NSKA 4GW5B 4JGMA 5E9DD 2NZIA 4JDVB 2FGWL 4XVSL 1LWRA 3T8XA 1GZPA 1YN6B 4EXKA 2I9LA 4MX7A 4XTRC 5D9SA 4OAWA 5GGUA 2DS4A 4WFFD 5C3TA 2YD2A 2B1HL 2DLFL 2NNAB 4K7PY 1I85C 1U2CA 2H6PB 5C2UB 1KLUA 3QNZB 3QQ4A 4DCQA 5GS1B 2DM3A 3ILQC 2IANB 5C8JB 1P4LB 2VLJE 3WIIH 5CFHA 5JPNA 4TTDC 3RUGF 3QUYA 3DMMC 2WIIB 2OQJA 1I7UB 5F9WB 4M43L 3ULVD 3MBXH 4HLJA 3SCMA 1A8JH 4N0UE 5EBMA 5I1JL 4ETQA 5MHSE 2QSCL 5CMAA 2ATKA 4NHUE 4OV5B 1BLNA 4JRWA 4P2QD 4JY5H 1LGVA 4I2XE 2HFTA 4XMKH 2YOCA 2AABH 4DW2H 1JWSA 4QRPA 4TSAH 1BHGA 3N9GH