4L8DA

Crystal structure of the h2db in complex with the np-n5d peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8dA01
4MX7B 4P5KB 1ED3B 1JI1A 4S1SL 5DMKA 4PJXF 3DGGB 3UTSE 3CU1A 2FEEI 5IMMA 5D6DA 5E1AA 1U8NA 5HYJA 1OB1B 3H7LA 4PRBB 5IW3A 3SKJH 1Q0XL 4ORZC 5D5MB 3AUVA 4ZPVB 4I2XB 1BJ8A 2W1NA 4TNVF 3SKOA 1UZ8A 2HLFC 2DMCA 2WAHA 5SV4A 2Q86B 5F44A 1I1YB 2ATKA 3NZ8B 4P2OB 4P9ML 2NTFB 3B43A 5I1LB 1JHTA 5T5NG 4HT1L 2NY5C 1LP9F 3RFZC 2DOCA 3JTTA 3GSRA 1A3RH 3KPRB 8FABB 3ALPA 4JG0L 1J8HD 4RX4A 1QLFA 4JFQA 2XWBB 1G0XA 5H94B 1DLFH 3ILPB 4K7PH 3U4EA 5ECJE 4QCIA 2V5MA 4FQ1H 5KSUA 3RTQD 3L5WA 4L29A 5GISL 3Q1SH 4K3EH 4U33A 1QACA 2EE3A 5IT2H 3I50H 2P46B 4ZS7H 4MJ5B 5FB8A 5FYKU 3ESVF 1U3HB 4L3EA 1JZ2A 3QR2A 1DN2A 3C2AL 5GGUB 1U36A 2BSRA 3N85L 3WBDA 2NY3B 1ORQA 5J1AB 2NR6C 3B2VH 2VITA 4XNUL 2E8YA 4OI7A 3GSOB 1AGEB 3ULUL 3WFHB 5H2BA 4ODTH 3SDXF 4HS6B 2OQJB 4X99A 3CXDH 1Q72L 1B0RA 2A0LC 1LO3H 3D87B 5E6ID 4HUUA 2OK0L 3DX6B 3FZUC 3GSQA 3I3EA 1VACB 1IC7H 4JFFE 3OG4B 2DLHA 1LHZA 2P8LA 4P2QE 3UYRL 2PYFA 4PJDB 1BD2B 4LAQL 4ALAL 1L7IL 2FJGA 4IOFD 2VL5A 1TJIH 3SDDB 4KV5E 1T0PB 4QF1A 1YQVH 2E6PA 5FYJE 5F7EH 3FONA 1MCDA 3SGKC 5B38G 2MHAA 1DQJB 2VZSA 1GL4B 3QP3A 3IDMB 3Q6FA 1G7LA 1N2RA 4XBEH 3BISA 1AGBA 3RL1A 5I6XC 4EVNA 1HXMB 1K4DB 4NJ9L 4PGBA 4A6YA 2Z35A 5CILH 5GZND 2FDBP 4NNYB 3WJLA 4JRYA 2DB8A 3MLUH 1T4KA 4LFHG 4JO2H 4UQ3A 4OZGA 2IBGA 5ITBH 4HKJB 2LAGB 1GVIA 3O11A 4M03A 4RZCA 5I19H 4FQCH 4NRXA 2ILLA 5HTSA 1HHHA 3CAFA 3FT2A 1CLOH 4V3EB 5ACLA 1MCLA 2O5XH 3HE6C 3SDYH 4PY8I 5M95B 4G7YH 3T65A 3CDFA 3DPBA 3QBTB 1ZEAL 2BOBA 4AYFA 1OCWH 5D2LB 2DQTL 3DMMC 4MAUL 2DWEA 3D0LA 1U92A 1FH5H 1RVFL 2OTPA 5DK2A 3GSXA 3VFVA 4DZBB 2YA2A 4JANB 1UEYA 5H37G 1IQDA 5F6HI 4FZEL 3TN0A 3BD3A 1NAKL 3K3QA 4U6HA 5EU5B 1TVHA 2P43B 3WHXA 3SBWA 3V6OE 4BYHA 1W0WB 4OLXL 5CAYB 3QUXC 1XF3B 4NQCA 2A77L 4FQQB 1UQSA 2FBJL 3AMLA 2DM7A 4GW5A 2GSIB 4OCMC 4NO0D 3BE1H 1B2WL 2IQAB 5EOCJ 1JPTL 3C09C 4NM8L 1TITA 1GGUA 5ALCH 4I18C 3NPSB 2CRZA 2OX5A 1T0NB 3FO2A 5DJ2B 3EYSL 1TVBA 3LQMA 3BH8A 3EHBC 4LLVB 1OAZH 1KJ3H 1NCUA 1T3FB 5GIRB 3NCBB 5C0IA 4CN6A 1F2XK 1W8NA 2E7CA 2IFFL 1V05A 2PW1A 3RRQA 1NCDH 5JR1H 3IFOB 2BVOA 4Z78A 3V9FA 3LQAL 4R7DB 1EAPA 3J7HA 3MV01 2CO6B 4JO4L 5MHSE 3GJEB 5JNYB 2Y5TA 4MLSA 4PGEB 3RWFA 4HKXA 1P53A 3GSWA 5EOQH 4APQA 4N90D 1I3GH 4YXKL 3PWPE 3LY6A 1V7ML 1JPST 1XGQB 2IEPA 3L3IB 1KB5A 1ZA6B 3CH1A 5BW7A 1CGTA 4C83A 4XVJL 4XT1C 3H42H 2DM3A 4QOKA 4NQXB 2OL3H 5F93C 2A6DB 3SQBA 4OZHB 3RVTD 4J3UA 4LF3B 1BZ9A 1FPTH 3HUJF 1FLRH 1LE5A 3VXNB 3WLBA 1N0XL 5FDYA 1AR2A 4PJFB 3TVMB 3HFMH 5DD3L 4K71B 2YPLE 4TN9A 5L8LB 1HKFA 2DQHH 3IETB 3TV3L 3TO2A 2XZAL 4KY1H 3ZL4H 3ULVD 3L9RB 5L2JA 1I8LC 2FL5B 2BNQE 3O3EA 4PUBH 5D1ZC 1A1OB 3B9KB 4JDVB 1GC1L 4WI2A 1J5OL 4BM7A 4DW2H 3RY5A 3MNWB 3CU7A 1IL1B 4R0LC 3P4LA 1OARH 3HNSH 3SGJC 5DEGA 2C3HA 2K7QA 2VXVL 1U91A 3MRRA 2P8PB 4D2NA 5BZDB 4E41A 5C0CE 3DWTA 3GDBA 2VZVA 2BNUB 1G9ML 4K7FA 3K8MA 4KK9C 3Q3GB 3DI3B 2PR4H 3C6LD 2AAVA 4NQDD 4I0PD 1T5XB 3VGAC 2DYPA 1X5LA 3PV7A 4LAJH 4P5TA 4I77L 4G59A 7FABH 3QDGD 3MLYH 1MFBH 4ONFL 4PG9B 4PR5B 2UZIL 1KCSL 3DGGA 4Z7QE 1EXUA 2V2XB 1U6AH 4OF0A 1OB1A 4PRBA 3FHQA 1MFEL 4UI2A 1IEBB 3OSKA 5D5MA 4ZPVA 4NFCA 5CEZL 4TOYH 4YQXL 2IPUG 1BBDH 4C56E 3O6FB 3U36B 2Q86A 3NZ8A 3OB0K 4FFWD 5LQBL 4P2OA 3CX2A 2NTFA 4Z7UB 5I1LA 1BM3L 1DP0A 3EO9L 3GGWB 2ZG2A 3KPRA 4BH7B 4Z6AT 3O9WB 5C08E 2JCCE 5H94A 3ILPA 2IBZX 3IDUA 4W4OA 3L5HA 1TZHA 3QDMD 4GKNB 1F4WL 2J7LA 5D2NE 4F58H 4P23B 4X6FA 1U3HA 5F9WC 6FABH 2A6IB 3WIHA 3A6CL 5GRYA 1NCAL 3AY4A 1WLHA 4OGXH 1PQZB 4QY8A 1I8IB 2ARWA 5J1AA 5AD0A 1MRFL 1X44A 3BGFC 1B90A 4LHUB 5IROC 5BOPA 3GSOA 1AGEA 1RZ7H 3WO4C 3WFHA 5JHLL 2W65B 1QG3A 4R4NC 3NH7L 5DFTA 1R3HA 2DKUA 4ZNEA 3Q5TA 1F97A 3TNNB 3CXHJ 3DX6A 1XGUB 1DBML 1O0VA 3HLAA 5T1DH 4MCZA 5F1NB 43CAB 3MRGB 5D93B 3I9GL 2CDFB 4LMQI 4JCLA 4PJDA 4LGPB 5J11C 1RUKH 5D96B 2QR0B 3BI9X 2BFVL 1E4KC 1BGXL 1FZKB 4U0QB 5DLML 1RUML 5JXEC 3FQNB 1IC1A 4KXZH 3SDDA 1GGIL 3MLTB 4EI5B 1SJHA 1U95B 5DJ6B 3VGHA 1N7MH 5DC4B 5HVFB 5I30L 1DQJA 2FX7H 1IGTA 1P4LB 4FTVE 4XRCB 3S37L 5HHMD 1Z2KA 3SKNA 5HYJE 3QPXH 1FBIL 1HXMA 1K4DA 3RQ3A 2R0KL 3WFEL 4N68A 4KQ3L 4FQLL 4NNYA 4Y4HD 1WBZA 1EJ6A 4U6VH 4WCYH 2X9WA 4HKJA 4OAWB 3NAAL 5JW4N 4M61A 5EBWB 1YEIH 2XRAH 4KK8C 1IT9H 4RCAA 2LE9A 2WBWB 4FABH 1U8OA 4MA1C 5C0AD 1VPOL 1NUDA 2XNAA 2Y5EA 3BFOA 5A2IH 4YJZL 5I16B 3V7AE 3HMXH 1X5XA 4X5WB 5DJDB 3QRFM 2Q20A 5IB5B 4MYWB 4OGAD 4JFYA 1LEIB 4YK4B 2VQUA 4JANA 1FNFA 4BK4A 2XYCA 5FUZH 1WAAA 4LQFL 4P5MB 3SHSA 5TE6H 2CGRH 5EU5A 3QEGL 1E6OH 2NYYD 2W9DH 3MGTB 1LQSR 1RZKL 4LVNC 3CXHK 4LCWB 5E5UB 3NIFE 1A4JA 4OCRH 1XF3A 4DTGH 4FQQA 1WFTA 3MV9D 4MAYB 4YFLF 4RMSA 4DGVH 4JDZB 2IQAA 5GS0L 3RJDA 3WXVH 2ZOLB 3WXWH 2J88L 4GSDH 3PDOB 4OCXL 1N59B 4TPRL 2GT9B 4OT1H 3GMQB 3UO1H 2VXUH 3MC0A 3VD4A 4R0LA 5GIRA 1T3FA 1QSFD 2GY7B 4GKOA 4MD4A 4G3YL 1KTDB 2APVA 5DI8B 1K6QH 4JPWH 3EYQC 3CIQA 4ODVL 4Y1AD 4HJ0D 1WC7B 1NANI 3IFOA 1TTGA 3GRWA 3WEXB 2BJML 3GJEA 5AAMA 5DS8B 4ELKB 5JNYA 1JGVL 3WNLA 3ZKXC 2XIDA 4QTHA 5MERB 3VXOA 4HAFA 1S7WA 1YEJH 3L3IA 1JNNL 1T1YB 1ZA6A 1J8HB 4N0UE 4FMFA 5TF0A 2NQCA 2ZCLH 4NQXA 3DRQB 1SQ2N 4OJFL 1CDIA 1KCKA 3DVNB 4YFLI 1DDHB 3RTQB 1XGPB 1M05B 2J5LB 3T08A 4AT6A 4LF3A 4DKFH 1MIMH 5TDOA 5J6GB 3EDKA 4JHWL 4FFYL 4P49A 3QYCA 2BNRD 3VXNA 1KEGH 4YR6B 4FFVC 4PJFA 3TVMA 5KVFH 1TZIB 4UDTB 2HTKC 4K8RD 3TBWA 5IGXL 4UV7L 3IETA 5B4MC 3RX8A 1N6QL 1KJ2B 2YXMA 3FQTA 4PJIF 2FL5A 4U1KA 3O3BB 1T83C 5DRXA 4DUWA 2IADB 1A1OA 3BKCL 4JDVA 5LAXA 2WNGA 3ARDD 1JWUB 2NY4B 5E6IB 3SE8L 4JFDE 1KN2L 1RFDL 5F96L 4NQCE 1IGIL 4PTTB 4NKMA 5HHNB 1MSPA 4CDGC 4ZO8A 1AE6H 4JM2C 4WW1B 3NFPB 4YEFA 1FQ9C 3SO3B 1H8SA 1LNUB 2P8PA 3HI5L 3VW3H 4NHUE 4GW1B 4RDQG 3QI9C 3RX5A 5A3ID 1DR9A 4XWGH 2BNUA 1F58L 2JJSC 5GSRB 4POYA 3GIZL 4LOUD 5JHDD 1EO8H 2Z8VC 3Q3GA 4MCYA 1CE6B 3KLAB 5GRJH 3MLZL 2LVCA 2X4SB 1T5XA 3PHQB 4F2MB 4LFHD 4ZUUB 4ZUTB 1YNLL 4PG9A 4PR5A 3RU8H 3VD5A 5I8EB 4NO2B 1WWWX 1KXVC 2WLZA 2ADFH 4U2ZA 4B0MM 1IEBA 5IP4A 3DURB 4RA3A 1CN4A 4J4PC 4PJ9D 3O6FA 3U36A 5ANME 5E7BA 4JY5L 5F1OB 1NBYA 1AHWC 2CLVA 2F15A 4QHNB 5AG8A 2D0GA 3ARED 3EOTL 4R96B 4J3VA 1QSED 2FX8L 3T2QA 3LKQB 1PG7W 1HHIB 4WO4D 1R3KB 1FO0H 5F7WC 3REVA 4M6OL 1JTTA 5ICXA 1ADQH 3ZMRA 4GKNA 1YN7B 2AJYH 3VFRB 3JV5A 4Z7VF 4YFDB 3QFDB 1SHMA 2GAZB 2A6IA 3I6LE 2WUCL 1MELA 3EYFA 2P1YA 1ITCA 1PQZA 4RA0C 1I8IA 4AK1A 2EDFA 4LHUA 4OGYL 2ZUUA 4FNLL 4HF5H 3P2TA 4U1IB 4LSUH 3DSFL 5CJQL 1DEDA 3O6LL 3GM0A 2EKJA 1QBMH 4XZUA 3TNNA 4NO0B 1XGUA 3ELAT 3FT4B 43CAA 5F1NA 3MRGA 1SMOA 4ZUVA 4ODXB 2CDFA 2DQCH 4F7CB 5IW1B 2Y07L 1WJ3A 1A21A 1A9EA 4ZFGH 2AK4A 1FZKA 4JQIL 4MB5A 2H45A 3FQNA 2E9WA 1XF5B 1Z9SA 3WSQH 3H9YA 4EBQL 3MLTA 4EI5A 4PJGB 4N0CA 1U95A 5HGGS 3TPUA 2H32A 2WUBL 3T4AB 1DLFL 1P4LA 4JVWA 1KT2B 1JHKH 1MI5A 1RUAL 4FQ1L 1F42A 2IQ9H 2W9EH 3BN3B 1HE7A 3ZDXE 3MRIB 5DVOA 3RNKA 5DD0L 3E2HB 3I50L 4FXKB 4GRWF 3MPCA 3HC4H 4LIQL 3WLWC 3BRFA 3QHFH 2KKQA 4HS3A 3VFGL 1DTUA 4JEGB 3BYYA 3THML 3S36H 4OLUH 4OAWA 3IKKA 3ARGC 2CJUH 3KPRE 3MJ7B 2Z91B 4OZGF 4ZXBC 2OI9B 3JSSA 4ODTL 2VC2H 2OP4H 1ZVYA 1WWAX 1B3JA 4PP8C 3QWRD 4HV8B 2HA1A 4NWUL 1IC7L 1RHHA 4JY4B 4X5WA 1E4XL 1CGVA 5DJDA 2DD8L 2MNUA 1YYML 1NGZB 4G9DB 5KSBB 4FFEX 1NAMH 4NZTH 1I85C 5EPMB 1LEIA 3LHPH 1KCGC 2QADD 4RWYH 1B6UA 4TULL 3CFEB 1GYAA 2KDGA 4HWZB 3KYOA 5F7EL 1GGBH 4HFUH 3VJ6B 4NZUH 4P5MA 4UQ2B 2QQKH 2HG5B 4PTUB 2AGJL 4EN3C 1PKOA 4K2UH 3TLRA 3MGTA 1CZ8L 1K8IB 1WBXB 4LCWA 1R5WB 3VMOA 1D5ZB 2R2HA 5IHUH 3L3DB 3HZKB 3QUZD 4JKMA 4PGZA 2VN4A 4JDZA 2VH5H 5HYEA 4HIJA 2WINB 5C3LD 3C6LB 3OF6D 5CINH 3DYPA 4NQDB 3MLUL 4I0PB 1ZLSL 4C58B 1L0YA 4JO2L 1SEBB 2ATPA 2GT9A 4L9LB 3GMQA 3QDGB 4J3OC 5EN2B 3BP7B 5EU6D 2GTWB 2PYEE 1YUHB 1X7QB 1VFMA 4I9WD 1KTDA 3EOYG 4HLJA 4KI5F 5DI8A 3C08H 3SDYL 4GRLD 2YMXH 2SEBB 2PXYC 2HTLC 3PG2A 1ETZB 4G7YL 1S9YB 1KCRH 3C5SB 4AIOA 1S78D 1OCWL 3L3JB 3PV6B 5DS8A 4ELKA 5FHBH 4DZ8A 4QT5B 4MS8D 2HH0L 3TIEA 1MJ8H 5MERA 4LLMB 1FH5L 4PJBA 4XMPH 1QEWB 4LLYB 1JYXA 1P9MC 3BPOB 4W4NA 4HW6A 3PP4H 4RAVB 4PDCE 4M3JA 3ZE1E 3IAGC 3CSPA 3DRQA 1EGJH 1MEXL 1PYWB 5CGTA 3RTQA 1M05A 5GGRB 4OD1L 2XZCH 3QDMB 4J4PA 2OMNA 4TVPE 3GEWB 3WIIH 1RULH 1IGYB 3NZHH 2V5TA 3P0GB 4KRLB 3MUY1 3BIKA 2G2RB 1YEDA 4M4RA 1TZIA 1AHWA 2HJFB 5FCSH 5GS2H 1BFOB 1Y18B 2J6EA 1G7JA 1MLCB 3KYMB 4HZLB 4NDMB 4X4XB 2HVKB 3ES6B 1KJ2A 4UILL 5DDHB 5DFVD 4LDEB 3O3BA 2B4CC 2VZOA 1WAAE 2IADA 3QIWD 4JRXE 1HKLL 2GITB 4R97C 2C1OB 5CEXB 3LN4A 5E6IA 4QRQB 1KJ3L 4YZFE 5C0DA 2LAAA 2RB8A 3HZYB 4H1LB 3ARFB 4XPHH 3LKRB 5JOEA 5IWLC 3QQ4B 3TNMA 4PTTA 4OQ1A 4S1DD 5JR1L 2WANA 4M6NH 4WW1A 5EORH 3G5VB 2VLJB 1DJSA 4LLDB 1LNUA 5DMYA 3LEXB 3KNBB 4GW1A 3NOIA 1BZQK 1I3GL 3H9HB 5GSRA 3QPQD 5FYJH 4EDWH 2X89D 5ESQB 4HUVB 1F3JA 2WLYA 3LS5H 1CE6A 2P47B 5E0QA 3P30L 2X4SA 3H42L 4F2MA 5B8CB 5HHMB 2OJEB 2OL3L 1FP5A 4ELMB 5F7FA 4ZUUA 5IMOA 1BJ1H 4ZUTA 5CSGA 4U6TA 4OLZH 5FV2A 5I8EA 4RGOL 4NO2A 1JYWA 2DQFB 4Y4HB 2EZ0D 5ERWB 3DURA 1EHXA 5DVLA 4PBXA 2DQHL 2F54D 35C8L 5C1MB 1F6AA 2BSSB 2FRGP 4P3DB 5D5MF 2XG4A 5KN5B 2VLME 5C0AB 5KBNC 1A7QH 4M7KL 3S35L 4JZJB 4R96A 1QLEL 3ARUA 4OBSA 3QG6B 4K3HA 4DW2L 1HHIA 3OKLA 4LCIH 1R3KA 1UADC 4QRTB 4XX1E 5JTWA 5B3NA 5HHQB 1NGQL 1OARL 3RP1A 1YN7A 1INQB 5I76A 2BC4A 5JZ7C 3O4OC 2IALB 4OLYL 3S9DB 3KXFD 3QFDA 4OZIB 3MJ9L 2GAZA 3OHXB 4NC2B 1LDSA 4KRPC 5CD3B 3IS0X 2PR4L 4ERSH 3G5YA 1AGDB 3FFCE 1ORSB 1OAUH 1F4XL 2BY0A 4WENB 4U1IA 1A5FH 1TNMA 5JPMB 3MLYL 1MFBL 2EIZB 3BDXA 3MV9B 3TBVA 4NO0A 1U6AL 1SY6H 1MCPH 1A6TB 1FG2B 1G6RL 2FCBA 4ODXA 4MB3A 4KJQC 5CWSB 4F7CA 5IW1A 4Z7OE 1RZJC 1JGDB 2ED9A 3F12A 3BIAX 3ZDZF 4PJDF 1XF5A 4TUJB 3I3BA 3T0DA 5I1IH 1T03L 5GJSH 5FUOL 5CLTA 3T4AA 4BQCA 4Y1AB 1Q9KB 1CL7L 2KZWA 2P7TB 4GXUN 5MEQA 1KT2A 1ZT1B 1G1CA 5KJRL 4NN6B 4AQOA 3SJVA 3MRIA 3WFDH 4PP1C 1WFNA 1OT1A 4O2EA 2GFBA 4RGNC 3C60D 2MQ0A 4FXKA 2OR9L 3C2SA 6FABL 4WTZA 1MPAH 1ZT4B 1JPGA 43C9B 4OGXL 3FCTB 5AUMB 5TDNB 1JF6A 1RZ7L 3NCMA 2OI9A 3HN3A 3LB6D 3BP6B 4F37K 2BNRB 1J1OH 3H3BC 4UUJB 1NMBH 1QQDB 1YEKL 2MCPH 3MLXL 4XP6L 3CMGA 1G9NL 5CZVL 4JY4A 4O2FB 1AKJA 3IKCA 3AU1A 5DGRA 2DBLH 1IGJB 3T77B 1NGZA 1HILA 3QISA 4G9DA 5D2LF 2G60H 5KSBA 3A0OA 1RUKL 4IRJB 3VFUB 2YD4A 2IANE 3FRUB 3E8UH 1A6UL 4I4WB 3ARDB 1KN4H 3CFEA 4OCYH 4UBDC 1IFHL 3FB7A 2H9GB 4R9HA 3MRCB 4HWZA 5CKGA 2C3GA 4XPAH 3VJ6A 3JV6B 3GHBL 3UZQA 4UQ2A 1N7ML 1FE8H 1AP2A 2CKBH 2HG5A 1ZVSB 2OTWB 4YDIL 3TO4B 4F9LA 5B38B 2EIBA 4PTUA 4I3GA 3VWJB 1WBXA 1D7FA 2R1YA 2M26A 3FRPA 1UM6H 1S7VB 4JFEE 2W07A 5JOPD 1W2KT 5K9KA 1BEYH 1V3LA 2VERN 1IAKA 1II4E 3QPXL 4G9FD 3L3DA 3HZKA 4NPYB 1NBZB 2QTEA 4LRIA 5JHDB 1P4BH 4KJWD 2DTMH 2C1PB 3C6LA 3VXUD 3OKYA 3WNOA 1YMME 4I0PA 4U6VL 1KCLA 2AK4E 1P7HL 2W0LA 5HI3C 3V4PH 1GCFA 5GRWA 4L9LA 2ZOKB 3QDGA 5JIKA 4JFHE 3VGFA 1MIEL 3TPUE 2FGWH 4ZPTB 4JO3H 2H3NA 5EN2A 4NUGL 3BP7A 1JPSL 2GTWA 5A2KH 1IT9L 5I0ZA 2OTUA 1X7QA 2AXGA 4JJ5B 1MI5E 4K94H 4XNYL 3RIFK 3T0EC 2Z4QB 1CFBA 3VRLE 2YD1A 1ETZA 1AXIB 1S9YA 3JWDH 4RMTA 2B8OT 4BA8A 4NZRH 3C5SA 4LSRH 5E99H 3HMXL 4IS6B 3VE0B 4PJ9B 2VAAA 1AIFB 3L3JA 4KRNA 4M7JL 4RFOH 4PLOB 2RIKA 5K9QI 1OP3K 3UX9B 1EIBA 4K9EL 4HK0A 2DLEA 2NY1D 3BKML 5CJBA 2NY2D 3AREB 4LLYA 4PRIA 4AIZB 5CJOL 3BHBB 3RKDC 4EDXA 3WFZA 3PWVA 4WO4B 1PYWA 2XN9D 3O2DA 3UPCA 4WDIB 3MODH 1OQOA 3JWOH 5JXAH 1E6OL 2W9DL 3DXAA 4WY7H 3QDMA 4UOJA 4HPOH 4OZHF 5C6PB 4DTGL 5GJTL 2HJFA 4DGVL 5CLWA 4HUWB 1BFOA 4PJAB 4MHHG 3MUZ1 1MLCA 4PJFF 4TUKH 4HZLA 3WXVL 4X4XA 2HVKA 3WXWL 1J0HA 2AVGA 3ES6A 4HIHB 5DDHA 5JORA 4OT1L 4FP8L 2VXUL 5EC1A 5DHVH 1XCQA 3P9MB 1BIIB 3AS1A 1SBSH 1RQ5A 1KIPA 3RVXC 5CEXA 4ZTPH 4PJ7B 1T7XA 4QRQA 1M71B 1RZIA 3HZYA 4H1LA 4KKAD 3ARFA 3LKRA 1K6QL 2P5EE 2XTJC 3QQ4A 2GIYA 1EUUA 4NYLB 2VLJA 3DLQR 2Q8BH 2OLDA 3H9HA 5B3JF 5ESQA 3ZKMD 4HUVA 5BV7H 2JB6A 3WFBH 3KYNB 2FO1A 4XXCC 4GH7B 3MRJB 5DUMH 3DVFA 3TCLB 5B8CA 2OJEA 4M9OA 5F9JA 2Q3AA 2D3VA 4JDTH 2B5IB 1A6VH 4ZYKB 4LSVH 2FEEL 1JFQL 4FQIH 1AGFB 5JPNB 1CGXA 4PB9L 2DQFA 2FYYA 2PO6D 5HHOD 3OJVC 4EIZC 4BZ1H 2EE6A 5T33H 5KVFL 4LLAA 1GIGH 4P2CG 5D7IB 2EDJA 4PJBE 3LCYA 3FJTA 4XMKH 5DJ0B 3W9EB 4CU6A 1ES0A 2YUWA 4X7DC 2BSSA 4P3DA 1GJIA 2D03L 4IRSD 1B9ZA 4UDUB 1FYHB 4LBEA 1FORH 5SWZD 2IAMC 1Z5LB 4IOIB 4Z7UF 1ZGLP 1O5DT 5CZXC 1KTKE 4Z0XB 4C54A 5JLZA 4XPGH 3WHE1 3ZTNH 3EJJX 5HHQA 3HR5A 1AE6L 1INQA 3UJIL 5E00B 1FNSH 3IAPA 5EZLB 3VW3L 2NY6D 2QADB 4OZIA 1QUNA 3KPPB 4XWGL 2X05A 4S0UC 5HGDB 3LH2L 5CD3A 4DVBB 3IDXH 1AGDA 2FSEB 4ENEC 4PRPE 3QFJD 1FV1B 1EHAA 1HOCB 2EXWC 5I74B 3IXAB 5JPMA 1E28B 5K59E 3QUZB 2EIZA 3MV9A 3RU8L 1IAMA 4ZO7A 4AEHH 2ADFL 1A6TA 5IFJA 4PJ5D 1FG2A 5CMAA 3CZFB 3UC0L 3AGVA 2VDPH 5CWSA 1A7OL 2VDQL 5DD6B 4P57B 1JGDA 1OQXA 3JVGA 5EU6B 1BLNB 4TUJA 5C09D 2I9TB 4LEXL 2VXSH 1ZHNB 3ZE0F 1TFHA 1A7BA 1AC6A 5IMLB 4RISH 2VDNL 4GRLB 3GO1H 5E9DE 4GRWH 5A40E 4Y1AA 5TF1H 1Q9KA 4UAOB 2P7TA 5E5RB 2FH6A 4DOHE 3G9VA 2E9BA 1NUFA 1R5VB 4YHMH 5HY9A 2J8HA 4X6CB 3KPSD 3B9DA 4PGCB 4DAGL 3JUZA 1FFNB 3IU4L 1ADQL 5L0QC 2EDXA 2AJYL 3HRPA 4WI8A 1G7HB 4ZQKB 2R2BB 1BJMA 5IKCB 2W0FA 3GNMH 4CVZB 1ZT4A 4JLRB 3FCTA 4YPJA 4N9OB 3SDCC 1BQLL 2DQUH 3B9AA 4LSUL 1KCVL 4XGZB 3VFSB 1QQDA 2NMSA 3BGMB 3MLPA 4M5YL 4Q6IC 2XPGB 1FYTB 2AP2A 3MYJB 1G6VK 1IGJA 3T77A 4F9PA 4TYUA 4IRJA 3VFUA 4Q9BA 3FRUA 3GB7B 4I4WA 2YHGA 3DUUB 3HS0B 2H9GA 3JV6A 5HGAB 3WFCH 2V7HB 5F3BB 4X9FA 1ZVSA 2OTWA 3TO4A 1DANT 3QQNA 3G9AB 3ARBD 3VWJA 2LU4A 1HIMH 1S7VA 1JHKL 5D7JD 1HYSC 2IQ9L 4NQSB 3U7WL 2XKNB 4NPYA 1NBZA 1CFQB 2CK0L 5JHDA 4UAOC 2YD6A 4CJ1A 2BSTB 1ZE3C 3QHFL 4PLJD 3X14B 5KVMC 3RWJA 1NSNL 3S36L 2ZOKA 3DYOA 3V0WH 4P3CL 2LU3A 5DJCA 4QRRA 3MX0A 1MCEA 3BESR 5GRUH 3WN5C 2YD2A 4JQVC 4CVWA 2OP4L 4JJ5A 1V3JA 1UKQA 2Z4QA 1H3PL 1J8KA 1WGOA 2VZ3A 1D9KC 3SJVE 3VXQB 3BRGC 2YSSA 3L5XL 3LEVH 4IS6A 3TPKA 3VE0A 2F54B 1AIFA 5BZWA 3PP3H 3R1GH 2J12B 3HB3C 2Y72A 3K2UH 3V7AG 5FO7B 2DF3A 1NAML 2NXYC 4FQXC 4NZTL 1BFVH 3EW3B 4K7PX 5L2KD 3ET9F 1J9CT 4I5BB 4RWYL 4V3DB 5B22A 5I8OH 4OV6F 5D6CB 2YUVA 4EOWH 1EBAA 1MJUH 1M6OB 1GGBL 4WO4A 4NZUL 2QQKL 2OM5A 4WDIA 1I1FB 1OAQL 5A2LH 3LDBC 4MDJB 4K2UL 5C0FB 2YPKA 3STZB 4UIKH 2WM0A 1KIUA 3BN9C 1FL6B 1MNUH 5IHUL 3KXFB 3QQ9D 3MRBB 4X8XA 2Y7QB 4HUWA 3BDBA 3SY0B 5CINL 3RVUC 4HIHA 2JLLA 3PDGA 1EBPA 5IVXE 5TJWK 1JZ5A 3VDAA 3QIBC 2G5RA 3U7YL 1LK2B 2W0KA 3UTSD 1BIIA 4K07A 4OD3L 2CR6A 4PJ7A 4M93C 1NGXA 1M71A 3MXWL 4KMTH 1UGNA 3K8LA 4BH8B 3C08L 1T6VN 2WWKO 1KPRB 1KCRL 4NYLA 4MGXA 4X80L 4Q2ZB 5T3XH 5BVPL 3QQ3B 4ESKA 4XP4H 1RUPH 1WZ1L 3OPZL 4NFDA 1P84J 1A1NB 4XMPL 4DKAA 1REIA 4X83A 3KYNA 5J3HC 4M48H 4HULB 2DBJA 3TCLA 4ZOAA 1Z0NA 1ZXQA 1OM3L 3F6LA 1HN1A 3NCYS 4M4PA 5I8CB 2YK1H 1EO7A 4ZYKA 2XZCL 2CDEB 1HH9A 5EFIB 1CR9L 1AGFA 1E27A 3TZVC 3C5ZC 3C60B 3TH2T 1TPXB 4S1QH 3VFTA 4QWWC 3MBXH 4ONOA 1DL7H 5D7IA 2NCMA 8CGTA 3GMNB 5GZOD 3C8DA 5D9SB 4PRIE 4R4BB 5IF0B 3NCCB 2X44D 3KPNA 2BZDA 2NXZD 3EKCA 4JREC 4UDUA 1QR1B 1J86A 4KJPD 2UWEA 3CH8A 1Z5LA 4JFFD 3BWAB 3TH4T 4O51B 4JHAH 3DXAE 4OM1H 4P2QD 3OKDA 4PRAB 4XPHL 4Z0XA 4H20H 4DGYH 2QSCL 4JVUA 3SGEI 1RJYB 2ERJC 3TF7C 1UWXK 1NCBH 3WIHH 4JG1H 1J12A 4M6NL 3SDCA 1LO5B 5FYJD 2V17H 5EZLA 4K3JL 4V2BA 4GG6B 3U9UA 3E3QA 5JMRA 1T1WA 4A2LA 4ZFFA 5FYJL 2JTDA 3W39B 5FGBA 5IV2A 3HNTH 4DVBA 2A9NL 4Q6IA 2VZUA 3NN8B 4FQ2H 1FV1A 4HEME 1T20B 1YY8B 1E28A 4CN1A 2HT3C 2GI7A 4G9FB 5H35A 3QUZA 1LEGB 1UB6A 4OLZL 1AQKH 3ZHLA 3BUYB 2VDLH 3P9WB 5CGYD 5EH1A 1Q94B 5DHXB 2NPLX 2VLJE 3QA3B 5EU7C 3CZFA 2XA8H 5DK0B 2VLRE 3OR6B 5IJKC 3AM8C 2RFXA 2FHBA 4PJHE 2KUTA 3CLEH 4Y5VB 5DD6A 4WVRA 3PIQB 3Q6GH 1YNKL 3UROR 4Z77A 2O5ZH 2R9HD 5E4EB 5EUOE 1U8HA 2BHYA 4L8SB 3LKPB 3QWQB 5HDQH 5I0DA 4M43H 5EU6A 1BLNA 1UEMA 4BZYA 3LS4H 1ZHNA 3GSUB 1A7QL 3RIAK 1A6AB 1EK3A 5KZCD 4PJGF 4AG4H 1R5VA 2ITDA 2Z8WC 1UA6H 2B2XL 1FFNA 3H0TB 5LBSL 2GJZA 1HK6A 3ZYIA 1KC5H 2NY2B 1S7UB 4ZQKA 3WE6A 5IKCA 5I1KH 4HWUA 4Q97A 5IB4B 4HH8A 1EJOH 1OP9A 4POUB 2D7PA 4XVUD 4JLRA 4CVZA 1EPFA 5TQ2H 5ISZE 2Y23A 1GGTA 3DETC 1D9KA 3V52L 3T04D 5HSFA 1OAUL 1PG7L 2AJ3B 4TVPH 4IEFB 4RGNE 5FA4A 4XGZA 3VFSA 3G5ZB 1LQVA 5F7KC 2V9RA 3ARWA 1CU4H 3DJ9A 3BGMA 4FQXA 4JZNB 1A6WL 5D7KE 1MCPL 2XPGA 3O6MH 1FYTA 3GJFK 4G6AD 4CW1A 4TQEL 4OZIE 3MYJA 1XIWD 5E56A 5F7DB 2CMRH 1X5ZA 3EJYD 4JJHA 5K9JH 3IDNA 5EG6C 3ULVF 4Y2DC 5HDBF 3P9LB 1YECL 1HEZB 2RR3A 3DUUA 4C57C 5KSBF 4KKNA 1P7KA 2VJXA 5HGAA 2V7HA 5F3BA 2ZG1A 4HXAH 3WD5H 5MHSD 4KC3B 3CDGB 3ULUC 3VD3A 3OAUL 3BYTA 3PWPD 4YX2L 4HCRA 3RA7L 1E6JL 2XKNA 3WFDL 4GQ9H 1CFQA 1KYOK 5LXGH 2X89A 2YEZB 3QRGL 2BSTA 2P44B 2D9QB 3VU2A 1GSMA 4R4FH 3H8NA 4LSQH 3X14A 1WIUA 3TIDB 2W9LA 1BFSA 4XVTL 4KKBD 1Z9MA 3VFOB 1CBVH 3LVEA 4WHCA 1MRDL 2JB5H 4XAKE 2QV2A 3T3PE 4HFWB 1XZ0A 5HHXH 4S0SD 4G6FD 2PO6B 4LVHB 5HHOB 3GRWH 2YPLD 1RIVL 1NMBL 3LKNB 2UYLB 1GXEA 4QXGH 2MCPL 5HJ3B 4X6EB 2PW2B 2BNQD 2EDLA 1AR1D 1CXKA 5KG9B 1GRWA 1S5HB 3U0PB 2DBLL 5CP7B 4IRSB 2BSED 2DI7A 2R0WH 3N9GH 2VNCA 5FO7A 1Q0YL 3T0EE 3QHTC 1FLTX 3E8UL 2ZUTA 4I5BA 1KN4L 2R0LL 2NY0D 1M6OA 2ZUVA 4XPAL 2QHRH 3BH9B 3P3YA 4TSAL 1FE8L 1I1FA 2CKBL 3RWGB 4K3DH 4MDJA 4MVBC 4GO6B 2E27L 3VWKD 5C0CD 2X4OB 1UM6L 1FL6A 4NZDA 1BEYL 1KFAH 3LD8B 3MRBA 4AQ1B 2Y7QA 5AYQA 3SY0A 1P4BL 2CLZB 1PD6A 2DTML 3RPKA 5KVEL 5ETUB 4NIKB 3GBLA 3S4SA 3V4PL 3QFJB 1HINH 3TFKD 1LK2A 4KH2A 4LEOB 3L3GB 4NUJB 3O0RH 4YBQC 5E95B 5HI4D 2HYMA 1XCTB 4PJ5B 4K94L 1E4WH 2CUHA 1MWAA 4C56D 3A6BH 1UM4H 1SM3H 3VFMA 4LSRL 1DN0A 4Q2ZA 1EA9C 5SX4I 4XWOC 3QQ3A 4RFOL 3V0AC 4FQHA 3IDJA 5C08D 5ILTH 3MREB 5C09B 4R3SB 1FSKC 2XTJE 3MACH 1IARB 4YHNB 1FO0B 1TTUA 4XP5H 4NBZB 3MLVH 4QRRE 1XH3B 2IBBA 3CK0L 2L4OA 5J12C 1RPQA 5I8CA 3KPSB 5CUSH 5IJKA 2EDTA 1EFXA 4XMLH 3GUTB 1B4JL 4ELMF 4HPOL 5EBLB 5JW5B 5BCAA 1DVFC 4QRPE 2D4FA 1J0KA 5I18H 1OSPH 2CK2A 2BP3A 5D9SA 4TUKL 3LQAC 5IF0A 4NO3A 1IEHA 3CMOH 5D72L 1QR1A 1PZ5B 32C2B 4GW4B 4ZTPL 2P5WE 4O51A 2EXYD 4PRAA 4U05A 1A14H 4Y5YC 1A22B 1ZSDB 2VR9A 1EZVX 2K3TA 4U1GB 1RJYA 4N5ED 2Q87A 5J8OA 3VRIB 3EO0B 3TT1H 4F33B 4R26L 4Y16D 2APWA 1LO5A 1ONQB 4L4JA 2Q8BL 5D7LE 5AZEH 2D7NA 3X12B 4U3XA 4FTVD 25C8L 5BV7L 4OZIF 2AJXH 1NH6A 3LRSB 3ARBB 3STLB 5HYJD 1CXEA 3NN8A 5EZJB 2ICES 2HFEB 4LARL 4TTDD 1FDLH 5D7JB 1T20A 1A6VL 5EO1B 4G9FA 1LEGA 3TYFB 1GC1C 4U1NB 2M8XA 3BUYA 2BHUA 4R90H 4MA8H 4HGWB 4Y2DA 4TUOB 3QA3A 2AXHA 5T33L 4RFNB 1N0LA 1GIGL 5DK0A 2VSDA 2ZUQB 4RX4D 5ACZB 1V3MA 3ZSTA 4Y5VA 3MFFB 2H32H 5CBAA 4KZDL 1W0VA 3LKPA 4L8SA 1IE5A 2QQLH 2APXA 5GS1B 1G9MC 3GSUA 2RQ8A 1A6PA 3F7PC 4CUCA 2HT4C 5F70A 3SE4C 4NFBA 5T5NF 4D9LH 3T0AA 2CIIB 5D7SL 1H5BB 3ZTNL 5IB1B 2C4FT 3B6SA 2OMBA 1FNSL 1RI8A 3QG7H 5IB4A 4XX1G 3TBTB 3LKSB 2IC2A 3C8HA 4D3CL 1Y0LB 3AVEA 3BW9B 5EZOH 2UWEE 3QUYC 5DQDH 5E8EA 2J8UA 4M7ZC 2AJ3A 1ZOXA 3P40A 5DD1L 2B20A 4MNGA 3MMEA 3G5ZA 1KG0A 5DT1H 4M6ML 3QDHA 3RVVD 1S7QB 1OTSD 1UJ3B 3IJSA 4JZNA 4NOBA 3U9PH 4F7TB 3LMJH 3V8OA 3T0WA 5K93A 2VDPL 1M7DB 5F7DA 3E3QE 3IS1X 3UTSB 3QNYA 5DGQA 4KVCL 4OF5A 3KVQA 2A2QT 5C0ND 1WCBB 3DTXA 4YXLH 4JM4H 4G5ZH 5HVHC 4OB5L 4URTB 2E8ZA 4PIRF 4RISL 3DIFB 1G7MB 4MXQC 3GO1L 3QHZL 4A6YL 5E08H 4YO0A 3CDGA 4YE4L 3PGDB 4LPUA 4YHML 2O5YH 5KSAD 3HZMA 4KKLD 2FIKA 2YEZA 1TMCB 2EEBA 4DUXA 2HMID 2J4WL 2YS4A 4C4KO 1UG9A 3OMZA 1GGCL 3TIDA 3VFOA 1ZV5A 5F7YC 1FVCA 5FKPB 1CFVH 5AYUH 2I60H 5IEHB 3DSNA 4QLRA 1JN6B 5E2UL 3BP5B 2UYLA 1YDPB 4PRNB 5HJ3A 4ACPA 5MEPB 5INDB 5GGTA 4LU5H 1DQMH 2PW2A 3P0YH 3TN0D 1VFBB 3JTSB 5KG9A 1S5HA 2B7DT 3U0PA 4WWKB 5CP7A 3U30C 2NXZB 2HRPL 5DWUH 3MLSH 2VR5A 4MQ7B 2Z93A 4JFDD 4I8DA 5C0JB 4XAWH 4P4KC 3LIZH 4NQCD 1ZKAA 5DZOA 3BH9A 3TJHD 4GAJH 1DVFA 3RWGA 2HKHH 4BUHA 4G6JH 2QSQA 3S3JA 1GZQB 4Y89A 2X4OA 2J6EH 4W68A 3HI1A 4HWBH 1FYTE 5D1QC 1Q1JH 3QXVA 3D48R 3C5JB 1CLYH 2ICEB 3HZVB 1TQCC 2CLZA 4ZOBA 4ODUA 4U0RB 4U1MA 3UTPE 4PJAF 4ZFOB 3PE9A 4DUVA 5IJVB 3UPRB 3S97C 3NIGE 3V0WL 5E8DH 1T2XA 4HLZG 3FQRB 3TBSB 1KPVA 4LEOA 4DN3H 2DL2A 3L3GA 3VCLB 1HHKB 2Z31D 1FZJA 2N7BA 4MD5B 4XPFL 3MRLB 3U2SB 3SGEH 4PJ7F 2FLRT 3UJTH 3BSZH 1AY1H 4BZ2H 3PJSB 4RRPG 1RZKC 1AJ7H 5FHAH 1KB5L 3R1GL 1QBLH 3N1PC 1C12B 4L8CB 2IGFH 1Q9LB 1A47A 5C09A 5DA0B 4R3SA 3WDJA 1XAUA 5GS0C 1BOGB 2HLFD 1BFVL 1XMWA 4YHNA 1FO0A 4N1HB 5KZCB 1MJUL 4NBYB 1XH3A 3UJJH 4HIIB 1UT9A 3WS6A 2W59A 1EHLL 3GUTA 3I6LD 2EH8H 5EBLA 3OBAA 4J1UB 5JW5A 4R2GC 3K2MC 3EGSB 4AEEA 4F3FB 2AV7B 4UV4H 1UKTA 3Q48A 4LKCB 3MUGA 5D7IF 4QNPF 1X4ZA 3DX7A 1ULVA 3C6SA 5FA3B 3QDJA 1G7QB 1PZ5A 2AV1A 4PJ8C 2NR6D 32C2A 1J0ZA 2I25N 4GW4A 1Z3GH 5E8PB 1IKNC 5FYKE 2YZ1A 1BQHG 2Y9RT 4S1RH 3FMGH 2EIDA 3BEVA 4AH2B 3EO1B 2X4NB 4MQXD 3ORJA 2VXTL 3MUJA 3OGCB 5J13B 1XIWB 4EQ3A 3VRIA 2A0LD 3EO0A 1P2CA 1OSZA 4KUZH 4RAUB 4Y4FC 3AAZB 4U31A 4YDJA 3FZUD 2DYPD 4F33A 3QUYA 5T3XL 1P6FA 3MLWH 4IIQC 1ONQA 5HHVL 1RUPL 1MREH 2V9QA 3X12A 4F57H 4YBLB 5FO9B 4ZMAT 3O3AA 2R0ZL 3NA4A 3QO0B 3LRSA 1G7IB 3ARBA 2HT2D 4OTXL 3STLA 4M48L 5EZJA 2VN7A 3GSNB 3IDIB 3N0PB 5D7JA 1OW0A 3PWPB 4GBXC 2YK1L 5EO1A 5HI5D 3TYFA 4U1NA 1URLA 2O61B 2J3SA 2I9LB 5E8OB 4HGWA 4S1QL 5DA4A 4YHPB 3GKWH 3KPRD 3MBXL 5EU3B 4ONGH 5ACZA 4HIEB 4GMTH 4WHTB 1FFQA 4MXQA 3MFFA 4JGUA 2ED8A 4O4YH 4ZUSB 3ARRA 3AXLA 4G6FB 1XGRB 4LCCC 3RDTC 5IB3B 1ZLWK 4DJMA 1WVZA 1G0DA 1NMAL 4OIIL 3PWNB 3AS3A 1VENA 5IHZA 1F2QA 1JZ7A 1KOAA 5F7LB 5C6WH 4ETQB 4H20L 1Q9OB 2BNQB 4GT7A 1KNOA 4I13B 5F7UA 1I9JH 3HE6D 3MGOA 1NCBL 1JHLH 3EYUH 3WIHL 4JFOB 4JG1L 3FO0H 4X6CF 3RI5K 1UZ6F 5TFSH 5TE7H 4X8JA 3DMMD 1LK3L 3IT8D 4AEFA 3LKSA 3VFWA 1RJLB 1YPZE 3W0WE 3EOAB 2NY0B 3ZE2F 1Y0LA 4KHXH 1RZFH 4HUNB 2FR4B 3X11B 4ZOEA 5JQ6H 4P0DA 4OKDA 3I2CH 3VWKB 5C0CB 4J6RH 4E5XB 2F9BT 1S9VA 4Z7WE 3S88L 4ODWB 3MCLH 3RY6C 4KZEH 4LHJB 3LSOB 5FO8B 1AQKL 3ZO0A 4W6WB 2Q6WA 4CBPA 3NABH 3S96A 3QUXD 4LVOC 2XA8L 5I75C 4PRDA 2CXGA 2ADJA 4YXHL 3F65A 3UTSA 2PYED 1UWEH 1RIUL 2X1XR 1TQBC 2NX5E 5T1KD 4OKVB 1IBGH 5D1QA 2DLGA 1G7MA 5LCVL 4C56B 4EIGB 2LU7A 4J12A 3EHBD 1X5KA 5EZIH 5TDPA 2B4CH 2V2WB 3PGDA 4AG4L 1IEAB 4WW2C 5DYOB 5C08B 5F8RC 2JCCB 4XCFH 4RQQB 1BF8A 4Y4KC 4FXLA 4X98B 4X4YA 1TMCA 3MROB 3IAQA 1CFNB 3IVKB 1CD1B 3WKMH 4L4VE 1EEQA 3ULUE 1SJVA 3AC0A 4DFHA 4Q9CA 4N8VA 4TVPD 5D2NB 2XWTB 2J8OA 1YYLH 2X1WL 4JN2B 3REWA 2KL6A 5FKPA 4DEPB 2FZ3A 5IEHA 5F7HA 3D18B 3BP5A 3JV4B 1CU4L 1DUZA 4PRNA 5I2IB 3N06B 3OR7B 1FNAA 5SX4H 5GHWH 1BFTA 5AWNH 1VFBA 3JTSA 4BQBA 5DHVB 1U3YA 2BVEA 2X09A 4J8RB 4JRXD 4WWKA 5I1EH 4KAQL 4U7SA 1U8JB 4X7TA 1HXYA 5FF6B 4JPKH 5K9JL 1GPOH 3O2DH 4MQ7A 1BVZA 5SWQB 3D3VE 3L7FB 3PDDA 4MMXC 5C0JA 3E1F1 1OAKL 2J8UE 1AC0A 4YAQB 5I1HL 3ME0A 1B0GB 4MNGE 1JTOA 5D1ZD 3WD5L 4MXVE 4PB0H 3ZYZA 2XZQH 2HAZA 3S3PA 3VI3E 4YHIB 4L5FL 4Y16B 3K1DA 1MF2H 3NGBC 1CFTB 1QP1A 4GQ9L 1HDMA 3C5JA 3BDYH 5DMKB 4FTVB 1IGCH 4G8EB 1JGUH 5E1AB 1GOHA 5HYJB 1MJJB 4ZFOA 4LSQL 3QSKB 2Y25A 4H1LH 4BFEA 4N1EA 4LDLB 4KK9D 3FQRA 1T2JA 4Y4FA 3SKOB 1HHKA 1UZ8B 2JB5L 4KDTA 4NQTA 3VCLA 4MD5A 3MRLA 1T2QH 3E0GA 3U2SA 2X4PA 4IIQA 3GRWL 3DHMA 4MXWL 1F6LL 3GSRB 4QXGL 4Y5XC 5MENE 3F6IA 3PJSA 3I6KA 2V5RA 2AK1H 5F7NC 1PY9A 3U4EB 2VLMD 5KSUB 4PREB 4YC2B 1A64A 3BXNB 3C8KB 5F9OH 3R8QA 3VH8A 4L8CA 1Q9LA 4GQPH 2R0WL 4GBXA 1X5YA 2Y36H 1HI6A 1BOGA 4HQQH 5C9JA 5HPOA 4F15B 4PGDA 5GGVY 2DM4A 4WTZG 4NHCH 4HIIA 3MV7E 2BSRB 3V5DB 4K3DL 1PSKH 4L8BB 4J1UA 1KFAL 1TVDA 4O9HH 2B1AL 4LCCA 3FFCD 4JGJA 1IC5L 2ZCHL 2AV7A 5E7FA 3U4AA 3MJ8A 4F3FA 3KYKH 3ZDYE 4HUUB 3V6OA 3N50A 4XVSH 4LKCA 3UZVB 3MRNA 1HINL 4LKXB 3T2OA 1J87A 4MD0A 5FA3A 1S9KC 1MHCA 4MS8C 3O0RL 1B88A 1OD7A 1CCZA 5E8PA 1MFAH 1TNNA 4AH2A 2VISB 3BJLA 3EO1A 2X4NA 2X5PA 4QF1B 5IEKA 4R4ND 1E4WL 4PBWD 3A6BL 3RGVC 1FIGH 3V4UH 4O02H 3SE3A 3AAZA 2L0DA 3Q6FB 3UDWC 1G7LB 3FRPG 4KGLA 3GZKA 2X6MA 2ZUYA 1CXIA 3U83A 3RL1B 1AXTH 4EVNB 5ILTL 3U7AA 5CBEB 4NNXB 5FO9A 1N5YH 4GG6F 3VXPB 3MACL 4XPBH 5TE4L 4RDQF 1G7IA 1NGWB 4EZMA 1QVOA 3G5XB 1FGNH 3MLVL 5JXED 4OZ4B 2PUQT 3GSNA 4Q7DA 3IDIA 4GJTB 1J0IA 3HAEA 4Z8FL 4UQ3B 3PWPA 5ADOL 4NKDB 1S7RA 5KSAB 2MQCA 4XMLL 3BZEB 4N0UB 4RZCB 2GKIA 3QAZB 2I9LA 4NRXB 3K7UA 4RMVA 3BKJL 4YHPA 3FT2B 3QXWA 1TCMA 4HIEA 2F5BL 5EU4B 4WHTA 3T65B 1LO0L 3D9AL 2ZJSH 4UZGA 2E7LC 2BOBB 3UMTA 4F7PB 3PWLB 3TA3C 4ZUSA 3CMOL 4S1DC 2JJVA 3WJJC 2B0SH 4XP1H 4YBHA 5IB3A 1XGRA 2DWEB 4M1CC 3D0LB 3B8SA 1U92B 1CQYA 3PWNA 3GSXB 1WEJH 3KJ4B 1AXSA 4ETQA 4KK8D 2JJWA 1A14L 1Q9OA 1QSVA 3MRHB 3TN0B 3UBXG 3HE7C 4KXZI 3PXJA 5E2TH 4XNQB 2IAND 1I3UA 4LLQB 1I8MB 1FVDB 1CICB 3TYGL 3ZT7A 3Q2CA 2RBLA 4F8QA 4CL7A 4JFDB 4WTXA 1K3ZA 2E7BA 4D0DB 3P77B 1RK1A 4HG4K 1RJLA 2IFGA 4PY8J 5DD5H 4NQCB 1QFWI 3EOAA 1MUJB 4XC1H 1QBBA 4GG8B 4P59L 2WZPD 1MJ7H 1INEH 3O45B 1KF9B 2D0FA 4JFED 2FR4A 3QDJE 2P8MB 3X11A 2AI0L 2AJXL 4KPHH 1OF2B 1UKSA 2R39A 4WFGE 4NHUB 5BJTB 1IGFH 4HPYH 4B53A 5C0CA 4E5XA 1DBJL 1FDLL 3NPZB 1AO7E 4ODWA 4LL9A 3LSOA 1YMMD 3A67H 1X5FA 2AK4D 3HTLX 3VFPB 5CSBA 5F6HJ 4H1LG 4M00A 5CEZE 2FX9H 5DR5H 1A7RH 4JFHD 4QHKI 2BCKB 2W60A 3TFKA 2WIMA 5L8KB 4XBPB 3GI9H 5I8KL 4AEIL 1MI5D 1EAPB 2Z31B 3NCYP 2QQLL 4OKVA 3WUWA 3GSWB 4BFGA 3CLFH 2DQIL 4QXTA 4YH6A 4C56A 1EHNA 4GKZA 5ANMB 2F8OA 2A73A 5GRVL 5SWSA 3SPVB 2V2WA 3R8BB 4D9LL 5MP6H 5MI0C 2RCSH 5DYOA 1WIOA 3OJDB 5C08A 3EYQD 2VLKE 1NCTA 1S5IL 3N1FC 4X98A 5DEZA 5JQHC 4YDLC 3QG7L 5CJXC 3RBSA 4MA7H 3MROA 1CFNA 5L9DH 3IVKA 2J1KA 1ZTXH 4IJ3C 3VG9C 5I1GH 2HJKB 5IBLC 5D2NA 5EZOL 2XWTA 3BPNC 4GXVH 3J8F7 3CVHH 4QRSB 5DQDL 3RVWC 4JN2A 3W2DH 4Y8DC 2FATH 4JB9H 4KDWA 3BMVA 2PF6A 1C5CH 5DMJB 3O3EB 3JV4A 4KMLB 5DT1L 5E2WL 3INUH 3WHE0 1T89C 2ZNXA 1QHOA 3U9PL 3LMJL 4PS4H 1I75A 4MNQE 4M5ZH 5CD5C 5DHVA 2V5SA 1P6AB 4J8RA 1KXTB 2HTKD 1U8JA 3MA7B 1KLUB 5HGBB 3LPGA 5SWQA 2PETA 3K4ZA 4YHYC 5B4MD 1T1XB 1U91B 1MCOH 1S7SB 1UH4A 2P5ED 1LO2H 4H0HB 1FZOB 1WF5A 3MLRL 1OLLA 1B0GA 4OCLC 2VDRH 4K7FB 3T3ME 4N5EA 1TZGL 1FFOA 5KS9E 1J10A 3F58L 2ICWB 1Q9WA 4NGHH 1CFTA 3RWCA 4CRPA 2O5YL 2X2YA 1PLGH 3L95B 4NC1E 1K4CB 5CKAA 4JM2D 4FTVA 2QSVA 4G8EA 2AEPH 2AJVH 1G9NC 1EXUB 2EC9U 5C0RH 4FG6C 4HKBB 4LRNL 4BQ6A 1MJJA 3QI9D 4RSVA 2AJZB 3T1WA 1XF2A 3RGVA 4PY7B 1GH7A 2GUOA 4BKLA 1F5WA 2VTFA 1CFVL 1HQRB 2I60L 4OV5A 1CF8H 3GI8H 3ZT5A 5HYSG 5IVZA 5I6XB 1SYVB 1JVKA 1HNGA 3L1OL 1L8JA 3V0VB 3LV3A 1OHQA 4LU5L 3OJMB 4M1DL 5C86A 1DQML 1VFOA 2WMPA 1UB5B 5B39A 1T0MA 4JZOB 15C8L 4M7LT 3HI6H 4CADB 2QL1A 4KK5C 4PREA 3BXNA 3C8KA 1TZHB 1NGPL 2DIJA 3VA2C 4J4PD 2WW8A 3MLSL 2DQDH 1C16B 4X6FB 1NGYB 4OIAA 4XAWL 3LIZL 4F8TA 4GAGL 4QXUL 2VKXA 2M2DA 1HHGA 3V5DA 3HE6B 4QY8B 2HKHL 4Q6YA 1J1PL 5AD0B 1CGSH 2DKSA 4L8BA 1MAMH 4NWTH 2J6EL 1C1EH 1L7TH 3GBMH 4O58H 3TA3A 3DMMB 1Q1JL 2NLJA 1IQWH 4PG2C 1KJ2L 5I73C 3VA6A 2MPAH 4IHOB 1R3HB 1CLYL 4PRPD 4JGMA 3HG1E 2NY4D 4NKOB 4W70A 2IG2L 4H0IA 2Y1VA 5FV1L 1J1XL 3HLAB 1J18A 1KEMH 4X9IA 4MCZB 4LQ1A 1EVTC 4K9EC 4LKXA 3HE7A 1BWWA 2HWZH 4JKLA 3KWWA 3QEQA 2OZ4H 1UYWL 4GOSA 2NY1C 3MOBH 5IQ9A 2VISA 4JFZL 4NN7C 1OGAA 3MRDB 1SJHB 3LAFA 3QUXB 3U46B 2FD6H 3ARXA 1NMCC 4O5LH 3BSZL 1AY1L 4MB4A 1IGTB 5DQ9A 3PL6C 1N26A 2PYEB 1CD0A 3OJ2C 3BD5A 3C09B 3SKNB 3QXTA 4I18B 4POZC 5E9DD 3D39E 4R8WL 5T1KB 1KLFA 5CBEA 2PN5A 4NNXA 4ZAKC 4NCC2 1WT5C 4N8PA 1J05B 4WFEE 3VXPA 1NGWA 1WBZB 2UVEA 3G5XA 3KPOA 3X13B 4OZ4A 4PLNC 3UJJL 4NKDA 4X7CC 3L7EB 1OPGL 3UTTE 5KSAA 3HPJA 3BZEA 4XHJC 4N0UA 4M61B 1F11A 1X5AA 4XCEB 2A83B 1I1RA 3I85A 1EH9A 3FOMA 4RWHA 5L6YH 3MJ9A 1U8OB 1MH5A 2XNAB 3ERYA 5EU4A 1JNLH 4F7PA 3PWLA 3WLWD 3I3DA 1A3LL 1JGLH 3VXRA 1VB9A 2DN7A 4EXPX 1OOAA 5HDLA 3OWEA 5DRWB 4U1LB 5DO2C 1WSST 3ARGD 3IFNL 3UYPA 4W81A 1Z3GL 4JFYB 3IDYC 2XG5A 4UT9H 3ZKMC 5CJXA 5J1SC 2Z0BA 4U3HA 5C6TL 3MRHA 1JYNA 4Y8AA 3BD4A 3KPQA 4JRXB 4LLQA 4XNQA 1I8MA 1FVDA 1AI1H 4RMUA 1CICA 4UIMA 1U42A 2R23A 3O6KH 4YDKH 5LWYH 4JFDA 4D0DA 1A4JB 1I7ZB 3P77A 4PGJA 4F57L 4KKCC 1MUJA 4GG8A 1KTRL 3TJHA 3O45A 4WHYH 1ZANL 5D1ZB 2P8MA 1OF2A 1T89A 3V7MA 2ZKHH 4NHUA 2XFXB 5BJTA 4LLUA 5LGHL 1XT5A 2R4SH 3B5GA 4X9BA 1S9WB 1UACH 2BXZA 3I6GB 4EN3D 1X6NA 3SQOL 4R0LB 2NW2B 3O4LE 3VFPA 1RMFL 4P2YA 3T3MF 5FXCH 1EERB 2ITCB 1NLDH 4MD4B 5E2VL 3BT2H 5CP3A 3ZYJA 2D7QA 5CSZB 4LK4A 5IFAL 3MXVH 2BCKA 4GMTL 4P48A 1OP3H 4ZTOL 4XBPA 3CFJB 1F90H 5EDXA 4O4YL 2Z31A 3VGAB 3ZKNC 1F3RB 5JUEH 3KJ6L 3SJVD 4I48B 4QTHB 2EECA 2DMBA 3VXOB 1BF2A 2NY6C 1S7WB 4HCRH 1DLHA 5ANMA 5DMIH 3MV8A 1CYGA 1JCKA 4FHBD 3SPVA 5IQ7H 3F7VB 4PJCA 4MA3A 5ID0B 1ACYH 1I9JL 1R3IL 5IESH 2OR8A 3OJDA 1X9QA 2MFNA 1JHLL 2PXYD 2HTLD 4AT6B 3FO0L 4N0YH 5TDOB 2ZCKH 1SBBA 1RAMA 5TE7L 4WI3A 4MQTB 3DBXB 2VDOH 2CXKA 2HJKA 1BAFH 2GK2A 3TBWB 4M7LH 1RZFL 4QRSA 4I3SH 1AKJD 3I2CL 1I8KB 4J6RL 3FQTB 5IBTH 1LGVA 1QRNB 3BKYL 3MCLL 4U1KB 4KZEL 5T5FH 5DRXB 1CDUA 4HXBH 4L3CB 4ZSOB 1JYVA 3TM6A 3ULVL 2BMKB 4GS7C 3RPIB 3FFCB 5LAXB 2FECI 4OSUH 3GKZA 1FIEA 4MQSB 4ODHH 3NABL 5F9WB 3ABZA 4D94A 3TESA 3BWUC 2FWOB 2JJUA 5AZ2H 1KLUA 1MCWM 3MA7A 4NKMB 4QHLB 4Y0GA 4HH9B 3BUTA 5FECA 3MRFB 5HGBA 1OTTC 3BGFB 2Q3ZA 1T1XA 1RUQH 4JFPB 2C4FU 1S7SA 5FYKH 3WO4B 1FZOA 3CFCH 4KHTH 4XNMB 3W11C 2FEDD 2W91A 4PRHE 4ETYA 4MCYB 4S11A 2ICWA 3HNVH 4PD4J 9CGTA 2YPVH 3FL7A 1YJDH 3PQYE 4LIQE 1TETH 2DQJH 4FFZH 4XCFL 3OB8A 2I27N 3L95A 3NA9L 4KV5F 1H3GA 1K4CA 1MRCH 5J11B 4RGMC 3ARZA 2FJHA 4XXDB 4HKBA 2GJ6E 3HA0A 1NBVL 4B5EA 1VDGA 3QO1B 2AJZA 4XNXH 5HGHB 4PY7A 3SGKA 1TJHH 1MWAH 1UM5H 2ORBH 1HQRA 5SWSE 1PKQE 1NBYB 2CLVB 3ILQC 4CKVX 1KCUH 5FM5O 1SYVA 1KJMB 2QQNH 4PRID 4YHZH 4HAGA 1CFSB 4AL8H 4TNWF 3V0VA 1CGYA 5GHWL 1UB5A 3D2UD 4JZOA 3MRPA 3T0XA 1CI5A 4G8GE 3BGAA 4CADA 1TJGH 3REVB 4B41A 3DXAD 2X42A 4JPKL 4KROC 5EIVA 5ICXB 1GPOL 1C16A 1NGYA 4XH2A 3N1MC 2EO1A 3EYFB 3PGCB 4MA1B 2OSLB 3HE6A 1NC2D 2UY6A 2IANB 3UTZB 4PB0L 1VGEH 3LQZB 1DFBL 1WITA 2R4RH 1DBAL 4X6DE 3DMMA 3OX8B 4WHYG 5C0BA 1RU9H 3BDYL 4IHOA 4XZUB 2E7HA 3FFDB 3TJEL 4Y2OA 2AQ3A 5JZ7D 4NKOA 4JFEB 1B4RA 2ADGB 1JPFB 3ARFD 4ZUVB 1VGKA 1ZHLA 1QA9A 2XKUA 3JTCA 1UXSA 2E3VA 2VLJD 1YMMB 5SX5K 1A9EB 1IAOA 2AK4B 2VLRD 4LVNB 3F5WB 3RWHB 3MRDA 4PD4K 3SOBH 5T1LA 3QUXA 3U46A 3TPUB 2CR3A 2H32B 5EWIL 3TEUA 4HT1H 1X3DA 3RUGB 2AK1L 4XCCL 3JBG7 2PYEA 3NCJH 1MI5B 5D8JH 4I18A 1QFWH 2Y6SC 5F9OL 4KJQD 5T1KA 1U8KB 2Y36L 3ETBF 3RNKB 1J05A 4HQQL 3QQ9C 1I1AC 1QFWM 5FFLA 3GFUA 5B21A 3X13A 5IFHL 1GAFL 4ORGB 4HS3B 4IBLT 3TC9A 1MAJA 1PJ9A 3LN9A 5E94A 3QIUC 4HJJH 3L7EA 4D0BB 5L88L 4BQ9A 4DGIH 5I1JH 4XCEA 4DVRH 1JL8A 2A83A 3KLDA 2JELL 5I1CH 5ISZD 5F9DC 3B5TA 4MHHI 4V1DA 4O9HL 3ZKXB 3ULUH 4PP1D 3W82A 2LABA 4PJXA 3KYKL 4HUXB 2E9IA 4RGND 4XVSL 1Q72H 2H2PC 1RHHB 4K23L 5KSVB 4LPVA 5EIQA 2OK0H 3DVIA 2O26U 3EDJA 2AXJA 5D7KD 3OQ3B 2FB4L 4U1LA 1KIRB 4HHAA 5DRWA 5CEYB 4NT6A 1MFAL 1LDPH 3UYRH 1BQHB 1UWGL 4LAQH 2E7LE 1LP9A 3WL9B 3KYOB 3FO1A 1FIGL 4JRXA 2XXMB 3V4UL 4D9QE 1MLBB 2F74B 4CN4A 5LVEA 5DC0A 1VHPA 2NNAA 1EO5A 4OLVH 4JR9L 2R2HB 1H8NA 1I7ZA 2P5EB 1AXTL 3TWCH 1C5DA 2A1WL 1I8LA 1N5YL 3O41B 1J0YA 4HIJB 5D1ZA 2VABB 4XPBL 1RURL 3QEQE 1H3UA 1FGNL 2XFXA 4HK3J 1A9BA 4UBDD 5JOFB 3S4SG 1FAIL 1OGAE 2ATPB 1S9WA 3RWDB 4B7LA 3I6GA 3SDAC 2NW2A 2R2CA 4JM2B 3SGJA 1JMXA 1H9VA 4BSVA 5CZKA 2ITCA 2UV3A 4CU7A 5CSZA 4JO1H 3QI9B 5C07A 4WV1C 4XAKD 3RAJH 2AEWA 3OV6A 3BIBX 3CFJA 1HWGB 3NIDE 4F7MB 4Z95H 3AB0C 5HI3D 2B0SL 4Z7QF 4DZ8B 4I48A 3TIEB 1K3IA 2AABL 2CDGA 1EX0A 4PJBB 4MAUH 3H9SE 3QULA 1WEJL 5F89A 1MCSA 5J7CC 3F7VA 3MNZB 5ID0A 4DN4L 5F88A 3T0ED 4YHLL 1T04B 4ZS6C 5IHLB 2JCCF 3DBXA 3BIKB 1YEDB 4MZ2A 5DRNA 3VXRE 4XC1L 1AHWB 4OCSL 5LG1A 1MJ7L 4OLXH 2WQRA 4HJGA 1G7JB 1OWRM 5IIEB 1E0OB 2VRAA 4HPYL 1I8KA 4K8RL 4KMQA 3HHRB 2YD5A 5GGTH 1JPTH 1CXFA 1QRNA 4LLWB 4NM8H 4L3CA 5DUBB 4ZSOA 4IRJD 2BMKA 3RPIA 3FFCA 4PRPB 1Y6NR 3A67L 3OL2A 4NN5C 4RNRB 3LN4B 3EYSH 1F8TH 5C0DB 1MCNA 5DR5L 1A7RL 1VADA 1BREA 2FWOA 3TNMB 1L6ZA 3TO4D 4X7FC 2F53E 3VWJD 3EFFB 1JWSA 4FZ8H 4QHLA 4HH9A 3MRFA 3GI9L 1HZHL 5IROA 4CGTA 4JFPA 4LCYB 1T5WA 4HK3N 5HVGB 1S9XB 3CLFL 3P73A 4WTWA 3LQAH 4XNMA 1T7VA 1F3JB 3I75B 3RVXD 5IUSA 1LEKB 4YXKH 4X0KB 3L3KB 2RCSL 2XTJD 5E9DB 5IMOB 3BQUC 3ZKSD 1D5BB 4TSCH 3FAXA 1VA9A 3QZWG 4QRRD 1HHJB 2I5YH 4OCWH 4DOHB 5D1XC 4MA7L 4HMCA 3RZCC 5L9DL 4XXDA 1E4KA 5DMGD 5JXEA 1ZTXL 1PBYA 2VZ1A 3QO1A 1N0XH 5HGHA 3O8XC 4YUEH 2X7LA 1WFUA 4GXVL 3IDGB 4NRZB 3PXHA 4ZDHB 1FC2D 2DICA 5DD3H 3MV8E 3W2DL 5FDWB 4QRPD 2H1PH 1CGWA 2FATL 5GSVA 1F6AB 5C3TA 2VDML 5C2BL 4PJCE 1C5CL 2C4XA 1KJMA 3INUL 1C08B 3OG6B 1CFSA 1UWXH 4NCDA 4PS4L 3MRKB 5TQ0L 2GW5A 1DBKH 1GC1H 3OKLB 3CCHB 4JKPL 4KTDH 5J89A 2CRIA 2P5WD 1J5OH 4WUUE 1FNGB 5I76B 2BC4B 2B39A 3ARGB 1U0QA 1MCOL 1LO2L 4YDVA 1BZ7A 4ZXBB 1MHPL 4N0FA 1JGEB 2VXVH 3PGCA 2VDRL 2OSLA 4OQTL 2IANA 4L1DA 3UTZA 2Y06H 2UY7A 5D7LD 1YEFL 3G5YB 5DZNA 2WK2A 3A6OA 5CZXD 2B1HL 2WBJC 3LQZA 4NGHL 1OP5H 3OX8A 1P5VA 2IJ0C 1PLGL 3UEZA 3RZWA 1FAKT 3FFDA 2A6KB 3TBVB 5A1AA 4PLKC 2AEPL 3EAKA 4JFEA 2AERT 5A16B 2ADGA 1JPFA 1MQ8A 3D69B 1AGCA 5I15H 2UZIH 3SKJL 4HBCH 3EDFA 1R24B 3NIFF 2Q8AH 1AR1C 4FN0A 3FQWB 1MFEH 4ENED 4EN3B 1YMMA 2IWGA 3F12B 1FCGA 2KQNA 4EQ2A 3F5WA 3RWHA 2EXWD 1QNZH 5CEZH 1AD0B 1CF8L 4YQXH 3P4MB 5KVGH 1F13A 1A3RL 4KTEH 3HC0A 2FJFB 4B50A 5ALBH 1TDQA 3RUGA 4RRPA 4K7PL 5MEQB 4DWHA 4O2CB 2PKDA 3HI6L 4D8PB 5BOZG 4Y88A 1U8KA 3SJVB 4PJEA 1L6XA 3Q1SL 2K1MA 3NCEB 4K3EL 4O2EB 5IT2L 2GFBB 4ZS7L 3KLHC 2DQDL 3VXMB 4TVSa 1F4WH 4ORGA 3GBNH 4CAGA 1JPGB 1U9KA 4RAHA 3NIDF 3PWUA 3G6DH 1AQDB 4G80A 4D0BA 2DAVA 3B2VL 1CGSL 3A6CH 2PXYB 1NCAH 4HD9A 4NWTL 3GBML 2R1XA 4K94C 3MZGB 1IQWL 2YD8A 3CXDL 2AJSH 3ZTJH 5JHLH 4Z7NE 4ZNCD 5KANG 1LO3L 4HUXA 1S7TB 2ESVB 1P4IH 3K46A 3RWIB 3IB4A 5KSVA 1AKJB 3IKCB 3SCMC 5ABDE 3AU1B 2VUYA 4PV8B 4M9PA 2VQTA 1DBMH 1HILB 4OFKA 1KIRA 5CEYA 3SDCD 3I9GH 3MOBL 3T09A 3U6RB 5IVXB 1O7VA 3IXTB 4PV9B 1BQHA 1TJIL 3FB7B 4DFIA 3WL9A 1YQVL 4P46C 2VYRE 5C0BE 2FD6L 1AP2B 1MLBA 1RZ8B 1GGIH 2F74A 2DJ4A 2APTA 2NTSP 4J2XA 4XBEL 2R1YB 2YRZA 1K8DA 5K9KB 3FTGA 5I30H 2R8SH 1BVLB 2P5EA 1IAKB 3V6BR 5HPMA 3S37H 1PGRB 2E6QA 3DROB 5C71A 3O41A 1T83A 4JN1H 5CILL 2VABA 1YNTA 5JIHA 4R97B 3GIVB 2R0KH 5BS0E 3MZTA 1U8PA 3WFEH 2GY5A 1N5AA 5JOFA 2E6JA 1NL0H 2ICCA 12E8H 5ITBL 3RWDA 1FCCA 1U3JA 5JO5A 2H3NB 5I19L 4FQCL 4JM2A 4HDIB 1NFKA 3NAAH 1HYSD 2OTUB 1CLOL 2AXGB 2O5XL 4QRUB 3QI9A 2JJSA 1JNLL 2GCYB 1K85A 3MOAH 1F00I 2PTTA 2VAAB 1VPOH 4F7MA 1FG9C 3O2WH 3ROOB 4UU9B 5DRZB 2X40A 4HK0B 4PPTA 5DJXB 1ZLVK 5BV7C 5C7XH 4PRIB 3P4NB 3EDEA 1U41A 4UT9L 4EDXB 3RZCA 1OVZA 2X9YA 3MNZA 3D2UB 1U8QB 3UBXB 3PWVB 1IKFH 1EEYB 3DO3A 4V1DE 3OKKB 4WEMB 1D9KD 1WICA 3DXAB 1T04A 4PJXE 1CIUA 3OKOB 3QEGH 3MFGB 4XB8A 1WUNT 1JMZA 1RZKH 1U8LB 3HB3D 1X6LA 3DECA 2X41A 3MR9A 2JKXA 3FQUB 4FQXD 2NXYD 4WHDA 1FL5A 2YWYA 3BE1L 4HWBA 1NC2B 1FYTD 5IIEA 5J9PA 2QKIA 2ZKHL 5ALCL 5FGCE 3BP4B 5GS0H 2R4SL 5C8JA 5JORB 1NUNB 4LLWA 1LP9E 5EC1B 5DUBA 2J88H 1XCQB 1KIPB 2ZSWB 4PRPA 4TPRH 3UTPD 4HZAA 3BN9D 4RNRA 1OAZL 1RZIB 3O4OB 2WWMC 4HUKB 3BT2L 2R2EA 5JA8B 2X4QA 4KRPB 3EFFA 1NCDL 3LOWA 1F90L 5F6IC 1QTYT 3RVUD 4AMKH 3DOSA 4XI5D 4LCYA 2WBJA 2VLRB 3QIBD 1S9XA 3O3UN 1CTOA 5EOQL 4PJHB 2BJMH 1NFIA 4HCRL 3I75A 2JB6B 2ZPKH 5DMIL 1U3ZA 1LEKA 5DTFB 5EUOB 1YN6B 1LVEA 4X0KA 3L3KA 1ACYL 1JNNH 3SDXE 5IESL 5F9JB 4EXKA 5JDSA 5E9DA 4WIQA 4NQEE 1D5BA 5C07E 3FT3B 1HHJA 5DJAB 4N0YL 1FPTL 3EDDA 3IFLH 5EO0A 5MEOB 1FLRL 3MCKA 4JPIA 2FYYB 3FKUS 4CU8A 3HFML 4JHWH 2C3WA 4BFIB 5IG7B 2H2SD 1BAFL 1EMTH 3PNWB 4M7LL 4CMHC 1CIDA 1UCBH 3IDGA 4JY6A 1BVKB 4I3SL 4NRZA 3ZDXF 4ZDHA 5J3HD 3B2UC 4KY1L 1ES0B 3ZTJG 3ZL4L 5FDWA 1IAIH 1X5JA 5IBTL 5ISZB 4LBEB 4HXBL 2KPNA 3DV4A 4PUBL 4L4TE 1C08A 1IAIM 4ODHL 4RGNB 3TZVD 3MRKA 1SJXA 3CCHA 3WJLC 4QWWD 3CUPA 5JLZB 3DUSA 3IRZA 2VDKH 3SE8H 3DUHA 2BX5A 3SKUD 5FYKD 1FNGA 2WSKA 3HNSL 3HR5B 1KN2H 1WBYB 1RFDH 5F96H 3ARGA 1RUQL 1IGIH 3L3OA 1ND0A 4ZXBA 3UTQB 4KHTL 1JGEA 3HMWH 4BSWB 1Q8MA 1QRNE 2P4AB 3T2NH 4ZSOE 4EUPG 5DJ8A 1BHGA 1JP5A 3IJHA 2YXFA 2YPVL 1JV5B 1YJDL 3MBEC 4OUOA 3SCMA 2DQJL 7FABL 3MLZH 5JDJA 2YD9A 3NMEA 2ZUXA 2A6KA 3DGCR 1N8ZB 4GLRH 1I85A 4HS8H 5A16A 2XV6B 3MCG1 1YNLH 1CDYA 3D69A 2VMFA 5IFJB 1QFUH 5CMAB 3VMNA 2YOCA 4Q0XH 1R24A 4HKZB 4P46A 1TJHL 4TOYL 3FQWA 3KS0H 1BBDL 1TXKA 2ORBL 4EN3A 3BRDA 1AD0A 3PWJB 2COQA 3P4MA 3SBWC 5HYSB 4JQXC 2HT3D 2QQNL 2FJFA 4AL8L 1DZBA 1JJUA 1CD9B 3T2PA 3EOTH 4O2CA 5HY9B 5I9QC 5ITFA 4D8PA 2FX8H 3GSNH 1EFXD 2YD3A 1EDQA 3HAEH 4F58L 2V7NB 1IZKA 4Q9RH 4NQUA 3VXMA 2W0FB 4KI5C 3U1SH 1EFQA 3I02B 3K80A 1T7ZA 1I3RB 4N8VG 1S8DB 2WQ8A 3T0EB 4E42A 1AQDA 1DQLH 2OYPA 2X10A 4QO1A 2PXYA 5BO1H 5LKNA 4OD2B 2FH8A 3W0WD 1LMKA 5BQ7A 4FNLH 3BAEH 5I71C 3ZE1F 1D3CA 4APQC 1S7TA 3F62A 2ESVA 4JKWA 3RWIA 3JUYA 3VD7A 1P9MA 5T1DL 4F80A 4YIQA 5BW7C 5JMOC 1CK0H 4PV8A 1TCRA 1XF1A 2NW3B 3DETD 2D4DA 1JF5A 3U6RA 3FB8B 5IVXA 3IXTA 4PV9A 2Y07H 2IBZY 3SOBL 4JQIH 1ZMYA 1RZ8A 3OZ9H 4U4BA 2FX7L 4YHKH 4EBQH 2MKLC 2NX5D 3P4OB 3TBYA 3HUJE 1WAAF 1JZ6A 1K5NA 3NCJL 2WUBH 4G8FB 5D8JL 1BVLA 1QFWL 2XXCB 4YZFF 1JFMA 3WIFA 2GSGB 2LTQC 2WP3O 3DROA 5FOBB 1VFAB 1CDGA 1RUAH 4IOSD 1NEZA 1ZK9A 1HH6A 5DF0A 4Z7VA 1MVFA 3GIVA 4Y2DD 2V2TA 1MHEB 2EIEA 4IDLA 1F3DH 4P9HH 4QGTA 5DD0H 3ARTA 3IU3A 4WCYL 4HWEH 4UINH 3RWJB 4LIQH 4HJJL 5IWLA 2IPKB 2P24B 2XTJB 4DGIL 5I1JL 3VFGH 2BERA 2XTLA 4DVRL 5DJCB 2X4UA 4QRRB 3THMH 4L4VD 3WNPA 3ULUD 1I9IH 4HDIA 5ELIA 3RUGE 1YEIL 2XRAL 3BPLC 5I1CL 1ZA3A 2MKWA 4FABL 4PYHA 3CVHB 4QRUA 1H3WM 5FM8A 2GCYA 4PJEE 4U1JA 2YBRB 4MQXC 4MJ4A 3W5NA 2YSSB 1J7VR 1PAMA 5BZWB 2E9JA 1MHHB 4X4MA 4QRPB 3QEUA 3ROOA 4UU9A 4NWUH 3VH8G 5DRZA 1WQVT 5DJXA 1E4XH 4P5TC 5BRZB 1LILA 4QEGA 2DD8H 3P4NA 1YYMH 1LDPL 2HVJB 1OTUC 2EYRA 1M7XA 4Y19E 3D2UA 1U8QA 3UBXA 5FUZL 2HT2C 5IOPB 5TE6L 3D3VD 1EEYA 2CGRL 4TULH 2DKMA 2P5WB 3OKKA 4I3RH 2YPKB 3FO9B 4OLVL 4Z76B 3OKOA 5HI5C 4U7MA 1MCIA 2AGJH 4OCRL 1CZ8H 2YR3A 1MOEA 4WU5B 1S7XA 4P2OC 1U8LA 3TWCL 2IAMB 3FQUA 2ENSA 1NC2A 2CH8A 5D7LB 3BZ4B 3S7GA 4GSDL 2NZ9C 3BP4A 5A2FA 2GEEA 2BY2A 4W4OC 3V8CA 3UO1L 2OS7A 4LMQE 1ZLSH 4MVBD 2ZSWA 1NGXB 2X4TB 4QYOB 5FEBA 5FOJA 1U3HC 3B9EA 5ESVB 4JPWL 4JO1L 2F8XC 3RAJL 3C87A 1BX2B 3AY4C 3EIFA 4H26B 2NY3C 2X1PA 1HQ4B 4Z95L 2VLRA 5MEND 5CCKH 3BZFB 1Z9LA 3MBEA 1JZ3A 2HLAA 4PJHA 1FNLA 1YEJL 2HH0H 1SMAA 5DTFA 5EUOA 1YN6A 4YBQD 2ADIB 2ZCLL 2GYSA 4Z7OF 3HAEG 1FJ1A 4DKFL 1MEXH 4NO5B 3FT3A 5DJAA 1MIML 1HH9B 1YEEH 1E27B 5MEOA 2OXHA 1J11A 4WEBH 3MV7D 4XWOD 3Q5OA 5GRVK 4OD1H 3VFTB 1KEGL 4BFIA 3SEPA 5IG7A 2MCG1 3SDDC 3PNWA 4JQXA 3VXSB 3RWEA 1BVKA 1AFVH 5F1IB 3O3DA 5GGTL 3KPNB 4OF3A 3RJQB 3HPLA 5ISZA 2UWEB 1VESA 1YEHH 1T80A 4UILH 2A38A 2D7TH 1JBJA 5L0QB 3AS0A 1F8TL 1DEEB 3OKDB 4H8WH 1HKLH 1DVFD 1T66C 1MY5A 4FZ8L 5K33A 2R15A 1WBYA 1MFDH 3IJYB 3SDCB 3U9UB 3UTQA 1MCCA 1T1WB 4ZFFB 4BSWA 1EO8L 5IV2B 5T1MB 5GRJL 4UOW1 1GOGA 3S5LA 4Q6IB 3GHEH 1FL3B 1JV5A 4ISVB 2AXFB 3P30H 1DQTA 2OJZH 3UAJC 4TSCL 5H35B 4LSPH 3JWNC 1UB6B 2I5YL 4OCWL 3R06B 1N8ZA 5L7XH 2HFGH 5DVKA 5JW4Q 5HD8D 1I7RA 3EYVB 4NKQB 4WI5A 3G6JB 4WGVB 4RGOH 5F1KC 1PVHA 3V6ZB 4CJ0A 1IM9B 4HKZA 1IZJA 4YUEL 2RFXB 3BZDA 4BQ8A 1ZLWH 4Z77B 2H1PL 1U8HB 1MCJA 3PWJA 3WUWG 5E8NB 5HYSA 35C8H 5DVMA 5E70A 2XQBH 3OAZK 3HKFA 3PF2A 2MJWA 1DBKL 4M7KH 3S35H 4KTDL 2ITDB 3FB6B 2HFTA 1N3NB 1FO0L 1QLEH 5E5MB 3NPSC 3RUGF 1DE4A 1YEGH 2GJZB 2V7NA 3N1GC 3VRLF 3WE6B 1NGQH 4PJEF 4QTIH 2MQ3A 5GGSY 3WN5B 3DO7A 3I02A 4RBPH 1I3RA 5GGVH 1NBQA 4OLYH 1S8DA 3T0EA 2D7OA 4WUKH 3MJ9H 2Y06L 4IMLA 1D9KB 2HT4D 4OD2A 2D31A 4HF5L 2EYTA 3M45A 5FA4B 3W5MA 3QDJD 1F4XH 2W38A 1YA5A 1QBML 1IJ9A 4WFGD 2C9AA 3ZHKA 5FGSA 4FQXB 2NXYB 1OL0A 4MX7A 1AO7D 4HC1A 4P5KA 5IK3B 3P0VH 1ED3A 2BRQA 5I15L 4CW1B 2DQCL 4HBCL 4Z5RB 2Q8AL 1G6RH 2K7PA 3D1MC 5CEZD 3EBAA 2NW3A 3IDNB 3LDBB 3QUYD 4ZFGL 3FB8A 4MMZC 4I2XA 5HXMA 1QNZL 3T1FB 1WZMA 3WSQL 5KVGL 1P7KB 1I1YA 4KTEL 4X9HA 3TVMC 5ALBL 2BVPB 3P4OA 4K71C 1T03H 2VKWA 8FABA 4G8FA 2VIRB 5FUOH 2XWBA 2Q76B 1CL7H 1KENH 2W9EL 5EO9B 2GSGA 3QIBB 5FOBA 1VFAA 4Q74A 5KJRH 1QFPA 3F7RA 3LEYH 3CJJA 3FN0H 3B9KC 1QPPA 4M93B 3HC4L 1MHEA 2VLKD 3GBNL 4MJ5A 4OFYA 1RD6A 4ZG1A 4PJIE 2OR9H 1H3TA 3G6DL 4MXQD 2IPKA 2P24A 4OLUL 5CP3H 4MZ3A 2CJUL 5GGUA 1XZ0B 1ZGLB 5GGSB 3BEWB 2Q1EA 2VC2L 4ZUWB 2AJSL 3CVHA 3VG0H 4JM2F 4HS6A 3AFLA 4OUUB 3O81A 2OQJA 2YBRA 1P4IL 1QZ1A 3H3PH 4MJIE 5B39G 1YEKH 4MWFB 3VXME 1MHHA 3MLXH 4XXCA 4QRPA 4XP6H 1VACA 1G9NH 5CZVH 5BRZA 2DLIA 4MNQD 5D4QA 4P2RB 3LHPL 2RAMA 2C26A 1BD2A 2HVJA 2I24N 4PJBF 3TZVB 3C5ZB 3K1KC 1A6UH 4HFUL 5IOPA 2P5WA 1IFHH 1SVZA 4UMGA 5IW6B 3FO9A 3GHBH 2NY5H 1I1CA 4OFDA 2ESVE 4Z76A 2R8SL 3EUUA 4YDIH 3O6FC 3IDMA 3PGFH 4WU5A 2FNBA 4JREB 4JN1L 2VH5L 2IAMA 3O9WC 3NVQA 1HNFA 5D7LA 3BZ4A 4P4KD 3CD4A 3LN5B 3S4SB 4DKDC 1NL0L 12E8L 5DUPH 5F72S 2FECL 2ERJB 4YHOH 5DHYB 1MFCH 5FYLE 2X4TA 4QYOA 5ACMA 4P23C 1MIEH 3K4DA 4WWID 4KDVA 5D1QD 3LPFA 5ESVA 4NUGH 1MCKA 1JPSH 1MWAB 2YMXL 3BMWA 3VFMB 1BX2A 3MOAL 4QHMB 4H26A 1XR9B 2IF7A 1DN0B 4XNYH 5K59F 4Z7VE 1NFDB 3QXAB 1HQ4A