4L8DA

Crystal structure of the h2db in complex with the np-n5d peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acute emergence and reversion of influenza A virus quasispecies within CD8(+) T cell antigenic peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 74
structure length 277
sequence length 277
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l8dA01
4RMWA 1DANT 3GSOB 5E6ID 5ACLA 1KTDB 5DR5L 4RFNC 4JFOA 2WP3O 3VFMA 4MXVE 1ZGLA 1RJYA 1K4DA 4G6KH 4Y5VB 2R0WL 1MEXH 3LS4L 5MERB 4MJ6A 1QNZL 1SY6A 2MCPH 5IF0A 1QA9A 1CG9B 1RY7B 4JHZA 5M95B 1CFNA 3LKSB 1T1XB 1A4JB 5DA4A 3NA9H 1MJJA 2DQGH 3WLWC 5TDOA 1ACYH 5CP3H 3HMXA 4JO2H 4NWTH 2CLRA 2MTPA 4FFVD 5CHNA 3VFPA 1Z9LA 2VR5A 4OIBA 2IANE 3RY6A 4OB5H 1TXKA 3JVGC 3BGFC 3GSQA 4JE4B 1J8KA 5JQHC 4U1GC 1AE6H 4TTGA 2ZUUA 3LN4B 1A02N 3VFVB 3LHPL 3GUTA 2R8SL 2PF6A 4J23A 1OM3L 4NHCL 3IXAB 4PJBF 1HHKA 2VXQH 4RGNE 3V79C 3BXNA 1UXSB 4OUUB 3MRKA 1UM5L 1XF2B 4GLRI 2YWYA 5DS8A 1ZHLB 4X98A 5GZOC 2GQHA 2G75B 5I1CL 3UPRB 3HUJB 3MJ8A 3RWDB 1MELA 1NCCL 4LLDB 2I07B 5HVHB 3HUJF 3P4OB 1NCBL 3MR9A 1OAXL 4NQVA 1KEML 4EUPH 3K2UL 2EH8L 5I1AA 4Y16B 1OTTD 4UT7H 4PV9B 1JPGB 3RWGA 2M1KA 2E8YA 3I75A 3RY4A 4K3EL 2HVKB 4OKVB 4WFGE 3WHXB 1S7QB 1JNJA 5TF0A 3PWJB 1A6WL 2LAAA 1XFPA 4EKXA 4PGCB 5IBTL 4H25A 1D5BA 1F11B 1X44A 4NRZA 2BNQB 3CFJA 3BWAA 3LH2L 1IM9A 5B3NA 1IC7L 3U0PA 1P84K 4ONFL 2H32A 3BP6B 4OLVH 1JGEB 4JVUA 4XMLL 1UB6B 3NIFE 4LCCC 5F7FA 2VZSA 1RZJC 4J6RL 3J7HA 5I1KH 3WFDH 1KNOA 4ZS6C 5IHUL 4PR5A 4BELD 2GTZA 5L6YL 5EBLB 3UBXI 1E4XH 3O45A 1EX0A 4MQXC 3LZFH 3TO4A 4GBXA 4E0RB 2P1YA 2ADGA 3IAQA 1LHZA 5DJ2A 4X5WB 3GM8A 3LOWA 1WIPA 4O2CA 1SJEA 2J4WL 4GW4A 5L2JA 5GS3A 1FL5B 2BVQA 1GPOL 2YPVH 1GGTA 4OGXH 3VGAC 5D72H 3VWJA 1CIDA 4F7CB 1MHEA 5L0QC 4UINH 4DGVL 5GSRA 3MRPA 3KNBB 3R0MA 5HHVL 2R23A 3MUZ1 1JGUL 3X13A 4KXZH 1A21A 1A22B 2WK2A 4XRCA 1DL7H 3N06B 4BSVB 1JGVL 5T1KA 5LCVL 3C5SB 3X11B 4PRPD 5HYEA 3VGHA 3QEGH 3BX7C 1FYTA 1T2JA 3AM8A 3VXSD 5DUPH 4I2XE 4U1KB 1R3IH 4HX1A 2ZWLT 1RZKL 3QH3A 1A1OB 2HH0L 4OCLC 3G5YB 5DJAA 3P73A 5HYQA 3OAUH 1AP2A 1KCGC 2D7NA 3VXSA 1AKJD 3QWOB 1OP5K 2O5XL 3TH2T 3NN8A 5BXFA 1LE5A 4NO0A 5E1HB 2X4TA 4NHUE 5FYKL 1RULL 1AQKL 2EDKA 2GKIA 1OQOA 2XN9D 5F7EH 4Y88A 2YPLD 5CLTA 4XWOD 1PZUB 3NAAL 1NDMA 1EEZB 5CD3B 1CGXA 2QHLA 1HCVA 1F4XH 1G9NH 1R3LA 1T21B 4F7MA 2HMID 4QXTB 4O5LL 3AS3A 4YPJA 4J3SA 2HT4C 4XBPB 2BNRA 5JW4N 5FO7A 4RQQA 3SE3A 1G1CA 3BKJH 3DWTA 4JFHE 3WSQH 4S1DD 1G84A 2EEDA 3SDXE 4HLZG 5LQBH 5FHAH 4EDWL 3U7WL 3KPRB 1L0YA 1TLKA 4JFQA 4H8WH 3DMMD 3KVQA 5FCSH 3GSNL 2J6EL 5GRYA 3O4LE 1C7SA 1A6ZB 1QFHA 4DGYL 3MROB 4EEEA 5CEYB 3ES6B 4R97C 4UOW0 2P42B 1U92A 4OI9A 4G42B 5C3TA 1TVBA 3QEQE 2HRPH 4KHXH 4XBEL 1KENH 2BY2A 3G5VB 4FA8A 2QHRL 3SDYL 4FQ2H 4BH7A 4HWUA 5ITFA 4FTVA 1UWXK 5JR1L 4LDEB 4Z7WA 4M03A 4WU7B 1E4WL 2FLBT 3AREB 4M5ZL 2IAMA 4LP5A 1YN6B 4NO2B 4UAOC 4Y2DA 3JV6B 3RX5A 4EXPX 4LHJB 3QXDA 3UC0H 1JE6A 4QYOB 4GSDH 4HBCH 2HJLB 4OGZA 3X3FL 1ZK9A 5IVZA 5JLZB 2XNAA 4NC0B 1YC8A 1G7LB 1CGYA 5IMMB 5C0AA 1JWMA 3BDYL 3OJVC 2UUDK 4J3VA 1OGTA 1FL3A 5IFAH 5FF6B 1S78D 2CRZA 2P5WD 3MLWH 3FFDA 4M6NL 4BQ9A 5CINL 3BFOA 1KCRL 2YD7A 3DX6B 1MCBA 2I9LB 1NKOA 2O5YH 4XNMA 3BKML 4JN2B 1RK0B 4Z6AT 1BOGB 1S3KH 3QHFH 4L9LC 2YBRB 3P9MB 5AZEH 4X5LA 3ULVL 4K8RL 3GBML 3Q3GB 5JW3L 4U0QB 4P4KB 1MFNA 2ICES 3UZVB 3UJIL 3ARBC 4JQIH 5DVLA 1G6VK 4PJDA 1UJ3C 4RCAA 1XF4B 4V1DD 4EXKA 4IOFD 1F4HA 5CGTA 3O2WL 1GH7A 1I8MB 3PDGA 5GGRB 5I1LB 3ZE1F 5JW4M 2GYSA 1DVFB 1WK0A 2XTLA 1NEZG 5FO9A 1AHWB 3PGCA 5CZKA 5J56B 5JIPA 4R4NC 3WIHH 1OGAD 1U3HB 1YNTB 2AJYL 5BRZA 2E7LA 2V5YA 1DBBH 1L9MA 3I2CH 2BNQE 4XCNB 1RU9L 1V7NH 4HS6B 2I9TB 4XP9L 1BBDL 4WV1B 3ZLQC 43CAB 4LSVL 4NSKA 3VFSA 3G6JB 1GGCL 5FB8A 2CMRL 1A2YA 3QCUH 4TSCH 3L3DA 4X7SH 5IFHL 1BFVL 3T0BA 5IV2B 2BCKB 4QRTA 2DBLL 1G7JA 2P5WE 4NKDA 4AG4L 1NCWH 1ONQB 3U30C 5C08A 5I1EH 5IMOB 4RIRB 1S7SA 4MAYB 4WO4A 4JQXA 4AY0A 2VXTL 3RL1B 5CJ5A 3WN5B 1KCVH 2W38A 3NCYS 1XIWC 3DBXB 3B9AA 4J4PC 3BGMB 3T0DA 5FYJD 5ENWB 4PRHD 3MBED 4OLYL 2JB6B 3NMEA 2B2XH 2P8PB 1KLFA 2Q76A 1Q9OA 2FIKB 3PGFH 2KL6A 4MJID 4UTAH 3QIUA 3RWCA 4X4YB 1EFQA 1NC4A 5D7IF 1U8PB 4WHYG 1BJ8A 4G9FA 4Y7MA 4X5XA 3ZDXE 3PHOB 2XPGA 1U95A 2YD4A 3IU4H 3V5DA 4BH8B 1YQ2A 4FP8H 1BWWA 3SE9H 1GGYA 1OLLA 1W0YT 5EZOH 3GJFA 1H9VA 3QWQB 5FOBA 1UM6L 5ISZD 4QGTA 3EDFA 4LLMB 2YZ8A 1IL1B 1FG9C 2OK0L 1KCUH 1KB9K 4ETQB 1HE7A 2EDRA 4GO6B 5A2KH 1SYVB 1U8IA 1K9TA 1PKQA 4PJGE 4G8IB 3UYRH 5HHMB 4LOUD 1RK1A 3RI5F 1N0XH 3C2AL 5TE4H 5LG1A 2BSSB 4GUPB 3IDIA 3MOAL 2IBZY 4KK6C 4C4KO 2DQTH 3HCVB 3RWHA 3U4AA 3K80A 5JIKA 3I50H 3E3QA 1M05B 2NCMA 4CL7A 1RHHB 1KV3A 4OD2A 5FGRA 3TV3H 1KACB 1V8HA 2YD8A 1C1EH 5JO5B 3MTRA 2OS7A 1F4WH 4OFVA 3NFPB 4LCWD 1FZJB 3IFOA 1U2CA 4LCCB 3QQ9C 2VNCA 5INDB 4JPIA 5F9WC 4M00A 3OKDA 5DQDL 4OV5A 2VKWA 2VLKA 3IFPA 1I1FA 4BUGA 4F9PA 3MJGX 4X4XB 5LJYH 1SVZA 3LN5B 1UFUA 3TNNB 2Y06H 1M71B 3BPNC 4HUMB 2H6PB 3GSNB 4X6FB 3CVIH 2NZ9C 4YNYB 4OIAA 3FRUA 4OCRH 5EN2B 1PBYA 1M7DB 4HWNA 4L5FH 5LKNA 1I1AC 5J11B 2H1PL 5E4EB 3RWJA 4GG6A 5I19L 5ICYB 1KELL 1Q1JH 1FFPB 4FQXC 2FH6A 2C5DC 1NBQA 3VXUA 1ZSDA 1OD7A 2AJUH 1GOHA 4GQ9L 3NCJL 5CUSH 4GAGL 5I0DA 3HPLB 1MEXL 3LS4H 3QUXB 3R06B 1M7XA 2AJSL 1INEH 4JREC 3VFUA 4MA3A 2X4OA 4ODXB 4Z78B 4Z0BL 1YYML 1RUAH 3MJ9L 3P9LB 4NBZB 4C83A 4ZNEE 2OZ4H 4MCYB 3GSQB 3PQYE 4JKPL 1QSFA 2DJSA 2VLRE 3RTQB 3D18B 4U1KA 4BZ2H 4N68A 5I1JL 4JFFD 3S37L 2H26A 1EHXA 1BX2A 4M7LH 1Z6JT 1UXSA 3P73B 5HYQB 2E9JA 1A5FH 3MBEB 4BKLA 3HC4L 4PJAB 3DIFA 2D9QB 4PRNB 4OF8A 1YNLH 4I0KA 4HPOH 5D93C 1CDHA 4HKZB 3BH9B 5E2TL 3KR3L 4NQUA 3NCFB 3T65A 1N0LA 4KJWC 4GRMA 5BV7H 1JZ3A 1EEZA 2IG2H 4MLIA 5CD3A 5E8EB 3NA4A 4I48B 2D7TH 2APVA 1EV2E 3T4AB 3MJ7A 5T5NF 1EK3A 2N7BA 3TN0C 1PKOA 2GSIA 1J0KA 3ARBB 2HTLD 5DEZA 3S98A 5D7SH 4QHUB 3SOBL 2IPUG 1BAFH 3LRSA 1YEEH 1UADC 1TENA 1K2DB 3OGCB 3AROA 1IC5H 4D0DB 2APBA 3KS0H 4KI5C 4PJGB 1OP9A 1PZ5A 1F90H 4JHWH 4R7NB 2R29H 1A6WH 3HS0A 4OF6A 4ZUSB 3RVUD 1OGAB 3EYUH 2NTFB 3DSFL 3I6LE 3WJLC 2Y5TA 5HYSB 3PJSB 3RVVD 2DQCH 1G7IA 2FBJL 3E2HC 4JR9L 4NIKB 4XC3L 3CU1A 3QJHB 1OTSC 4LASL 5EO9A 3LKNA 2IEPA 3HR6A 3HLAB 1IC7H 1IKNC 1EMTH 2G5BA 2Y4SA 2X40A 4HC1A 4CW1A 1SM3L 4WU7A 4IRSC 4Z7NE 4JG1L 1P7QD 3EJZD 5I18L 2XWBA 3FOLA 3ET9F 4PJ9C 5KN5B 4UDUB 5D1ZC 2WNGA 5ESQA 2UYLB 3BHBB 2DWEB 4O2CB 3VDBA 3LQAH 1FNGA 3RVXD 1N59B 2EDFA 2AI0L 5IG7A 1H3XA 3KGRA 2C7UB 3AU1A 2J8OA 4EN3B 1UCTA 3V52H 1SY6H 3WE6B 2X4UB 4ERSH 1GHFL 4YXHL 1YEJL 3P11L 3H7BB 2A38A 2M8XA 1JYXA 4LCUA 4CVZB 3QA3B 3ZO0A 3VFOA 5DDHA 5KZCD 1ZANH 5D72L 2VLRD 2FLRT 5L2KB 1D9KC 1MLBB 2X4RB 5T1KB 5HI4D 4JAMA 2FH8A 1KN4L 1EJOL 3FQUB 4PRIB 4PRBA 4JRYD 3KPSE 4L9DA 1DBJL 4PLKC 3BVNA 3FB6A 4NOFA 3T8XB 2EZ0C 1W0WA 2JK5A 4KRPC 4NQCE 2A6KB 2NY7L 5KS9E 1R3JB 3IETB 1JGVH 2I5YH 4MXWH 4TUJB 2Y36H 5BCAA 1J87A 4NUJB 4LHUB 1MREL 4DN4H 2CRIA 1DN0A 1NLBH 1N64H 4Y4HB 2Q8BL 5AWNH 1B2WH 4LDLB 5IVXF 2RHEA 4IJ3B 12E8L 2O5XH 5KVDH 4N9GA 4HS6A 3HRZA 1HIMH 2J6EA 4FQIL 5IFJA 1JBJA 4Y19D 4QNPF 3TPKA 4HGWA 1G9EA 3O6FD 2DJUA 4RGMC 2A77L 2OL3H 2MPAL 5SWSD 4DK3A 4FQCH 5DD5H 2LU7A 2Z8RA 3WNNA 3L3DB 3S7GA 2MCPL 1LEIB 4X6EA 2X4QA 15C8H 4J2XA 2WBJA 5JA8B 2HKFH 4P9MH 4PJHA 1NFDA 3GHBL 3BI9X 4QRRE 4Y16A 3AS2A 1VFOA 2G2RA 4E41D 3NZ8A 5ADPH 1J9CT 5TGBA 4KUZH 4YAQA 3SCMC 3ZDYF 5FKAA 4L4TA 3M1BA 3TZVC 1UXWA 3ZT5A 3EFFB 2VDLH 4LLYB 1AE6L 1NDGA 1RIVH 2E7HA 1RZ7L 4L1HA 4PYHA 2FIKA 4TOYL 3QZWA 2NZ9D 4HW6A 1D6VH 2LQRA 1YJDL 1KOAA 1FIGL 4MNGA 3QG6B 5DWUL 4ZTOH 3RIAK 5KSAA 1L7IH 1D5MA 4OIIH 4PR5B 2XPGB 3MLVH 3OJDB 4Y4KD 1Q9LA 1JMXA 4GRWE 1Q0XH 3EOAA 2VKXA 5GRUL 4EDXA 3FB7A 1QLEH 3H3BC 3OHXA 5C0EA 1KCKA 3KJ6H 4NC2B 1U8HA 4U1HB 3MRQA 3K2UH 3ARDB 3DURA 2AK4D 5JW4R 5JZ7D 5E2VL 2R1WA 4WDIB 4EUPB 4K3EH 3BP5B 5ERWA 1EFXB 1C16A 3NPSC 1KIPA 3EJYC 4X6CB 3LDBB 2A74B 3PP3H 2DLFL 3VWJB 4CU8A 3K81A 3BZDA 3SDXB 4I18C 1Q9WA 4YXLH 3MRPB 3ROLB 5SWSB 5JHLH 3I85A 2Q7YA 3LH2H 3HCVA 1A9EB 3DRQB 3OR6B 2DOCA 5HGBB 2R9HD 1FG2B 3TH4T 5CIPH 5BO1L 4D94A 2AXGA 4Z0XA 2W60B 3T1WA 4AYFA 2QKIB 4UNTA 4JO1L 1QFPA 1OTTC 1U8JA 3BKYH 4HIHB 4QKXB 4Z7OE 1RZGB 2WIIB 2X4SB 2YHGA 3V0VB 4XP1L 1JZ2A 2ADIB 4UU9A 5CJXC 5DUBA 5DMKB 3T08A 1HHHB 1G0DA 5SWZA 3MBXL 5E2WL 3HE7B 1GGBH 5CJQL 1V7NL 4OCWL 3TBTB 3WNOA 1XF5B 4ELMA 3BP4A 3JWDL 2Z91B 4ZAKA 4IIQA 1EAJA 4OCNC 4PJIA 4RIRA 2BRQA 3CZJA 3B2UC 4LU5H 1FV1A 2PYFA 4N0YL 4ZUWB 5T1DL 4ZFZA 5HYJD 3MLYL 2J5LC 3GDBA 3NZHL 3FO1A 4TNWF 5IB1B 4XHQA 3Q1SH 3KYMB 4WFGD 3FB5B 1QEWB 4K94L 5TDPB 5CZVL 4J4PA 3PE9A 3B8YA 1WCQA 4POZC 1FDLH 4QCIA 4NN7B 2VITA 5J0BA 1R3IL 2HWZL 2VZVA 3QUMA 1AR1D 2F8OA 5BS0D 3MV8B 2XTJE 4PJ5D 4YK4C 4JM2F 4U1SA 3UTTA 4XPBH 1G7QA 3G5VA 4WWID 4R8WH 1KTRL 5FM5O 1VFMA 1EA9C 1P1ZA 1F4YH 2VOTA 3MACH 5DLMH 3SQOH 4X9HA 1NEUA 1IGYA 1MRCH 2YZ1A 4G8GA 2ICEB 4NKMA 5L0QB 1NCDL 5GRXG 5I8OL 2ERJB 4OZHA 1F5WA 5IGXH 5GRJL 3IFLL 1QRNE 1JGLL 1AO7A 3ECBB 3MRLB 3VFRB 3BMVA 4YDLB 1LE9B 5C08E 4OZGB 5JOFA 3NFSH 3QXVA 4BKLB 2J88H 5J89A 3JTSB 1QQDB 2A1WL 2Y7QA 4HKJA 3VXQA 4NBXB 1BZ7A 1IGTA 1M6OA 3EUUA 5FKPA 3U0WH 1KTLB 1A47A 3C8HA 5LQBL 1J5OH 2G9HA 2VAJA 3FRPA 2V7NA 4ZSOB 5I6XB 2DKMA 1HH6A 3L3HA 1GCFA 5JOPD 2NY3B 2AK4A 4WI9A 1JRHI 4EQ2A 4ODHL 1CCZA 4MA8L 4AMKL 2AJXH 2ICWA 3GBNL 5IP4A 4LEOA 5TE4L 1A7OH 4QF1A 3QO0A 1IEAA 1WWCA 3O3DA 4MDJA 1CQYA 3ARBA 1BVZA 2QHRH 3SDYH 3HR5B 5B39B 3H3KA 1BREA 3VG9B 1LNUB 4H1LA 3TJHA 4PJAF 3L95B 3UZEA 4G80A 4YE4L 4JZNB 2HLAB 3CDCA 2EH7L 3B9EA 5D2LB 4K7PL 1LO3H 2DTML 2D4DA 4QRPA 1FNEA 4RWYH 5E7FA 1RIHH 1OB1A 3QNXA 4A6YA 1MJUH 3LCYA 4ZFOB 3AXLB 1XGPA 3GSOA 2AK4E 4H0HB 2XIDA 2WUCL 4YUEL 2F5BL 5F7LB 2VDOH 4TNVK 4GKSB 3S6CA 1HEZB 1MVUB 1R3HB 1GXEA 3B6SB 4YGVA 3DRTA 2YKLL 3ZKQD 1J10A 3ILQC 3PWPA 5C07A 3GSNA 3VRIB 3WKNA 3QNYB 4WCYL 3HAEA 4CW1B 1PY9A 2DQEH 3SKUD 1IAIL 4QRRB 2C1OB 1CFSA 2H2SC 1SMAA 3VRJB 4BSWA 4M6NH 4WFED 3GJEB 3MO1A 4PTTA 4KHTL 5FCUL 1UEMA 2YRPA 3KJ4B 2EDXA 1UACL 5B22A 3VW3L 4NN6B 3D9AH 5CMAA 5C0NC 3E6FA 2JIXA 4XPHL 4NYLB 1LO2H 2JKXA 2XN9E 1WFOA 4U31A 2AABH 2DDQL 3IFNH 4L5FL 2O5ZH 1OT2A 5M94B 3V2AR 3DROA 1FNSL 4JFOB 3EYSL 4ELKA 5E94B 4CVZA 3SCMB 1HINH 3VFUB 4DAGH 2M26A 3GUTB 4OZFG 2K9UA 1CICA 4FFYH 1SQ2N 2AJUL 4LSRH 3WJLA 5CILH 2V9TA 1I1CA 1MY5A 4OUUA 2PNDA 4S0SD 4XHJC 4OCSL 4N0FA 4XMKL 5MEOB 3D39B 4L8CA 1U93B 3CMOH 4ZXBA 3CLEH 4Z0BH 5FECB 3FQXA 5IK3A 5JDSB 4NJ9H 2ZJSL 2CIIB 2OI9C 3GJFH 1I3UA 3OKYA 4XVTL 1TZHB 3VJ6A 1G6RL 4NRXA 1L8JA 4ODBD 2IBGA 3FT3B 1NGQH 4GAYB 2IALB 2VB5A 1MCPH 3O2VH 3VD9A 2FWOA 2BMKA 4OB5L 1YMMD 1MIMH 2C3HA 4JPVH 3VWKA 4XZUA 4F7EB 3D0VB 4HJJL 5HHXL 1NAMB 3ZDZE 1RZKC 1XH3A 2DLIA 5ISZA 3O3AA 3MMEA 1RJLB 1ZT1B 2FCBA 4PGBA 1YNLL 1OM3H 1FO0A 2VISB 1C5CL 4WHTA 1D7FA 2IH1B 4YHPA 1IGJB 2UVEA 4JANA 2IAMD 3VXRE 4PRPA 1TQBB 1T5XB 1CT8A 3UDWA 5I1CH 2ZOLB 4OLYH 1BJ1H 4NQCD 3C5ZD 1NANI 2JIXD 3MGTA 4DOHE 4YHLH 2Z93B 4NQVB 2CQVA 4UQ3A 4YHNB 3NZ8B 1QRND 2NR6D 2QSQA 1RVFH 4Y4FA 5HGAA 5IHZB 4MNGE 3RGVA 2NW2B 4I2XA 1DQTA 2CRMA 4PJEB 1PQZB 2DYPA 1QBBA 3IXTB 5E6ZA 4DN3L 1JPSH 1FSKC 5JNYA 5HVWA 4MQ7A 1XR9B 4X7CC 5C0ND 1L6XA 3GEWB 3ERYA 3IRPX 5CCKL 3S35H 1KCUL 3GSWA 3MYJA 2JCCB 1QLRA 4ZUUA 1UB6A 3BSZH 1KLGA 4V1DA 2H2SD 5DD6A 4WNQA 3W9DB 1KLUB 1FLRL 4NKIH 3RDTA 2FECI 4XVJH 4KJPD 2BXYA 4LKXB 1Q8MA 3U2SB 4M7ZB 4MDIB 5F7DB 4UOJA 3TBSA 1HHGA 4JRXE 1NBVL 3H0TB 1X6NA 3P77A 2W1NA 3G5ZB 3MV8E 4Z7NF 3I6LD 4YEFA 3CXDL 3WIIH 1I4FB 3RPIA 3WFHA 3OKEA 1NC2D 1CXFA 4UV7L 4MJ4A 3QIBD 2COQA 3NH7L 5MENE 2V2XA 1D6EA 5EULV 4HEME 4DUWA 3FKUS 3G5XA 3VCLA 4P48A 3D2UB 5GS1C 3NVQA 2R4SH 3V4VL 4MA7H 3HUJA 3MJ8B 3RWDA 5KSUB 3C5JA 5IW6A 2VLJD 2XWJB 3N9GH 5GGTL 3P0VL 5D8JH 2CJUL 3NTCL 2ZNWA 3QDGB 4F7MB 4MCYA 1JPGA 1GSMA 4NN6C 4LHUA 2NY0D 1I1YB 2GCYB 1HDMA 1JL8A 1DSFL 2EXWD 1JK8A 3W81A 4MS8C 4BFIB 5AD0A 3VXTB 2BSTA 2Z8VC 5I2IA 2Y36L 4Y5VC 2D7QA 2HAZA 1VEPA 2R0KH 4UBDC 1QHPA 4FNLH 2F15A 1YPZA 1MCSA 1RZKH 1S7TA 4HQQH 4OQ1A 1NEZB 5EG6C 4M1DL 1MCWW 1NBYB 3K4AA 3WFZA 2VLLA 4NPYB 4Z7VA 1HHHA 1ZLWH 4HKBB 5CJBA 4PP2B 2IPUK 5F1NA 2CLZB 5TE6H 1J8HB 1HSAB 3MCKB 1K4CA 3F58H 1AQKH 3H9HB 1II4E 4YWGL 5GJSL 1FC2D 3GSVB 4GRLA 4OQTL 1WJ3A 1KXTB 5EZJB 3LEVH 4FQLL 1IKFH 4O5LH 4FQCL 5DD5L 4NBYB 2GSIB 3PL6C 1LDPH 1A7NH 5EU7E 5D2NC 1L7TL 5D7KE 5E9DA 5FHAL 3NCEB 3PP4L 1EZVX 1UYWH 4KY1L 1NC2B 2P8LA 5ACZA 1NUFA 1U91A 1NJ9B 2NY5L 5DZNA 1KJMB 2L7JA 2ITCB 2Q6WB 4DGYH 4M9PA 3RU8H 5E9DD 5IMMA 3RUGF 1IQDB 1MHCB 4M43L 5DJ0A 1NMAH 1OPGH 4Y4KA 4OD1H 3R1GH 4ZO9A 1IT9L 3STZA 1QVOB 3W5MA 3NCBB 1YMME 4MGXA 4LSQL 3C9NB 3S96B 1AQDB 2YA2A 1QA9B 5DJDB 4X6DE 4Y5XB 5C0EB 4QXUL 2D31A 4JCLA 3BYYA 4S1QL 2GITB 3RVTC 4OIIL 2ZUTA 1AKJB 2F8XC 3ZSTA 3CX5K 1ODAA 3JV6A 4AH2B 4HUXA 2P45B 4OJFH 1ORSA 3UROR 1CGWA 3ULVD 4N8PA 2YMXH 2V6HA 4ENED 3RDTD 5F1IA 3JVGA 1UKQA 4QT5B 3NN8B 5DURD 5D96C 3SOBH 1CVRA 2B4CH 2C4XA 4O4YH 5IJVA 3ROLA 3O81A 3MNZB 5F3HA 3OTTA 3TN0B 3VXPB 2AERT 3EFDH 3BRGC 4GKZB 5C07D 3QDMA 3O8XA 4P3DA 2WBWB 5C0CB 3GGWB 4EOWL 2AVGA 3QHFL 2XZAL 5EUKA 4UIKL 4Y2DD 5IT2L 5KVGH 1CFQA 2PXYA 5HYJB 2HT2C 1LVEA 2BY3A 4KKBD 2P47B 1QSFE 3LB6C 1TPXB 1XF4A 2A0LC 1T7ZA 1B0GB 3QIWD 3EHBD 3W2DH 3CPLA 5L8JB 3U36B 1LO5B 1OF2A 3MRMA 1CLOH 3QIBA 4LSPL 2QL1A 4JG0L 1A6ZA 5DUBB 3QPQD 5DQJA 1MI5D 1DUYB 3GMNB 3VFTA 3MLTA 2QV2A 1DVFC 3VXRB 4TULL 5GS0L 5CKGA 2EEAA 1SY6L 4NRZB 3BGMA 4MHHG 3DPBA 4IBLT 5DQ9A 1T20B 4PGEA 4QTIL 3X3GH 4PJFA 2X1WL 1SEQL 1CWVA 4EIZC 3PXJA 3RTQC 5DRWA 4NC1C 3QDJE 3U9UA 2EDLA 2BRRH 4M4PA 4PJ8C 3QR2A 1KJVB 2AXFB 4PJHB 5AYQA 3D6GA 3DX8A 1ULVA 4HJ0D 3MLYH 4KJQD 5KG9B 2DWDA 4S0UC 2Z92B 4RBPH 3DVNB 3PL6D 2L0DA 5AZ2L 1OP3H 1EHLL 3RIAF 1MJ7H 3QUZD 1QUNA 4OFYA 3G6AA 1A1MB 5DHYB 1KCVL 3BWUC 1IGFH 2OI9B 2FB4L 4WEUD 3QWRD 1G9ML 5K59E 1SYVA 3SDCD 5C9KA 5CIPA 2N56A 5AWNL 3UTTD 1IGIL 2BNUB 4DVRH 2DIBA 1UWGL 5EBMA 4JM4H 4ZXBB 5KSBE 1HH9B 4H8WC 4DGIL 2BSSA 4PG2C 3SHSA 3MXVL 2IF7A 1BFOB 3SQOL 3TIEB 2ATPB 4R4FL 5IROC 1C5DA 3E3QE 1J7VR 1P7KB 2PO6B 1H8SA 5DJ8A 3OKLB 1GOGA 4FXKB 4ZOBA 1CXHA 4DKFL 2IQAA 3PGCB 3VXMB 3A67L 1ZT7A 3GSUB 2XQBH 4Q2ZB 2PR4L 4HWEL 1CTNA 1S7RB 1MFCH 2O93L 4KQ3H 3GK8H 3C5ZB 1WZKA 4NDMA 3QPQC 4D3CL 4M8QA 4P4RB 4PPTA 2OXGA 5INDA 2MNUA 3EJJX 3ILPB 2OSLB 1BVLA 4L3EB 5EU5B 3ARGD 5J3HD 5IM7A 4ODHH 3MOQA 4G6FB 2YRZA 4UTBL 1MNUH 4KKBC 5HGHB 5J1AB 4HUKB 1D5IH 2DQTL 3QEUA 1D6VL 4E41B 5I9QB 1UC6A 3IGAA 3ARUA 1E0OB 1HILB 1T89C 2YUZA 2NW2A 1L7IL 1WFUA 1NCTA 1MCRA 4MX7A 3WFCL 2CDFB 5HHOB 3NGBC 3DJ9A 2D03L 2HJKA 4PS4H 4N8VB 4G6JL 4YHKH 1RIHL 1DQJB 3DXAD 3PIQA 2XN9A 3P4MA 3SJVA 4LPCA 4PV8B 3D48R 3ARDD 1U8QA 1FZOA 4OSUH 1A3LL 1NFIA 3I6KB 1CN4A 4TNWK 1OAQH 3BN3B 3DMMB 5GIRA 5IB5A 4HIIA 1EH9A 2ZCLL 1RQ5A 1YEKL 4C56D 5FYKE 3KLHC 3V6OC 5ITFB 4L3CB 2J3SA 3PWPE 3OKOB 4W4OA 5HI3D 4MB5A 5GHWL 3ZTJH 1F6AA 3AREA 1XF3B 2ZPKH 4JFZL 3ZZ1A 4HXAH 1SEBB 3C8KA 3QNZB 1CICB 5BO1H 5IKCA 2YPLA 3T4YB 1K3IA 4DUVA 4NJAH 4Z7UB 4YXKL 3MOBH 5E6IB 2AKRB 1MSPA 4WI8A 5F6HI 4JDTL 4ZNEA 2UUDH 4IOIB 3CUPB 5MEOA 3KYAA 4YPGA 4S1SL 3BP7A 3OG4B 5C0IA 1J86A 1ZS8B 4N0CA 1JWMB 2YUWA 5ETUB 2EE2A 3P4NA 3Q6GL 4LVOC 4XP1H 1B0WA 4TVPE 3SJVD 2A6IB 1Z9SA 3ARSA 2BOBA 3FFDB 3SGDI 2DMCA 2OTUB 1YYLH 5EZLA 3H6JA 2NY4D 5J6HB 1M05A 4IDJL 4YO0A 1I1AB 3MBXH 3T09A 2R15A 3BZ4B 3HE6C 4PP8C 2QLVB 3NABL 4PJ7B 5C6TH 3D18A 4FQXB 1ITBB 1T22B 4KAQH 5H2BA 3STLA 4HS3A 4PJDB 1XGYH 4P5MA 4Q6YA 1YPZF 5J6GB 4Y16C 1RSFA 2BXZA 5FYKD 4K3DH 3TCLB 3T0AA 2PYED 2QADD 3OJMB 1HXMA 1MCKA 3Q1SL 4LLQB 4YZFE 1INQA 2ZOKB 1KN2L 4ODVH 4P23D 4R90H 4ALAL 2XI9A 5EO0A 1CDJA 1X5FA 1WWWX 4X6BB 3OXSB 4JGMA 3SKNB 4OLWL 4M1CD 2VLMD 1F6FB 5T1LD 4WW2C 2IFFL 5DEFB 3LPGA 3CH8A 3O3BA 1MRFL 5E5MB 2ARJB 1UJ3B 4X8JA 2X09A 4HCRH 4WV1A 5JPNB 4BFGA 3QG7L 3BE1H 1M7DA 3ESVF 4JRWA 5A16B 5TF1L 5JHDA 1YDPB 1B4RA 3SDAC 3PUCA 3OV6A 2R4RL 3WUWA 1S9WB 3MACL 1F6LL 3HZKA 3VFNB 5D7SL 1MJ8L 1NCDH 4BA8A 4HC1H 5IBLD 5D2NA 3SDXF 3MV7E 4MD0B 5FUZL 3SKOA 5IWLA 5F71A 1RIUL 5ECJE 4EN3A 3ETBF 1F90L 2VLKD 1OGAA 2OTWB 3DLQR 4R0LC 2P8MA 1IQDA 5DJYA 4MNHB 1ZLSL 3C60A 1VFBA 2GT9B 2W0LA 3GKWH 5TH2B 2ARWA 3LQZA 4KRLB 3EOYG 2XZQH 3KLAB 3NCCB 3W82A 3IT8D 3QBTB 4JPKL 1KUMA 1UT9A 3L3IA 3PWUB 1J5OL 2R2CA 2B7DT 1EMTL 3DUSA 1WZLA 1VGEL 1C7TA 4Y5XA 5E8DH 5BMFH 4Y8DC 1BQUA 4DEPC 2NY2C 4U6YA 5F1KC 5DC9B 3CNKA 5FYJH 1T83A 3TO2B 2NPLX 1ZHKB 3BHBA 3UAJC 3RUGE 2H26B 5HHNA 3V6ZB 5DSCB 1JZ7A 5DJCB 3BO8B 1U8PA 4M7LT 2APFA 5IMLB 5LGKA 3MFFB 4LVOB 3UBXA 3MV7B 2KKQA 3IDMA 2EYTB 4FQHA 5ID0B 4IHOB 4N0UA 1WVZA 5IBLC 1MQKH 4LVHC 4U1IA 2FJHB 3HE7C 3P11H 2DM3A 5ICZB 1D5ZB 4W6YB 2EKJA 3ULSA 1BPVA 1MCOL 1JNHA 2ICWI 4JB9L 4KDWA 4L1DA 3HRZB 3BQUC 5DO2D 5ESAB 5BS0E 3MJ7B 1JUFB 4WI3A 4I3RH 1Y6MR 4ZPTB 1JK8B 1K8IB 1CFQB 2PXYB 4X98B 5DFVD 5T3XD 5EU7C 2KQMA 4AENB 3IDIB 1J1PH 2KZ1B 4P2OC 2F58L 3WL9A 4G8GE 2VLJB 3N1MC 4XPGH 2AS5M 2DL2A 1NGPL 3VG0L 2CPCA 4JY5L 3MRMB 1TCRB 3SKJL 5HHPB 3IS1X 2DRUA 4AJ0A 1A7PH 1BD2D 4IMLB 4P2RA 5CJXA 3WHXA 1FO0L 1LO2L 1HKFA 1J1XL 4MAUL 2AABL 2M2DA 3GFUA 4M3JA 2CK0H 3ARRA 3SN6N 3O9WB 1HKLH 1N4XH 5KVDL 5CBAB 3K8LA 3QUMH 4WWKB 3IF1B 1IGML 2VTFA 3F58L 5KJRH 3U9UB 3ARYA 4OGYH 4LSRL 4WTWA 4WW2F 1CT8B 4ODTH 4HIEA 5CILL 3H42L 4NNPL 4M48H 3MGTB 1H3UA 3KDMB 4YJZL 4HHAB 2WBJB 5IVXE 4MYWB 15C8L 3IS0X 1NC2A 2HT3D 3JWOL 1IRAY 4JY4A 3FO2B 4I18A 4OZFH 3RZCB 1T1ZB 2VO5A 2UV3A 3RGVB 2VL5A 5DJ0B 4PJCE 3TJEH 4Y4KB 4JFDA 1BZ9B 3DVFA 5GRVK 1CFTA 1Q9KA 3N1GC 4XPFL 3ARVA 3BH8A 4PLNC 4PY8J 1DUZA 3SE8H 3TA3C 1EGJH 4FXLA 1VA9A 4PRAA 4TSAH 1F02I 3U4EB 3C09B 1FSKB 4UUJA 5C07E 2PW2A 2YC1A 1EEQA 2A74A 2BVPB 2D31B 4RZCB 3FN9A 2FX9L 2JJUA 1EXUA 2EO1A 3LKRA 2IPTL 2XXCB 2JK5B 3UTZB 4KROC 3IAPA 3SGJA 9CGTA 2YD9A 1UM5H 3G08B 5D4QA 1AXTH 1BMGA 4AEIL 3V9FA 1Q0XL 4QT5A 3BGFB 3IDGB 2AJVH 1ZWIA 4P9HC 3QXAB 1RUPL 2BOCB 2W07A 3MRQB 3H0TA 1S7RA 1FYTB 5ITBL 5GSVA 2H9GB 4KUCD 1C12A 1OAXH 2F19H 5EZIL 4R96A 5C0BE 1JZ5A 4O4YL 1KYOK 3ZKMD 5KS9F 3VXSB 2ZCHL 4NQCA 1Z3GL 2KUTA 3JWOC 4JFPB 4ONGH 1YC7A 5BXFB 3S3SA 1IAOB 2QSCL 1KF9B 3D2UA 4LLUA 4KFZC 3FQNA 5I16A 1LEIA 1HHKB 4HUVB 2JJSC 3CPLB 3T2OA 1KG0B 4LHUG 3EOBB 3L7EA 1OSZA 5K33A 5TGBB 5DQJB 1I85C 1C08A 5AD0B 1V05A 5I8KH 4OLVL 1V3LA 3PV6B 3J8F7 5D1XC 4L4TB 2FATH 4OLXL 3B8SA 4JKLA 1VB9A 5BS0B 5C92A 4PJFB 4G8EB 4JZOA 1NCNA 4KZDH 3VGGA 3I75B 1MCDA 2V5MA 3LZFL 3REVA 4ZUSA 2Y07L 3O6FA 1WT5C 3V0WH 5I15H 4TSBL 1N7MH 2YS4A 4F80A 3T0EA 3QDJA 4JCMA 5C0FB 3OJ2C 4LGPB 4MNGB 5EO9B 4I5BB 3TBYA 1LO0H 4ZAKB 2OMBA 1N6QL 1HQRA 4XP6L 5KG9A 4GG8B 1I9JL 4ONHA 1IC4H 3CVHA 1PFCA 1XF3A 3MJ6A 1RMFH 5MP6H 4AM0A 1A1MA 4QXWA 1EEYB 2VRAA 5DK0A 4R97B 4OZGA 5JOFB 5F6HJ 4ODWA 1QQDA 1REIA 5CSZA 2BNUA 1P7QB 3DO7B 5EUOA 3KPNA 1DE4A 1R0AL 3MLXL 1KGCD 5FM5M 4PRDB 3O6FC 2FB4H 1LP9E 4MWFA 4BZ1L 5C86A 4HDIA 2GFBA 4X9FA 4OUOA 5KTEH 1E4XI 1L4IA 3GO1L 4I0PB 3WUZA 5F93C 1RZJL 4UIMB 4Z77B 4LBEA 4HAGA 3EDEA 3QI9C 2QQLL 3OKLA 4HG4K 3AB0C 1NGWA 3F5WB 2R39A 2UWEF 3ROOA 2FX8L 4H20L 3GSUA 3V8CA 3CCHB 3GHEL 3BPLB 4JFDE 1QFWM 3L95A 1ORSB 3NAAH 2GJ6D 4XMLH 3PHQA 4KMLB 2HLFD 4GRWF 4G9FE 2A1WH 1QPPA 5IW1A 2QSVA 4JPWH 4NUJA 2XZCH 1QO3A 2DM7A 3X11A 2DI7A 5E24E 3EO9H 3GK8L 3IDXL 5CD5C 4W4NA 5HVGB 4IRJD 3B6SA 2N7AA 2AK4B 3DECA 1D9KD 4YGVB 4P46B 3QEUB 5DJAB 4APQB 2VR9A 4AMKH 1I7ZB 3B3IA 4IIQB 4G7YL 1DBMH 3SE4C 4M7KL 3R1GL 1JMZA 4NQDB 4FABL 4D9LH 3PWVB 1QR1A 2CXKA 4DK6A 2W59A 4XBEH 3KG5A 3VFNA 3QFJD 2VXQL 32C2A 4OCMC 1DQJA 2WLZA 2HP4A 3SBWA 2W92A 5DHVH 5D70H 2OTWA 5AUMA 4XGZA 4M6OH 1W72A 2EKSA 1TZIB 1YY9C 2CUIA 3V7MA 2PCPA 1KXQE 3W0WE 2ADFH 2EH8H 1Y0LB 1UXWB 3HB3D 5B21A 3ULUE 5C0RL 2YKLH 4OSUL 3BZFA 4ZXBD 4ZS6D 5FGCE 4IRJA 4GRWB 4XMPL 2KBGA 1IKNA 2ICEA 1E28A 3WDJA 4UNVA 5CEXB 3ULUL 5K9OB 4X83A 2ZCLH 1SJXA 4OTXL 1T03L 5HDBF 3MV7D 2E27H 3G04B 5CINH 1DDHB 5HJ3A 3VFRA 2FSEB 4XPHH 5E00B 4PJFE 5EC1B 3AC0A 3HZMB 4J8RB 3MV7A 4KI1A 1IAMA 3A6CL 4L4VE 4YDKL 5EORL 2A9MH 1F4XL 3VXQB 1IFHL 2VSDA 4G3YH 2V7HB 4CN6A 1IMHC 3DARA 3UJIH 1L0XA 3VWKB 3OHXB 3P4NB 1FLTX 2WUBH 1FNSH 4KMTL 3FT2A 5K9KA 2A6IA 3HFMH 1YN6A 2HFGH 4NO2A 1MHPL 3RNQB 3DURB 2I26N 4CRPA 3WS3A 2VQUA 4GXUM 1I1AA 1ZXQA 5EBMB 1RJCA 3K4DA 4HUUB 5JDSA 5FECA 5B39A 2Z0BA 3KPSB 4LLWA 5CEZH 1GAFH 3WKMH 3UXFA 4NRXB 1A9EA 4RSVA 4RFEB 1F8TL 4G5ZH 3LV3B 3SY0A 3L3OB 4LSVH 4UDTA 1U6AH 3BIAX 4KPHH 4UQ2A 4IMLA 1TPXC 3KXFD 5J06A 2CMRH 1P2CB 4GKSA 5CJOH 5HHXH 2OJEA 3OKNB 1S9VB 1FRGH 3D39E 3BOVA 5FGBA 3DI3B 4PB9H 2EXWC 3IDUA 4GRLD 1KBGL 2Q86B 4C56A 3O4LD 1DL7L 4TVPD 3VXUE 2N1KA 3BIBX 1KN2H 2UZYB 3BEWB 1YN7A 4CJ0A 3ZKXB 5LCVH 1A7RH 3KPOA 1OVZA 4BSWB 3JV5A 2VDRL 5HDBE 3RKDC 3LIZL 1H3WM 3CGTA 4ZUUB 4OGAC 2DQDL 3AB0B 4DVRL 1Q94B 3ZL4L 4NYLA 4NZTL 1WZMA 3EKCA 4XXCA 4FQXD 5FM8A 5EO1B 5C8JA 3RDTB 4PJIB 5AZEL 3ULVH 1RULH 3I9GL 2YPLE 4XNYL 5I9QC 2IPKB 5DRNB 4FMKA 4ZUTA 4CADA 3BYTA 4NNYB 4YQXL 4RFNB 1M7IB 1U3HD 3FFCA 3G5ZA 4MNQA 5D1XB 2XQYK 4EI5C 1I9RH 4PUBH 1I3GH 3ALWA 4NT6A 4DN3H 4DKFH 1CS6A 3P30L 4WUUE 4JZJA 4PRHE 3VXUB 2DQHL 1ZSDB 2V2XB 4HWEH 1WC7B 5D7JD 3D39A 4JFED 2X1QA 2EC8A 1F4AA 5DD0H 3BPCB 4XCCH 1PG7H 3QUXA 2VXSL 4IMKC 1KLGB 4V1DB 4U1SB 1A6TB 4X9GA 2AEWA 3DHMA 1YY8A 3FZUD 4H88H 3JV4B 3BKCL 1MNUL 4LDOB 2JJVA 4M3KB 4BK4A 1O5DT 1MWAL 2ESVB 3MC0A 1FPTH 4P9HL 4AEHH 3QNZA 4X0KA 4G9FB 3WFBH 4U3HA 5IFHH 4JDZB 2VERN 2CGRL 4PYGA 1HK6A 4LCWA 1D6EB 4FHBD 3NH7H 5F70A 2VLLB 5C0JA 3KJ4C 1KTLA 1KB5B 4LLUB 1X4XA 4F57H 1KJ3H 1ZLUK 3SDCA 4GMTL 2I07A 3H9SD 4ZTPL 4JFFA 2QSTA 1NFKA 1KG0A 1ZLVH 1B90A 2FNBA 5DQDH 4WJ5A 2P24A 4YHNA 2R56H 4BQBA 3QI9B 3BDYH 5HHMA 1AC0A 1K6QH 2GCYA 1JF1A 1TQBC 1J0IA 4OQTA 1LP9B 1E6OH 5FYLH 4MDJB 5HHOE 5K93A 1YJDC 3BPOC 2AGJL 1CBVL 4BFEA 3VXTA 3HE6A 4JY5H 4PGCA 1IEBA 1X6LA 4ZDHA 3BKMH 3FONA 1J18A 4RMTA 4PJDF 4ZS7H 3KPMB 1WWAX 3QUKB 4YHIB 4PJAE 5JW3H 5LGJB 4NC1E 1NCAL 5IVXB 4F2MA 2XKSA 2P46B 2WY3A 2DIAA 4U3CA 4V3DB 2RR3A 4JQIL 4NJAL 1JTOA 4EZMA 3CH1A 3T0EC 3L5IA 4FQ1H 4G8FA 2X7LA 1Q1JL 3H9YA 4S1SH 1CD1B 1PYWA 5EBLA 5JXED 2BVOB 2R0WH 3NCJH 4EI6A 2YA0A 4PD4J 5CSBA 3RWFB 1TMCA 2FEEL 1N0XL 5J11C 1JWUA 3JWOH 2WWMD 2EIZA 3NA9L 2DIJA 4HMEA 4Q58C 4WO4C 4PBXA 2WW8A 4JO4H 4RISL 1CXKA 2H6PA 3NABH 4YH6A 1BBDH 4I8DA 3UEZA 1VPOH 1UYWL 3DV4B 2UWEA 4KY1H 3TESA 1UZ6F 1BF2A 2GEEA 1DCLA 1DE4B 2NY5H 1GGCH 1C5BL 5IEHB 5DK2A 1NAML 5D7IB 3VGAB 5LGHL 5IJVB 1T7WA 1ZTXH 3QDJD 4PJCF 3MREA 4TUOA 4ZO6A 2BK8A 4BQCA 1RUQL 2Z8SA 2XWJA 1S7UA 2FJFA 3M17B 5GS0D 5E2JA 1P6FA 3MRNA 3TYGL 4LSQH 4PJFF 3MJ9A 2XRAH 4E42B 4QHNB 2JJWA 3IDGA 3ARQA 4DJMA 1U41A 1I1YA 4OLWH 3KR3H 1H15B 1YECH 2QQKL 3CK0H 5HYFA 4XH2B 5JPMB 3ME0A 1ZHKA 4AH2A 4HK0B 1XCTA 4YFEA 3ARTA 4Z78A 4QHMA 5IMLA 3HZYB 1S7XB 5T3ZE 2GI7A 4YC2B 5CAYB 1A0QH 2RCSH 1AO7E 2BJMH 2AQ1A 4OZIA 5K9JH 3ARFD 3B9KD 2Y1VA 5I19H 4L4VB 3HMXL 1KELH 3EOBA 3L7EB 2VISA 3L3KB 3GRWA 2IQ9L 4XBPA 3SGKC 3MXWL 4ODUA 1GIGL 1R24A 1CLZL 2B0SH 2EIDA 1LK3H 4XC3H 1BVKB 3FT4B 2CDGA 3D3VB 1IARB 4LASH 4L8SC 1WBZA 4WTZG 5ILTH 4HJGB 5GPRA 4KK8D 3U36A 4OCXL 3S5LB 1H3TA 4MJIA 1UCBL 1YYMH 3BGAA 3IDNA 5H8DA 5F21B 2XT1B 3CAFA 5SX4I 2OR9H 5I1DA 1X5IA 3BD3A 3F62A 3R0NA 4FQJH 3EYFA 1QRNB 3MRIB 4KROD 5D7LE 4DVBA 5JIIA 1T66C 2XWTA 3I50L 4JRYA 3A0OA 4WFFD 4WFHE 1YMMA 5CEXA 5KS9A 3TA3A 1ZLWK 5DURB 5SWZE 3PJSA 2LVCA 1LO0L 3BQUA 1AKJA 3LDBC 5F3BA 1E6JL 2ADJA 3QFJA 5B38G 3TA3D 3TP4A 4ZO7A 1MRDH 2VABA 4J8RA 3RKDD 1EUTA 4WO4D 5CSZB 5DGRA 3S88H 1Y6KR 2AXJA 4KVNL 5DJ6B 4LVNB 4WUUB 2V7HA 1J1PL 5GGTA 5MP6L 2Z92A 3ARED 4NKOA 4PBVC 4Q9RL 4Q6IA 1XGUA 1H8OA 1T4KB 4NHUA 4AEEA 5ESQB 1CICD 3GB7B 3P77B 4HUNB 3RQ3A 4IDLA 3QEGL 4LARH 4NDMB 4P49A 4S1RL 1PEZA 1IQWL 3BD5A 4M8QB 1R0AH 4P3CL 5IQ9A 1VGKA 5D2LE 3ARFB 3B9KB 1HYRC 3F5WA 1I1RA 4MAUH 3T0ED 4DN4L 2HH0H 2QADC 3MRJB 2NNAA 4NFBA 5IM7B 3FB8B 3MA7A 3TIDA 2LTQB 4UT9H 1U8KB 1HKLL 3JWNC 4MB4A 5I6XC 5C6PB 2CDEA 12E8H 2YN5A 3TIEA 1A6UL 3BRDA 1C5DB 3I02A 1JNNL 1P4BL 5L2KA 3HE6D 3LSOB 3MV9D 3JSSA 4EQ3A 5JW5B 4EIGB 3C60C 1A7QL 5BVJA 5DTFA 2PTTB 4HFWA 5DS8B 4PRBB 2OL3L 1CDIA 1I9IL 1INEL 1JHKH 4YIQB 5D9SB 3VXRA 3VFGH 4K9EC 3UPCA 2PW1A 3GHBH 5DJZB 3IKKA 4APQA 5E1AA 4YR6B 3O8XC 1RUKL 2R0ZH 1ETZA 3LPWA 2XN9B 3P4MB 3U7WH 2ZP0T 2VDKH 2CKNA 1QSVA 2V9QA 1DN0B 4WV1C 5ISZE 4XCYA 1K8DB 1W72L 5BZWA 5HGHA 1CF8L 4ZO8A 4D0BB 4M7KH 1LEGA 3OKMB 4Y1AA 3IJHB 3TBVA 2VH5L 3IGAB 5IWLC 1BECA 3CFJB 4XGZB 4NOBA 5GGQL 3LRHA 3T2PA 1YJDH 4CADB 1EJOH 4K71B 3SDDA 1S78C 4X4ZA 1DBJH 2ERJC 3FZUC 4Y19A 5EOCJ 3HAEG 5MERA 1WLHA 4O02H 1BLNA 4YHKL 1XGQB 5F7HA 3WHE1 4PY7A 1A4JA 2QJDA 3LQMA 1EO5A 3LKOB 3UC0L 5GGUA 3O45B 4E5XB 2VITB 1ZS8A 1NGZA 1VCAA 3DMMA 5DMGC 5GIRB 1ZHNB 3O41A 5C0RH 3T0EB 1TNMA 1G7PA 5FA3A 4F33B 4YBQD 5EUOE 4CMHC 3TBYB 3HC0B 1A6VH 5INCB 2XZZA 2DKUA 2DS4A 1T03H 4HF5L 1ND0B 4YO0B 1AGBB 1F6AB 3MCLL 2IBBA 2BX5A 3TZVD 4OF5A 1OAKL 1BEYL 1EVUA 5JHLL 4NQXB 4B0MM 5DK0B 4XVSL 3CC5A 4WWKC 3GM0A 4Z7WE 4I4WB 3SPVA 25C8L 1OAYL 3DMMC 1JPTH 3U4BL 5IR1A 2OR7A 3MRCA 5CBEB 3KPSA 3WNPA 4KUZL 3QEQA 3U46A 3Q6GH 4I1NB 4KZDL 3VXPA 2AI0H 3I84A 4GKZA 1VENA 5E5RB 2ID5A 3SY0B 4LCYB 4LEOB 4OKVA 3FOMA 3BZ4A 3HI6L 4L8BB 3ZE2F 4F3FB 1AGDA 3KLSA 4P2RD 3QO1A 2J8HA 2X9YA 1GGBL 5CJQH 4XI5C 1IM3B 4X4MA 2DF3A 3PHQB 4LLVB 4J3UA 1JN6B 3MRRA 5J6GA 2VYRE 3RIFK 4KKAD 1BFVH 3KPOB 3MLVL 4K3DL 1CE6B 1OB1B 5CJOL 4A6YB 1U8QB 2W91A 4N0YH 5T1DH 4NCC1 3AXLA 5F88A 2H32B 1KPUB 5I1HH 4ORZC 4PB9L 5JQ6H 4ODVL 1X7QB 3VXME 4K3HA 2NY7H 3OMZA 3RIFF 1WEJH 1UWEL 4NQEA 4URTB 3DX9A 3KPRA 3O2DL 2GTZB 2ICWJ 3RVWD 3DX7B 5MENB 4MSWA 1T3FB 1MREH 3TYFB 4PGEB 2HWZH 1CDCA 1N64L 3BN9C 3ULVF 2KZWA 5FA4B 2R2HB 3F7QA 2R2BB 3WUWB 3QYCA 1W8NA 2PYEA 4R4BB 4XVUD 2J12B 5IKCB 4PJ8D 5JUEL 1A1NA 1TDQA 3KYNA 4NRYB 4H20H 3GRWH 3U79A 2YPKA 1S9XA 4U1GB 2P8MB 5HDOA 1CXEA 5HHQA 2JJTC 4P4KD 3IU4L 3ARZA 2DD8H 1R5IA 2DTSA 2BSRB 1RJYB 4XPTH 3P30H 3GSRA 2HKFL 3L6FA 5L8KB 4Y5VA 2X4OB 1QEWA 4KDTA 3QP3A 2BOBB 1VKXA 2XZCL 3BPLC 3E8UL 4XRCB 3TT3H 1CG9A 4QHNA 1GL4B 1YY9D 4DZBB 5JLZA 5KVFH 5DRZA 2CIKB 5JORB 2LU3A 4XAWL 4QNPE 4XH2A 3G04A 5FF6A 3F6LA 1CXIA 3TH3T 2VXVL 4PP1C 5EC1A 3HZMA 3HPJB 4LPUA 5D71L 5I1IH 2XG5A 4G8GB 5ICXA 3P9MA 4QOKA 5BQ7A 5T1LB 4OBRA 5DEGB 1N2RA 3O6MH 4ZYKB 2D9CA 2VLRA 4ZTOL 2EDNA 1T0NB 2CGRH 1MCJA 1X5JA 4ORGB 5D70L 2EH7H 2XKUA 4NQED 5BV7C 3EO1A 1EHNA 1F4WL 3U6RA 1HI6B 3O9WA 4RWYL 1NGYA 2FO4B 3HA0A 4F57L 5JW4Q 4EN3C 4HG4J 4ZTPH 3RDTC 1PDKA 2VDOL 5JPNA 3RA7L 3F7YA 4F9LC 3D2UD 1FE8L 4FFZL 3K2MC 5KSBF 4I13B 5GZOD 4QTHB 3S5LA 5IQ7L 5FV1L 1TCRA 4XPGL 4RFEA 1E6OL 5LGJA 3L3OA 4R7NA 4N8CL 2NXZC 3SKJH 4BSJA 1T1ZA 3CDFA 2YSSB 3QFJE 5IHZA 2YA1A 1A7PL 3CH1B 1CDYA 3PWJA 1TZGL 2VSCA 4P4KC 5TH2A 4H1LH 3A6CH 4YDKH 4H25B 1Q9KB 2Y25A 5HDLA 3CFDA 2DAVA 2BHYA 3QEHB 1ACZA 2XTJD 3HI5L 3THML 2WUBL 3H9SB 3X12B 3DUSB 4HIXL 5T5FL 4JREB 4LRNL 1H5BB 8CGTA 5IMOA 1TMCB 2X10A 4MMZC 4OGYL 5B8CC 5JXEA 2W65A 5D1QB 3BN9D 4ODTL 4FFYL 2D0FA 3QCTL 4J3TA 4GAFB 1Z0MA 3QHTC 3QUZC 4GXUN 4I18B 5B3JE 5EBGA 2QQQA 5CEZL 3DGGA 2VDQH 4FQHB 5ID0A 3WIFB 5DK2B 4LKXA 5I8EB 4K7PY 4RISH 4ZUTB 4P46C 1AGFB 1S7VA 2RBLA 4LQFH 1FORL 4YHMH 3NFNB 4KKLC 4Z7VF 1G6RH 1A3RL 1I9EA 4TPRL 4Z7UA 5I30H 5JMOC 3WEXB 3LKQB 3U4EA 5BZDB 3S37H 3VWKC 3CUPA 1DJSA 3JV0A 4NQCB 1H15A 2Y6SC 3VXNA 1XZ0A 1I8LC 2ZUSA 3CD4A 2NX5D 1YUHB 3PP3K 2GJZB 3HNTH 4PJ7E 4RAUA 3EBAA 2OMNA 4AENA 3L7FB 1MCNA 1U2HA 2A6KA 1C5CH 1UVQA 4R7DB 4JKMA 1YY8B 4P23A 1W0VB 3D3VD 1JCKA 1RHFA 4BQ8A 2DQEL 5KANI 3D69A 5BV7B 2AJVL 5FYLD 1D5XB 1MOEA 4NZTH 3S3PA 3K7UA 4JRXB 1QACA 5GSVB 2DMBA 1KCSL 4D9RD 2DQIH 3L3KA 1AP2B 4QRPE 5J9PA 1JI2A 4JZOB 4B41A 1NBYA 1PVHA 5F7MC 4U4BA 1FN4A 1Z3GH 1MFAL 4YFLF 2P7TB 4U2ZA 2ZOKA 5DC0A 2QSCH 5F1NB 5FUCE 2R29L 3D85B 4G7VL 2MCG1 3O9WC 2FHBA 1RJLA 1ZT1A 3MV01 2IQ9H 4GAJL 1T21A 2G2RB 4EJ1C 4F8QA 4X99A 3P40A 4ZQKB 1WGOA 3RJDA 5CCKH 3H9ZA 1C08B 3CMOL 3CDGB 4TNVF 2ZCKL 2CKBH 1QFWL 4OZGF 1W8OA 3BIKA 2DQFA 3N85H 1FPTL 4GW4B 3CVHH 5E2UH 4W81A 3X14A 3LQAL 1MCPL 3O2VL 3IAGC 2RJMA 1U92B 2VN7A 4G42A 3MV9E 5KW9H 5C09B 1Y18B 1G6RB 4YE4H 2DLGA 3VD4A 4OZIF 5CP7B 3ALPA 3SDAD 4UV7H 3N1FC 4OBSA 1DBAH 4GXVL 2AEQL 5SV3A 3HHRB 4GMTH 1ZOXA 3MZTA 4WTXA 3L3GA 2JJTA 5AYUH 1ZANL 2HG5B 4U7MA 4Y0GA 4NQSB 1U58A 1QLRB 2J2ZA 1KXVC 3MGOB 4HV8B 3V6FA 4YDIH 3VXOA 4DTGH 2A73A 5E8PB 2WLYA 1UKTA 1RZ8B 4KVNH 3VD5A 1TJHL 4E41E 4CDHA 2AGJH 1NH6A 2DI8A 2ZSWA 4WHDA 3U1SL 3VRLE 4KHTH 5FCUH 5C0AB 4MZ2A 2D0GA 2LAGB 2XQYG 2EO9A 5IIEB 1A7BA 1I3RB 5GS1A 4P3CH 5EDXA 1A6AA 1NLBL 3HG1A 1BX2B 3O4LB 1NDMB 1JPSL 5DI8A 5F9OL 4P2QD 1RHHA 1I7ZA 5ADOH 1IM9D 2D7MA 5A3IC 3VDAA 4KZEH 2YWZA 3VCLB 5FO7B 2HFFA 3IDJA 3S35L 4HK0A 4AL8H 3MV11 1P4BH 4LLAA 3QQ4B 4K8RC 2KQNA 2MPAH 3HZYA 4HXBL 4UBDD 1ZGLP 3EZ8A 3UYPA 2HVJA 4MAYC 3O6LL 3ES6A 4JPWL 3REVB 4IOFC 4U0RB 6FABH 4P99A 1KPRA 1VPOL 3KYKH 1QSZA 2R0ZL 3M8OL 1VERA 4KGLA 3T3MF 1EBPA 1C5BH 4WIQA 1T3FA 1WAAA 4OZ4A 2PTVA 2H3NA 1MIML 4HJJH 3W0WB 2R2HA 2NXYC 3QPXL 4IIQC 4HZLA 4P5TB 4S10A 1ZA3A 5C7XH 2DBJA 3ZTJG 1MH5A 4HHAA 4XNZC 2XXMB 4GKNA 4WW1B 2VAAB 2QQKH 3CK0L 3CX5J 4HKXB 5FOJA 4XCEA 2NXZB 3ARDC 5EUOB 1ORQB 2NY2D 1WBXB 5MI0C 2GAZA 1FL3B 3OAYH 4O2EB 5FAAA 5KN5A 4OJFL 1CFTB 3B83A 3B2VH 5KZCB 1F3JB 3FQWB 3F7RA 1XR8A 2RCSL 2OI9A 1K85A 4PRAB 3GMRA 1RK0A 2P5WA 4KK8C 2PW2B 2YC1B 1QSFB 3IJYA 4MNQE 4JO3H 4TTDC 2AAVA 2I27N 2IMMA 4XCFH 4PJEF 2DLFH 3MRLA 2EDTA 4O2FA 1UZ8A 2Z9TA 3U0TB 3PDOA 1BFOA 2NXYD 4X80L 1GIGH 4LL9A 2VZUA 4WY7H 1WCBA 4OQTH 2HFEB 2H2PD 2E8ZA 4R2GD 2R1XA 5DEGA 4FXKA 5IR1B 4WI6A 5FGBC 5EOQL 2C4FT 4OCXH 4C54A 5EOTB 5GGSB 2A6DB 4HUXB 2RGSA 3MQIA 3RWEA 5BRZB 4NGHH 25C8H 1ACYL 2Q87A 5JHDD 1CLOL 4FZEL 5LVEA 2VWEE 4L3EA 4OCYH 1ES0A 2MOVA 5E8OB 2QBWA 5DMYA 3A6OA 3OBAA 4HUUA 3RWIA 5L7XL 1N8ZB 1YMHA 1U3YA 4OD1L 3TT1H 3WKML 4LMQE 4APQC 3BRFA 5I76B 1UA6L 3T0XA 3TEUA 5A3ID 3QDMB 1G7JB 4UV4H 2O61B 4E41A 5GISH 1OSZB 1NUGA 2ORBH 5JW5A 4UQ2B 3ORJA 1JJUA 3DVGA 3JWDH 3SDCC 3T0EE 4HWBA 3NFPA 3VFMB 2SEBA 4F37F 2CJUH 1B0GA 1MI5E 2H32H 4QHLA 1FRGL 5DJZA 4NFDA 3E2HB 2G5BB 4MJ6B 1KBGH 1AR1C 4Q9RH 3OF6A 2JB6A 3B4NA 4G8EA 4PBWD 4K94H 4U2YA 2GK0A 4ZFGL 4LHUD 1FL6B 2WWMC 1WC7A 1Q9OB 1WEJL 4OI8A 1MJ7L 4D0CB 1CGSL 3RWCB 3VD7A 4QY8B 1CD8A 2LABA 4N90E 4WEBH 1FNGB 4KQ4H 3LQAC 1BQSA 5HGDA 3L9RA 5SWZD 5EO1A 5IBTH 3RTQD 3GIZL 1AC6A 3WIFA 2R0LL 2X1XR 3H7BA 3NCYP 2XZAH 5DRWB 3DROB 1ZHBA 4ELKB 4DGIH 5LAXA 3SDDB 4YZFF 1AGFA 1S7VB 1BJ1J 4IRSA 1FFOA 3U9PH 3C08L 3VG9C 5KSAB 5FYKU 3T3ME 4LEXH 2Z35B 1QPXA 3MRFA 1MCHA 3S9DB 3FN3A 4JM2D 4FN0A 4JAMB 2FGWH 1JZ4A 5ABDE 1FYTE 4P5TD 3OAZH 1RUKH 3EHBC 5HTSA 1L7TH 1Q72H 5EWIL 3K8MA 3OR7A 5JXAL 3VJ6B 1R3JA 3IETA 3ILQD 5GS0H 3HC0A 1W0VA 1NBZB 4EUPA 5I1GH 1SJHA 4UIMA 4Z77A 2QQNL 3IDYC 4PJXF 5L88H 1D9KA 4M43H 4LKCA 4KGJA 4YDJA 5I75B 1L9NA 2JE8A 5LXGH 4U1NB 2J1KA 2CLVB 2VH5H 4JFXA 1KPVB 1D5IL 3CC5B 2YUXA 4X6DB 4OT1L 4PJAA 3TFKC 2FO4A 2PO6A 3EOTL 4IJ3C 1QHOA 4M93B 3BWAB 5J3HC 4S1QH 4LLQA 4Z0XB 4O02L 4ZUVB 4NUGL 1OHQA 4H5SB 2E9BA 5J4MA 1JGEA 4HH9A 5ID1A 1HHIB 4Z7VE 5T33H 2NY6B 1JYWA 2HKHH 4O51A 3RA7H 1G9MH 1OTUD 4Y4FB 1KEGH 3FOMB 1JF1B 4FFZH 3ABZA 1EBAA 4WCYH 1IGIH 3VH8B 1KB5H 1JYVA 1CBVH 5H37H 4XB8A 1IM3A 3GMOA 2MHAA 3FONB 3NIGF 4DEPB 1ZVSB 4LNRA 5D2LF 3LEXB 3MFGB 1OAKH 1NKRA 3SKOB 5L2JB 2RQ8A 1WTGT 4NQDD 5H94B 4F2MB 4GG6F 2BVQB 2AV7B 2WZPD 5HYSA 2WV3A 3VI3E 3UJJL 1FV1B 2PYFB 5D7IA 1TZIA 4FXGB 4P2RE 2UY6A 5FYLE 5HI5C 3LKNB 2YK1H 4QWWD 5DD6B 1IGCH 3BT2H 2Y72A 2GY7B 2CUMA 3TPUE 4DAGL 4W68A 4PRID 3RVWC 3WSQL 3X13B 3PWUA 3FB7B 1NSNH 3L3GB 4OGAD 2YR3A 5D6CA 1FNLA 3VXOB 3MUHL 2YOCA 4OFYD 1G7QB 5DZOA 5E6IC 4CGTA 2FSEA 2GSGB 2A9NH 5DJXA 3QDGD 2F8VA 4HZAA 3OKOA 4IDJH 3UBXB 4KWUA 3HMWL 1LE5B 1NGQL 4NO0B 4HIJA 5C6TL 2NW3A 4RFOL 3EW3B 1A3RH 4TPRH 3QA3A 3T65B 5LGHH 4MD4B 1DN2A 2AJZB 2FYYB 1LE9A 4PS4L 5BOZG 5E8EA 2IANA 3QRGL 5K9QG 4Y4HD 2W0PA 4HWZA 2C3GA 1MFEH 4KTDL 1U3JA 3OG6B 1OT1A 5JPMA 1BVKA 3FT4A 2YUVA 3QQNA 1XAUA 4RMQA 3QUYB 4IRZL 4M8VA 2JB5L 3VU2A 3PWLB 5I1AB 1F13A 3MR9B 2EICA 1QBLH 4YHLL 3TFKD 1MCIA 2WP3T 1SHMA 1JF6A 3SGDH 5KSAC 5HXMA 3OL2A 5FUOH 4JJ5A 2X05A 3CLFH 4OZIB 3D85A 2BJML 4YC2C 2ZPKL 3UO1H 1XIWB 2AK1H 1T0PB 3U6RB 4LCIH 2X5PA 3TF7A 4MQTB 2FZ3A 1U8MA 5MEND 1I7TB 1MFAH 4ZQKA 5C0BA 2XA8H 3QUZB 1FIEA 1P69B 3C6LC 1T2QL 5KS9B 5D7LB 3U0PB 3TA3B 3EYQC 2FL5A 1CTOA 3F7YB 2IAND 1MFCL 3OXSA 1P4IH 5FDWB 4GKNB 5KVFL 1BWMA 2VAAA 5DEFA 3LEYL 4XPAL 1CGTA 3BJ91 4MHHI 2V9RA 4JM2C 2CKBB 3BSZL 4XAWH 1OLZA 4YX2L 1WBYA 1KJMA 4IRSD 1J12A 1JTPA 2DKSA 2Q3AA 4LSSL 3INUH 2MMXA 1WBXA 1FLRH 1QSFD 4YAQB 5C09A 4NKIL 2GY5A 2YEZB 4XP9H 4HWBL 4TRPL 5D6DA 3HNSH 5K59F 1LK2A 2PO6C 5D71H 2DQJL 3WFEH 1ZVHA 4Z9KB 4S2SA 3E6FB 4UB0L 1XR8B 3C2SA 2V17L 3CSYA 4LLYA 1HWGB 1T5WB 5DMIH 3V4UH 3MRBA 3KPRE 1EPFA 1MAML 4FQPA 5CLWA 2HG5A 4JGUA 1X4ZA 4MNHA 3RX8A 1KTDA 4KI5D 3ZYZA 4IS6A 1U8KA 1ZGLB 1DEDA 4U49A 4G6JH 4O9HH 2JF1A 2CDEB 3RZCC 1TNNA 4TVPL 1AIFB 4JHAH 4Q0XL 4TUJA 3TF7C 1FE8H 1FYTD 2XY2A 3G08A 1ZV5A 4HPYL 4J7RA 3DUHA 5FKPB 1H0DB 4MJ5B 1WUNT 4DTGL 4Q7DA 3EYVB 2EECA 3TO2A 3QG7H 1WT5A 4LSUH 2DJ4A 1YEKH 1F3RB 1DSFH 2R4RH 4WDIA 3BO8A 5F9WB 3BDBA 4KJYA 4XC1H 4NWUL 4FNLL 1ETZB 2P5ED 1EJ6A 3O3DB 2VDNL 3PABB 3FO0H 4UILL 4NSKB 4K9EL 3VFSB 3KXFA 1MCQA 3PWPD 3W39A 4HGWB 3ZSSA 4AK1A 4M1DH 3KHQA 4YDLC 1CQKA 2G60H 4ODSL 3S4SB 5DMJB 4UT9L 4X6DF 2BVYA 4XX1E 1Q38A 2JTDA 1QP1A 1WF5A 3VXSE 1DQML 2GTWA 1Y6NR 4JPKH 3RL2A 1UM6H 3BEVA 2LVEA 1XF2A 2JJSA 5KJRL 4FG6C 4JN1L 4R9HA 1MFBH 1GJIA 5E8DL 3RGVD 4ZAKC 4V3EB 1K8IA 4RQQB 1JWSA 2UY7A 4NNPH 1RZFH 4N0RA 4JDVA 4BFBD 1I9IH 5KBNC 1BGXH 5EUOF 4XT1C 3EYFB 4QXGL 3WL9B 3CFCH 3VFGL 4WW2A 1A7NL 2WIIA 3V0VA 3DBXA 2DQGL 3SDDD 1AGCB 4U1LA 4CVXA 4UU9B 1YEHL 1FORH 2Q76B 3PP4H 4PTTB 4MJ2A 1YPZE 5HY9B 2C3WA 4EI5A 1K8DA 1WSST 1B9ZA 1JHLH 3O41B 5SWZB 4P2YA 5DT1H 3SE8L 2ADJB 3QFJB 2DYPB 1RFDH 2R1YA 1VADB 4KXZI 5E70A 1GC1C 1P6AB 3O3EA 2E9WA 2DWDB 4QRUA 3D5OF 4F15C 5TE7L 3RJQB 1U8HB 4U1HA 1CLYH 5JHDE 1AO7D 3HI1A 3UTQB 1MUJA 4M1GL 5DHYA 4YHYB 2CUHA 5D7KD 4GFTB 4N5UA 2OJZL 3BIKB 4BUHA 1JFQL 1KJ2L 4JY4B 4HCRL 1JRHL 1C16B 3ULUF 2Z8WC 1VGKB 4X6CA 2XKNA 3SPVB 1U93A 3CZFB 2EE6A 3MRGA 3MV8A 5B8CA 3U2SA 3FJTA 1Q9WB 1FO0H 1G7MA 3OB0K 1MJ8H 3MNVA 1J1XH 3MREB 2B4CL 5EZIH 3DX6A 2GFBB 3VA2C 1T04A 5DHXB 4I3SL 3GI9H 3ZHLA 1ZMYA 2IALA 3WJJA 1EO7A 2CH8A 3DETD 5DJ8B 1FL5A 1JTTA 1WAAF 4PJHE 4E42A 2K3TA 1NGWB 5BVJB 4P4KA 1DQLL 3VXMA 4GAJH 3LY6A 3W9EA 3V0AC 4C59B 2F74A 5DD3L 1F00I 5ANMA 3P0YH 4HIHA 3ZKMC 2PW1B 1FZKA 2Q8AL 2X4SA 1J05A 1VGEH 5JIHA 1M6OB 3LRGA 3C5SA 4TN9A 5DVKA 2H8PB 3QXAA 5FYJL 1HDMB 1JPTL 4I0PC 5I8KL 2QTEA 4OZIE 4F9LA 3L3HB 1GZQB 2BSTB 3JUZA 1FNAA 4UQ3B 5F9JA 2ITDA 3WHE0 3E6HB 2QR0A 5DI8B 5IEKA 2PXYD 4BZ2L 3TBVB 5I1JH 1EGJL 1H3GA 4L8BA 4M7LL 1AFVH 3FRUB 3KYOB 1ED3A 3VI3F 3HC4H 1CZ8H 1SEQH 1OD9A 1A2YB 1DBAL 2E6QA 3MLRL 4GXVH 2FEDD 4HUVA 4LLVA 1KIRA 5I17B 1VDGA 1NQBA 1N6QH 4OGXL 1K5NA 4MJIB 4QRSB 1HN1A 2HVJB 4UINL 4DGVH 4WHCA 1NGZB 5E5UB 3CFBB 4QLRA 3LKPA 4MAYA 1JGUH 1TJGH 3WCYA 2F58H 4JVWA 5EU4B 1XIWD 2ZKHH 1KULA 4S0TD 4C4KT 3AREC 4DVBB 5SX4H 2OP4L 5ENWA 2EYSB 2X70B 2F19L 1H3PH 2X1PA 3B2UD 4PJHF 3ZKND 4DZBA 4GT7A 1ND0A 3BISA 1T83C 3U7AA 3VH8G 5C6WH 4U3XA 1ZA3B 4Z5RA 2APXA 1GYAA 3OAUL 1UWGH 3BJLA 4X4YA 3EYUL 1U8NB 1MH5B 5KSVB 5J1SC 1QVOA 1X5HA 1RZJH 3HC3H 4MXVF 4HULB 1QBML 3FQRB 2FBJH 4JR9H 5MEPB 3QIUD 1A9BB 4HKXA 1I1AD 3ARXA 4LRIA 4ONHB 5F7EL 1FVCA 3MPCA 4GW1B 4QOKB 4GRWH 1DQQA 1T66D 5HHQB 2FO1A 3VFWA 3H42H 2Z31C 2LV4A 1YEGL 4LLMA 1QBAA 3EYOB 2PR4H 5IB2B 1UEYA 3E8UH 4NQTA 6FABL 1NGYB 1MIEH 1YEDA 3VXRD 5DRZB 3FQTB 3KYKL 3TJEL 3M8OH 2BY0A 4NFCA 2NNAB 2R9HC 4HFUH 3O9WD 5CEZE 4EVNA 3QO1B 3FAWA 3EO0A 2V2WA 4WGVB 5C0AE 4JFEE 1NCUA 1PG7X 4P2QE 4G9DA 4FABH 4D9LL 2HRPL 4KHXL 4Z7VB 4OD2B 5C0AD 2L7UA 1MLCB 4X6BA 1KPUA 3H9HA 2R2EB 1T6WA 3R8QA 1W2KT 2XA3A 1S9VA 3BAEH 3WFCH 4Q9CA 4A2MA 4JLRB 1OSPH 2UZIH 4PFEA 3PWPB 4RA0C 4M5ZH 3VRIA 4GBXC 4EUPG 4KK6D 3H9SA 3X12A 4JY6A 1EAPB 1SMOA 3BUYB 3DYOA 3RBSA 4M6OL 2FL5B 4NZDA 5A16A 5IW3A 2F53B 4LOUC 4M9OA 2D4FA 4NO5B 5SWSE 5D96B 3X3FH 3PGDA 3OAYK 4MD5A 5BZWB 3WIHA 2Z93A 1TTGA 2OL3B 2Y6SD 5D2NB 1T7XA 5E8NB 3JUYA 4LNRB 5AG8A 1JP5A 2C1PA 4YNYA 1NMCC 1T1WB 3ULUH 5A2FA 4MXQA 2QQLH 2X4UA 3WNKA 2A83A 1MY7A 4GS7B 2O5YL 4W70A 4WY7L 1TZGH 4XB7A 3RWJB 3IXTA 4D9RE 4CN4A 4PGDA 3QJFA 4HXAL 5KOVC 1XGQA 5C0DB 3UJJH 3RNKA 5EFIB 3VGBA 4H0GA 2BY1A 4C56E 4N0FB 4P9ML 1FZMA 2GUOA 3F12B 2W65B 5D1QA 2YD3A 3ZKNC 4POZD 4D0CA 3WUWG 5DA0B 4WI5A 3L7FA 5DVNA 1MF2H 3G6AB 3NIDE 2BVEA 3QCTH 3ARWA 4MA3B 3MFFA 1GGIL 3VXMD 3ZYJA 3SJVE 3P9LA 3ISWA 1H0DA 4K23L 1CFNB 3LKSA 4NZUL 2XTJC 3TPUA 4A6YH 2Y07H 4HS8L 3TT1L 5T1LA 1DBBL 3C6SA 3T1FB 3MNZA 1GAFL 1KJ2B 4ZSOE 1NAMA 3NFNA 4AIXA 4KI5E 3G6JF 3O3AB 5E00A 4YHYC 3OKEB 3HMWH 4KJYB 2ZG3A 3MRFB 4Y16D 4F7TA 1LO4H 4JRXD 4QRPD 3MBEA 3I6GB 3VGEA 3ZE0F 3MLPA 5D1QC 1IGJA 1MI5B 1FYHB 1BD2A 4D8PB 1BIHA 4GJTB 4PJ5E 1KB5A 3B9DA 1PLGL 3VFVA 4WUKH 3QRGH 3KPTA 5FYJE 2PXYC 1NCWL 4ZFGH 4RRPG 4PLKD 1XT5A 1K3ZA 4ALAH 3UTOA 4P2QA 2LE9A 3G6DH 1D3CA 4OM1L 5HHPA 4R2GB 2MQ3A 4XMPH 1RK1B 4I0PD 5GJTL 2ZSVB 3UX9B 1AGDB 2WINB 5C09E 5AG9A 1GVIA 4AT6A 4LMQI 1HHJB 1J0HA 2IBZX 4PJGA 2DQIL 4A2LA 1S8DA 3OGCA 4YXLL 3T2NH 3KPMA 1LDSA 3QUZA 4Z7UE 1QG3A 2FX8H 1BQLL 4PP2A 1F2QA 2AK1L 5E7BA 1K4CB 4K3GA 2YD2A 1Y18A 1OY3B 2DQUH 4J3XA 5FK9B 3PV7A 1ZLSH 3Q0HA 5D1ZD 1HXYB 1G9NC 6CGTA 1MVFA 4R26L 5C09D 4G6ML 3W9DA 3OKDB 4FS0A 3BKYL 3TWCH 5DHVB 4QRUB 3EO9L 3MLUL 4DQOH 1PY4A 1P4IL 3VH8A 1NFIB 5I8EA 4XCCL 5H37G 4XPAH 4Y4KC 5E08L 3CSYB 1ZVSA 5D7JC 3RVVC 5GGVY 4LSSH 1JFMA 4F58H 4UUJB 4ZD3H 3N85L 2JELH 1KIPB 2ITCA 2YPKB 3WYRA 2Z4QB 5KOMC 3WFEL 1P4LB 4IS6B 4OT1H 5ESVB 1YUHA 5IIEA 2V17H 3S8WA 1ZA6A 2YD5A 5T1MB 4X7FC 3BZEB 3GSRB 3AVEA 4LU5L 1T04B 2WANA 3TV3L 5F6IC 1E4JA 5GRWA 3TN0D 1DQDL 3SCMD 4GW5A 2QADB 5F7NC 2NQCA 2E5EA 2W0FB 1KJ3L 5CZXD 1HNFA 4TVPH 3MGOA 2VQTA 4Q2ZA 3BVNB 1OP5H 2ADFL 1W0WB 1ITCA 5B4MD 4P4RA 1RZGA 3WLBB 4RRPA 4S1DC 4XPBL 3WMSA 5F1IB 2NY6C 3V5HA 4Y4FD 5J6HA 4ZOEA 2H8PA 1CR9L 2ESVA 3S3JA 5F97E 2HT4D 4WU5A 2P48B 2C9AA 3HE7A 3GSVA 4M93C 5I74C 2GTWB 3O8XB 5EORH 5TPWH 4D2NA 4EBQL 2CK0L 4PRNA 3TCLA 2P43B 4WFEE 2D3VA 1QTYT 1N4XL 4OLUH 2X4TB 1IGCL 2EDJA 3BT2L 3EAKA 3QHZH 1XEDA 4HZLB 5EPMA 5HYJA 1MHPH 3AM8C 1JNLL 3F7VA 1WFNA 3SKNA 2P44B 4FZ8H 4M5YL 3PWLA 43C9B 1XGRA 4XNQA 2EZ0D 4KRPD 4M48L 4HXBH 1BQHG 2ZUVA 5HD8C 1FVEA 1KIQA 3CSGA 2BNRB 4O00A 5FV2A 3MUGB 3Q6FB 3Q5TA 3CFCL 4ISVB 3TO4B 2GAZB 3JBG7 3HE6B 1CXLA 4U1MA 5C0FA 1JV5A 2ATKA 4X5WA 5LBSH 3M1BB 3V6OE 4G5ZL 1L6ZA 4OM0L 2XWTB 3GZKA 2BHZA 5D5MB 4PLJC 4RAHA 3W0WA 1PW3A 3QZWB 1NAKH 4OZFB 4WFHD 5A1AA 4YDVA 1LQVA 5FDWA 3KWWB 3ESUF 4Z8FL 2Y9RT 4YUEH 2VZ3A 5HPMA 3QZWG 2W9DH 3NOIA 4NP4H 5TJWK 5I73B 1Z2KA 5F72S 3W5NA 5TE7H 4HKJB 5TFSH 4XNZB 5BV7L 2ILLA 2R56L 2R1XB 4EDXB 5D1XD 3WXWL 1DVFD 4M1GH 4LFHD 2HRLA 4U6XA 3QQ3B 4AEIH 4MWFB 1JFQH 3PF2A 4R3SA 2D7TL 1SJVA 3ZL4H 3EYOA 4S2SB 1RUPH 2FD6H 5HDQL 3GGWA 2A0LD 5DZLA 1ES0B 3S5LG 2HT2D 4IHOA 4N0UB 4LAQL 5H35B 1CDGA 3KHOA 2ZCHH 3IDJB 5SWSA 2FECL 3MV9B 3CFEB 1I3GL 3FO9A 4Y2DC 4JHWL 1AJ7L 1AIFA 3HMXH 4CBPA 1RJZB 4OZHF 3EYSH 4X80H 1BOGA 4RGNC 1ZKAA 2HFEA 5LWYL 4AIZB 1DR9A 1MHHA 3MXWH 4P5KA 5MI0B 5KSAD 4POYA 1CFVL 4FQQA 3P0YL 3VD3A 5T3ZD 5EOQH 4RNRB 3UTSB 5B39G 1SM3H 3INUL 3ULVC 5KAQG 3C60D 3P4OA 5IEKB 3HZVA 5I18H 4ZFOL 2ZJSH 4LF3A 4PRHB 3ZMRA 4OD3H 1DLHA 1MWAH 1CFSB 3QULA 5JHDB 2GHWB 2PKDA 1BBJB 1AXSB 3V4UL 3U7YH 32C2B 1PGRB 3KS0J 3WFBL 5J8OA 2YD1A 2FBOJ 1RUML 4TSBH 1ZLVK 5BJTB 4PJIE 4YXHH 4Z7WF 1UA6H 5HGDB 1CGUA 2C4FU 4N1CA 3BP4B 2E6JA 3UBXG 3TYGH 1LMKA 1OARH 5GISL 4ELMF 1FH5H 4RDQG 2XRAL 4PTUA 3UTTE 4XP6H 1CICC 4J4PD 4JDVB 2CDFA 3OPZL 5EU4A 1E27B 4X7TA 3BP6A 4PGDB 5F44A 2BC4B 4CDGC 4HJGA 3DYPA 2X89A 1NFDB 1UQSA 1RMFL 1XCQA 2HT3C 2DQFB 1K6QL 1ONQA 5CIPB 1NC4D 5FYLL 2MQCA 4N5EA 5I74B 1A0QL 2OP4H 5HVHC 4GOSA 4AEFA 1A6PA 5CHNB 1T89A 4XBGB 4H0IA 1FCCA 4Y5YA 4OF7A 4Z7UF 3TPUB 4PJBB 1YMMB 3L5XH 2FIRT 3GIZH 5MHSD 3NACH 1ZHBB 3MODL 3TC9A 1Z5LA 2EIBA 1DLFH 2W0KA 1QBMH 3NPSB 1CLZH 1ZT7B 2B0SL 2A6DA 5GSRB 4PDCE 5GZNC 5E99H 1AD9B 5ILTL 4R4ND 3EGSA 4Y89A 1MFBL 4F7TB 4Z7QE 5DD1H 2Y7QB 3ILPA 2BNQD 2O26U 3OQ3B 3P4LA 2IH1A 1JUFA 2VXUH 5J1TC 1FGVL 4RDQF 3CZFA 4Z95L 4KK5D 1UB5A 4XTRD 1KC5L 3CDYA 4MS8D 1X5ZA 5ALCL 4F7PB 4LLDA 1H8NA 4XVJL 3U46B 3GB7A 1IL1A 4DUXA 3QQ9D 4FQJL 5EWIH 5JXAH 1NBZA 4KV5E 1J11A 4R96B 1U8IB 3A6BH 4HFUL 3KLDA 3VMOA 2VDKL 4E9LA 3CXDH 1AGEA 3QO0B 2ZSVA 1P53A 3DETC 3DVGB 1W72H 3SDXA 4G7YH 3SO5A 3D87B 3QEQD 1I7RA 1X5GA 8FABB 2F74B 2ZG2A 1X9QA 1RZ7H 2HLAA 1IC1A 3D0LB 2Q86A 4G80B 4OKDA 4M7ZC 4QRTB 1RURL 4OF0A 2R4SL 2XFXB 4WWKA 5EOCH 1IM9B 2OZ4A 4G43B 1HXMB 2GJ6B 2DLTA 3P0VH 5D8JL 2GK0B 3LVEA 5DWUH 2W60A 4J3OC 1FNFA 5EU3A 3H2WA 4JFHD 4QRRD 3RAJL 3IFOB 5CJ8A 4YBLC 1MCEA 4KJPC 4DFIA 1UM4L 3UDWC 4N0CD 2JCCF 1WAAE 2XICA 3O3BB 2VWEC 1NFDE 4QRRA 1IVLA 3STBA 3VRJA 4OZ4B 4M6MH 3TYFA 1YQVH 4Y19E 1XGTB