4L8EA

Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
203
structure length
203
Chain Sequence
b'IDLYYAPTPNGYKITLFLEEVGLPYTIHPIDISAGDQFKPEFLAIAPNNKIPAIVDHQPDGGGEAISIFESGAILLYLANKTGRFLSKDTRERTEQLQWLFWQVAGFGPMLGQNHHFNRYAPEVVPYAIKRYTEESQRLYKVLNTQLEKTPYLGGNEYSIADIAVYPWAKCYEHQKINLEDYPAVKKWLEKIQQRPATQAAYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase enzyme with thioredoxin-like domai
publication title Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
rcsb
source organism Xenorhabdus nematophila
molecule tags Transferase
total genus 76
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4l8eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4l8eA01
4KCAA 3UVHA 4ZL7A 2VCVA 1OKDA 2V2GA 3LJRA 3NIVA 2CVDA 1TRSA 2HZFA 1BX9A 4HZ4A 4QL9A 2IN3A 2G0FA 5HR0A 2WS2A 4PNFA 4XCSA 2J23A 3GKMA 4RQRA 2CQ9A 2FHEA 1XWBA 4XTSA 5DAKB 2TIRA 2XPDA 5J9BA 1FOVA 1O73A 4MLYA 3LORA 1AW9A 2JL4A 3V1WA 2L4CA 2HRKA 1K0NA 4JRRA 3GTUB 4HQSA 1I9DA 3GYKA 3US3A 2IMIA 3CRTA 1PA3A 4X43A 1YZXA 3GUSA 2AUVA 4MK3A 2B6MA 1GNEA 4POBA 3W6GA 4Q5FA 4G9HA 1GSDA 1XOAA 1GNWA 2HSHA 2VLVA 4FYUA 4G10A 3MSZA 4N0ZA 4KA0A 2F8AA 4TKYA 4LMVA 1ABAA 1GUHA 4EF0A 1EOHA 2Z9SA 2CT6A 4N11A 3QAGA 4PUFC 1GSFA 3U6VA 1MDIA 1HNAA 3ZVJD 1K0CA 2K8SA 2IL3A 5B7CA 1B9YC 2C3NA 5C00A 5KEJA 2HRNA 20GSA 3G7YA 4I5QA 2R5GA 1H75A 2H1GA 2X99A 2R3XA 1TKDB 4POMA 2IMFA 3KMOA 2DJKA 1XWKA 2GS3A 2OE0A 3FZ9A 4TR4A 2C80A 3KMNA 3VWUA 4ACSA 4EE0A 4MJEA 1TK0B 4HI7A 2QC7A 5F8BA 2AYTA 2YNXA 4G0IA 4PXOA 1XIYA 4D73B 3CSJA 3CTFA 2LJKA 5CAXA 3I43A 1GSQA 1AQXA 3UL3A 4AF2A 2GGTA 1OE7A 4J2FA 5H5QA 2FD3A 1URMA 1U3AA 3F9UA 1F9MA 2B5XA 18GSA 4G0LA 4NV2A 2ZUPA 1QQ2A 3KH9A 5D96A 4QL7A 4XS1A 1T00A 3TKSA 3DEXA 4PQ1A 3IBHA 5JWRB 4IVFA 5J41A 1K3OA 2FNOA 4EO3A 3A3TA 2IIYA 1B8XA 2EIQA 4NHWA 5J9CA 1GSSA 4JR6A 1ERTA 2QKEA 4MA9A 1XOBA 4MMMA 3NOFA 6GSYA 3DD3A 2R37A 1M7TA 3QD9A 3FW2A 3LWAA 1TDIA 4OFTA 2L4QA 3KGKA 2NBSA 2KHPA 4V1Ap 2IMEA 3D4MA 4PGTA 1EOGA 5IOWA 1YEXA 1VRSD 2GTUA 4DEJA 1GUKA 3H8QA 3WD6A 1M99A 1GULA 3I6AA 4YQVA 2OE1A 3UEMA 3D21A 1Y25A 3I69A 3ZFBA 1EGOA 3M1GA 2XHFA 2KOKA 4ML6A 2IFQB 1MDKA 5DCHA 2YANA 10GSA 3ZITA 2VLTA 4X1UA 3Q18A 4GSNA 3UJ1A 5ECHB 3L4NA 2FWHA 4L0WA 1R4WA 1I5GA 2GT5A 4PTSA 4TXOA 3IV4A 2DJ3A 4ZL9A 3GSTA 1TW9A 6GSWA 2MBSA 5ECQB 5HR3A 2HZEB 4KAEA 3F6FA 1W4VA 2V32A 3UARA 4IHUA 2H0HA 3W8JA 6GSTA 2PWJA 3BBYA 2VAFA 2CV4A 5ENUA 1ZGNA 1TI1A 1KNGA 3FY7A 4GTUA 4TR3A 1A24A 5IO2A 2WDUA 1R5PA 1UVZA 1SKRB 4IQ1A 2DJJA 3MNGA 4K9ZA 1M2AA 3UBKA 3DRNA 2CVKA 3GKNA 2VD1A 4O92A 1ACVA 3P90A 1GP1A 2VM2A 1K0OA 4POLA 5DALA 2HRFA 1XZOA 1R26A 2JADA 5JCGA 3VI5A 2FWEA 3BOAA 4LA1A 1TOFA 2L5LA 5ABRA 2O89A 3QAWA 2JACA 4NWYA 3DVXA 2GVPA 3TOTA 2LRTA 2GZYA 4GXZA 1GSEA 2M46A 3IXRA 5LD0A 4ZBDA 3IHQA 1GLQA 4IP6A 2H30A 3EURA 3JCML 2CVBA 3IK7A 2H71A 1PQNA 5A4WA 1PGTA 4QQ7A 4MABA 4XRAA 3GKXA 1PMTA 1K0AA 4LL1B 1A23A 2LNTA 2PUKC 3D4TA 1A8YA 1NHOA 2X8CA 5CRHA 2AB6A 3F4TA 1TU8A 3UAPA 1A8LA 2K9FA 1YKCA 4OCFA 1WMJA 2VO4A 2YZHA 3OR5A 5DAKA 4BVXB 2DMLA 3KM6A 1JZWA 1O6JA 3M9JA 2GT6A 4F0CA 3HHVA 2CAIA 4OD7A 2QGVA 1RQMA 3HA9A 2LEGA 3M8NA 4I97A 2P31A 2H1BA 4EDZA 3VPQA 2G2QA 5ECPB 3VWWA 1LBKA 4IS0A 3CBUA 4LMWA 3SWLA 3FK8A 2FLSA 1E2YA 3TRXA 5CYYA 4ZILA 4KDXA 3A2VA 4O7HA 1THOA 4K7NA 1X5DA 1X9SB 4L5LA 1AQVA 4F9ZA 3EU4A 4OCEA 2PU9C 3QOUA 1PX7A 2PPTA 4CDOA 1AC1A 4EKZA 7GSSA 1TK5B 3TUEA 3KP8A 3R2QA 3C71A 2I3YA 5CO3A 5H5SA 3ZMKA 2HXKA 1G6WA 3ZYWA 4FQUA 1O81A 4RQXA 1TRWA 3DVWA 4PUAA 5HQPA 2C4JA 2XC2A 3C1RA 3HVVA 2GSRA 4TOPA 3FR9A 5IPGA 3WGXA 3VURA 1GTAA 5D93A 5EL8A 5D9VA 4XHMA 3N9JA 4Z7XA 1SL2B 3A2WA 1E6BA 5ECMB 2E2MA 1K0DA 4WF5A 4HS1A 1BG5A 1FG4A 5B6NA 3HJPA 2VLUA 3FRCA 3G9BA 3LXZA 3K8NA 3G7JA 1YF0A 1M2DA 2KUCA 1IYHA 3WGEA 2LV3A 2N5AA 2DIYA 1K3YA 3L9SA 3M9KA 2PVOC 5KN0A 1F2EA 3KH7A 3FYGA 1B4PA 1R7HA 1Q98A 5JCUA 4WR5A 3E9JB 1S3CA 3LYPA 5ELAA 2L57A 3RAZA 4ID0A 4KGIA 3DYRA 3VPTA 5F0GA 4ZB8A 4GF0A 5EVOA 1GH2A 2YWNA 3A2XA 2MZCA 5ID2B 1SL0B 1EZKA 3QMXA 5F06A 2AHEA 2DLXA 2GQMA 4OMVA 4TVEA 5G5FA 2LJRA 2JZRA 1F37A 4ML1A 3D22A 1WE0A 4N10A 4WKWA 1X9WB 1N2AA 13GSA 1V58A 2IFQA 5G2ZA 3FR6A 4ZB9A 3C7MA 4PQHA 2M72A 4G0KA 4LL4B 3UIWA 4Q5QA 3BJ5A 3KP9A 2YP6A 4IJIA 5H5RA 1ERVA 1QUWA 5B8BA 1S3AA 1FB0A 4IJ3A 1G6YA 2HZEA 4EC0A 2DIZA 3NZNA 2A2SA 2WJUA 1VF1A 5CRWA 1XW5A 2WB9A 1Z3EA 3H4KA 1LJRA 5AIVA 1XVWA 2K8VA 4WEYA 4ECJA 3HVSA 4TN8A 1TK8B 1GSYA 1G7EA 4TR1B 4ZIJA 5ELGA 1T1VA 1XXUA 1ZYEA 2TRCP 4HDEA 4AJ6A 6GSSA 3GHAA 4DSQA 1ERWA 4KCEA 2HLSA 3TOUA 2L5OA 3QFAC 4Q5RA 5HR1A 3L9UA 5HFGA 4KX4A 2L6CA 1A0FA 1SJIA 3MAKA 5JCWA 2XBIA 4NMUA 1NM3A 1V2AA 1XW6A 4MP4A 3KEBA 1PX6A 1VF3A 2BJXA 4KSMA 4HZ2A 4GRFA 3IE3A 2XPEA 5G1LA 3DIEA 4BL7A 5GSSA 2VL2C 1Z7PA 2R6KA 1V9WA 2I9HA 2YV7A 4K0GA 4AGSA 2OKAA 5DCGA 5D9WA 1YKAA 1PSQA 2PVQA 2PGTA 1F3AA 5D9TA 2K18A 5CNWA 2J9HA 2JSYA 3GN3A 3QFBC 4FYBA 3IA1A 1ML6A 3GNJA 3FZ5A 1HD2A 4I8BA 1LU4A 4NAXA 1MDJA 2L59A 4ULXA 4WBRD 3TKRA 4BVXA 4GQFA 4F03A 2IPAA 2N5BA 2VCWA 5LCZA 4YQMA 2V1MA 3P7XA 4POKA 2YJHA 1FB6A 1K3LA 2BTOT 4L0UA 5IM9A 4N30A 1FAAA 4MJCA 1MD3A 4PURA 22GSA 3EYTA 1GL8A 4MF7A 1M2BA 3VWVA 1ST9A 2TRXA 2CX3A 4ECIA 3QR6A 3VK9A 1XWGA 3TB2A 2X64A 5FWGA 4XS4A 1UN2A 3HJOA 3IC8A 1G7OA 4NPBA 1SYRA 3M3MA 4CW9A 2A4VA 4JZQA 2H6XA 1SD8A 4IP1A 2DBCA 4GQCA 1XVQA 2CA8A 4YQUA 1U88A 4FIWA 9GSSA 4LLRA 3VI7A 4CHSA 3F4RA 3H1NA 5ECOB 4HU7A 2HT9A 4I6XA 1TXXA 4MF6A 2YWOA 2LRCA 4DSSB 5DBQA 1NSWA 4DSRA 5D73A 3DKSA 2VL9A 2EIRA 4EXJA 2C0DA 2PERA 4JU5A 2KP2A 4G2EA 1MD4A 1TP9A 2YWIA 3KD0A 5ECLB 3HKRA 2OBIA 3LEFA 2DC5A 4MJBA 12GSA 2C3TA 3FR3A 5D8IA 1WIKA 2LTKA 1XW9A 2B3SA 2REMA 5GAPD 2H0GA 2IJYA 1B9XC 2ON7A 1DE2A 1XPVA 3W8SA 4KUNA 3WGDA 4KB3A 4HJ2A 1OYJA 1PKZA 3HXSA 5IOXA 5J3RA 2VOCA 5ECKB 2DJ2A 5L71A 3ZFLA 2IMDA 2GZPA 1VF2A 5ECSA 2HSMB 1PL1A 1GLPA 3CXGA 1AQWA 1H4OA 4FH8A 5IMAA 1A0RP 1FHEA 4MDCA 1EWXA 3TKSE 1YF1A 1JZDA 3GIXA 2LRNA 3GSSA 4KE3A 1SU9A 3TJGA 2B5EA 1T4YA 2M80A 4I2UA 5AISA 4L5OA 4BWQA 2JZTA 5ID2A 2YCDA 4MPFA 3TRQA 1AUCA 2AAWA 5CP1A 2A2RA 3VLNA 5G5EA 1WWJA 5C04A 1YJ6A 3TJFA 3MWHA 3FHKA 2H0IA 4XRDA 3BD2A 1F6MC 3HJMA 1M9BA 4WBJA 3DWVA 3TKPA 1O8XA 1K0MA 1YDKA 1PD21 2LUSA 1A2LA 1BAYA 2QSIA 4KW6A 3F3QA 5KN1A 3LQ7A 5HR2A 1KTEA 5IMCA 3ISOA 4OWYA 2HNLA 4TRXA 3EMXA 2HSYA 1XFLA 1Z9HA 2O7KA 1TU7A 3WYWA 3KCMA 4F2IA 4MF5A 1GTUA 6GSVA 3GTUA 5A4VA 2LS5A 1BYEA 3F0IA 6GSXA 1TRUA 2O85A 4BWSA 4NV5A 2CZ3A 1Q4JA 1S3DA 4P3YB 4TR1A 3ZRDA 2H8LA 4O5RA 1U87A 4G19A 2VCTA 3RPPA 2B1LA 1WPIA 1K0BA 2PN8A 5COHA 2GZZA 4KNDA 3TJBA 3HY2A 3KXOA 2F8FA 2JZSA 1GTBA 3IOSA 2NVLA 3TKSC 1J0FA 5HFKA 3EMPA 3RPNA 2PBJA 2O8VB 4JE1A 1FVKA 5ECRB 3FZAA 3QPMA 2WGRA 1BJXA 1SKWB 2V6KA 5HFIA 1UC7A 1ILOA 4BVYB 4KDYA 1X5CA 4F0BA 4EUYA 3O6TA 4GSSA 1OC9B 4HQZA 2HFDA 2YZUA 2HRAA 3APSA 1UA5A 2YOIA 4JR4A 1WRYA 4D73A 5JWOB 1JHBA 3GURA 3IAS2 3N5OA 3GL3A 2VL3A 4JBBA 2VM1A 2IMKA 2EIOA 1R5AA 2ES7A 2ZNMA 4K7IA 1HYUA 4IGJA 3CSIA 2B1KA 3WT1A 4BPYA 1OKTA 4K2DA 4V2NA 4TXOB 1RW1A 1YY7A 1FO5A 1JLWA 5A4UA 5DQYA 2HQTA 2VUPA 1USBA 2E7PA 3ZL5A 1B4QA 4MPGA 1ZCPA 3EU3A 1EEJA 5KN2A 1CQGA 3ZTLA 2VCZA 2FGXA 2C1YA 2P0GA 3C8EA 2RM5A 3UVTA 4MH3A 5DJLA 5AN1A 3RHBA 1RK4A 3LGCA 4K1FA 8GSSA 1V98A 1QMVA 2C0GA 1J9BA 4EDYA 4XIHA 3GH6A 19GSA 4OFMA 3ERGA 4OO5A 5INYA 4DSSA 5F05A 4KH7A 5IMDA 2LJAA 1T7PB 1F3BA 2B7JA 2YWMA 1OC8A 3D5JA 1TI3A 2LSTA 3APOA 2DSAA 5J5NA 1VF4A 2C3QA 1TJDA 3TKQA 1EP7A 5B8AA 1SKSB 5DDLA 2DJ0A 2P5QA 2JU5A 1SJZA 2FCHA 4ZL8A 1ERUA 3L0HA 1SJ6A 4V2MA 3I9V2 2L6DA 4EVMA 2LQQA 3QDNA 1PKWA 4E8HA 1SENA 2WRTA 3GFKA 4PX1A 5CRGA 1M9AA 4PQIA 3U5RE 2HSMA 2KP1A 5FHIA 2YN1A 1WP0A 2YPMA 1SD9A 6GSUA 4MZWA 1PRXA 4ZBBA 3O76A 1T4ZA 1U6TA 3ERWA 2WZ9A 4ZBAA 3GV1A 3Q19A 1AXDA 4ISDA 4ECBA 4RUVA 3AY8A 3ZVJA 3EE2A 3VWXA 2ON5A 2H75A 3HVXA 2MMAA 2R2JA 2F9SA 5IPHA 2FWGA 2GLRA 3IK9A 5DJMA 4BA7A 5E59A 3DGQA 2FWFA 4HU9A 4MJAA 4YAVA 2F3MA 2HI7A 2DJ1A 1EP8A 1CQHA 3IPZA 2H76A 3GX8A 4WF4A 4NHZA 1QXHA 3GMFA 2H70A 4GLTA 1A2JA 1O8WA 5CRDA 1EEMA 4L8EA 3HYPA 1EV4A 2R4VA 3TJKA 2RIIA 4USSA 3SBCA 2CX4A 3RBTA 2ALBA 4MZCA 4HOJA 2HSNB 2OACA 1JLVA 1Z5YE 3WT2A 2AJQB 2LQOA 3E0UA 3HCZA 3P2AA 4WR4A 2HE3A 1SK1A 2H66A 2H1DA 3IAM2 1XWAA 1EV9A 4YH2A 1ZYQB 1DUGA 4EL1A 3Q74A 3HZ4A 1C72A 2XBQA 4AJ8A 4N0VA 2V41A 1Z6NA 3PPUA 2GQLA 2V6OA 3BCIA 1THXA 3EVIA 3PINA 4IELA 5A5KA 4GCIA 4ILFA 1SL1B 1HNBA 1M0UA 4AJ7A 1MTCA 2BMXA 2CZ2A 5IO0A 5J4UA 1G0TA 1TRVA 4ZXGA 3HD5A 4OFNA 1O85A 2E2GA 2I1UA 2GSSA 4MH2A 1B48A 3F63A 4MCUA 4J57E 4RI6A 2O87A 2C0FA 3TGZA 4HEA2 3D0ZA 5KN3A 4IKHA 3ZREA 1N8JA 1SK2A 3ZZXA 2I81A 1KEBA 1O7UA 2NDOA 4WXTA 1W89A 4BVYA 5IQYA 3HDCA 5D9XA 1ZOFA 3CMIA 4HJMA 4IQAA 2CAQA 1OC9A 3APQA 1AIUA 2OBKA 4K6XA 5G1KA 3QAVA 2MMZA 2OADA 1HQOA 4FO5A 2VCQA 14GSA 2K6VA 3TRPA 4O32A 3UMAA 1QFNA 1MEKA 2MYGA 4MZBA 2B5YA 1ZL9A 3RDWA 2P5RA 5AIXA 4RI7A 3FEUA 1QGVA 2H6ZA 4K7OA 1AAZA 3R3EA 2HRKB 2N5FA 3IR4A 3VFIA 1ON4A 5CREA 2UZ8A 2EC4A 1KBNA 1T8EB 2H73A 4DVCA 2MMNA 1GUMA 1YEPA 1V57A 3TJJA 3EWLA 3H93A 3J7Yb 2OE3A 2VD0A 1V40A 3LYKA 1JFUA 2RUFA 1ZMAA 1JZOA 5EY6A 3GL5A 1VGLA 1X5EA 2PMTA 1NW2A 3EC3A 3O3TA 3GH9A 4IN0A 2VIMA 3FZ4A 3M0FA 3KTBA 3PH9A 4E8EA 3ME7A 2H6YA 1DE1A 2HYXA 3PR8A 4OO4A 2MMOA 3UOMA 3KIJA 4BL7B 1SYXA 1GWCA 11GSA 2AV4A 2H72A 4IW9A 2WULA 5B6MA 3E3EA 2F51A 4F82A 4WETA 3IRAA 3S9FA 2FY6A 3HZ8A 2GSQA 1PN9A 5G30A 4TW5A 3LXTA 5EPFA 3H79A 1XWCA 1SK0A 1GSUA 3C73A 3G7IA 1QK8A 3CTGA 2LKUA 4K0NA 3GKKA 1HNCA 2YV9A 3TCOA 1DBYA 2OJLA 17GSA 2RLIA 4ECCA 3DMLA 1XBSA 4TR0A 2H74A 1JZRA 2X8HA 4NXIA 2LNSA 3QCPA 2X8GA 4YAPA 5GAND 2C0EA 1XCCA 1EGRA 2MBTA 1Z6MA 4ZB6A 1WJKA 1TTZA 4V1Ag 2VL2A 4XS6A 3ZLPA 4KF9A 3BCKA 2B7KA 1WOUA 3ERFA 4GWRA 3C1SA 2RUEA 3KTLA 2I4AA 3EINA 3Q6OA 1J08A 2C8UA 1DSBA 4KSOA 2DMMA 1IYIA 2H19A 2FUG2 2YJ7A 5FT3A 1ZZYA 3F6DA 1YQ1A 3KJYA 5GZZB 3ED3A 1GTIA 3TDGA 2H1AA 3CSHA 5BMUA 4XS4B 5JWQB 5ECNB 3D6IA 1GRXA 4KDUA 3F3RA 4IBPA 2H01A 4JEDA 3ZMLA 3CYNA 1Y6EA 2GQKA 3FKFA 4Q5NA 3ZIJA 3GA4A 3PGTA 3LFLA 2KLXA 2D2ZA 2VCXA 2NPBA 4TXVA 1OE8A 4FYCA 1X9MB 1BEDA 3J7Yk 1OAZA 3GX0A 2FA4A 2ZCTA 2FA8A 3LG6A 5DQSA 4H86A 3RHCA 4PNGA 4GSTA 5AGYA 3F4SA 3ME8A 4HUAA 3L9VA 2NTOA 5GSTA 3L78A 4K8MA 1NHYA 4I2TA 4J56E 5IMZA 3F8UA 5IMVA 3UBLA 3DXBA 2RM6A 3LSZA 4X0XA 1BQ7A 5DVBA 1A2MA 2JSZA 2WCIA 5DALB 3IDVA 1OVNA 3IC4A 3P8WA 1PL2A 5IMFA 1U3IA 2E0QA 1OC3A 5F07A 2GDRA 2OA7A 1Z7RA 4V2LA 5ECIB 3A5WA 3GRXA 3MDKA 3ZIVA 5E4WA 1X0RA 1FVJA 1FW1A 2IWTA 1T3BA 5LNKe 16GSA 2WFCA 3CRUA 5G31A 5IIZA 2GSTA 3KZQA
chains in the Genus database with same CATH superfamily
4KCAA 3UVHA 4K5RA 4ZL7A 2VCVA 1OKDA 2A2PA 2V2GA 2EFEA 3LJRA 3NIVA 2CVDA 1TRSA 2HZFA 1BX9A 4HZ4A 4QL9A 2IN3A 2G0FA 5HR0A 2WS2A 4PNFA 4XCSA 2J23A 3GKMA 4RQRA 2CQ9A 2FHEA 1XWBA 4XTSA 5DAKB 2TIRA 2XPDA 5J9BA 1FOVA 1O73A 1S3RA 4MLYA 3LORA 1AW9A 2JL4A 3V1WA 4N3ZA 2L4CA 2HRKA 1K0NA 4JRRA 4PHZC 3GTUB 1N25A 4HQSA 1I9DA 3GYKA 3US3A 2IMIA 3CRTA 1PA3A 4X43A 1YZXA 3GUSA 2AUVA 4MK3A 2B6MA 1GNEA 4POBA 3W6GA 4Q5FA 4G9HA 1GSDA 1XOAA 1GNWA 2HSHA 2VLVA 4FYUA 4G10A 3MSZA 4N0ZA 3CWGA 4KA0A 2F8AA 4TKYA 4LMVA 1ABAA 1GUHA 4EF0A 1EOHA 2Z9SA 2CT6A 4N11A 3QAGA 4PUFC 1GSFA 3U6VA 1MDIA 1HNAA 3ZVJD 1K0CA 2K8SA 2IL3A 5B7CA 1B9YC 2C3NA 5C00A 5KEJA 2HRNA 20GSA 3G7YA 4I5QA 2R5GA 1H75A 2H1GA 2X99A 2R3XA 1TKDB 4POMA 2IMFA 4YKGA 3KMOA 2DJKA 1XWKA 2GS3A 2OE0A 4W66A 3FZ9A 4TR4A 2C80A 3KMNA 3VWUA 4ACSA 4EE0A 4MJEA 1TK0B 4HI7A 2QC7A 5F8BA 2AYTA 2YNXA 4G0IA 4PXOA 1XIYA 4D73B 3CSJA 3CTFA 2LJKA 5CAXA 3I43A 1GSQA 1AQXA 3UL3A 4AF2A 2GGTA 1OE7A 4J2FA 5H5QA 2FD3A 1URMA 1U3AA 3F9UA 1F9MA 2B5XA 18GSA 4G0LA 4NV2A 2ZUPA 1QQ2A 3KH9A 5D96A 4QL7A 4XS1A 1T00A 3TKSA 3DEXA 4PQ1A 3IBHA 5JWRB 1ZYNA 4IVFA 5J41A 5J4YA 1K3OA 2FNOA 4EO3A 3A3TA 2IIYA 1B8XA 2EIQA 4NHWA 5J9CA 1GSSA 4JR6A 1ERTA 2QKEA 4MA9A 1XOBA 4MMMA 3NOFA 6GSYA 3DD3A 2R37A 1M7TA 3QD9A 1YVLA 3FW2A 3LWAA 1TDIA 4OFTA 2L4QA 3KGKA 2NBSA 2KHPA 4V1Ap 2IMEA 3D4MA 1PN0A 4PGTA 1EOGA 5IOWA 1YEXA 1VRSD 2GTUA 4DEJA 1GUKA 4EIQA 3H8QA 3WD6A 1M99A 1GULA 3I6AA 4YQVA 2OE1A 3UEMA 3D21A 2VKZG 1Y25A 3I69A 3ZFBA 1EGOA 3M1GA 2XHFA 2KOKA 4ML6A 2IFQB 1MDKA 5DCHA 2YANA 10GSA 3ZITA 2VLTA 4X1UA 3Q18A 4GSNA 3UJ1A 5ECHB 3L4NA 2FWHA 4L0WA 1R4WA 1I5GA 2GT5A 4PTSA 4TXOA 3IV4A 2DJ3A 4ZL9A 3GSTA 1TW9A 2WZSA 6GSWA 2MBSA 5ECQB 5HR3A 2HZEB 4KAEA 3F6FA 1W4VA 2V32A 3UARA 4IHUA 2H0HA 3W8JA 6GSTA 2PWJA 3BBYA 2VAFA 2CV4A 5ENUA 1ZGNA 1TI1A 1KNGA 3FY7A 4GTUA 4TR3A 1A24A 5IO2A 2WDUA 1R5PA 1UVZA 1SKRB 4IQ1A 2DJJA 3MNGA 4K9ZA 1M2AA 3UBKA 3DRNA 2CVKA 3GKNA 2VD1A 4O92A 1ACVA 3P90A 1GP1A 2VM2A 1K0OA 4POLA 5DALA 2HRFA 1XZOA 1R26A 2JADA 5JCGA 3VI5A 2FWEA 3BOAA 4LA1A 1TOFA 2L5LA 5ABRA 2O89A 3QAWA 2JACA 4NWYA 3IHGA 3DVXA 2GVPA 3TOTA 2LRTA 2GZYA 4GXZA 1GSEA 2M46A 3IXRA 5LD0A 4ZBDA 2UV8G 3IHQA 1GLQA 2EFDA 4IP6A 2H30A 3EURA 3JCML 2CVBA 3IK7A 2H71A 1PQNA 5A4WA 1PGTA 4QQ7A 4MABA 4XRAA 3GKXA 1PMTA 1K0AA 4LL1B 1A23A 2LNTA 2PUKC 2X4AA 3D4TA 1A8YA 1NHOA 2X8CA 5CRHA 2AB6A 3F4TA 1TU8A 3MIXA 3UAPA 1A8LA 2K9FA 1YKCA 4OCFA 1WMJA 2VO4A 2YZHA 3OR5A 5DAKA 1TXUA 4BVXB 2DMLA 3KM6A 1JZWA 1O6JA 3M9JA 2GT6A 4F0CA 3HHVA 2CAIA 4OD7A 2QGVA 1RQMA 3HA9A 2LEGA 3M8NA 4I97A 2P31A 2H1BA 4EDZA 3VPQA 2G2QA 5ECPB 3VWWA 1LBKA 4IS0A 4GDFA 3CBUA 4LMWA 3SWLA 3FK8A 2FLSA 1E2YA 3TRXA 5CYYA 4ZILA 4KDXA 3A2VA 4O7HA 1THOA 4K7NA 1X5DA 1X9SB 4L5LA 1AQVA 4F9ZA 3EU4A 4OCEA 2PU9C 3QOUA 1PX7A 2PPTA 4CDOA 1AC1A 4EKZA 7GSSA 1TK5B 3TUEA 3KP8A 3R2QA 3C71A 5KOWA 2I3YA 5CO3A 5H5SA 3ZMKA 2HXKA 1G6WA 3ZYWA 4FQUA 1O81A 4RQXA 1TRWA 3DVWA 4PUAA 5HQPA 2C4JA 2WW1A 2XC2A 3C1RA 3HVVA 2GSRA 4TOPA 3FR9A 5IPGA 3WGXA 3VURA 1GTAA 5D93A 5EL8A 5D9VA 4XHMA 3N9JA 4Z7XA 1SL2B 3A2WA 1E6BA 5ECMB 2E2MA 1K0DA 4WF5A 4HS1A 1BG5A 1FG4A 5B6NA 3HJPA 2VLUA 3FRCA 3G9BA 3LXZA 3K8NA 3G7JA 1YF0A 1M2DA 2KUCA 4PI0C 1IYHA 3WGEA 2LV3A 2N5AA 2DIYA 1K3YA 3L9SA 3M9KA 2PVOC 5KN0A 1F2EA 3KH7A 1ZYPA 3FYGA 1B4PA 1R7HA 4Z2TA 1Q98A 5JCUA 4WR5A 3E9JB 1S3CA 3LYPA 5ELAA 2L57A 3RAZA 4ID0A 4KGIA 1SVOA 3DYRA 3VPTA 5F0GA 4ZB8A 4GF0A 2O5VA 5EVOA 1GH2A 2YWNA 3A2XA 2MZCA 5ID2B 1SL0B 1EZKA 3QMXA 5F06A 2AHEA 2DLXA 2GQMA 4OMVA 4TVEA 5G5FA 2LJRA 2JZRA 1F37A 4ML1A 3D22A 1WE0A 4N10A 1BG1A 4WKWA 1X9WB 1N2AA 13GSA 1V58A 2IFQA 5G2ZA 3FR6A 4ZB9A 3C7MA 4PQHA 2M72A 4G0KA 4LL4B 3UIWA 4Q5QA 3BJ5A 3KP9A 2YP6A 4IJIA 3MYDA 5H5RA 4EIPA 1ERVA 1QUWA 5B8BA 1S3AA 1FB0A 4IJ3A 1G6YA 2HZEA 4EC0A 2DIZA 3NZNA 2A2SA 2WJUA 1VF1A 5CRWA 3EPTA 2EFCA 1XW5A 2WB9A 1Z3EA 3H4KA 1LJRA 5AIVA 1XVWA 5J47A 2K8VA 4WEYA 4ECJA 3HVSA 4TN8A 1TK8B 1GSYA 1G7EA 4TR1B 4ZIJA 5ELGA 1T1VA 1XXUA 1ZYEA 2TRCP 4HDEA 4AJ6A 6GSSA 3GHAA 4DSQA 1ERWA 4KCEA 2HLSA 3TOUA 4MNNA 2L5OA 3QFAC 4Q5RA 5HR1A 3L9UA 5HFGA 4KX4A 2L6CA 4ZB7A 1A0FA 1SJIA 3MAKA 5JCWA 2XBIA 4NMUA 1NM3A 1V2AA 1XW6A 4MP4A 3KEBA 1PX6A 1VF3A 2BJXA 4KSMA 3FMWA 4K2XA 4HZ2A 4GRFA 3IE3A 2XPEA 5G1LA 3DIEA 4BL7A 5GSSA 2VL2C 1Z7PA 2R6KA 1V9WA 2I9HA 2YV7A 4K0GA 4AGSA 2OKAA 5DCGA 3CQFA 5D9WA 1YKAA 1PSQA 2PVQA 2PGTA 1F3AA 5D9TA 2K18A 5CNWA 2J9HA 2JSYA 3GN3A 3QFBC 4FYBA 3IA1A 2WVXB 1ML6A 3GNJA 3FZ5A 1HD2A 5J4VA 4I8BA 1LU4A 4NAXA 1MDJA 2L59A 1M3IA 4ULXA 4WBRD 3TKRA 4BVXA 4GQFA 4Z2UA 4F03A 2IPAA 2N5BA 2VCWA 5LCZA 4YQMA 2V1MA 3P7XA 4POKA 2YJHA 1FB6A 1K3LA 2BTOT 4L0UA 5IM9A 4N30A 1FAAA 4MJCA 1MD3A 4PURA 22GSA 3EYTA 1GL8A 4MF7A 1M2BA 3VWVA 1ST9A 2TRXA 2CX3A 4ECIA 3QR6A 3VK9A 1XWGA 3TB2A 2X64A 5FWGA 4XS4A 1UN2A 3HJOA 3IC8A 1G7OA 4NPBA 1SYRA 3M3MA 4CW9A 2A4VA 4JZQA 2H6XA 1SD8A 4IP1A 2DBCA 4GQCA 1XVQA 3A5IA 2CA8A 4YQUA 1U88A 4FIWA 9GSSA 4LLRA 3VI7A 4CHSA 3F4RA 3H1NA 5ECOB 4HU7A 2HT9A 4I6XA 1TXXA 4MF6A 2YWOA 2LRCA 4DSSB 5DBQA 1NSWA 4DSRA 5D73A 3DKSA 2VL9A 2EIRA 4EXJA 4A5PA 2C0DA 2PERA 4JU5A 2KP2A 4G2EA 1MD4A 1TP9A 2YWIA 3KD0A 5ECLB 3HKRA 2OBIA 3LEFA 2DC5A 4MJBA 12GSA 2C3TA 3FR3A 5D8IA 1WIKA 2LTKA 1XW9A 2B3SA 2REMA 5GAPD 2H0GA 2IJYA 1B9XC 2ON7A 2R0CA 4O5UA 1DE2A 1XPVA 3W8SA 4KUNA 3WGDA 4KB3A 4HJ2A 1OYJA 1PKZA 3HXSA 5KOXA 5IOXA 5J3RA 2VOCA 5ECKB 2DJ2A 5L71A 3ZFLA 2IMDA 2GZPA 4AKXB 5A5HA 1VF2A 5ECSA 2HSMB 1PL1A 1GLPA 3CXGA 1AQWA 1H4OA 3LW9A 4FH8A 4CY8A 5IMAA 1A0RP 1FHEA 4MDCA 1EWXA 3TKSE 1YF1A 1JZDA 3GIXA 2LRNA 3GSSA 4KE3A 1SU9A 3TJGA 2B5EA 1T4YA 2M80A 4I2UA 5AISA 4L5OA 4BWQA 2JZTA 4G01A 5ID2A 2YCDA 4MPFA 3TRQA 1AUCA 2AAWA 5CP1A 2A2RA 3VLNA 5G5EA 1WWJA 2A4HA 5C04A 1YJ6A 3TJFA 3MWHA 3FHKA 2H0IA 4XRDA 3BD2A 1F6MC 3HJMA 1M9BA 4WBJA 3DWVA 3TKPA 1O8XA 1PFOA 1K0MA 1YDKA 1PD21 2LUSA 1A2LA 1BAYA 2QSIA 4KW6A 3F3QA 5KN1A 3LQ7A 5HR2A 1KTEA 5IMCA 3ISOA 4OWYA 2HNLA 4TRXA 3EMXA 2HSYA 1XFLA 1Z9HA 2O7KA 1TU7A 3WYWA 3KCMA 4F2IA 4MF5A 1GTUA 2QA2A 6GSVA 3GTUA 5A4VA 4HSCX 2LS5A 1BYEA 3F0IA 6GSXA 1TRUA 2O85A 4BWSA 4NV5A 2CZ3A 1Q4JA 4PI2C 1S3DA 2O36A 4P3YB 4TR1A 3ZRDA 2H8LA 4O5RA 1U87A 4G19A 2VCTA 3RPPA 2B1LA 1WPIA 2WW3A 1K0BA 2PN8A 5COHA 2GZZA 4KNDA 3TJBA 3HY2A 3KXOA 2F8FA 2JZSA 1GTBA 3IOSA 2NVLA 3TKSC 1J0FA 5HFKA 3EMPA 3RPNA 2PBJA 2O8VB 4JE1A 1FVKA 5ECRB 3FZAA 3QPMA 2WGRA 1BJXA 1SKWB 2V6KA 5HFIA 2EFHA 1UC7A 1ILOA 4BVYB 4KDYA 1X5CA 4F0BA 4EUYA 3O6TA 4GSSA 1OC9B 4HQZA 2HFDA 2YZUA 2HRAA 3APSA 1UA5A 2YOIA 4JR4A 1WRYA 4D73A 5JWOB 2WVXA 1JHBA 3GURA 3IAS2 3N5OA 3GL3A 2VL3A 4JBBA 2R0PA 2VM1A 2IMKA 2EIOA 1R5AA 2ES7A 2ZNMA 4K7IA 1HYUA 4IGJA 4E68A 3CSIA 2B1KA 3WT1A 4BPYA 1OKTA 4K2DA 4V2NA 4TXOB 4AKGA 1RW1A 1YY7A 1FO5A 2OT3A 1JLWA 5A4UA 5DQYA 2HQTA 2VUPA 1USBA 2E7PA 3ZL5A 1B4QA 4MPGA 1ZCPA 3EU3A 4ICYA 5BRTA 1EEJA 5KN2A 1CQGA 3ZTLA 2VCZA 2FGXA 2WW2A 2C1YA 2P0GA 4BIKA 3C8EA 2RM5A 3UVTA 4MH3A 5DJLA 5AN1A 3RHBA 1RK4A 3LGCA 4K1FA 8GSSA 1V98A 1QMVA 1SVMA 2C0GA 1J9BA 4EDYA 4XIHA 3GH6A 19GSA 3CHXC 4OFMA 3ERGA 4OO5A 5INYA 4DSSA 5F05A 4KH7A 5IMDA 2WVYA 2LJAA 1T7PB 1F3BA 2B7JA 2YWMA 1OC8A 3D5JA 4Z2RA 1TI3A 1I1IP 2LSTA 3APOA 2DSAA 5J5NA 1VF4A 2C3QA 1TJDA 3TKQA 1EP7A 5B8AA 1SKSB 2QA1A 5DDLA 2DJ0A 2P5QA 2JU5A 1SJZA 2FCHA 4ZL8A 1ERUA 3L0HA 1SJ6A 2O3EA 4V2MA 3I9V2 2L6DA 4EVMA 2LQQA 3QDNA 1PKWA 4E8HA 1SENA 2WRTA 3GFKA 4PX1A 5CRGA 1M9AA 4PQIA 3U5RE 2HSMA 2KP1A 5FHIA 2DKIA 2YN1A 1WP0A 2YPMA 1SD9A 6GSUA 4MZWA 1PRXA 5A1NB 4ZBBA 3O76A 1T4ZA 1U6TA 3ERWA 2WZ9A 4ZBAA 3GV1A 3Q19A 1AXDA 4ISDA 4ECBA 4RUVA 5BMUB 3AY8A 3ZVJA 1SVLA 3EE2A 2WW0A 3VWXA 2ON5A 2H75A 3HVXA 2MMAA 2R2JA 2F9SA 5IPHA 2FWGA 2GLRA 3IK9A 5DJMA 4BA7A 5E59A 3DGQA 2FWFA 4HU9A 4MJAA 4YAVA 2F3MA 2HI7A 2DJ1A 1EP8A 1CQHA 3IPZA 2H76A 3GX8A 3RGBC 4WF4A 4NHZA 1QXHA 3GMFA 2H70A 4GLTA 1A2JA 1O8WA 5CRDA 1EEMA 4L8EA 3HYPA 1EV4A 2R4VA 3TJKA 2RIIA 4USSA 3SBCA 2CX4A 3RBTA 3RFRC 2ALBA 4MZCA 4HOJA 2HSNB 2OACA 1JLVA 1Z5YE 3WT2A 2AJQB 2LQOA 3E0UA 3HCZA 3P2AA 4WR4A 2HE3A 1SK1A 2H66A 2H1DA 3IAM2 1XWAA 1EV9A 4YH2A 1ZYQB 1DUGA 4EL1A 3Q74A 3HZ4A 1C72A 2XBQA 4AJ8A 4N0VA 2V41A 1Z6NA 3PPUA 2GQLA 2V6OA 3BCIA 1THXA 3EVIA 3PINA 4IELA 5A5KA 4GCIA 4ILFA 1SL1B 1HNBA 1M0UA 4AJ7A 1MTCA 2BMXA 2X49A 2CZ2A 5IO0A 5J4UA 1G0TA 1TRVA 4ZXGA 3HD5A 5A34B 4OFNA 1O85A 2E2GA 2I1UA 2DKHA 2GSSA 4MH2A 1B48A 1YEWC 3F63A 4MCUA 4J57E 4RI6A 2O87A 2C0FA 3TGZA 4AKHA 4HEA2 3D0ZA 5KN3A 4IKHA 3ZREA 1N8JA 1SK2A 3ZZXA 2I81A 1KEBA 1O7UA 2NDOA 4WXTA 1W89A 4BVYA 5IQYA 3HDCA 5D9XA 1ZOFA 3CMIA 4HJMA 4IQAA 2CAQA 1OC9A 3APQA 1AIUA 2OBKA 4K6XA 5G1KA 3QAVA 2MMZA 2OADA 1HQOA 4FO5A 2VCQA 14GSA 2K6VA 3TRPA 4O32A 3UMAA 5J40A 1QFNA 1MEKA 2MYGA 4MZBA 2B5YA 1ZL9A 3RDWA 2P5RA 5AIXA 4RI7A 3FEUA 1QGVA 2H6ZA 4K7OA 1AAZA 3R3EA 2HRKB 2N5FA 3IR4A 3VFIA 1ON4A 5CREA 2UZ8A 2EC4A 1KBNA 1T8EB 2H73A 4DVCA 4FXYP 2MMNA 1GUMA 1YEPA 1V57A 3TJJA 3EWLA 3H93A 3J7Yb 2OE3A 2VD0A 1V40A 3LYKA 1JFUA 2RUFA 1ZMAA 1JZOA 5EY6A 3GL5A 1VGLA 1X5EA 2PMTA 1NW2A 3EC3A 3O3TA 3GH9A 4IN0A 2VIMA 3FZ4A 3M0FA 3KTBA 3PH9A 4E8EA 3ME7A 2H6YA 1DE1A 2HYXA 3PR8A 4OO4A 2MMOA 4K5SA 3UOMA 3KIJA 4BL7B 1SYXA 1BF5A 1GWCA 11GSA 2AV4A 2H72A 4IW9A 2WULA 5B6MA 3E3EA 3TU3B 2F51A 4F82A 4WETA 4O5QA 3IRAA 3S9FA 2FY6A 3HZ8A 2GSQA 1PN9A 5G30A 4TW5A 3LXTA 5EPFA 3H79A 1XWCA 1SK0A 1GSUA 3C73A 3G7IA 1QK8A 3CTGA 2LKUA 4K0NA 3GKKA 1HNCA 2H1LA 2YV9A 3TCOA 1DBYA 4AI6A 2OJLA 17GSA 2RLIA 4ECCA 3DMLA 2R0GA 1XBSA 4TR0A 2H74A 1JZRA 2X8HA 4NXIA 2LNSA 3QCPA 2X8GA 4YAPA 5GAND 2C0EA 1XCCA 1EGRA 2MBTA 1Z6MA 4ZB6A 1S4BP 1WJKA 1TTZA 4V1Ag 2VL2A 4XS6A 3ZLPA 4KF9A 3BCKA 2B7KA 1WOUA 3ERFA 4AKIA 4GWRA 3C1SA 2RUEA 3KTLA 2I4AA 3EINA 3Q6OA 1J08A 2C8UA 5A1NA 1DSBA 4KSOA 2DMMA 2WVZA 1IYIA 2H19A 2FUG2 2YJ7A 5FT3A 1ZZYA 3HVNA 3F6DA 1YQ1A 3KJYA 5GZZB 3ED3A 1GTIA 3TDGA 2H1AA 3CSHA 5BMUA 4XS4B 5JWQB 5ECNB 3D6IA 1GRXA 4X4JA 4KDUA 3F3RA 4IBPA 2H01A 4JEDA 3ZMLA 3CYNA 1Y6EA 1M3JA 2GQKA 4QMKA 3FKFA 4Q5NA 3ZIJA 3GA4A 3PGTA 3LFLA 2KLXA 2D2ZA 2VCXA 2NPBA 4TXVA 1OE8A 4FYCA 1X9MB 1BEDA 3J7Yk 4CY6A 1OAZA 3GX0A 2FA4A 2HSNA 4YKFA 2ZCTA 2FA8A 1XG8A 3LG6A 5DQSA 4H86A 3RHCA 4PNGA 4GSTA 5AGYA 3F4SA 3ME8A 4HUAA 3L9VA 2NTOA 5GSTA 3L78A 1NHYA 4I2TA 4K8MA 4J56E 1FOHA 5IMZA 3F8UA 5IMVA 3UBLA 3DXBA 2RM6A 3LSZA 4X0XA 1BQ7A 1Y1UA 5DVBA 5A5HB 1A2MA 2JSZA 2WCIA 5DALB 3IDVA 1OVNA 5A34A 3IC4A 3P8WA 1PL2A 5IMFA 1U3IA 2E0QA 1OC3A 5F07A 2GDRA 2OA7A 1Z7RA 4V2LA 5ECIB 3A5WA 3GRXA 3MDKA 3ZIVA 5E4WA 1X0RA 3HMJG 1FVJA 1FW1A 2IWTA 1T3BA 5LNKe 16GSA 2WFCA 3CRUA 5G31A 5IIZA 2GSTA 3KZQA
chains in the Genus database with same CATH topology
4KCAA 3UVHA 4K5RA 4ZL7A 2VCVA 1OKDA 2A2PA 2V2GA 2EFEA 3LJRA 3NIVA 2CVDA 1TRSA 2HZFA 1BX9A 4HZ4A 4QL9A 2IN3A 2G0FA 5HR0A 2WS2A 4PNFA 4XCSA 2J23A 3GKMA 4RQRA 2CQ9A 2FHEA 1XWBA 4XTSA 5DAKB 2TIRA 2XPDA 5J9BA 1FOVA 1O73A 4MLYA 3LORA 1AW9A 2JL4A 3V1WA 4N3ZA 2L4CA 2HRKA 1K0NA 4JRRA 3GTUB 1N25A 4HQSA 1I9DA 3GYKA 3US3A 2IMIA 3CRTA 1PA3A 4X43A 1YZXA 3GUSA 2AUVA 4MK3A 2B6MA 1GNEA 4POBA 3W6GA 4Q5FA 4G9HA 1GSDA 1XOAA 1GNWA 2HSHA 2VLVA 4FYUA 4G10A 3MSZA 4N0ZA 3CWGA 4KA0A 2F8AA 4TKYA 4LMVA 1ABAA 1GUHA 4EF0A 1EOHA 2Z9SA 2CT6A 4N11A 3QAGA 4PUFC 1GSFA 3U6VA 1MDIA 1HNAA 3ZVJD 1K0CA 2K8SA 2IL3A 5B7CA 1B9YC 2C3NA 5C00A 5KEJA 2HRNA 20GSA 3G7YA 4I5QA 2R5GA 1H75A 2H1GA 2X99A 2R3XA 1TKDB 4POMA 2IMFA 4YKGA 3KMOA 2DJKA 1XWKA 2GS3A 2OE0A 4W66A 3FZ9A 4TR4A 2C80A 3KMNA 3VWUA 4ACSA 4EE0A 4MJEA 1TK0B 4HI7A 2QC7A 5F8BA 2AYTA 2YNXA 4G0IA 4PXOA 1XIYA 4D73B 3CSJA 3CTFA 2LJKA 5CAXA 3I43A 1GSQA 1AQXA 3UL3A 4AF2A 2GGTA 1OE7A 4J2FA 5H5QA 2FD3A 1URMA 1U3AA 3F9UA 1F9MA 2B5XA 18GSA 4G0LA 4NV2A 2ZUPA 1QQ2A 3KH9A 5D96A 4QL7A 4XS1A 1T00A 3TKSA 3DEXA 4PQ1A 3IBHA 5JWRB 1ZYNA 4IVFA 5J41A 5J4YA 1K3OA 2FNOA 4EO3A 3A3TA 2IIYA 1B8XA 2EIQA 4NHWA 5J9CA 1GSSA 4JR6A 1ERTA 2QKEA 4MA9A 1XOBA 4MMMA 3NOFA 6GSYA 3DD3A 2R37A 1M7TA 3QD9A 1YVLA 3FW2A 3LWAA 1TDIA 4OFTA 2L4QA 3KGKA 2NBSA 2KHPA 4V1Ap 2IMEA 3D4MA 1PN0A 4PGTA 1EOGA 5IOWA 1YEXA 1VRSD 2GTUA 4DEJA 1GUKA 4EIQA 3H8QA 3WD6A 1M99A 1GULA 3I6AA 4YQVA 2OE1A 3UEMA 3D21A 2VKZG 1Y25A 3I69A 3ZFBA 1EGOA 3M1GA 2XHFA 2KOKA 4ML6A 2IFQB 1MDKA 5DCHA 2YANA 10GSA 3ZITA 2VLTA 4X1UA 3Q18A 4GSNA 3UJ1A 5ECHB 3L4NA 2FWHA 4L0WA 1R4WA 1I5GA 2GT5A 4PTSA 4TXOA 3IV4A 2DJ3A 4ZL9A 3GSTA 1TW9A 6GSWA 2MBSA 5ECQB 5HR3A 2HZEB 4KAEA 3F6FA 1W4VA 2V32A 3UARA 4IHUA 2H0HA 3W8JA 6GSTA 2PWJA 3BBYA 2VAFA 2CV4A 5ENUA 1ZGNA 1TI1A 1KNGA 3FY7A 4GTUA 4TR3A 1A24A 5IO2A 2WDUA 1R5PA 1UVZA 1SKRB 4IQ1A 2DJJA 3MNGA 4K9ZA 1M2AA 3UBKA 3DRNA 2CVKA 3GKNA 2VD1A 4O92A 1ACVA 3P90A 1GP1A 2VM2A 1K0OA 4POLA 5DALA 2HRFA 1XZOA 1R26A 2JADA 5JCGA 3VI5A 2FWEA 3BOAA 4LA1A 1TOFA 2L5LA 5ABRA 2O89A 3QAWA 2JACA 4NWYA 3IHGA 3DVXA 2GVPA 3TOTA 2LRTA 2GZYA 4GXZA 1GSEA 2M46A 3IXRA 5LD0A 4ZBDA 2UV8G 3IHQA 1GLQA 2EFDA 4IP6A 2H30A 3EURA 3JCML 2CVBA 3IK7A 2H71A 1PQNA 5A4WA 1PGTA 4QQ7A 4MABA 4XRAA 3GKXA 1PMTA 1K0AA 4LL1B 1A23A 2LNTA 2PUKC 2X4AA 3D4TA 1A8YA 1NHOA 2X8CA 5CRHA 2AB6A 3F4TA 1TU8A 3MIXA 3UAPA 1A8LA 2K9FA 1YKCA 4OCFA 1WMJA 2VO4A 2YZHA 3OR5A 5DAKA 1TXUA 4BVXB 2DMLA 3KM6A 1JZWA 1O6JA 3M9JA 2GT6A 4F0CA 3HHVA 2CAIA 4OD7A 2QGVA 1RQMA 3HA9A 2LEGA 3M8NA 4I97A 2P31A 2H1BA 4EDZA 3VPQA 2G2QA 5ECPB 3VWWA 1LBKA 4IS0A 4GDFA 3CBUA 4LMWA 3SWLA 3FK8A 2FLSA 1E2YA 3TRXA 5CYYA 4ZILA 4KDXA 3A2VA 4O7HA 1THOA 4K7NA 1X5DA 1X9SB 4L5LA 1AQVA 4F9ZA 3EU4A 4OCEA 2PU9C 3QOUA 1PX7A 2PPTA 4CDOA 1AC1A 4EKZA 7GSSA 1TK5B 3TUEA 3KP8A 3R2QA 3C71A 5KOWA 2I3YA 5CO3A 5H5SA 3ZMKA 2HXKA 1G6WA 3ZYWA 4FQUA 1O81A 4RQXA 1TRWA 3DVWA 4PUAA 5HQPA 2C4JA 2XC2A 3C1RA 3HVVA 2GSRA 4TOPA 3FR9A 5IPGA 3WGXA 3VURA 1GTAA 5D93A 5EL8A 5D9VA 4XHMA 3N9JA 4Z7XA 1SL2B 3A2WA 1E6BA 5ECMB 2E2MA 1K0DA 4WF5A 4HS1A 1BG5A 1FG4A 5B6NA 3HJPA 2VLUA 3FRCA 3G9BA 3LXZA 3K8NA 3G7JA 1YF0A 1M2DA 2KUCA 1IYHA 3WGEA 2LV3A 2N5AA 2DIYA 1K3YA 3L9SA 3M9KA 2PVOC 5KN0A 1F2EA 3KH7A 1ZYPA 3FYGA 1B4PA 1R7HA 4Z2TA 1Q98A 5JCUA 4WR5A 3E9JB 1S3CA 3LYPA 5ELAA 2L57A 3RAZA 4ID0A 4KGIA 1SVOA 3DYRA 3VPTA 5F0GA 4ZB8A 4GF0A 2O5VA 5EVOA 1GH2A 2YWNA 3A2XA 2MZCA 5ID2B 1SL0B 1EZKA 3QMXA 5F06A 2AHEA 2DLXA 2GQMA 4OMVA 4TVEA 5G5FA 2LJRA 2JZRA 1F37A 4ML1A 3D22A 1WE0A 4N10A 1BG1A 4WKWA 1X9WB 1N2AA 13GSA 1V58A 2IFQA 5G2ZA 3FR6A 4ZB9A 3C7MA 4PQHA 2M72A 4G0KA 4LL4B 3UIWA 4Q5QA 3BJ5A 3KP9A 2YP6A 4IJIA 3MYDA 5H5RA 4EIPA 1ERVA 1QUWA 5B8BA 1S3AA 1FB0A 4IJ3A 1G6YA 2HZEA 4EC0A 2DIZA 3NZNA 2A2SA 2WJUA 1VF1A 5CRWA 3EPTA 2EFCA 1XW5A 2WB9A 1Z3EA 3H4KA 1LJRA 5AIVA 1XVWA 5J47A 2K8VA 4WEYA 4ECJA 3HVSA 4TN8A 1TK8B 1GSYA 1G7EA 4TR1B 4ZIJA 5ELGA 1T1VA 1XXUA 1ZYEA 2TRCP 4HDEA 4AJ6A 6GSSA 3GHAA 4DSQA 1ERWA 4KCEA 2HLSA 3TOUA 4MNNA 2L5OA 3QFAC 4Q5RA 5HR1A 3L9UA 5HFGA 4KX4A 2L6CA 4ZB7A 1A0FA 1SJIA 3MAKA 5JCWA 2XBIA 4NMUA 1NM3A 1V2AA 1XW6A 4MP4A 3KEBA 1PX6A 1VF3A 2BJXA 4KSMA 3FMWA 4K2XA 4HZ2A 4GRFA 3IE3A 2XPEA 5G1LA 3DIEA 4BL7A 5GSSA 2VL2C 1Z7PA 2R6KA 1V9WA 2I9HA 2YV7A 4K0GA 4AGSA 2OKAA 5DCGA 5D9WA 1YKAA 1PSQA 2PVQA 2PGTA 1F3AA 5D9TA 2K18A 5CNWA 2J9HA 2JSYA 3GN3A 3QFBC 4FYBA 3IA1A 1ML6A 3GNJA 3FZ5A 1HD2A 5J4VA 4I8BA 1LU4A 4NAXA 1MDJA 2L59A 4ULXA 4WBRD 3TKRA 4BVXA 4GQFA 4Z2UA 4F03A 2IPAA 2N5BA 2VCWA 5LCZA 4YQMA 2V1MA 3P7XA 4POKA 2YJHA 1FB6A 1K3LA 2BTOT 4L0UA 5IM9A 4N30A 1FAAA 4MJCA 1MD3A 4PURA 22GSA 3EYTA 1GL8A 4MF7A 1M2BA 3VWVA 1ST9A 2TRXA 2CX3A 4ECIA 3QR6A 3VK9A 1XWGA 3TB2A 2X64A 5FWGA 4XS4A 1UN2A 3HJOA 3IC8A 1G7OA 4NPBA 1SYRA 3M3MA 4CW9A 2A4VA 4JZQA 2H6XA 1SD8A 4IP1A 2DBCA 4GQCA 1XVQA 3A5IA 2CA8A 4YQUA 1U88A 4FIWA 9GSSA 4LLRA 3VI7A 4CHSA 3F4RA 3H1NA 5ECOB 4HU7A 2HT9A 4I6XA 1TXXA 4MF6A 2YWOA 2LRCA 4DSSB 5DBQA 1NSWA 4DSRA 5D73A 3DKSA 2VL9A 2EIRA 4EXJA 4A5PA 2C0DA 2PERA 4JU5A 2KP2A 4G2EA 1MD4A 1TP9A 2YWIA 3KD0A 5ECLB 3HKRA 2OBIA 3LEFA 2DC5A 4MJBA 12GSA 2C3TA 3FR3A 5D8IA 1WIKA 2LTKA 1XW9A 2B3SA 2REMA 5GAPD 2H0GA 2IJYA 1B9XC 2ON7A 2R0CA 4O5UA 1DE2A 1XPVA 3W8SA 4KUNA 3WGDA 4KB3A 4HJ2A 1OYJA 1PKZA 3HXSA 5KOXA 5IOXA 5J3RA 2VOCA 5ECKB 2DJ2A 5L71A 3ZFLA 2IMDA 2GZPA 4AKXB 5A5HA 1VF2A 5ECSA 2HSMB 1PL1A 1GLPA 3CXGA 1AQWA 1H4OA 3LW9A 4FH8A 4CY8A 5IMAA 1A0RP 1FHEA 4MDCA 1EWXA 3TKSE 1YF1A 1JZDA 3GIXA 2LRNA 3GSSA 4KE3A 1SU9A 3TJGA 2B5EA 1T4YA 2M80A 4I2UA 5AISA 4L5OA 4BWQA 2JZTA 4G01A 5ID2A 2YCDA 4MPFA 3TRQA 1AUCA 2AAWA 5CP1A 2A2RA 3VLNA 5G5EA 1WWJA 2A4HA 5C04A 1YJ6A 3TJFA 3MWHA 3FHKA 2H0IA 4XRDA 3BD2A 1F6MC 3HJMA 1M9BA 4WBJA 3DWVA 3TKPA 1O8XA 1K0MA 1YDKA 1PD21 2LUSA 1A2LA 1BAYA 2QSIA 4KW6A 3F3QA 5KN1A 3LQ7A 5HR2A 1KTEA 5IMCA 3ISOA 4OWYA 2HNLA 4TRXA 3EMXA 2HSYA 1XFLA 1Z9HA 2O7KA 1TU7A 3WYWA 3KCMA 4F2IA 4MF5A 1GTUA 2QA2A 6GSVA 3GTUA 5A4VA 2LS5A 1BYEA 3F0IA 6GSXA 1TRUA 2O85A 4BWSA 4NV5A 2CZ3A 1Q4JA 1S3DA 4P3YB 4TR1A 3ZRDA 2H8LA 4O5RA 1U87A 4G19A 2VCTA 3RPPA 2B1LA 1WPIA 1K0BA 2PN8A 5COHA 2GZZA 4KNDA 3TJBA 3HY2A 3KXOA 2F8FA 2JZSA 1GTBA 3IOSA 2NVLA 3TKSC 1J0FA 5HFKA 3EMPA 3RPNA 2PBJA 2O8VB 4JE1A 1FVKA 5ECRB 3FZAA 3QPMA 2WGRA 1BJXA 1SKWB 2V6KA 5HFIA 2EFHA 1UC7A 1ILOA 4BVYB 4KDYA 1X5CA 4F0BA 4EUYA 3O6TA 4GSSA 1OC9B 4HQZA 2HFDA 2YZUA 2HRAA 3APSA 1UA5A 2YOIA 4JR4A 1WRYA 4D73A 5JWOB 1JHBA 3GURA 3IAS2 3N5OA 3GL3A 2VL3A 4JBBA 2R0PA 2VM1A 2IMKA 2EIOA 1R5AA 2ES7A 2ZNMA 4K7IA 1HYUA 4IGJA 4E68A 3CSIA 2B1KA 3WT1A 4BPYA 1OKTA 4K2DA 4V2NA 4TXOB 4AKGA 1RW1A 1YY7A 1FO5A 2OT3A 1JLWA 5A4UA 5DQYA 2HQTA 2VUPA 1USBA 2E7PA 3ZL5A 1B4QA 4MPGA 1ZCPA 3EU3A 4ICYA 5BRTA 1EEJA 5KN2A 1CQGA 3ZTLA 2VCZA 2FGXA 2C1YA 2P0GA 3C8EA 2RM5A 3UVTA 4MH3A 5DJLA 5AN1A 3RHBA 1RK4A 3LGCA 4K1FA 8GSSA 1V98A 1QMVA 1SVMA 2C0GA 1J9BA 4EDYA 4XIHA 3GH6A 19GSA 4OFMA 3ERGA 4OO5A 5INYA 4DSSA 5F05A 4KH7A 5IMDA 2LJAA 1T7PB 1F3BA 2B7JA 2YWMA 1OC8A 3D5JA 4Z2RA 1TI3A 2LSTA 3APOA 2DSAA 5J5NA 1VF4A 2C3QA 1TJDA 3TKQA 1EP7A 5B8AA 1SKSB 2QA1A 5DDLA 2DJ0A 2P5QA 2JU5A 1SJZA 2FCHA 4ZL8A 1ERUA 3L0HA 1SJ6A 4V2MA 3I9V2 2L6DA 4EVMA 2LQQA 3QDNA 1PKWA 4E8HA 1SENA 2WRTA 3GFKA 4PX1A 5CRGA 1M9AA 4PQIA 3U5RE 2HSMA 2KP1A 5FHIA 2DKIA 2YN1A 1WP0A 2YPMA 1SD9A 6GSUA 4MZWA 1PRXA 5A1NB 4ZBBA 3O76A 1T4ZA 1U6TA 3ERWA 2WZ9A 4ZBAA 3GV1A 3Q19A 1AXDA 4ISDA 4ECBA 4RUVA 5BMUB 3AY8A 3ZVJA 1SVLA 3EE2A 3VWXA 2ON5A 2H75A 3HVXA 2MMAA 2R2JA 2F9SA 5IPHA 2FWGA 2GLRA 3IK9A 5DJMA 4BA7A 5E59A 3DGQA 2FWFA 4HU9A 4MJAA 4YAVA 2F3MA 2HI7A 2DJ1A 1EP8A 1CQHA 3IPZA 2H76A 3GX8A 4WF4A 4NHZA 1QXHA 3GMFA 2H70A 4GLTA 1A2JA 1O8WA 5CRDA 1EEMA 4L8EA 3HYPA 1EV4A 2R4VA 3TJKA 2RIIA 4USSA 3SBCA 2CX4A 3RBTA 2ALBA 4MZCA 4HOJA 2HSNB 2OACA 1JLVA 1Z5YE 3WT2A 2AJQB 2LQOA 3E0UA 3HCZA 3P2AA 4WR4A 2HE3A 1SK1A 2H66A 2H1DA 3IAM2 1XWAA 1EV9A 4YH2A 1ZYQB 1DUGA 4EL1A 3Q74A 3HZ4A 1C72A 2XBQA 4AJ8A 4N0VA 2V41A 1Z6NA 3PPUA 2GQLA 2V6OA 3BCIA 1THXA 3EVIA 3PINA 4IELA 5A5KA 4GCIA 4ILFA 1SL1B 1HNBA 1M0UA 4AJ7A 1MTCA 2BMXA 2X49A 2CZ2A 5IO0A 5J4UA 1G0TA 1TRVA 4ZXGA 3HD5A 5A34B 4OFNA 1O85A 2E2GA 2I1UA 2DKHA 2GSSA 4MH2A 1B48A 3F63A 4MCUA 4J57E 4RI6A 2O87A 2C0FA 3TGZA 4AKHA 4HEA2 3D0ZA 5KN3A 4IKHA 3ZREA 1N8JA 1SK2A 3ZZXA 2I81A 1KEBA 1O7UA 2NDOA 4WXTA 1W89A 4BVYA 5IQYA 3HDCA 5D9XA 1ZOFA 3CMIA 4HJMA 4IQAA 2CAQA 1OC9A 3APQA 1AIUA 2OBKA 4K6XA 5G1KA 3QAVA 2MMZA 2OADA 1HQOA 4FO5A 2VCQA 14GSA 2K6VA 3TRPA 4O32A 3UMAA 5J40A 1QFNA 1MEKA 2MYGA 4MZBA 2B5YA 1ZL9A 3RDWA 2P5RA 5AIXA 4RI7A 3FEUA 1QGVA 2H6ZA 4K7OA 1AAZA 3R3EA 2HRKB 2N5FA 3IR4A 3VFIA 1ON4A 5CREA 2UZ8A 2EC4A 1KBNA 1T8EB 2H73A 4DVCA 2MMNA 1GUMA 1YEPA 1V57A 3TJJA 3EWLA 3H93A 3J7Yb 2OE3A 2VD0A 1V40A 3LYKA 1JFUA 2RUFA 1ZMAA 1JZOA 5EY6A 3GL5A 1VGLA 1X5EA 2PMTA 1NW2A 3EC3A 3O3TA 3GH9A 4IN0A 2VIMA 3FZ4A 3M0FA 3KTBA 3PH9A 4E8EA 3ME7A 2H6YA 1DE1A 2HYXA 3PR8A 4OO4A 2MMOA 4K5SA 3UOMA 3KIJA 4BL7B 1SYXA 1BF5A 1GWCA 11GSA 2AV4A 2H72A 4IW9A 2WULA 5B6MA 3E3EA 3TU3B 2F51A 4F82A 4WETA 4O5QA 3IRAA 3S9FA 2FY6A 3HZ8A 2GSQA 1PN9A 5G30A 4TW5A 3LXTA 5EPFA 3H79A 1XWCA 1SK0A 1GSUA 3C73A 3G7IA 1QK8A 3CTGA 2LKUA 4K0NA 3GKKA 1HNCA 2H1LA 2YV9A 3TCOA 1DBYA 4AI6A 2OJLA 17GSA 2RLIA 4ECCA 3DMLA 2R0GA 1XBSA 4TR0A 2H74A 1JZRA 2X8HA 4NXIA 2LNSA 3QCPA 2X8GA 4YAPA 5GAND 2C0EA 1XCCA 1EGRA 2MBTA 1Z6MA 4ZB6A 1WJKA 1TTZA 4V1Ag 2VL2A 4XS6A 3ZLPA 4KF9A 3BCKA 2B7KA 1WOUA 3ERFA 4AKIA 4GWRA 3C1SA 2RUEA 3KTLA 2I4AA 3EINA 3Q6OA 1J08A 2C8UA 5A1NA 1DSBA 4KSOA 2DMMA 1IYIA 2H19A 2FUG2 2YJ7A 5FT3A 1ZZYA 3F6DA 1YQ1A 3KJYA 5GZZB 3ED3A 1GTIA 3TDGA 2H1AA 3CSHA 5BMUA 4XS4B 5JWQB 5ECNB 3D6IA 1GRXA 4X4JA 4KDUA 3F3RA 4IBPA 2H01A 4JEDA 3ZMLA 3CYNA 1Y6EA 2GQKA 4QMKA 3FKFA 4Q5NA 3ZIJA 3GA4A 3PGTA 3LFLA 2KLXA 2D2ZA 2VCXA 2NPBA 4TXVA 1OE8A 4FYCA 1X9MB 1BEDA 3J7Yk 4CY6A 1OAZA 3GX0A 2FA4A 2HSNA 4YKFA 2ZCTA 2FA8A 3LG6A 5DQSA 4H86A 3RHCA 4PNGA 4GSTA 5AGYA 3F4SA 3ME8A 4HUAA 3L9VA 2NTOA 5GSTA 3L78A 1NHYA 4I2TA 4K8MA 4J56E 1FOHA 5IMZA 3F8UA 5IMVA 3UBLA 3DXBA 2RM6A 3LSZA 4X0XA 1BQ7A 1Y1UA 5DVBA 5A5HB 1A2MA 2JSZA 2WCIA 5DALB 3IDVA 1OVNA 5A34A 3IC4A 3P8WA 1PL2A 5IMFA 1U3IA 2E0QA 1OC3A 5F07A 2GDRA 2OA7A 1Z7RA 4V2LA 5ECIB 3A5WA 3GRXA 3MDKA 3ZIVA 5E4WA 1X0RA 3HMJG 1FVJA 1FW1A 2IWTA 1T3BA 5LNKe 16GSA 2WFCA 3CRUA 5G31A 5IIZA 2GSTA 3KZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCA A;  3UVH A;  4ZL7 A;  2VCV A;  1OKD A;  2V2G A;  3LJR A;  3NIV A;  2CVD A;  1TRS A;  2HZF A;  1BX9 A;  4HZ4 A;  4QL9 A;  2IN3 A;  2G0F A;  5HR0 A;  2WS2 A;  4PNF A;  4XCS A;  2J23 A;  3GKM A;  4RQR A;  2CQ9 A;  2FHE A;  1XWB A;  4XTS A;  5DAK B;  2TIR A;  2XPD A;  5J9B A;  1FOV A;  1O73 A;  4MLY A;  3LOR A;  1AW9 A;  2JL4 A;  3V1W A;  2L4C A;  2HRK A;  1K0N A;  4JRR A;  3GTU B;  4HQS A;  1I9D A;  3GYK A;  3US3 A;  2IMI A;  3CRT A;  1PA3 A;  4X43 A;  1YZX A;  3GUS A;  2AUV A;  4MK3 A;  2B6M A;  1GNE A;  4POB A;  3W6G A;  4Q5F A;  4G9H A;  1GSD A;  1XOA A;  1GNW A;  2HSH A;  2VLV A;  4FYU A;  4G10 A;  3MSZ A;  4N0Z A;  4KA0 A;  2F8A A;  4TKY A;  4LMV A;  1ABA A;  1GUH A;  4EF0 A;  1EOH A;  2Z9S A;  2CT6 A;  4N11 A;  3QAG A;  4PUF C;  1GSF A;  3U6V A;  1MDI A;  1HNA A;  3ZVJ D;  1K0C A;  2K8S A;  2IL3 A;  5B7C A;  1B9Y C;  2C3N A;  5C00 A;  5KEJ A;  2HRN A;  20GS A;  3G7Y A;  4I5Q A;  2R5G A;  1H75 A;  2H1G A;  2X99 A;  2R3X A;  1TKD B;  4POM A;  2IMF A;  3KMO A;  2DJK A;  1XWK A;  2GS3 A;  2OE0 A;  3FZ9 A;  4TR4 A;  2C80 A;  3KMN A;  3VWU A;  4ACS A;  4EE0 A;  4MJE A;  1TK0 B;  4HI7 A;  2QC7 A;  5F8B A;  2AYT A;  2YNX A;  4G0I A;  4PXO A;  1XIY A;  4D73 B;  3CSJ A;  3CTF A;  2LJK A;  5CAX A;  3I43 A;  1GSQ A;  1AQX A;  3UL3 A;  4AF2 A;  2GGT A;  1OE7 A;  4J2F A;  5H5Q A;  2FD3 A;  1URM A;  1U3A A;  3F9U A;  1F9M A;  2B5X A;  18GS A;  4G0L A;  4NV2 A;  2ZUP A;  1QQ2 A;  3KH9 A;  5D96 A;  4QL7 A;  4XS1 A;  1T00 A;  3TKS A;  3DEX A;  4PQ1 A;  3IBH A;  5JWR B;  4IVF A;  5J41 A;  1K3O A;  2FNO A;  4EO3 A;  3A3T A;  2IIY A;  1B8X A;  2EIQ A;  4NHW A;  5J9C A;  1GSS A;  4JR6 A;  1ERT A;  2QKE A;  4MA9 A;  1XOB A;  4MMM A;  3NOF A;  6GSY A;  3DD3 A;  2R37 A;  1M7T A;  3QD9 A;  3FW2 A;  3LWA A;  1TDI A;  4OFT A;  2L4Q A;  3KGK A;  2NBS A;  2KHP A;  4V1A p;  2IME A;  3D4M A;  4PGT A;  1EOG A;  5IOW A;  1YEX A;  1VRS D;  2GTU A;  4DEJ A;  1GUK A;  3H8Q A;  3WD6 A;  1M99 A;  1GUL A;  3I6A A;  4YQV A;  2OE1 A;  3UEM A;  3D21 A;  1Y25 A;  3I69 A;  3ZFB A;  1EGO A;  3M1G A;  2XHF A;  2KOK A;  4ML6 A;  2IFQ B;  1MDK A;  5DCH A;  2YAN A;  10GS A;  3ZIT A;  2VLT A;  4X1U A;  3Q18 A;  4GSN A;  3UJ1 A;  5ECH B;  3L4N A;  2FWH A;  4L0W A;  1R4W A;  1I5G A;  2GT5 A;  4PTS A;  4TXO A;  3IV4 A;  2DJ3 A;  4ZL9 A;  3GST A;  1TW9 A;  6GSW A;  2MBS A;  5ECQ B;  5HR3 A;  2HZE B;  4KAE A;  3F6F A;  1W4V A;  2V32 A;  3UAR A;  4IHU A;  2H0H A;  3W8J A;  6GST A;  2PWJ A;  3BBY A;  2VAF A;  2CV4 A;  5ENU A;  1ZGN A;  1TI1 A;  1KNG A;  3FY7 A;  4GTU A;  4TR3 A;  1A24 A;  5IO2 A;  2WDU A;  1R5P A;  1UVZ A;  1SKR B;  4IQ1 A;  2DJJ A;  3MNG A;  4K9Z A;  1M2A A;  3UBK A;  3DRN A;  2CVK A;  3GKN A;  2VD1 A;  4O92 A;  1ACV A;  3P90 A;  1GP1 A;  2VM2 A;  1K0O A;  4POL A;  5DAL A;  2HRF A;  1XZO A;  1R26 A;  2JAD A;  5JCG A;  3VI5 A;  2FWE A;  3BOA A;  4LA1 A;  1TOF A;  2L5L A;  5ABR A;  2O89 A;  3QAW A;  2JAC A;  4NWY A;  3DVX A;  2GVP A;  3TOT A;  2LRT A;  2GZY A;  4GXZ A;  1GSE A;  2M46 A;  3IXR A;  5LD0 A;  4ZBD A;  3IHQ A;  1GLQ A;  4IP6 A;  2H30 A;  3EUR A;  3JCM L;  2CVB A;  3IK7 A;  2H71 A;  1PQN A;  5A4W A;  1PGT A;  4QQ7 A;  4MAB A;  4XRA A;  3GKX A;  1PMT A;  1K0A A;  4LL1 B;  1A23 A;  2LNT A;  2PUK C;  3D4T A;  1A8Y A;  1NHO A;  2X8C A;  5CRH A;  2AB6 A;  3F4T A;  1TU8 A;  3UAP A;  1A8L A;  2K9F A;  1YKC A;  4OCF A;  1WMJ A;  2VO4 A;  2YZH A;  3OR5 A;  5DAK A;  4BVX B;  2DML A;  3KM6 A;  1JZW A;  1O6J A;  3M9J A;  2GT6 A;  4F0C A;  3HHV A;  2CAI A;  4OD7 A;  2QGV A;  1RQM A;  3HA9 A;  2LEG A;  3M8N A;  4I97 A;  2P31 A;  2H1B A;  4EDZ A;  3VPQ A;  2G2Q A;  5ECP B;  3VWW A;  1LBK A;  4IS0 A;  3CBU A;  4LMW A;  3SWL A;  3FK8 A;  2FLS A;  1E2Y A;  3TRX A;  5CYY A;  4ZIL A;  4KDX A;  3A2V A;  4O7H A;  1THO A;  4K7N A;  1X5D A;  1X9S B;  4L5L A;  1AQV A;  4F9Z A;  3EU4 A;  4OCE A;  2PU9 C;  3QOU A;  1PX7 A;  2PPT A;  4CDO A;  1AC1 A;  4EKZ A;  7GSS A;  1TK5 B;  3TUE A;  3KP8 A;  3R2Q A;  3C71 A;  2I3Y A;  5CO3 A;  5H5S A;  3ZMK A;  2HXK A;  1G6W A;  3ZYW A;  4FQU A;  1O81 A;  4RQX A;  1TRW A;  3DVW A;  4PUA A;  5HQP A;  2C4J A;  2XC2 A;  3C1R A;  3HVV A;  2GSR A;  4TOP A;  3FR9 A;  5IPG A;  3WGX A;  3VUR A;  1GTA A;  5D93 A;  5EL8 A;  5D9V A;  4XHM A;  3N9J A;  4Z7X A;  1SL2 B;  3A2W A;  1E6B A;  5ECM B;  2E2M A;  1K0D A;  4WF5 A;  4HS1 A;  1BG5 A;  1FG4 A;  5B6N A;  3HJP A;  2VLU A;  3FRC A;  3G9B A;  3LXZ A;  3K8N A;  3G7J A;  1YF0 A;  1M2D A;  2KUC A;  1IYH A;  3WGE A;  2LV3 A;  2N5A A;  2DIY A;  1K3Y A;  3L9S A;  3M9K A;  2PVO C;  5KN0 A;  1F2E A;  3KH7 A;  3FYG A;  1B4P A;  1R7H A;  1Q98 A;  5JCU A;  4WR5 A;  3E9J B;  1S3C A;  3LYP A;  5ELA A;  2L57 A;  3RAZ A;  4ID0 A;  4KGI A;  3DYR A;  3VPT A;  5F0G A;  4ZB8 A;  4GF0 A;  5EVO A;  1GH2 A;  2YWN A;  3A2X A;  2MZC A;  5ID2 B;  1SL0 B;  1EZK A;  3QMX A;  5F06 A;  2AHE A;  2DLX A;  2GQM A;  4OMV A;  4TVE A;  5G5F A;  2LJR A;  2JZR A;  1F37 A;  4ML1 A;  3D22 A;  1WE0 A;  4N10 A;  4WKW A;  1X9W B;  1N2A A;  13GS A;  1V58 A;  2IFQ A;  5G2Z A;  3FR6 A;  4ZB9 A;  3C7M A;  4PQH A;  2M72 A;  4G0K A;  4LL4 B;  3UIW A;  4Q5Q A;  3BJ5 A;  3KP9 A;  2YP6 A;  4IJI A;  5H5R A;  1ERV A;  1QUW A;  5B8B A;  1S3A A;  1FB0 A;  4IJ3 A;  1G6Y A;  2HZE A;  4EC0 A;  2DIZ A;  3NZN A;  2A2S A;  2WJU A;  1VF1 A;  5CRW A;  1XW5 A;  2WB9 A;  1Z3E A;  3H4K A;  1LJR A;  5AIV A;  1XVW A;  2K8V A;  4WEY A;  4ECJ A;  3HVS A;  4TN8 A;  1TK8 B;  1GSY A;  1G7E A;  4TR1 B;  4ZIJ A;  5ELG A;  1T1V A;  1XXU A;  1ZYE A;  2TRC P;  4HDE A;  4AJ6 A;  6GSS A;  3GHA A;  4DSQ A;  1ERW A;  4KCE A;  2HLS A;  3TOU A;  2L5O A;  3QFA C;  4Q5R A;  5HR1 A;  3L9U A;  5HFG A;  4KX4 A;  2L6C A;  1A0F A;  1SJI A;  3MAK A;  5JCW A;  2XBI A;  4NMU A;  1NM3 A;  1V2A A;  1XW6 A;  4MP4 A;  3KEB A;  1PX6 A;  1VF3 A;  2BJX A;  4KSM A;  4HZ2 A;  4GRF A;  3IE3 A;  2XPE A;  5G1L A;  3DIE A;  4BL7 A;  5GSS A;  2VL2 C;  1Z7P A;  2R6K A;  1V9W A;  2I9H A;  2YV7 A;  4K0G A;  4AGS A;  2OKA A;  5DCG A;  5D9W A;  1YKA A;  1PSQ A;  2PVQ A;  2PGT A;  1F3A A;  5D9T A;  2K18 A;  5CNW A;  2J9H A;  2JSY A;  3GN3 A;  3QFB C;  4FYB A;  3IA1 A;  1ML6 A;  3GNJ A;  3FZ5 A;  1HD2 A;  4I8B A;  1LU4 A;  4NAX A;  1MDJ A;  2L59 A;  4ULX A;  4WBR D;  3TKR A;  4BVX A;  4GQF A;  4F03 A;  2IPA A;  2N5B A;  2VCW A;  5LCZ A;  4YQM A;  2V1M A;  3P7X A;  4POK A;  2YJH A;  1FB6 A;  1K3L A;  2BTO T;  4L0U A;  5IM9 A;  4N30 A;  1FAA A;  4MJC A;  1MD3 A;  4PUR A;  22GS A;  3EYT A;  1GL8 A;  4MF7 A;  1M2B A;  3VWV A;  1ST9 A;  2TRX A;  2CX3 A;  4ECI A;  3QR6 A;  3VK9 A;  1XWG A;  3TB2 A;  2X64 A;  5FWG A;  4XS4 A;  1UN2 A;  3HJO A;  3IC8 A;  1G7O A;  4NPB A;  1SYR A;  3M3M A;  4CW9 A;  2A4V A;  4JZQ A;  2H6X A;  1SD8 A;  4IP1 A;  2DBC A;  4GQC A;  1XVQ A;  2CA8 A;  4YQU A;  1U88 A;  4FIW A;  9GSS A;  4LLR A;  3VI7 A;  4CHS A;  3F4R A;  3H1N A;  5ECO B;  4HU7 A;  2HT9 A;  4I6X A;  1TXX A;  4MF6 A;  2YWO A;  2LRC A;  4DSS B;  5DBQ A;  1NSW A;  4DSR A;  5D73 A;  3DKS A;  2VL9 A;  2EIR A;  4EXJ A;  2C0D A;  2PER A;  4JU5 A;  2KP2 A;  4G2E A;  1MD4 A;  1TP9 A;  2YWI A;  3KD0 A;  5ECL B;  3HKR A;  2OBI A;  3LEF A;  2DC5 A;  4MJB A;  12GS A;  2C3T A;  3FR3 A;  5D8I A;  1WIK A;  2LTK A;  1XW9 A;  2B3S A;  2REM A;  5GAP D;  2H0G A;  2IJY A;  1B9X C;  2ON7 A;  1DE2 A;  1XPV A;  3W8S A;  4KUN A;  3WGD A;  4KB3 A;  4HJ2 A;  1OYJ A;  1PKZ A;  3HXS A;  5IOX A;  5J3R A;  2VOC A;  5ECK B;  2DJ2 A;  5L71 A;  3ZFL A;  2IMD A;  2GZP A;  1VF2 A;  5ECS A;  2HSM B;  1PL1 A;  1GLP A;  3CXG A;  1AQW A;  1H4O A;  4FH8 A;  5IMA A;  1A0R P;  1FHE A;  4MDC A;  1EWX A;  3TKS E;  1YF1 A;  1JZD A;  3GIX A;  2LRN A;  3GSS A;  4KE3 A;  1SU9 A;  3TJG A;  2B5E A;  1T4Y A;  2M80 A;  4I2U A;  5AIS A;  4L5O A;  4BWQ A;  2JZT A;  5ID2 A;  2YCD A;  4MPF A;  3TRQ A;  1AUC A;  2AAW A;  5CP1 A;  2A2R A;  3VLN A;  5G5E A;  1WWJ A;  5C04 A;  1YJ6 A;  3TJF A;  3MWH A;  3FHK A;  2H0I A;  4XRD A;  3BD2 A;  1F6M C;  3HJM A;  1M9B A;  4WBJ A;  3DWV A;  3TKP A;  1O8X A;  1K0M A;  1YDK A;  1PD2 1;  2LUS A;  1A2L A;  1BAY A;  2QSI A;  4KW6 A;  3F3Q A;  5KN1 A;  3LQ7 A;  5HR2 A;  1KTE A;  5IMC A;  3ISO A;  4OWY A;  2HNL A;  4TRX A;  3EMX A;  2HSY A;  1XFL A;  1Z9H A;  2O7K A;  1TU7 A;  3WYW A;  3KCM A;  4F2I A;  4MF5 A;  1GTU A;  6GSV A;  3GTU A;  5A4V A;  2LS5 A;  1BYE A;  3F0I A;  6GSX A;  1TRU A;  2O85 A;  4BWS A;  4NV5 A;  2CZ3 A;  1Q4J A;  1S3D A;  4P3Y B;  4TR1 A;  3ZRD A;  2H8L A;  4O5R A;  1U87 A;  4G19 A;  2VCT A;  3RPP A;  2B1L A;  1WPI A;  1K0B A;  2PN8 A;  5COH A;  2GZZ A;  4KND A;  3TJB A;  3HY2 A;  3KXO A;  2F8F A;  2JZS A;  1GTB A;  3IOS A;  2NVL A;  3TKS C;  1J0F A;  5HFK A;  3EMP A;  3RPN A;  2PBJ A;  2O8V B;  4JE1 A;  1FVK A;  5ECR B;  3FZA A;  3QPM A;  2WGR A;  1BJX A;  1SKW B;  2V6K A;  5HFI A;  1UC7 A;  1ILO A;  4BVY B;  4KDY A;  1X5C A;  4F0B A;  4EUY A;  3O6T A;  4GSS A;  1OC9 B;  4HQZ A;  2HFD A;  2YZU A;  2HRA A;  3APS A;  1UA5 A;  2YOI A;  4JR4 A;  1WRY A;  4D73 A;  5JWO B;  1JHB A;  3GUR A;  3IAS 2;  3N5O A;  3GL3 A;  2VL3 A;  4JBB A;  2VM1 A;  2IMK A;  2EIO A;  1R5A A;  2ES7 A;  2ZNM A;  4K7I A;  1HYU A;  4IGJ A;  3CSI A;  2B1K A;  3WT1 A;  4BPY A;  1OKT A;  4K2D A;  4V2N A;  4TXO B;  1RW1 A;  1YY7 A;  1FO5 A;  1JLW A;  5A4U A;  5DQY A;  2HQT A;  2VUP A;  1USB A;  2E7P A;  3ZL5 A;  1B4Q A;  4MPG A;  1ZCP A;  3EU3 A;  1EEJ A;  5KN2 A;  1CQG A;  3ZTL A;  2VCZ A;  2FGX A;  2C1Y A;  2P0G A;  3C8E A;  2RM5 A;  3UVT A;  4MH3 A;  5DJL A;  5AN1 A;  3RHB A;  1RK4 A;  3LGC A;  4K1F A;  8GSS A;  1V98 A;  1QMV A;  2C0G A;  1J9B A;  4EDY A;  4XIH A;  3GH6 A;  19GS A;  4OFM A;  3ERG A;  4OO5 A;  5INY A;  4DSS A;  5F05 A;  4KH7 A;  5IMD A;  2LJA A;  1T7P B;  1F3B A;  2B7J A;  2YWM A;  1OC8 A;  3D5J A;  1TI3 A;  2LST A;  3APO A;  2DSA A;  5J5N A;  1VF4 A;  2C3Q A;  1TJD A;  3TKQ A;  1EP7 A;  5B8A A;  1SKS B;  5DDL A;  2DJ0 A;  2P5Q A;  2JU5 A;  1SJZ A;  2FCH A;  4ZL8 A;  1ERU A;  3L0H A;  1SJ6 A;  4V2M A;  3I9V 2;  2L6D A;  4EVM A;  2LQQ A;  3QDN A;  1PKW A;  4E8H A;  1SEN A;  2WRT A;  3GFK A;  4PX1 A;  5CRG A;  1M9A A;  4PQI A;  3U5R E;  2HSM A;  2KP1 A;  5FHI A;  2YN1 A;  1WP0 A;  2YPM A;  1SD9 A;  6GSU A;  4MZW A;  1PRX A;  4ZBB A;  3O76 A;  1T4Z A;  1U6T A;  3ERW A;  2WZ9 A;  4ZBA A;  3GV1 A;  3Q19 A;  1AXD A;  4ISD A;  4ECB A;  4RUV A;  3AY8 A;  3ZVJ A;  3EE2 A;  3VWX A;  2ON5 A;  2H75 A;  3HVX A;  2MMA A;  2R2J A;  2F9S A;  5IPH A;  2FWG A;  2GLR A;  3IK9 A;  5DJM A;  4BA7 A;  5E59 A;  3DGQ A;  2FWF A;  4HU9 A;  4MJA A;  4YAV A;  2F3M A;  2HI7 A;  2DJ1 A;  1EP8 A;  1CQH A;  3IPZ A;  2H76 A;  3GX8 A;  4WF4 A;  4NHZ A;  1QXH A;  3GMF A;  2H70 A;  4GLT A;  1A2J A;  1O8W A;  5CRD A;  1EEM A;  4L8E A;  3HYP A;  1EV4 A;  2R4V A;  3TJK A;  2RII A;  4USS A;  3SBC A;  2CX4 A;  3RBT A;  2ALB A;  4MZC A;  4HOJ A;  2HSN B;  2OAC A;  1JLV A;  1Z5Y E;  3WT2 A;  2AJQ B;  2LQO A;  3E0U A;  3HCZ A;  3P2A A;  4WR4 A;  2HE3 A;  1SK1 A;  2H66 A;  2H1D A;  3IAM 2;  1XWA A;  1EV9 A;  4YH2 A;  1ZYQ B;  1DUG A;  4EL1 A;  3Q74 A;  3HZ4 A;  1C72 A;  2XBQ A;  4AJ8 A;  4N0V A;  2V41 A;  1Z6N A;  3PPU A;  2GQL A;  2V6O A;  3BCI A;  1THX A;  3EVI A;  3PIN A;  4IEL A;  5A5K A;  4GCI A;  4ILF A;  1SL1 B;  1HNB A;  1M0U A;  4AJ7 A;  1MTC A;  2BMX A;  2CZ2 A;  5IO0 A;  5J4U A;  1G0T A;  1TRV A;  4ZXG A;  3HD5 A;  4OFN A;  1O85 A;  2E2G A;  2I1U A;  2GSS A;  4MH2 A;  1B48 A;  3F63 A;  4MCU A;  4J57 E;  4RI6 A;  2O87 A;  2C0F A;  3TGZ A;  4HEA 2;  3D0Z A;  5KN3 A;  4IKH A;  3ZRE A;  1N8J A;  1SK2 A;  3ZZX A;  2I81 A;  1KEB A;  1O7U A;  2NDO A;  4WXT A;  1W89 A;  4BVY A;  5IQY A;  3HDC A;  5D9X A;  1ZOF A;  3CMI A;  4HJM A;  4IQA A;  2CAQ A;  1OC9 A;  3APQ A;  1AIU A;  2OBK A;  4K6X A;  5G1K A;  3QAV A;  2MMZ A;  2OAD A;  1HQO A;  4FO5 A;  2VCQ A;  14GS A;  2K6V A;  3TRP A;  4O32 A;  3UMA A;  1QFN A;  1MEK A;  2MYG A;  4MZB A;  2B5Y A;  1ZL9 A;  3RDW A;  2P5R A;  5AIX A;  4RI7 A;  3FEU A;  1QGV A;  2H6Z A;  4K7O A;  1AAZ A;  3R3E A;  2HRK B;  2N5F A;  3IR4 A;  3VFI A;  1ON4 A;  5CRE A;  2UZ8 A;  2EC4 A;  1KBN A;  1T8E B;  2H73 A;  4DVC A;  2MMN A;  1GUM A;  1YEP A;  1V57 A;  3TJJ A;  3EWL A;  3H93 A;  3J7Y b;  2OE3 A;  2VD0 A;  1V40 A;  3LYK A;  1JFU A;  2RUF A;  1ZMA A;  1JZO A;  5EY6 A;  3GL5 A;  1VGL A;  1X5E A;  2PMT A;  1NW2 A;  3EC3 A;  3O3T A;  3GH9 A;  4IN0 A;  2VIM A;  3FZ4 A;  3M0F A;  3KTB A;  3PH9 A;  4E8E A;  3ME7 A;  2H6Y A;  1DE1 A;  2HYX A;  3PR8 A;  4OO4 A;  2MMO A;  3UOM A;  3KIJ A;  4BL7 B;  1SYX A;  1GWC A;  11GS A;  2AV4 A;  2H72 A;  4IW9 A;  2WUL A;  5B6M A;  3E3E A;  2F51 A;  4F82 A;  4WET A;  3IRA A;  3S9F A;  2FY6 A;  3HZ8 A;  2GSQ A;  1PN9 A;  5G30 A;  4TW5 A;  3LXT A;  5EPF A;  3H79 A;  1XWC A;  1SK0 A;  1GSU A;  3C73 A;  3G7I A;  1QK8 A;  3CTG A;  2LKU A;  4K0N A;  3GKK A;  1HNC A;  2YV9 A;  3TCO A;  1DBY A;  2OJL A;  17GS A;  2RLI A;  4ECC A;  3DML A;  1XBS A;  4TR0 A;  2H74 A;  1JZR A;  2X8H A;  4NXI A;  2LNS A;  3QCP A;  2X8G A;  4YAP A;  5GAN D;  2C0E A;  1XCC A;  1EGR A;  2MBT A;  1Z6M A;  4ZB6 A;  1WJK A;  1TTZ A;  4V1A g;  2VL2 A;  4XS6 A;  3ZLP A;  4KF9 A;  3BCK A;  2B7K A;  1WOU A;  3ERF A;  4GWR A;  3C1S A;  2RUE A;  3KTL A;  2I4A A;  3EIN A;  3Q6O A;  1J08 A;  2C8U A;  1DSB A;  4KSO A;  2DMM A;  1IYI A;  2H19 A;  2FUG 2;  2YJ7 A;  5FT3 A;  1ZZY A;  3F6D A;  1YQ1 A;  3KJY A;  5GZZ B;  3ED3 A;  1GTI A;  3TDG A;  2H1A A;  3CSH A;  5BMU A;  4XS4 B;  5JWQ B;  5ECN B;  3D6I A;  1GRX A;  4KDU A;  3F3R A;  4IBP A;  2H01 A;  4JED A;  3ZML A;  3CYN A;  1Y6E A;  2GQK A;  3FKF A;  4Q5N A;  3ZIJ A;  3GA4 A;  3PGT A;  3LFL A;  2KLX A;  2D2Z A;  2VCX A;  2NPB A;  4TXV A;  1OE8 A;  4FYC A;  1X9M B;  1BED A;  3J7Y k;  1OAZ A;  3GX0 A;  2FA4 A;  2ZCT A;  2FA8 A;  3LG6 A;  5DQS A;  4H86 A;  3RHC A;  4PNG A;  4GST A;  5AGY A;  3F4S A;  3ME8 A;  4HUA A;  3L9V A;  2NTO A;  5GST A;  3L78 A;  4K8M A;  1NHY A;  4I2T A;  4J56 E;  5IMZ A;  3F8U A;  5IMV A;  3UBL A;  3DXB A;  2RM6 A;  3LSZ A;  4X0X A;  1BQ7 A;  5DVB A;  1A2M A;  2JSZ A;  2WCI A;  5DAL B;  3IDV A;  1OVN A;  3IC4 A;  3P8W A;  1PL2 A;  5IMF A;  1U3I A;  2E0Q A;  1OC3 A;  5F07 A;  2GDR A;  2OA7 A;  1Z7R A;  4V2L A;  5ECI B;  3A5W A;  3GRX A;  3MDK A;  3ZIV A;  5E4W A;  1X0R A;  1FVJ A;  1FW1 A;  2IWT A;  1T3B A;  5LNK e;  16GS A;  2WFC A;  3CRU A;  5G31 A;  5IIZ A;  2GST A;  3KZQ A; 
#chains in the Genus database with same CATH topology
 4KCA A;  3UVH A;  4K5R A;  4ZL7 A;  2VCV A;  1OKD A;  2A2P A;  2V2G A;  2EFE A;  3LJR A;  3NIV A;  2CVD A;  1TRS A;  2HZF A;  1BX9 A;  4HZ4 A;  4QL9 A;  2IN3 A;  2G0F A;  5HR0 A;  2WS2 A;  4PNF A;  4XCS A;  2J23 A;  3GKM A;  4RQR A;  2CQ9 A;  2FHE A;  1XWB A;  4XTS A;  5DAK B;  2TIR A;  2XPD A;  5J9B A;  1FOV A;  1O73 A;  1S3R A;  4MLY A;  3LOR A;  1AW9 A;  2JL4 A;  3V1W A;  4N3Z A;  2L4C A;  2HRK A;  1K0N A;  4JRR A;  4PHZ C;  3GTU B;  1N25 A;  4HQS A;  1I9D A;  3GYK A;  3US3 A;  2IMI A;  3CRT A;  1PA3 A;  4X43 A;  1YZX A;  3GUS A;  2AUV A;  4MK3 A;  2B6M A;  1GNE A;  4POB A;  3W6G A;  4Q5F A;  4G9H A;  1GSD A;  1XOA A;  1GNW A;  2HSH A;  2VLV A;  4FYU A;  4G10 A;  3MSZ A;  4N0Z A;  3CWG A;  4KA0 A;  2F8A A;  4TKY A;  4LMV A;  1ABA A;  1GUH A;  4EF0 A;  1EOH A;  2Z9S A;  2CT6 A;  4N11 A;  3QAG A;  4PUF C;  1GSF A;  3U6V A;  1MDI A;  1HNA A;  3ZVJ D;  1K0C A;  2K8S A;  2IL3 A;  5B7C A;  1B9Y C;  2C3N A;  5C00 A;  5KEJ A;  2HRN A;  20GS A;  3G7Y A;  4I5Q A;  2R5G A;  1H75 A;  2H1G A;  2X99 A;  2R3X A;  1TKD B;  4POM A;  2IMF A;  4YKG A;  3KMO A;  2DJK A;  1XWK A;  2GS3 A;  2OE0 A;  4W66 A;  3FZ9 A;  4TR4 A;  2C80 A;  3KMN A;  3VWU A;  4ACS A;  4EE0 A;  4MJE A;  1TK0 B;  4HI7 A;  2QC7 A;  5F8B A;  2AYT A;  2YNX A;  4G0I A;  4PXO A;  1XIY A;  4D73 B;  3CSJ A;  3CTF A;  2LJK A;  5CAX A;  3I43 A;  1GSQ A;  1AQX A;  3UL3 A;  4AF2 A;  2GGT A;  1OE7 A;  4J2F A;  5H5Q A;  2FD3 A;  1URM A;  1U3A A;  3F9U A;  1F9M A;  2B5X A;  18GS A;  4G0L A;  4NV2 A;  2ZUP A;  1QQ2 A;  3KH9 A;  5D96 A;  4QL7 A;  4XS1 A;  1T00 A;  3TKS A;  3DEX A;  4PQ1 A;  3IBH A;  5JWR B;  1ZYN A;  4IVF A;  5J41 A;  5J4Y A;  1K3O A;  2FNO A;  4EO3 A;  3A3T A;  2IIY A;  1B8X A;  2EIQ A;  4NHW A;  5J9C A;  1GSS A;  4JR6 A;  1ERT A;  2QKE A;  4MA9 A;  1XOB A;  4MMM A;  3NOF A;  6GSY A;  3DD3 A;  2R37 A;  1M7T A;  3QD9 A;  1YVL A;  3FW2 A;  3LWA A;  1TDI A;  4OFT A;  2L4Q A;  3KGK A;  2NBS A;  2KHP A;  4V1A p;  2IME A;  3D4M A;  1PN0 A;  4PGT A;  1EOG A;  5IOW A;  1YEX A;  1VRS D;  2GTU A;  4DEJ A;  1GUK A;  4EIQ A;  3H8Q A;  3WD6 A;  1M99 A;  1GUL A;  3I6A A;  4YQV A;  2OE1 A;  3UEM A;  3D21 A;  2VKZ G;  1Y25 A;  3I69 A;  3ZFB A;  1EGO A;  3M1G A;  2XHF A;  2KOK A;  4ML6 A;  2IFQ B;  1MDK A;  5DCH A;  2YAN A;  10GS A;  3ZIT A;  2VLT A;  4X1U A;  3Q18 A;  4GSN A;  3UJ1 A;  5ECH B;  3L4N A;  2FWH A;  4L0W A;  1R4W A;  1I5G A;  2GT5 A;  4PTS A;  4TXO A;  3IV4 A;  2DJ3 A;  4ZL9 A;  3GST A;  1TW9 A;  2WZS A;  6GSW A;  2MBS A;  5ECQ B;  5HR3 A;  2HZE B;  4KAE A;  3F6F A;  1W4V A;  2V32 A;  3UAR A;  4IHU A;  2H0H A;  3W8J A;  6GST A;  2PWJ A;  3BBY A;  2VAF A;  2CV4 A;  5ENU A;  1ZGN A;  1TI1 A;  1KNG A;  3FY7 A;  4GTU A;  4TR3 A;  1A24 A;  5IO2 A;  2WDU A;  1R5P A;  1UVZ A;  1SKR B;  4IQ1 A;  2DJJ A;  3MNG A;  4K9Z A;  1M2A A;  3UBK A;  3DRN A;  2CVK A;  3GKN A;  2VD1 A;  4O92 A;  1ACV A;  3P90 A;  1GP1 A;  2VM2 A;  1K0O A;  4POL A;  5DAL A;  2HRF A;  1XZO A;  1R26 A;  2JAD A;  5JCG A;  3VI5 A;  2FWE A;  3BOA A;  4LA1 A;  1TOF A;  2L5L A;  5ABR A;  2O89 A;  3QAW A;  2JAC A;  4NWY A;  3IHG A;  3DVX A;  2GVP A;  3TOT A;  2LRT A;  2GZY A;  4GXZ A;  1GSE A;  2M46 A;  3IXR A;  5LD0 A;  4ZBD A;  2UV8 G;  3IHQ A;  1GLQ A;  2EFD A;  4IP6 A;  2H30 A;  3EUR A;  3JCM L;  2CVB A;  3IK7 A;  2H71 A;  1PQN A;  5A4W A;  1PGT A;  4QQ7 A;  4MAB A;  4XRA A;  3GKX A;  1PMT A;  1K0A A;  4LL1 B;  1A23 A;  2LNT A;  2PUK C;  2X4A A;  3D4T A;  1A8Y A;  1NHO A;  2X8C A;  5CRH A;  2AB6 A;  3F4T A;  1TU8 A;  3MIX A;  3UAP A;  1A8L A;  2K9F A;  1YKC A;  4OCF A;  1WMJ A;  2VO4 A;  2YZH A;  3OR5 A;  5DAK A;  1TXU A;  4BVX B;  2DML A;  3KM6 A;  1JZW A;  1O6J A;  3M9J A;  2GT6 A;  4F0C A;  3HHV A;  2CAI A;  4OD7 A;  2QGV A;  1RQM A;  3HA9 A;  2LEG A;  3M8N A;  4I97 A;  2P31 A;  2H1B A;  4EDZ A;  3VPQ A;  2G2Q A;  5ECP B;  3VWW A;  1LBK A;  4IS0 A;  4GDF A;  3CBU A;  4LMW A;  3SWL A;  3FK8 A;  2FLS A;  1E2Y A;  3TRX A;  5CYY A;  4ZIL A;  4KDX A;  3A2V A;  4O7H A;  1THO A;  4K7N A;  1X5D A;  1X9S B;  4L5L A;  1AQV A;  4F9Z A;  3EU4 A;  4OCE A;  2PU9 C;  3QOU A;  1PX7 A;  2PPT A;  4CDO A;  1AC1 A;  4EKZ A;  7GSS A;  1TK5 B;  3TUE A;  3KP8 A;  3R2Q A;  3C71 A;  5KOW A;  2I3Y A;  5CO3 A;  5H5S A;  3ZMK A;  2HXK A;  1G6W A;  3ZYW A;  4FQU A;  1O81 A;  4RQX A;  1TRW A;  3DVW A;  4PUA A;  5HQP A;  2C4J A;  2WW1 A;  2XC2 A;  3C1R A;  3HVV A;  2GSR A;  4TOP A;  3FR9 A;  5IPG A;  3WGX A;  3VUR A;  1GTA A;  5D93 A;  5EL8 A;  5D9V A;  4XHM A;  3N9J A;  4Z7X A;  1SL2 B;  3A2W A;  1E6B A;  5ECM B;  2E2M A;  1K0D A;  4WF5 A;  4HS1 A;  1BG5 A;  1FG4 A;  5B6N A;  3HJP A;  2VLU A;  3FRC A;  3G9B A;  3LXZ A;  3K8N A;  3G7J A;  1YF0 A;  1M2D A;  2KUC A;  4PI0 C;  1IYH A;  3WGE A;  2LV3 A;  2N5A A;  2DIY A;  1K3Y A;  3L9S A;  3M9K A;  2PVO C;  5KN0 A;  1F2E A;  3KH7 A;  1ZYP A;  3FYG A;  1B4P A;  1R7H A;  4Z2T A;  1Q98 A;  5JCU A;  4WR5 A;  3E9J B;  1S3C A;  3LYP A;  5ELA A;  2L57 A;  3RAZ A;  4ID0 A;  4KGI A;  1SVO A;  3DYR A;  3VPT A;  5F0G A;  4ZB8 A;  4GF0 A;  2O5V A;  5EVO A;  1GH2 A;  2YWN A;  3A2X A;  2MZC A;  5ID2 B;  1SL0 B;  1EZK A;  3QMX A;  5F06 A;  2AHE A;  2DLX A;  2GQM A;  4OMV A;  4TVE A;  5G5F A;  2LJR A;  2JZR A;  1F37 A;  4ML1 A;  3D22 A;  1WE0 A;  4N10 A;  1BG1 A;  4WKW A;  1X9W B;  1N2A A;  13GS A;  1V58 A;  2IFQ A;  5G2Z A;  3FR6 A;  4ZB9 A;  3C7M A;  4PQH A;  2M72 A;  4G0K A;  4LL4 B;  3UIW A;  4Q5Q A;  3BJ5 A;  3KP9 A;  2YP6 A;  4IJI A;  3MYD A;  5H5R A;  4EIP A;  1ERV A;  1QUW A;  5B8B A;  1S3A A;  1FB0 A;  4IJ3 A;  1G6Y A;  2HZE A;  4EC0 A;  2DIZ A;  3NZN A;  2A2S A;  2WJU A;  1VF1 A;  5CRW A;  3EPT A;  2EFC A;  1XW5 A;  2WB9 A;  1Z3E A;  3H4K A;  1LJR A;  5AIV A;  1XVW A;  5J47 A;  2K8V A;  4WEY A;  4ECJ A;  3HVS A;  4TN8 A;  1TK8 B;  1GSY A;  1G7E A;  4TR1 B;  4ZIJ A;  5ELG A;  1T1V A;  1XXU A;  1ZYE A;  2TRC P;  4HDE A;  4AJ6 A;  6GSS A;  3GHA A;  4DSQ A;  1ERW A;  4KCE A;  2HLS A;  3TOU A;  4MNN A;  2L5O A;  3QFA C;  4Q5R A;  5HR1 A;  3L9U A;  5HFG A;  4KX4 A;  2L6C A;  4ZB7 A;  1A0F A;  1SJI A;  3MAK A;  5JCW A;  2XBI A;  4NMU A;  1NM3 A;  1V2A A;  1XW6 A;  4MP4 A;  3KEB A;  1PX6 A;  1VF3 A;  2BJX A;  4KSM A;  3FMW A;  4K2X A;  4HZ2 A;  4GRF A;  3IE3 A;  2XPE A;  5G1L A;  3DIE A;  4BL7 A;  5GSS A;  2VL2 C;  1Z7P A;  2R6K A;  1V9W A;  2I9H A;  2YV7 A;  4K0G A;  4AGS A;  2OKA A;  5DCG A;  3CQF A;  5D9W A;  1YKA A;  1PSQ A;  2PVQ A;  2PGT A;  1F3A A;  5D9T A;  2K18 A;  5CNW A;  2J9H A;  2JSY A;  3GN3 A;  3QFB C;  4FYB A;  3IA1 A;  2WVX B;  1ML6 A;  3GNJ A;  3FZ5 A;  1HD2 A;  5J4V A;  4I8B A;  1LU4 A;  4NAX A;  1MDJ A;  2L59 A;  1M3I A;  4ULX A;  4WBR D;  3TKR A;  4BVX A;  4GQF A;  4Z2U A;  4F03 A;  2IPA A;  2N5B A;  2VCW A;  5LCZ A;  4YQM A;  2V1M A;  3P7X A;  4POK A;  2YJH A;  1FB6 A;  1K3L A;  2BTO T;  4L0U A;  5IM9 A;  4N30 A;  1FAA A;  4MJC A;  1MD3 A;  4PUR A;  22GS A;  3EYT A;  1GL8 A;  4MF7 A;  1M2B A;  3VWV A;  1ST9 A;  2TRX A;  2CX3 A;  4ECI A;  3QR6 A;  3VK9 A;  1XWG A;  3TB2 A;  2X64 A;  5FWG A;  4XS4 A;  1UN2 A;  3HJO A;  3IC8 A;  1G7O A;  4NPB A;  1SYR A;  3M3M A;  4CW9 A;  2A4V A;  4JZQ A;  2H6X A;  1SD8 A;  4IP1 A;  2DBC A;  4GQC A;  1XVQ A;  3A5I A;  2CA8 A;  4YQU A;  1U88 A;  4FIW A;  9GSS A;  4LLR A;  3VI7 A;  4CHS A;  3F4R A;  3H1N A;  5ECO B;  4HU7 A;  2HT9 A;  4I6X A;  1TXX A;  4MF6 A;  2YWO A;  2LRC A;  4DSS B;  5DBQ A;  1NSW A;  4DSR A;  5D73 A;  3DKS A;  2VL9 A;  2EIR A;  4EXJ A;  4A5P A;  2C0D A;  2PER A;  4JU5 A;  2KP2 A;  4G2E A;  1MD4 A;  1TP9 A;  2YWI A;  3KD0 A;  5ECL B;  3HKR A;  2OBI A;  3LEF A;  2DC5 A;  4MJB A;  12GS A;  2C3T A;  3FR3 A;  5D8I A;  1WIK A;  2LTK A;  1XW9 A;  2B3S A;  2REM A;  5GAP D;  2H0G A;  2IJY A;  1B9X C;  2ON7 A;  2R0C A;  4O5U A;  1DE2 A;  1XPV A;  3W8S A;  4KUN A;  3WGD A;  4KB3 A;  4HJ2 A;  1OYJ A;  1PKZ A;  3HXS A;  5KOX A;  5IOX A;  5J3R A;  2VOC A;  5ECK B;  2DJ2 A;  5L71 A;  3ZFL A;  2IMD A;  2GZP A;  4AKX B;  5A5H A;  1VF2 A;  5ECS A;  2HSM B;  1PL1 A;  1GLP A;  3CXG A;  1AQW A;  1H4O A;  3LW9 A;  4FH8 A;  4CY8 A;  5IMA A;  1A0R P;  1FHE A;  4MDC A;  1EWX A;  3TKS E;  1YF1 A;  1JZD A;  3GIX A;  2LRN A;  3GSS A;  4KE3 A;  1SU9 A;  3TJG A;  2B5E A;  1T4Y A;  2M80 A;  4I2U A;  5AIS A;  4L5O A;  4BWQ A;  2JZT A;  4G01 A;  5ID2 A;  2YCD A;  4MPF A;  3TRQ A;  1AUC A;  2AAW A;  5CP1 A;  2A2R A;  3VLN A;  5G5E A;  1WWJ A;  2A4H A;  5C04 A;  1YJ6 A;  3TJF A;  3MWH A;  3FHK A;  2H0I A;  4XRD A;  3BD2 A;  1F6M C;  3HJM A;  1M9B A;  4WBJ A;  3DWV A;  3TKP A;  1O8X A;  1PFO A;  1K0M A;  1YDK A;  1PD2 1;  2LUS A;  1A2L A;  1BAY A;  2QSI A;  4KW6 A;  3F3Q A;  5KN1 A;  3LQ7 A;  5HR2 A;  1KTE A;  5IMC A;  3ISO A;  4OWY A;  2HNL A;  4TRX A;  3EMX A;  2HSY A;  1XFL A;  1Z9H A;  2O7K A;  1TU7 A;  3WYW A;  3KCM A;  4F2I A;  4MF5 A;  1GTU A;  2QA2 A;  6GSV A;  3GTU A;  5A4V A;  4HSC X;  2LS5 A;  1BYE A;  3F0I A;  6GSX A;  1TRU A;  2O85 A;  4BWS A;  4NV5 A;  2CZ3 A;  1Q4J A;  4PI2 C;  1S3D A;  2O36 A;  4P3Y B;  4TR1 A;  3ZRD A;  2H8L A;  4O5R A;  1U87 A;  4G19 A;  2VCT A;  3RPP A;  2B1L A;  1WPI A;  2WW3 A;  1K0B A;  2PN8 A;  5COH A;  2GZZ A;  4KND A;  3TJB A;  3HY2 A;  3KXO A;  2F8F A;  2JZS A;  1GTB A;  3IOS A;  2NVL A;  3TKS C;  1J0F A;  5HFK A;  3EMP A;  3RPN A;  2PBJ A;  2O8V B;  4JE1 A;  1FVK A;  5ECR B;  3FZA A;  3QPM A;  2WGR A;  1BJX A;  1SKW B;  2V6K A;  5HFI A;  2EFH A;  1UC7 A;  1ILO A;  4BVY B;  4KDY A;  1X5C A;  4F0B A;  4EUY A;  3O6T A;  4GSS A;  1OC9 B;  4HQZ A;  2HFD A;  2YZU A;  2HRA A;  3APS A;  1UA5 A;  2YOI A;  4JR4 A;  1WRY A;  4D73 A;  5JWO B;  2WVX A;  1JHB A;  3GUR A;  3IAS 2;  3N5O A;  3GL3 A;  2VL3 A;  4JBB A;  2R0P A;  2VM1 A;  2IMK A;  2EIO A;  1R5A A;  2ES7 A;  2ZNM A;  4K7I A;  1HYU A;  4IGJ A;  4E68 A;  3CSI A;  2B1K A;  3WT1 A;  4BPY A;  1OKT A;  4K2D A;  4V2N A;  4TXO B;  4AKG A;  1RW1 A;  1YY7 A;  1FO5 A;  2OT3 A;  1JLW A;  5A4U A;  5DQY A;  2HQT A;  2VUP A;  1USB A;  2E7P A;  3ZL5 A;  1B4Q A;  4MPG A;  1ZCP A;  3EU3 A;  4ICY A;  5BRT A;  1EEJ A;  5KN2 A;  1CQG A;  3ZTL A;  2VCZ A;  2FGX A;  2WW2 A;  2C1Y A;  2P0G A;  4BIK A;  3C8E A;  2RM5 A;  3UVT A;  4MH3 A;  5DJL A;  5AN1 A;  3RHB A;  1RK4 A;  3LGC A;  4K1F A;  8GSS A;  1V98 A;  1QMV A;  1SVM A;  2C0G A;  1J9B A;  4EDY A;  4XIH A;  3GH6 A;  19GS A;  3CHX C;  4OFM A;  3ERG A;  4OO5 A;  5INY A;  4DSS A;  5F05 A;  4KH7 A;  5IMD A;  2WVY A;  2LJA A;  1T7P B;  1F3B A;  2B7J A;  2YWM A;  1OC8 A;  3D5J A;  4Z2R A;  1TI3 A;  1I1I P;  2LST A;  3APO A;  2DSA A;  5J5N A;  1VF4 A;  2C3Q A;  1TJD A;  3TKQ A;  1EP7 A;  5B8A A;  1SKS B;  2QA1 A;  5DDL A;  2DJ0 A;  2P5Q A;  2JU5 A;  1SJZ A;  2FCH A;  4ZL8 A;  1ERU A;  3L0H A;  1SJ6 A;  2O3E A;  4V2M A;  3I9V 2;  2L6D A;  4EVM A;  2LQQ A;  3QDN A;  1PKW A;  4E8H A;  1SEN A;  2WRT A;  3GFK A;  4PX1 A;  5CRG A;  1M9A A;  4PQI A;  3U5R E;  2HSM A;  2KP1 A;  5FHI A;  2DKI A;  2YN1 A;  1WP0 A;  2YPM A;  1SD9 A;  6GSU A;  4MZW A;  1PRX A;  5A1N B;  4ZBB A;  3O76 A;  1T4Z A;  1U6T A;  3ERW A;  2WZ9 A;  4ZBA A;  3GV1 A;  3Q19 A;  1AXD A;  4ISD A;  4ECB A;  4RUV A;  5BMU B;  3AY8 A;  3ZVJ A;  1SVL A;  3EE2 A;  2WW0 A;  3VWX A;  2ON5 A;  2H75 A;  3HVX A;  2MMA A;  2R2J A;  2F9S A;  5IPH A;  2FWG A;  2GLR A;  3IK9 A;  5DJM A;  4BA7 A;  5E59 A;  3DGQ A;  2FWF A;  4HU9 A;  4MJA A;  4YAV A;  2F3M A;  2HI7 A;  2DJ1 A;  1EP8 A;  1CQH A;  3IPZ A;  2H76 A;  3GX8 A;  3RGB C;  4WF4 A;  4NHZ A;  1QXH A;  3GMF A;  2H70 A;  4GLT A;  1A2J A;  1O8W A;  5CRD A;  1EEM A;  4L8E A;  3HYP A;  1EV4 A;  2R4V A;  3TJK A;  2RII A;  4USS A;  3SBC A;  2CX4 A;  3RBT A;  3RFR C;  2ALB A;  4MZC A;  4HOJ A;  2HSN B;  2OAC A;  1JLV A;  1Z5Y E;  3WT2 A;  2AJQ B;  2LQO A;  3E0U A;  3HCZ A;  3P2A A;  4WR4 A;  2HE3 A;  1SK1 A;  2H66 A;  2H1D A;  3IAM 2;  1XWA A;  1EV9 A;  4YH2 A;  1ZYQ B;  1DUG A;  4EL1 A;  3Q74 A;  3HZ4 A;  1C72 A;  2XBQ A;  4AJ8 A;  4N0V A;  2V41 A;  1Z6N A;  3PPU A;  2GQL A;  2V6O A;  3BCI A;  1THX A;  3EVI A;  3PIN A;  4IEL A;  5A5K A;  4GCI A;  4ILF A;  1SL1 B;  1HNB A;  1M0U A;  4AJ7 A;  1MTC A;  2BMX A;  2X49 A;  2CZ2 A;  5IO0 A;  5J4U A;  1G0T A;  1TRV A;  4ZXG A;  3HD5 A;  5A34 B;  4OFN A;  1O85 A;  2E2G A;  2I1U A;  2DKH A;  2GSS A;  4MH2 A;  1B48 A;  1YEW C;  3F63 A;  4MCU A;  4J57 E;  4RI6 A;  2O87 A;  2C0F A;  3TGZ A;  4AKH A;  4HEA 2;  3D0Z A;  5KN3 A;  4IKH A;  3ZRE A;  1N8J A;  1SK2 A;  3ZZX A;  2I81 A;  1KEB A;  1O7U A;  2NDO A;  4WXT A;  1W89 A;  4BVY A;  5IQY A;  3HDC A;  5D9X A;  1ZOF A;  3CMI A;  4HJM A;  4IQA A;  2CAQ A;  1OC9 A;  3APQ A;  1AIU A;  2OBK A;  4K6X A;  5G1K A;  3QAV A;  2MMZ A;  2OAD A;  1HQO A;  4FO5 A;  2VCQ A;  14GS A;  2K6V A;  3TRP A;  4O32 A;  3UMA A;  5J40 A;  1QFN A;  1MEK A;  2MYG A;  4MZB A;  2B5Y A;  1ZL9 A;  3RDW A;  2P5R A;  5AIX A;  4RI7 A;  3FEU A;  1QGV A;  2H6Z A;  4K7O A;  1AAZ A;  3R3E A;  2HRK B;  2N5F A;  3IR4 A;  3VFI A;  1ON4 A;  5CRE A;  2UZ8 A;  2EC4 A;  1KBN A;  1T8E B;  2H73 A;  4DVC A;  4FXY P;  2MMN A;  1GUM A;  1YEP A;  1V57 A;  3TJJ A;  3EWL A;  3H93 A;  3J7Y b;  2OE3 A;  2VD0 A;  1V40 A;  3LYK A;  1JFU A;  2RUF A;  1ZMA A;  1JZO A;  5EY6 A;  3GL5 A;  1VGL A;  1X5E A;  2PMT A;  1NW2 A;  3EC3 A;  3O3T A;  3GH9 A;  4IN0 A;  2VIM A;  3FZ4 A;  3M0F A;  3KTB A;  3PH9 A;  4E8E A;  3ME7 A;  2H6Y A;  1DE1 A;  2HYX A;  3PR8 A;  4OO4 A;  2MMO A;  4K5S A;  3UOM A;  3KIJ A;  4BL7 B;  1SYX A;  1BF5 A;  1GWC A;  11GS A;  2AV4 A;  2H72 A;  4IW9 A;  2WUL A;  5B6M A;  3E3E A;  3TU3 B;  2F51 A;  4F82 A;  4WET A;  4O5Q A;  3IRA A;  3S9F A;  2FY6 A;  3HZ8 A;  2GSQ A;  1PN9 A;  5G30 A;  4TW5 A;  3LXT A;  5EPF A;  3H79 A;  1XWC A;  1SK0 A;  1GSU A;  3C73 A;  3G7I A;  1QK8 A;  3CTG A;  2LKU A;  4K0N A;  3GKK A;  1HNC A;  2H1L A;  2YV9 A;  3TCO A;  1DBY A;  4AI6 A;  2OJL A;  17GS A;  2RLI A;  4ECC A;  3DML A;  2R0G A;  1XBS A;  4TR0 A;  2H74 A;  1JZR A;  2X8H A;  4NXI A;  2LNS A;  3QCP A;  2X8G A;  4YAP A;  5GAN D;  2C0E A;  1XCC A;  1EGR A;  2MBT A;  1Z6M A;  4ZB6 A;  1S4B P;  1WJK A;  1TTZ A;  4V1A g;  2VL2 A;  4XS6 A;  3ZLP A;  4KF9 A;  3BCK A;  2B7K A;  1WOU A;  3ERF A;  4AKI A;  4GWR A;  3C1S A;  2RUE A;  3KTL A;  2I4A A;  3EIN A;  3Q6O A;  1J08 A;  2C8U A;  5A1N A;  1DSB A;  4KSO A;  2DMM A;  2WVZ A;  1IYI A;  2H19 A;  2FUG 2;  2YJ7 A;  5FT3 A;  1ZZY A;  3HVN A;  3F6D A;  1YQ1 A;  3KJY A;  5GZZ B;  3ED3 A;  1GTI A;  3TDG A;  2H1A A;  3CSH A;  5BMU A;  4XS4 B;  5JWQ B;  5ECN B;  3D6I A;  1GRX A;  4X4J A;  4KDU A;  3F3R A;  4IBP A;  2H01 A;  4JED A;  3ZML A;  3CYN A;  1Y6E A;  1M3J A;  2GQK A;  4QMK A;  3FKF A;  4Q5N A;  3ZIJ A;  3GA4 A;  3PGT A;  3LFL A;  2KLX A;  2D2Z A;  2VCX A;  2NPB A;  4TXV A;  1OE8 A;  4FYC A;  1X9M B;  1BED A;  3J7Y k;  4CY6 A;  1OAZ A;  3GX0 A;  2FA4 A;  2HSN A;  4YKF A;  2ZCT A;  2FA8 A;  1XG8 A;  3LG6 A;  5DQS A;  4H86 A;  3RHC A;  4PNG A;  4GST A;  5AGY A;  3F4S A;  3ME8 A;  4HUA A;  3L9V A;  2NTO A;  5GST A;  3L78 A;  1NHY A;  4I2T A;  4K8M A;  4J56 E;  1FOH A;  5IMZ A;  3F8U A;  5IMV A;  3UBL A;  3DXB A;  2RM6 A;  3LSZ A;  4X0X A;  1BQ7 A;  1Y1U A;  5DVB A;  5A5H B;  1A2M A;  2JSZ A;  2WCI A;  5DAL B;  3IDV A;  1OVN A;  5A34 A;  3IC4 A;  3P8W A;  1PL2 A;  5IMF A;  1U3I A;  2E0Q A;  1OC3 A;  5F07 A;  2GDR A;  2OA7 A;  1Z7R A;  4V2L A;  5ECI B;  3A5W A;  3GRX A;  3MDK A;  3ZIV A;  5E4W A;  1X0R A;  3HMJ G;  1FVJ A;  1FW1 A;  2IWT A;  1T3B A;  5LNK e;  16GS A;  2WFC A;  3CRU A;  5G31 A;  5IIZ A;  2GST A;  3KZQ A; 
#chains in the Genus database with same CATH homology
 4KCA A;  3UVH A;  4K5R A;  4ZL7 A;  2VCV A;  1OKD A;  2A2P A;  2V2G A;  2EFE A;  3LJR A;  3NIV A;  2CVD A;  1TRS A;  2HZF A;  1BX9 A;  4HZ4 A;  4QL9 A;  2IN3 A;  2G0F A;  5HR0 A;  2WS2 A;  4PNF A;  4XCS A;  2J23 A;  3GKM A;  4RQR A;  2CQ9 A;  2FHE A;  1XWB A;  4XTS A;  5DAK B;  2TIR A;  2XPD A;  5J9B A;  1FOV A;  1O73 A;  4MLY A;  3LOR A;  1AW9 A;  2JL4 A;  3V1W A;  4N3Z A;  2L4C A;  2HRK A;  1K0N A;  4JRR A;  3GTU B;  1N25 A;  4HQS A;  1I9D A;  3GYK A;  3US3 A;  2IMI A;  3CRT A;  1PA3 A;  4X43 A;  1YZX A;  3GUS A;  2AUV A;  4MK3 A;  2B6M A;  1GNE A;  4POB A;  3W6G A;  4Q5F A;  4G9H A;  1GSD A;  1XOA A;  1GNW A;  2HSH A;  2VLV A;  4FYU A;  4G10 A;  3MSZ A;  4N0Z A;  3CWG A;  4KA0 A;  2F8A A;  4TKY A;  4LMV A;  1ABA A;  1GUH A;  4EF0 A;  1EOH A;  2Z9S A;  2CT6 A;  4N11 A;  3QAG A;  4PUF C;  1GSF A;  3U6V A;  1MDI A;  1HNA A;  3ZVJ D;  1K0C A;  2K8S A;  2IL3 A;  5B7C A;  1B9Y C;  2C3N A;  5C00 A;  5KEJ A;  2HRN A;  20GS A;  3G7Y A;  4I5Q A;  2R5G A;  1H75 A;  2H1G A;  2X99 A;  2R3X A;  1TKD B;  4POM A;  2IMF A;  4YKG A;  3KMO A;  2DJK A;  1XWK A;  2GS3 A;  2OE0 A;  4W66 A;  3FZ9 A;  4TR4 A;  2C80 A;  3KMN A;  3VWU A;  4ACS A;  4EE0 A;  4MJE A;  1TK0 B;  4HI7 A;  2QC7 A;  5F8B A;  2AYT A;  2YNX A;  4G0I A;  4PXO A;  1XIY A;  4D73 B;  3CSJ A;  3CTF A;  2LJK A;  5CAX A;  3I43 A;  1GSQ A;  1AQX A;  3UL3 A;  4AF2 A;  2GGT A;  1OE7 A;  4J2F A;  5H5Q A;  2FD3 A;  1URM A;  1U3A A;  3F9U A;  1F9M A;  2B5X A;  18GS A;  4G0L A;  4NV2 A;  2ZUP A;  1QQ2 A;  3KH9 A;  5D96 A;  4QL7 A;  4XS1 A;  1T00 A;  3TKS A;  3DEX A;  4PQ1 A;  3IBH A;  5JWR B;  1ZYN A;  4IVF A;  5J41 A;  5J4Y A;  1K3O A;  2FNO A;  4EO3 A;  3A3T A;  2IIY A;  1B8X A;  2EIQ A;  4NHW A;  5J9C A;  1GSS A;  4JR6 A;  1ERT A;  2QKE A;  4MA9 A;  1XOB A;  4MMM A;  3NOF A;  6GSY A;  3DD3 A;  2R37 A;  1M7T A;  3QD9 A;  1YVL A;  3FW2 A;  3LWA A;  1TDI A;  4OFT A;  2L4Q A;  3KGK A;  2NBS A;  2KHP A;  4V1A p;  2IME A;  3D4M A;  1PN0 A;  4PGT A;  1EOG A;  5IOW A;  1YEX A;  1VRS D;  2GTU A;  4DEJ A;  1GUK A;  4EIQ A;  3H8Q A;  3WD6 A;  1M99 A;  1GUL A;  3I6A A;  4YQV A;  2OE1 A;  3UEM A;  3D21 A;  2VKZ G;  1Y25 A;  3I69 A;  3ZFB A;  1EGO A;  3M1G A;  2XHF A;  2KOK A;  4ML6 A;  2IFQ B;  1MDK A;  5DCH A;  2YAN A;  10GS A;  3ZIT A;  2VLT A;  4X1U A;  3Q18 A;  4GSN A;  3UJ1 A;  5ECH B;  3L4N A;  2FWH A;  4L0W A;  1R4W A;  1I5G A;  2GT5 A;  4PTS A;  4TXO A;  3IV4 A;  2DJ3 A;  4ZL9 A;  3GST A;  1TW9 A;  6GSW A;  2MBS A;  5ECQ B;  5HR3 A;  2HZE B;  4KAE A;  3F6F A;  1W4V A;  2V32 A;  3UAR A;  4IHU A;  2H0H A;  3W8J A;  6GST A;  2PWJ A;  3BBY A;  2VAF A;  2CV4 A;  5ENU A;  1ZGN A;  1TI1 A;  1KNG A;  3FY7 A;  4GTU A;  4TR3 A;  1A24 A;  5IO2 A;  2WDU A;  1R5P A;  1UVZ A;  1SKR B;  4IQ1 A;  2DJJ A;  3MNG A;  4K9Z A;  1M2A A;  3UBK A;  3DRN A;  2CVK A;  3GKN A;  2VD1 A;  4O92 A;  1ACV A;  3P90 A;  1GP1 A;  2VM2 A;  1K0O A;  4POL A;  5DAL A;  2HRF A;  1XZO A;  1R26 A;  2JAD A;  5JCG A;  3VI5 A;  2FWE A;  3BOA A;  4LA1 A;  1TOF A;  2L5L A;  5ABR A;  2O89 A;  3QAW A;  2JAC A;  4NWY A;  3IHG A;  3DVX A;  2GVP A;  3TOT A;  2LRT A;  2GZY A;  4GXZ A;  1GSE A;  2M46 A;  3IXR A;  5LD0 A;  4ZBD A;  2UV8 G;  3IHQ A;  1GLQ A;  2EFD A;  4IP6 A;  2H30 A;  3EUR A;  3JCM L;  2CVB A;  3IK7 A;  2H71 A;  1PQN A;  5A4W A;  1PGT A;  4QQ7 A;  4MAB A;  4XRA A;  3GKX A;  1PMT A;  1K0A A;  4LL1 B;  1A23 A;  2LNT A;  2PUK C;  2X4A A;  3D4T A;  1A8Y A;  1NHO A;  2X8C A;  5CRH A;  2AB6 A;  3F4T A;  1TU8 A;  3MIX A;  3UAP A;  1A8L A;  2K9F A;  1YKC A;  4OCF A;  1WMJ A;  2VO4 A;  2YZH A;  3OR5 A;  5DAK A;  1TXU A;  4BVX B;  2DML A;  3KM6 A;  1JZW A;  1O6J A;  3M9J A;  2GT6 A;  4F0C A;  3HHV A;  2CAI A;  4OD7 A;  2QGV A;  1RQM A;  3HA9 A;  2LEG A;  3M8N A;  4I97 A;  2P31 A;  2H1B A;  4EDZ A;  3VPQ A;  2G2Q A;  5ECP B;  3VWW A;  1LBK A;  4IS0 A;  4GDF A;  3CBU A;  4LMW A;  3SWL A;  3FK8 A;  2FLS A;  1E2Y A;  3TRX A;  5CYY A;  4ZIL A;  4KDX A;  3A2V A;  4O7H A;  1THO A;  4K7N A;  1X5D A;  1X9S B;  4L5L A;  1AQV A;  4F9Z A;  3EU4 A;  4OCE A;  2PU9 C;  3QOU A;  1PX7 A;  2PPT A;  4CDO A;  1AC1 A;  4EKZ A;  7GSS A;  1TK5 B;  3TUE A;  3KP8 A;  3R2Q A;  3C71 A;  5KOW A;  2I3Y A;  5CO3 A;  5H5S A;  3ZMK A;  2HXK A;  1G6W A;  3ZYW A;  4FQU A;  1O81 A;  4RQX A;  1TRW A;  3DVW A;  4PUA A;  5HQP A;  2C4J A;  2XC2 A;  3C1R A;  3HVV A;  2GSR A;  4TOP A;  3FR9 A;  5IPG A;  3WGX A;  3VUR A;  1GTA A;  5D93 A;  5EL8 A;  5D9V A;  4XHM A;  3N9J A;  4Z7X A;  1SL2 B;  3A2W A;  1E6B A;  5ECM B;  2E2M A;  1K0D A;  4WF5 A;  4HS1 A;  1BG5 A;  1FG4 A;  5B6N A;  3HJP A;  2VLU A;  3FRC A;  3G9B A;  3LXZ A;  3K8N A;  3G7J A;  1YF0 A;  1M2D A;  2KUC A;  1IYH A;  3WGE A;  2LV3 A;  2N5A A;  2DIY A;  1K3Y A;  3L9S A;  3M9K A;  2PVO C;  5KN0 A;  1F2E A;  3KH7 A;  1ZYP A;  3FYG A;  1B4P A;  1R7H A;  4Z2T A;  1Q98 A;  5JCU A;  4WR5 A;  3E9J B;  1S3C A;  3LYP A;  5ELA A;  2L57 A;  3RAZ A;  4ID0 A;  4KGI A;  1SVO A;  3DYR A;  3VPT A;  5F0G A;  4ZB8 A;  4GF0 A;  2O5V A;  5EVO A;  1GH2 A;  2YWN A;  3A2X A;  2MZC A;  5ID2 B;  1SL0 B;  1EZK A;  3QMX A;  5F06 A;  2AHE A;  2DLX A;  2GQM A;  4OMV A;  4TVE A;  5G5F A;  2LJR A;  2JZR A;  1F37 A;  4ML1 A;  3D22 A;  1WE0 A;  4N10 A;  1BG1 A;  4WKW A;  1X9W B;  1N2A A;  13GS A;  1V58 A;  2IFQ A;  5G2Z A;  3FR6 A;  4ZB9 A;  3C7M A;  4PQH A;  2M72 A;  4G0K A;  4LL4 B;  3UIW A;  4Q5Q A;  3BJ5 A;  3KP9 A;  2YP6 A;  4IJI A;  3MYD A;  5H5R A;  4EIP A;  1ERV A;  1QUW A;  5B8B A;  1S3A A;  1FB0 A;  4IJ3 A;  1G6Y A;  2HZE A;  4EC0 A;  2DIZ A;  3NZN A;  2A2S A;  2WJU A;  1VF1 A;  5CRW A;  3EPT A;  2EFC A;  1XW5 A;  2WB9 A;  1Z3E A;  3H4K A;  1LJR A;  5AIV A;  1XVW A;  5J47 A;  2K8V A;  4WEY A;  4ECJ A;  3HVS A;  4TN8 A;  1TK8 B;  1GSY A;  1G7E A;  4TR1 B;  4ZIJ A;  5ELG A;  1T1V A;  1XXU A;  1ZYE A;  2TRC P;  4HDE A;  4AJ6 A;  6GSS A;  3GHA A;  4DSQ A;  1ERW A;  4KCE A;  2HLS A;  3TOU A;  4MNN A;  2L5O A;  3QFA C;  4Q5R A;  5HR1 A;  3L9U A;  5HFG A;  4KX4 A;  2L6C A;  4ZB7 A;  1A0F A;  1SJI A;  3MAK A;  5JCW A;  2XBI A;  4NMU A;  1NM3 A;  1V2A A;  1XW6 A;  4MP4 A;  3KEB A;  1PX6 A;  1VF3 A;  2BJX A;  4KSM A;  3FMW A;  4K2X A;  4HZ2 A;  4GRF A;  3IE3 A;  2XPE A;  5G1L A;  3DIE A;  4BL7 A;  5GSS A;  2VL2 C;  1Z7P A;  2R6K A;  1V9W A;  2I9H A;  2YV7 A;  4K0G A;  4AGS A;  2OKA A;  5DCG A;  5D9W A;  1YKA A;  1PSQ A;  2PVQ A;  2PGT A;  1F3A A;  5D9T A;  2K18 A;  5CNW A;  2J9H A;  2JSY A;  3GN3 A;  3QFB C;  4FYB A;  3IA1 A;  1ML6 A;  3GNJ A;  3FZ5 A;  1HD2 A;  5J4V A;  4I8B A;  1LU4 A;  4NAX A;  1MDJ A;  2L59 A;  4ULX A;  4WBR D;  3TKR A;  4BVX A;  4GQF A;  4Z2U A;  4F03 A;  2IPA A;  2N5B A;  2VCW A;  5LCZ A;  4YQM A;  2V1M A;  3P7X A;  4POK A;  2YJH A;  1FB6 A;  1K3L A;  2BTO T;  4L0U A;  5IM9 A;  4N30 A;  1FAA A;  4MJC A;  1MD3 A;  4PUR A;  22GS A;  3EYT A;  1GL8 A;  4MF7 A;  1M2B A;  3VWV A;  1ST9 A;  2TRX A;  2CX3 A;  4ECI A;  3QR6 A;  3VK9 A;  1XWG A;  3TB2 A;  2X64 A;  5FWG A;  4XS4 A;  1UN2 A;  3HJO A;  3IC8 A;  1G7O A;  4NPB A;  1SYR A;  3M3M A;  4CW9 A;  2A4V A;  4JZQ A;  2H6X A;  1SD8 A;  4IP1 A;  2DBC A;  4GQC A;  1XVQ A;  3A5I A;  2CA8 A;  4YQU A;  1U88 A;  4FIW A;  9GSS A;  4LLR A;  3VI7 A;  4CHS A;  3F4R A;  3H1N A;  5ECO B;  4HU7 A;  2HT9 A;  4I6X A;  1TXX A;  4MF6 A;  2YWO A;  2LRC A;  4DSS B;  5DBQ A;  1NSW A;  4DSR A;  5D73 A;  3DKS A;  2VL9 A;  2EIR A;  4EXJ A;  4A5P A;  2C0D A;  2PER A;  4JU5 A;  2KP2 A;  4G2E A;  1MD4 A;  1TP9 A;  2YWI A;  3KD0 A;  5ECL B;  3HKR A;  2OBI A;  3LEF A;  2DC5 A;  4MJB A;  12GS A;  2C3T A;  3FR3 A;  5D8I A;  1WIK A;  2LTK A;  1XW9 A;  2B3S A;  2REM A;  5GAP D;  2H0G A;  2IJY A;  1B9X C;  2ON7 A;  2R0C A;  4O5U A;  1DE2 A;  1XPV A;  3W8S A;  4KUN A;  3WGD A;  4KB3 A;  4HJ2 A;  1OYJ A;  1PKZ A;  3HXS A;  5KOX A;  5IOX A;  5J3R A;  2VOC A;  5ECK B;  2DJ2 A;  5L71 A;  3ZFL A;  2IMD A;  2GZP A;  4AKX B;  5A5H A;  1VF2 A;  5ECS A;  2HSM B;  1PL1 A;  1GLP A;  3CXG A;  1AQW A;  1H4O A;  3LW9 A;  4FH8 A;  4CY8 A;  5IMA A;  1A0R P;  1FHE A;  4MDC A;  1EWX A;  3TKS E;  1YF1 A;  1JZD A;  3GIX A;  2LRN A;  3GSS A;  4KE3 A;  1SU9 A;  3TJG A;  2B5E A;  1T4Y A;  2M80 A;  4I2U A;  5AIS A;  4L5O A;  4BWQ A;  2JZT A;  4G01 A;  5ID2 A;  2YCD A;  4MPF A;  3TRQ A;  1AUC A;  2AAW A;  5CP1 A;  2A2R A;  3VLN A;  5G5E A;  1WWJ A;  2A4H A;  5C04 A;  1YJ6 A;  3TJF A;  3MWH A;  3FHK A;  2H0I A;  4XRD A;  3BD2 A;  1F6M C;  3HJM A;  1M9B A;  4WBJ A;  3DWV A;  3TKP A;  1O8X A;  1K0M A;  1YDK A;  1PD2 1;  2LUS A;  1A2L A;  1BAY A;  2QSI A;  4KW6 A;  3F3Q A;  5KN1 A;  3LQ7 A;  5HR2 A;  1KTE A;  5IMC A;  3ISO A;  4OWY A;  2HNL A;  4TRX A;  3EMX A;  2HSY A;  1XFL A;  1Z9H A;  2O7K A;  1TU7 A;  3WYW A;  3KCM A;  4F2I A;  4MF5 A;  1GTU A;  2QA2 A;  6GSV A;  3GTU A;  5A4V A;  2LS5 A;  1BYE A;  3F0I A;  6GSX A;  1TRU A;  2O85 A;  4BWS A;  4NV5 A;  2CZ3 A;  1Q4J A;  1S3D A;  4P3Y B;  4TR1 A;  3ZRD A;  2H8L A;  4O5R A;  1U87 A;  4G19 A;  2VCT A;  3RPP A;  2B1L A;  1WPI A;  1K0B A;  2PN8 A;  5COH A;  2GZZ A;  4KND A;  3TJB A;  3HY2 A;  3KXO A;  2F8F A;  2JZS A;  1GTB A;  3IOS A;  2NVL A;  3TKS C;  1J0F A;  5HFK A;  3EMP A;  3RPN A;  2PBJ A;  2O8V B;  4JE1 A;  1FVK A;  5ECR B;  3FZA A;  3QPM A;  2WGR A;  1BJX A;  1SKW B;  2V6K A;  5HFI A;  2EFH A;  1UC7 A;  1ILO A;  4BVY B;  4KDY A;  1X5C A;  4F0B A;  4EUY A;  3O6T A;  4GSS A;  1OC9 B;  4HQZ A;  2HFD A;  2YZU A;  2HRA A;  3APS A;  1UA5 A;  2YOI A;  4JR4 A;  1WRY A;  4D73 A;  5JWO B;  1JHB A;  3GUR A;  3IAS 2;  3N5O A;  3GL3 A;  2VL3 A;  4JBB A;  2R0P A;  2VM1 A;  2IMK A;  2EIO A;  1R5A A;  2ES7 A;  2ZNM A;  4K7I A;  1HYU A;  4IGJ A;  4E68 A;  3CSI A;  2B1K A;  3WT1 A;  4BPY A;  1OKT A;  4K2D A;  4V2N A;  4TXO B;  4AKG A;  1RW1 A;  1YY7 A;  1FO5 A;  2OT3 A;  1JLW A;  5A4U A;  5DQY A;  2HQT A;  2VUP A;  1USB A;  2E7P A;  3ZL5 A;  1B4Q A;  4MPG A;  1ZCP A;  3EU3 A;  4ICY A;  5BRT A;  1EEJ A;  5KN2 A;  1CQG A;  3ZTL A;  2VCZ A;  2FGX A;  2C1Y A;  2P0G A;  3C8E A;  2RM5 A;  3UVT A;  4MH3 A;  5DJL A;  5AN1 A;  3RHB A;  1RK4 A;  3LGC A;  4K1F A;  8GSS A;  1V98 A;  1QMV A;  1SVM A;  2C0G A;  1J9B A;  4EDY A;  4XIH A;  3GH6 A;  19GS A;  4OFM A;  3ERG A;  4OO5 A;  5INY A;  4DSS A;  5F05 A;  4KH7 A;  5IMD A;  2LJA A;  1T7P B;  1F3B A;  2B7J A;  2YWM A;  1OC8 A;  3D5J A;  4Z2R A;  1TI3 A;  2LST A;  3APO A;  2DSA A;  5J5N A;  1VF4 A;  2C3Q A;  1TJD A;  3TKQ A;  1EP7 A;  5B8A A;  1SKS B;  2QA1 A;  5DDL A;  2DJ0 A;  2P5Q A;  2JU5 A;  1SJZ A;  2FCH A;  4ZL8 A;  1ERU A;  3L0H A;  1SJ6 A;  4V2M A;  3I9V 2;  2L6D A;  4EVM A;  2LQQ A;  3QDN A;  1PKW A;  4E8H A;  1SEN A;  2WRT A;  3GFK A;  4PX1 A;  5CRG A;  1M9A A;  4PQI A;  3U5R E;  2HSM A;  2KP1 A;  5FHI A;  2DKI A;  2YN1 A;  1WP0 A;  2YPM A;  1SD9 A;  6GSU A;  4MZW A;  1PRX A;  5A1N B;  4ZBB A;  3O76 A;  1T4Z A;  1U6T A;  3ERW A;  2WZ9 A;  4ZBA A;  3GV1 A;  3Q19 A;  1AXD A;  4ISD A;  4ECB A;  4RUV A;  5BMU B;  3AY8 A;  3ZVJ A;  1SVL A;  3EE2 A;  3VWX A;  2ON5 A;  2H75 A;  3HVX A;  2MMA A;  2R2J A;  2F9S A;  5IPH A;  2FWG A;  2GLR A;  3IK9 A;  5DJM A;  4BA7 A;  5E59 A;  3DGQ A;  2FWF A;  4HU9 A;  4MJA A;  4YAV A;  2F3M A;  2HI7 A;  2DJ1 A;  1EP8 A;  1CQH A;  3IPZ A;  2H76 A;  3GX8 A;  4WF4 A;  4NHZ A;  1QXH A;  3GMF A;  2H70 A;  4GLT A;  1A2J A;  1O8W A;  5CRD A;  1EEM A;  4L8E A;  3HYP A;  1EV4 A;  2R4V A;  3TJK A;  2RII A;  4USS A;  3SBC A;  2CX4 A;  3RBT A;  2ALB A;  4MZC A;  4HOJ A;  2HSN B;  2OAC A;  1JLV A;  1Z5Y E;  3WT2 A;  2AJQ B;  2LQO A;  3E0U A;  3HCZ A;  3P2A A;  4WR4 A;  2HE3 A;  1SK1 A;  2H66 A;  2H1D A;  3IAM 2;  1XWA A;  1EV9 A;  4YH2 A;  1ZYQ B;  1DUG A;  4EL1 A;  3Q74 A;  3HZ4 A;  1C72 A;  2XBQ A;  4AJ8 A;  4N0V A;  2V41 A;  1Z6N A;  3PPU A;  2GQL A;  2V6O A;  3BCI A;  1THX A;  3EVI A;  3PIN A;  4IEL A;  5A5K A;  4GCI A;  4ILF A;  1SL1 B;  1HNB A;  1M0U A;  4AJ7 A;  1MTC A;  2BMX A;  2X49 A;  2CZ2 A;  5IO0 A;  5J4U A;  1G0T A;  1TRV A;  4ZXG A;  3HD5 A;  5A34 B;  4OFN A;  1O85 A;  2E2G A;  2I1U A;  2DKH A;  2GSS A;  4MH2 A;  1B48 A;  3F63 A;  4MCU A;  4J57 E;  4RI6 A;  2O87 A;  2C0F A;  3TGZ A;  4AKH A;  4HEA 2;  3D0Z A;  5KN3 A;  4IKH A;  3ZRE A;  1N8J A;  1SK2 A;  3ZZX A;  2I81 A;  1KEB A;  1O7U A;  2NDO A;  4WXT A;  1W89 A;  4BVY A;  5IQY A;  3HDC A;  5D9X A;  1ZOF A;  3CMI A;  4HJM A;  4IQA A;  2CAQ A;  1OC9 A;  3APQ A;  1AIU A;  2OBK A;  4K6X A;  5G1K A;  3QAV A;  2MMZ A;  2OAD A;  1HQO A;  4FO5 A;  2VCQ A;  14GS A;  2K6V A;  3TRP A;  4O32 A;  3UMA A;  5J40 A;  1QFN A;  1MEK A;  2MYG A;  4MZB A;  2B5Y A;  1ZL9 A;  3RDW A;  2P5R A;  5AIX A;  4RI7 A;  3FEU A;  1QGV A;  2H6Z A;  4K7O A;  1AAZ A;  3R3E A;  2HRK B;  2N5F A;  3IR4 A;  3VFI A;  1ON4 A;  5CRE A;  2UZ8 A;  2EC4 A;  1KBN A;  1T8E B;  2H73 A;  4DVC A;  2MMN A;  1GUM A;  1YEP A;  1V57 A;  3TJJ A;  3EWL A;  3H93 A;  3J7Y b;  2OE3 A;  2VD0 A;  1V40 A;  3LYK A;  1JFU A;  2RUF A;  1ZMA A;  1JZO A;  5EY6 A;  3GL5 A;  1VGL A;  1X5E A;  2PMT A;  1NW2 A;  3EC3 A;  3O3T A;  3GH9 A;  4IN0 A;  2VIM A;  3FZ4 A;  3M0F A;  3KTB A;  3PH9 A;  4E8E A;  3ME7 A;  2H6Y A;  1DE1 A;  2HYX A;  3PR8 A;  4OO4 A;  2MMO A;  4K5S A;  3UOM A;  3KIJ A;  4BL7 B;  1SYX A;  1BF5 A;  1GWC A;  11GS A;  2AV4 A;  2H72 A;  4IW9 A;  2WUL A;  5B6M A;  3E3E A;  3TU3 B;  2F51 A;  4F82 A;  4WET A;  4O5Q A;  3IRA A;  3S9F A;  2FY6 A;  3HZ8 A;  2GSQ A;  1PN9 A;  5G30 A;  4TW5 A;  3LXT A;  5EPF A;  3H79 A;  1XWC A;  1SK0 A;  1GSU A;  3C73 A;  3G7I A;  1QK8 A;  3CTG A;  2LKU A;  4K0N A;  3GKK A;  1HNC A;  2H1L A;  2YV9 A;  3TCO A;  1DBY A;  4AI6 A;  2OJL A;  17GS A;  2RLI A;  4ECC A;  3DML A;  2R0G A;  1XBS A;  4TR0 A;  2H74 A;  1JZR A;  2X8H A;  4NXI A;  2LNS A;  3QCP A;  2X8G A;  4YAP A;  5GAN D;  2C0E A;  1XCC A;  1EGR A;  2MBT A;  1Z6M A;  4ZB6 A;  1WJK A;  1TTZ A;  4V1A g;  2VL2 A;  4XS6 A;  3ZLP A;  4KF9 A;  3BCK A;  2B7K A;  1WOU A;  3ERF A;  4AKI A;  4GWR A;  3C1S A;  2RUE A;  3KTL A;  2I4A A;  3EIN A;  3Q6O A;  1J08 A;  2C8U A;  5A1N A;  1DSB A;  4KSO A;  2DMM A;  1IYI A;  2H19 A;  2FUG 2;  2YJ7 A;  5FT3 A;  1ZZY A;  3F6D A;  1YQ1 A;  3KJY A;  5GZZ B;  3ED3 A;  1GTI A;  3TDG A;  2H1A A;  3CSH A;  5BMU A;  4XS4 B;  5JWQ B;  5ECN B;  3D6I A;  1GRX A;  4X4J A;  4KDU A;  3F3R A;  4IBP A;  2H01 A;  4JED A;  3ZML A;  3CYN A;  1Y6E A;  2GQK A;  4QMK A;  3FKF A;  4Q5N A;  3ZIJ A;  3GA4 A;  3PGT A;  3LFL A;  2KLX A;  2D2Z A;  2VCX A;  2NPB A;  4TXV A;  1OE8 A;  4FYC A;  1X9M B;  1BED A;  3J7Y k;  4CY6 A;  1OAZ A;  3GX0 A;  2FA4 A;  2HSN A;  4YKF A;  2ZCT A;  2FA8 A;  3LG6 A;  5DQS A;  4H86 A;  3RHC A;  4PNG A;  4GST A;  5AGY A;  3F4S A;  3ME8 A;  4HUA A;  3L9V A;  2NTO A;  5GST A;  3L78 A;  1NHY A;  4I2T A;  4K8M A;  4J56 E;  1FOH A;  5IMZ A;  3F8U A;  5IMV A;  3UBL A;  3DXB A;  2RM6 A;  3LSZ A;  4X0X A;  1BQ7 A;  1Y1U A;  5DVB A;  5A5H B;  1A2M A;  2JSZ A;  2WCI A;  5DAL B;  3IDV A;  1OVN A;  5A34 A;  3IC4 A;  3P8W A;  1PL2 A;  5IMF A;  1U3I A;  2E0Q A;  1OC3 A;  5F07 A;  2GDR A;  2OA7 A;  1Z7R A;  4V2L A;  5ECI B;  3A5W A;  3GRX A;  3MDK A;  3ZIV A;  5E4W A;  1X0R A;  3HMJ G;  1FVJ A;  1FW1 A;  2IWT A;  1T3B A;  5LNK e;  16GS A;  2WFC A;  3CRU A;  5G31 A;  5IIZ A;  2GST A;  3KZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...