4L8EA

Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
203
structure length
203
Chain Sequence
IDLYYAPTPNGYKITLFLEEVGLPYTIHPIDISAGDQFKPEFLAIAPNNKIPAIVDHQPDGGGEAISIFESGAILLYLANKTGRFLSKDTRERTEQLQWLFWQVAGFGPMLGQNHHFNRYAPEVVPYAIKRYTEESQRLYKVLNTQLEKTPYLGGNEYSIADIAVYPWAKCYEHQKINLEDYPAVKKWLEKIQQRPATQAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase enzyme with thioredoxin-like domai
publication title Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
rcsb
source organism Xenorhabdus nematophila
molecule tags Transferase
total genus 76
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4l8eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4l8eA01
1HD2A 4K0GA 3VWWA 2H19A 2WDUA 2NBSA 14GSA 1Y25A 4I8BA 2VL2C 2LQOA 1ZCPA 1FHEA 2B3SA 2GS3A 1T1VA 2VLTA 3QAWA 4DEJA 4G0KA 1OAZA 1TOFA 5HQPA 5GSTA 1H4OA 2QC7A 4TXOA 1R26A 2L4QA 1AXDA 3DVWA 4WBJA 3HYPA 3L9UA 3FR9A 3I69A 2REMA 3A2VA 5AIVA 5J5NA 3TKRA 1BJXA 2DC5A 3NOFA 1PSQA 1GSYA 4I2UA 2GZPA 1XW5A 4EC0A 1A0RP 4POLA 2FCHA 3TCOA 1PD21 4ISDA 2O85A 2LJKA 4XS4A 1T4ZA 3RAZA 1XZOA 4V1Ap 3I9V2 4G0IA 2KOKA 4TR4A 2YNXA 2PERA 4JE1A 3O76A 5G2ZA 1UA5A 1SK0A 2HRAA 5COHA 4IJIA 2VUPA 3QDNA 3WGDA 1KNGA 3CBUA 1TXXA 4XIHA 4F9ZA 2HRKA 3EU3A 3FR3A 3TRPA 5A4VA 3UBLA 3QOUA 2HNLA 1XWAA 2FGXA 1S3CA 2IJYA 4I6XA 5A4UA 3U6VA 5KEJA 4MF6A 3MDKA 5D8IA 2JZRA 3QFBC 4KH7A 3P7XA 3M9JA 3UL3A 1XWCA 4GF0A 4PNFA 4LA1A 4WF5A 2H1AA 2H75A 4PNGA 2GZYA 5ECPB 4FYCA 3GX0A 2IMEA 4XHMA 5DJLA 1URMA 1DE2A 4AGSA 4KCEA 1XFLA 4KAEA 2VAFA 2VLVA 1EGOA 4KSMA 2BTOT 4PQHA 1M7TA 1K3OA 1XWKA 2G2QA 2WCIA 2KP2A 3TKSE 3VFIA 4JU5A 5GAPD 1K0DA 2TRCP 2KLXA 4WBRD 4ILFA 5CNWA 1XIYA 1LU4A 2YV9A 3ZIJA 4EDZA 4LLRA 2VCZA 3M3MA 4HU9A 5G5EA 4EE0A 4O32A 1OC8A 1ZL9A 1WOUA 3F3QA 1J0FA 2IL3A 2FA4A 1SK2A 3ZLPA 3ZTLA 4IGJA 2FLSA 1OE7A 3ZFBA 1X0RA 2AUVA 3F4TA 3APOA 2E7PA 1AUCA 4O5RA 3TRXA 4WEYA 1DBYA 3ERWA 2F51A 3MSZA 2K6VA 1MDIA 4AJ7A 4MDCA 3UMAA 2ZCTA 3IPZA 2XBIA 4K1FA 5EPFA 1WE0A 3DD3A 1ZZYA 4IBPA 3M9KA 1OYJA 1ML6A 2B1LA 3VURA 2HSMA 4POBA 3IC8A 1TI1A 1AQVA 4Q5QA 2KHPA 2PBJA 3CTGA 4TR1B 2WZ9A 4MZCA 2H0IA 1ZYQB 2L5OA 5B7CA 1TW9A 1B9YC 3QAVA 2RM6A 5HFIA 2LTKA 3KP8A 3ZFLA 3KGKA 16GSA 5JCUA 3FHKA 3C7MA 4I97A 3BD2A 3EE2A 1K0NA 3LQ7A 3ERGA 2CVKA 4TW5A 2C3QA 2GVPA 1SYXA 1PRXA 3VK9A 2IPAA 4TXVA 1TDIA 1Z5YE 3GTUB 6GSSA 3IK7A 1OC3A 2DIYA 4XCSA 4N0VA 1UN2A 2YZHA 4V2NA 4HJMA 2DMLA 3EC3A 3ZRDA 2K8SA 2CX4A 4KB3A 2V32A 1ERVA 2PN8A 1PKWA 2O8VB 2CVDA 4RI7A 3IRAA 3K8NA 2VIMA 1QUWA 4WF4A 2E2GA 1Y6EA 1B4QA 2L6DA 2C0EA 3FZAA 4MMMA 4HQZA 2H73A 2DJ0A 3HZ8A 4BVYA 2C8UA 4N30A 2L5LA 3H79A 1I5GA 1Z7RA 2JSYA 2ZUPA 4FQUA 4GLTA 3M0FA 2L59A 5DVBA 1YEPA 6GSXA 1KTEA 1BYEA 5ECKB 4MJBA 4EVMA 3D0ZA 3F4RA 1GNEA 4X1UA 5LNKe 3LXTA 2CQ9A 2FA8A 4ECBA 1O73A 2L57A 3R2QA 1JFUA 4OWYA 4USSA 1V57A 2YJHA 3FKFA 1T8EB 4PQ1A 4ML6A 3J7Yb 2MMZA 4KDYA 17GSA 2AHEA 4KDXA 4RI6A 5H5RA 3HJMA 3TJGA 3C73A 2MMOA 1U3IA 2JACA 1MDKA 2FWEA 1XWBA 1Q98A 4AF2A 2OADA 5HR2A 1O85A 2LRNA 3DWVA 3LWAA 3G7IA 4NHZA 4YQMA 3UBKA 1SJIA 1XPVA 4E8EA 3A2WA 2IFQA 5JCGA 4ZBDA 5B8BA 4F03A 3MNGA 1XBSA 4YAPA 1IYIA 1FB0A 1W4VA 4ML1A 2OBKA 4MK3A 3N9JA 5D73A 3GH6A 4HZ4A 5J41A 3TKPA 5JWQB 4XRAA 3D4MA 1DE1A 1GNWA 3D5JA 2WJUA 3RPPA 2AV4A 1V2AA 1A2MA 5J3RA 1V40A 5DALB 1F9MA 1GUKA 3GH9A 5ECRB 1NHOA 3HJPA 3DIEA 2ON7A 1F6MC 2H6XA 1GLPA 2P5RA 1EWXA 3TDGA 4IN0A 4KUNA 4HEA2 4WR5A 2E2MA 2FWGA 2PGTA 3Q19A 4CW9A 4ZL8A 2YANA 4Q5RA 1TRUA 4IS0A 2X8GA 1MEKA 2RM5A 3DKSA 2KP1A 2DJJA 11GSA 1SKWB 2VLUA 3RPNA 4IQAA 4RQRA 3F3RA 1TU8A 4OMVA 5JCWA 2K9FA 3DGQA 1AQXA 1BX9A 2VL9A 3W8SA 4F82A 5IOWA 2DJ3A 3NIVA 1I9DA 2HLSA 3I6AA 3LFLA 5J4UA 1GSSA 2IMIA 1NW2A 2RUFA 4NV2A 4GWRA 1MD4A 3EYTA 4D73A 1MDJA 3GA4A 4MZWA 2O7KA 5CP1A 1FOVA 2VD0A 3E0UA 2JADA 4MH3A 2HRFA 2PVQA 3A3TA 4IKHA 3WD6A 1FAAA 5D9WA 1OC9A 3GIXA 2IMKA 4K7IA 5AN1A 3GL5A 4KE3A 3HD5A 2B7KA 3GNJA 4GQFA 1H75A 1ABAA 2K8VA 5FHIA 2N5FA 5DAKB 2E0QA 2GSTA 2JZTA 1K0BA 3CSJA 3L0HA 5ENUA 5G1LA 4GRFA 2I1UA 2AAWA 1G7EA 3CSHA 1CQGA 3RDWA 2LQQA 2H1BA 4BL7B 1NM3A 1PQNA 1RW1A 4MCUA 4ZL9A 3CXGA 4K7OA 1Z9HA 5ECQB 1GTAA 3TOUA 1WWJA 4HDEA 3TOTA 4BVXB 4JEDA 4ULXA 2TIRA 4TVEA 2VM1A 1PKZA 5D96A 5ECHB 1GSQA 1X9SB 2H72A 3KH9A 3RHCA 5IPHA 3TJJA 2K18A 3PINA 5IMZA 2I4AA 5ELAA 1IYHA 3LGCA 1X5EA 4JZQA 1BG5A 3TKQA 5B8AA 4I5QA 3KM6A 5EL8A 10GSA 3LEFA 4MP4A 4NXIA 4EUYA 2WULA 3IHQA 1WJKA 4WETA 3EU4A 3WGEA 1NHYA 4IVFA 1BQ7A 4PXOA 1A8LA 4OCEA 3KIJA 1EOHA 1G6WA 4CDOA 4NV5A 4PURA 3EVIA 3IXRA 4MJAA 1O81A 4JR6A 2H6YA 1XCCA 3GRXA 2WB9A 1U6TA 1EV4A 3DEXA 3F0IA 2XHFA 5IO2A 2H71A 2DJ1A 2UZ8A 2HFDA 4L8EA 4RQXA 1TI3A 3D6IA 3ZITA 3GSSA 4YH2A 2ZNMA 2IMFA 1M2AA 3W8JA 1TK8B 4GTUA 1PMTA 5BMUA 3UVHA 3KMNA 2HSHA 3L4NA 4ZBBA 12GSA 2H30A 4JR4A 13GSA 3LG6A 5G30A 4MLYA 5GZZB 4AJ8A 2A2SA 5ECLB 2H0HA 2PU9C 1A8YA 5JWOB 5ECMB 2NVLA 4JBBA 4EKZA 1TK5B 3CRTA 2WS2A 4ZL7A 3I43A 5A4WA 4WR4A 5LD0A 2X99A 4IQ1A 1SENA 4OO4A 4X43A 3ED3A 1EP7A 4J2FA 5CRGA 2C3TA 2HE3A 1TKDB 3ZREA 3IE3A 2CX3A 5F8BA 1AIUA 2PMTA 5GAND 1PL1A 3J7Yk 5B6MA 1GP1A 4OFTA 4HZ2A 1EP8A 1THXA 5ECOB 1GWCA 2OE3A 5IOXA 5ECSA 3E3EA 4Q5NA 3GV1A 1PA3A 3H8QA 3A2XA 2DSAA 1G0TA 2GQLA 5F06A 4TR1A 3G7YA 1M9BA 3LJRA 3ZZXA 2L6CA 2GTUA 2JL4A 4QQ7A 5DCHA 5F07A 3LSZA 4EL1A 4MJCA 4F0BA 3RBTA 3WT2A 1GLQA 1USBA 3C1SA 3IAM2 1R7HA 3TUEA 6GSYA 1SK1A 3FK8A 3VWUA 2LRTA 3VI7A 3HVVA 4IJ3A 3GTUA 4LMWA 2H8LA 1FO5A 4PTSA 1X9WB 2R3XA 4Q5FA 4YQVA 2KUCA 1GSUA 2R2JA 2H6ZA 2XC2A 1VGLA 3HY2A 3HJOA 2B7JA 4E8HA 2EC4A 2ON5A 2MMAA 4DSSB 3PR8A 2MMNA 1QQ2A 1THOA 3UEMA 2F8FA 2HYXA 4J57E 5FT3A 3JCML 5CRDA 3ME7A 5D93A 5CO3A 1SU9A 3FR6A 4O7HA 2EIQA 5AISA 2QKEA 1R5PA 4TOPA 1T7PB 1SYRA 1M2BA 3GFKA 1E6BA 2GSRA 1DUGA 5EY6A 2B5YA 4PGTA 2XPDA 2C3NA 1SL0B 4QL7A 5IIZA 2EIOA 1EGRA 2VO4A 5B6NA 3KZQA 1U3AA 2MZCA 1T00A 5L71A 3QPMA 2OE0A 2I3YA 4KCAA 4GXZA 3APQA 4G10A 3HCZA 4YQUA 4MJEA 3KP9A 2HRNA 5IMFA 1O8XA 1R4WA 3DMLA 2R5GA 3C8EA 2FD3A 3GUSA 4PUAA 2H1DA 4HUAA 5F05A 2HQTA 1A2LA 2FHEA 3IR4A 2YWIA 3UIWA 5CAXA 3Q74A 2CVBA 4BWSA 5C00A 1ERUA 2YOIA 3IC4A 3M8NA 4Z7XA 2VD1A 1V58A 1ST9A 3WYWA 3BJ5A 1TP9A 3HDCA 4L0WA 2LJRA 2O89A 1GTBA 2HZEB 4G0LA 3HKRA 3UJ1A 4IP6A 4BA7A 2M72A 2J23A 4ACSA 1F3AA 2AYTA 5IMAA 5DQYA 2F9SA 4JRRA 3HZ4A 2X8HA 2GSSA 3GN3A 2GDRA 1JLVA 7GSSA 2NTOA 4HOJA 4ZB6A 4FYUA 5HR3A 3VPTA 4F2IA 1CQHA 4J56E 1TJDA 2QGVA 1M99A 1O6JA 2VL3A 1JLWA 1Q4JA 1AQWA 3DXBA 3HA9A 1V98A 5C04A 2XBQA 2R6KA 2GGTA 3IOSA 1U87A 4K8MA 3WGXA 5DALA 3CSIA 2QSIA 3W6GA 1OVNA 3F8UA 1Z7PA 2DIZA 4NWYA 3KD0A 1QK8A 5KN2A 2P0GA 4MZBA 3KTLA 2GQKA 4POKA 1M9AA 2CA8A 3L9VA 3HXSA 3ME8A 2D2ZA 4TKYA 4ID0A 1ZMAA 5ID2B 3UOMA 5A5KA 1B8XA 3LYPA 1MTCA 2HXKA 1HYUA 2CAIA 3D21A 3KXOA 1ZGNA 3FW2A 4F0CA 1M0UA 4DVCA 1O8WA 1QXHA 4L5OA 3UVTA 3LORA 2GT5A 4KNDA 4DSRA 2G0FA 2OACA 3CMIA 2P5QA 1KEBA 2C1YA 1BAYA 1PX7A 4MPFA 1K0OA 3M1GA 2H70A 1ZYEA 1YKAA 1WP0A 4FIWA 4TN8A 1W89A 1EV9A 2LSTA 3WT1A 1GUHA 3KH7A 2V2GA 1B4PA 1GSEA 3F4SA 1AAZA 3DYRA 2HI7A 2X8CA 3GKNA 4IP1A 4X0XA 1YZXA 3MWHA 3DRNA 1TRVA 3ZMLA 1X5DA 4FH8A 1FW1A 2GLRA 2R4VA 1U88A 1SKRB 1GL8A 2MYGA 2NDOA 2PUKC 1PL2A 1Z6MA 2LUSA 2B5EA 5JWRB 2LEGA 1A2JA 5ECNB 5DAKA 2V1MA 5IPGA 2VCTA 4TR0A 5CRWA 1ON4A 3MAKA 2JU5A 1XW9A 1RK4A 3S9FA 2C0DA 3F6FA 4PQIA 4BL7A 3GKMA 1BEDA 1OKTA 1EEJA 8GSSA 2LNTA 22GSA 2BJXA 3ZIVA 2MBSA 4BVXA 1C72A 5IMDA 3CTFA 2M80A 1VRSD 1JZWA 2C4JA 1A24A 1XOBA 4OFNA 2VM2A 4HU7A 5G1KA 4ZIJA 5DJMA 3APSA 1HNBA 2XPEA 2BMXA 3PGTA 4KW6A 1AW9A 4GSNA 1N2AA 1GUMA 1S3AA 4K7NA 4TXOB 1GSDA 1QMVA 1YF1A 2AB6A 5J9CA 5CYYA 3FY7A 3BOAA 4ZB8A 1VF2A 4N11A 2DLXA 3H4KA 1XOAA 5ABRA 3VPQA 1YKCA 1Z6NA 4V1Ag 2GZZA 2YWOA 4RUVA 2F3MA 3KEBA 2H1GA 5DCGA 1UVZA 2HZFA 2R37A 1ZOFA 2FWFA 3FZ4A 4XS4B 2PPTA 4OO5A 4K9ZA 4V2LA 3EWLA 1HNCA 3QD9A 2A4VA 4XRDA 4I2TA 4XS6A 3FRCA 1EEMA 1EZKA 2HRKB 4ECCA 5D9TA 4HI7A 2LKUA 1K0AA 1QGVA 2VCVA 5HFGA 1YDKA 3IK9A 1N8JA 1J08A 4N10A 4QL9A 4MH2A 2VCWA 1B9XC 4KX4A 2V41A 3GYKA 3SWLA 4PUFC 2LJAA 5KN1A 1GTIA 3UAPA 2M46A 2CZ3A 2OKAA 5D9XA 3TKSA 5ECIB 3Q6OA 4GSTA 1YEXA 2LNSA 2RLIA 2X64A 1WPIA 2I81A 4NMUA 3V1WA 1GSFA 1SJZA 4ZBAA 4KSOA 1TRSA 3TRQA 1Z3EA 4XS1A 3BCIA 3EMPA 5F0GA 3D4TA 3C71A 3BCKA 1SD9A 1JZDA 1GULA 2N5AA 2PVOC 4CHSA 1A0FA 2WRTA 1DSBA 3TJFA 3QAGA 3ZL5A 3EINA 1T3BA 2RUEA 4EO3A 4L0UA 1YJ6A 3L9SA 4WKWA 2CAQA 2VL2A 1VF4A 4XTSA 1TK0B 4OD7A 2YN1A 1F2EA 2N5BA 2GSQA 5IMVA 4FO5A 5HR0A 20GSA 4MF5A 4BWQA 1KBNA 4PX1A 3O6TA 2ES7A 1WIKA 4ZILA 4O92A 3QCPA 2IMDA 3KTBA 2H01A 3C1RA 5J9BA 2JZSA 1ILOA 6GSTA 1XW6A 1O7UA 1F37A 3QFAC 4KDUA 2Z9SA 5KN0A 3NZNA 4HJ2A 3TJBA 2YZUA 1M2DA 5LCZA 1FVKA 1XXUA 2HSMB 4NHWA 1VF3A 3GSTA 3CYNA 3A5WA 3GKXA 2GT6A 3GKKA 3F9UA 5IMCA 1X9MB 4MF7A 1OE8A 3QR6A 1V9WA 1B48A 3VLNA 1E2YA 2IWTA 4DSSA 2FY6A 3CRUA 1QFNA 3L78A 2F8AA 2C0FA 1PN9A 1PX6A 2B5XA 2P31A 3QMXA 4IHUA 1HQOA 4OCFA 4DSQA 4K2DA 3P8WA 3SBCA 1MD3A 2RIIA 2B6MA 4K6XA 4ECJA 1X5CA 2YPMA 5DDLA 3E9JB 3P90A 5CREA 3G7JA 2B1KA 1GTUA 3KCMA 4KA0A 3GMFA 1XWGA 4MABA 5KN3A 3PPUA 1AC1A 1ERWA 1K3LA 2VOCA 4AJ6A 4NPBA 1G7OA 2YV7A 5DQSA 1JZRA 5G5FA 4KF9A 1OKDA 3KMOA 3HVSA 2HSNB 4BVYB 1UC7A 5IM9A 3TGZA 2EIRA 2C0GA 4K0NA 2DMMA 3BBYA 3KJYA 2DJ2A 6GSVA 4L5LA 2V6OA 9GSSA 5INYA 1ERTA 2I9HA 4GQCA 6GSUA 3IV4A 3FEUA 4NAXA 5G31A 1GRXA 3UARA 5AGYA 1A23A 2GQMA 2PWJA 1PGTA 1FVJA 4GSSA 2H66A 2HZEA 5HR1A 3IDVA 2LS5A 4ZB9A 1SL1B 5FWGA 4FYBA 1F3BA 2YP6A 4V2MA 3GL3A 5GSSA 4G2EA 1TRWA 2AJQB 3ZVJA 3D22A 2H74A 2LV3A 2OBIA 4POMA 2FWHA 4YAVA 2DBCA 3IAS2 1SL2B 4P3YB 18GSA 4ECIA 2NPBA 4BPYA 1ACVA 4EDYA 5ELGA 2FNOA 5E4WA 2ALBA 2IN3A 1TU7A 3TB2A 1LJRA 4EF0A 1VF1A 3P2AA 4LL4B 1HNAA 3ERFA 3IBHA 4ZXGA 4TR3A 2IFQB 2O87A 1K0MA 2CZ2A 4IELA 5AIXA 2WFCA 2YWMA 3AY8A 3H1NA 4OFMA 3TJKA 3GX8A 1JZOA 2OA7A 4GCIA 1GH2A 3HVXA 3US3A 1SD8A 2C80A 5IQYA 1WRYA 1FG4A 2L4CA 5ID2A 3N5OA 4HS1A 5D9VA 2CT6A 1K3YA 4IW9A 4TRXA 3R3EA 1XVWA 3PH9A 3FYGA 2OJLA 3OR5A 5HFKA 2YWNA 2HT9A 3ZVJD 4H86A 4WXTA 1FB6A 5H5SA 2YCDA 1YY7A 1WMJA 3RHBA 2YJ7A 3EURA 4LL1B 3GHAA 4HQSA 1JHBA 1RQMA 3VI5A 1NSWA 5CRHA 4MA9A 2CV4A 6GSWA 4G9HA 1YQ1A 5IO0A 2WGRA 1LBKA 3F6DA 2MBTA 4N0ZA 1S3DA 3IA1A 2VCQA 2FUG2 1SJ6A 5EVOA 3HHVA 5H5QA 1TTZA 19GSA 2H76A 3O3TA 1J9BA 3ZYWA 3VWVA 2DJKA 4EXJA 2OE1A 1G6YA 3Q18A 4MPGA 4LMVA 3DVXA 3G9BA 4D73B 2V6KA 1K0CA 1R5AA 1EOGA 3FZ9A 1YF0A 4KGIA 3LXZA 1SKSB 3TKSC 3EMXA 3F63A 3VWXA 2VCXA 2LRCA 4G19A 2A2RA 3U5RE 1T4YA 2IIYA 2H0GA 5DBQA 2TRXA 2JSZA 2J9HA 3LYKA 1OC9B 3FZ5A 3ISOA 3GURA 3H93A 5E59A 1XVQA 2HSYA 3ZMKA
chains in the Genus database with same CATH superfamily
1HD2A 4K0GA 3VWWA 2H19A 2WDUA 2NBSA 14GSA 1Y25A 4I8BA 2VL2C 2LQOA 1ZCPA 1FHEA 2B3SA 2GS3A 1T1VA 2VLTA 3QAWA 4DEJA 4G0KA 1OAZA 1TOFA 5HQPA 5GSTA 1H4OA 2QC7A 4TXOA 1R26A 2L4QA 1AXDA 3DVWA 4WBJA 3HYPA 3L9UA 3FR9A 3I69A 2REMA 3A2VA 5AIVA 5J5NA 3TKRA 1BJXA 2DC5A 3NOFA 1PSQA 1GSYA 4I2UA 2GZPA 1XW5A 4EC0A 1A0RP 4POLA 2FCHA 3TCOA 1Y1UA 1PD21 4ISDA 2O85A 2LJKA 4XS4A 1T4ZA 3RAZA 1XZOA 4V1Ap 3I9V2 4G0IA 2KOKA 4TR4A 2YNXA 2PERA 4JE1A 3O76A 5G2ZA 1UA5A 4AKIA 1SK0A 2QA2A 2HRAA 5COHA 4IJIA 2VUPA 3QDNA 3WGDA 1KNGA 3CBUA 1TXXA 4XIHA 4F9ZA 5J4VA 2HRKA 3EU3A 3FR3A 4EIPA 3TRPA 5A4VA 3UBLA 3QOUA 2HNLA 1XWAA 2FGXA 1S3CA 2IJYA 4I6XA 5A4UA 3U6VA 5KEJA 4MF6A 3MDKA 5D8IA 2JZRA 3QFBC 4KH7A 3P7XA 2H1LA 3M9JA 3UL3A 1XWCA 4GF0A 4PNFA 4LA1A 4WF5A 2H1AA 2H75A 4PNGA 2GZYA 5ECPB 4FYCA 3GX0A 2IMEA 4XHMA 5DJLA 1URMA 1DE2A 4AGSA 4KCEA 1XFLA 4KAEA 2VAFA 2VLVA 1EGOA 4KSMA 2BTOT 4PQHA 4K5RA 1M7TA 1K3OA 1XWKA 2G2QA 2WCIA 2R0PA 2KP2A 3TKSE 5BMUB 4JU5A 3VFIA 5GAPD 1K0DA 2TRCP 2KLXA 4WBRD 4ILFA 5CNWA 1XIYA 1LU4A 2YV9A 3ZIJA 4EDZA 4LLRA 2VCZA 3FMWA 3M3MA 4HU9A 2EFDA 5G5EA 4EE0A 4O32A 1OC8A 1ZL9A 4ZB7A 1WOUA 3F3QA 1J0FA 2IL3A 2FA4A 1SK2A 3ZLPA 3ZTLA 4IGJA 2FLSA 1OE7A 3ZFBA 1X0RA 2AUVA 3F4TA 3APOA 2E7PA 1AUCA 4O5RA 4O5QA 3TRXA 4WEYA 1DBYA 3ERWA 2F51A 3MSZA 2K6VA 1MDIA 4AJ7A 4MDCA 3UMAA 2ZCTA 3IPZA 5A1NA 2OT3A 2XBIA 4K1FA 5EPFA 1WE0A 2WW3A 3DD3A 1ZZYA 4IBPA 3M9KA 1OYJA 1ML6A 2B1LA 3VURA 2HSMA 4POBA 3IC8A 1TI1A 1AQVA 4Q5QA 2KHPA 2PBJA 3CTGA 4TR1B 2WZ9A 4MZCA 5A5HA 2H0IA 1ZYQB 2L5OA 5B7CA 1TW9A 1B9YC 3QAVA 2RM6A 5HFIA 2LTKA 3KP8A 3ZFLA 3KGKA 3FHKA 16GSA 5JCUA 3HMJG 2DKIA 4I97A 3BD2A 3C7MA 3EE2A 1K0NA 3A5IA 3LQ7A 3ERGA 2CVKA 4TW5A 2C3QA 2GVPA 1SYXA 1PRXA 3VK9A 2IPAA 4TXVA 1TDIA 1Z5YE 3GTUB 6GSSA 3IK7A 1OC3A 2DIYA 4XCSA 4N0VA 1UN2A 2YZHA 4V2NA 4HJMA 2DMLA 3EC3A 3ZRDA 2K8SA 2CX4A 4KB3A 2V32A 1ERVA 2PN8A 1PKWA 2O8VB 2CVDA 4RI7A 3IRAA 3K8NA 2VIMA 1QUWA 4WF4A 2E2GA 1Y6EA 1B4QA 4AKGA 3HVNA 2L6DA 2C0EA 3FZAA 4MMMA 4HQZA 2H73A 2HSNA 2DJ0A 3HZ8A 4BVYA 2C8UA 4N30A 2L5LA 3H79A 1I5GA 1Z7RA 2JSYA 2ZUPA 4FQUA 4GLTA 3M0FA 2L59A 5DVBA 1YEPA 6GSXA 1KTEA 1BYEA 4PHZC 5ECKB 4MJBA 4EVMA 3D0ZA 3F4RA 1GNEA 4X1UA 5LNKe 3LXTA 2CQ9A 2FA8A 4ECBA 1O73A 2L57A 3R2QA 1JFUA 4OWYA 4USSA 1V57A 2YJHA 3FKFA 1T8EB 4PQ1A 4ML6A 3J7Yb 2MMZA 4KDYA 17GSA 2AHEA 4KDXA 4RI6A 5H5RA 3HJMA 3TJGA 3C73A 2MMOA 1U3IA 2JACA 1MDKA 2FWEA 1XWBA 1Q98A 4AF2A 2OADA 5HR2A 1O85A 2LRNA 3DWVA 3LWAA 3G7IA 4NHZA 4YQMA 3UBKA 1SJIA 1XPVA 4E8EA 3A2WA 2IFQA 5JCGA 4ZBDA 5B8BA 3MIXA 4F03A 3MNGA 1XBSA 4YAPA 1IYIA 1FB0A 1W4VA 4ML1A 2OBKA 4MK3A 3N9JA 5D73A 3GH6A 4HZ4A 5J41A 3TKPA 5JWQB 1I1IP 4XRAA 3D4MA 1DE1A 1GNWA 3D5JA 2WJUA 3RPPA 2AV4A 1V2AA 1A2MA 5J3RA 1V40A 5DALB 1F9MA 1GUKA 3GH9A 5ECRB 1NHOA 3HJPA 3DIEA 3EPTA 2ON7A 1F6MC 2H6XA 1GLPA 2P5RA 1EWXA 3TDGA 4IN0A 4KUNA 4HEA2 4WR5A 2E2MA 2FWGA 2PGTA 3Q19A 4CW9A 4ZL8A 2YANA 4Q5RA 1TRUA 4YKGA 4IS0A 2X8GA 1MEKA 2RM5A 3DKSA 2KP1A 2DJJA 11GSA 1SKWB 1FOHA 2VLUA 3RPNA 4IQAA 4RQRA 3F3RA 1TU8A 4OMVA 5JCWA 1BG1A 2K9FA 3DGQA 1AQXA 5KOWA 1BX9A 2VL9A 3W8SA 3TU3B 4F82A 5IOWA 2DJ3A 3NIVA 1I9DA 2HLSA 3I6AA 3LFLA 5J4UA 1GSSA 2IMIA 1NW2A 2RUFA 4NV2A 4GWRA 1MD4A 3EYTA 4D73A 4MNNA 1MDJA 3GA4A 4MZWA 1XG8A 2O7KA 5CP1A 1FOVA 2VD0A 3E0UA 2JADA 4MH3A 2HRFA 2PVQA 2WVZA 4G01A 3A3TA 4IKHA 3WD6A 1FAAA 5D9WA 1OC9A 3GIXA 2IMKA 4K7IA 5AN1A 3GL5A 4KE3A 3HD5A 2B7KA 3GNJA 4GQFA 4CY8A 1H75A 1ABAA 2K8VA 5FHIA 2N5FA 5DAKB 2E0QA 2GSTA 2JZTA 1K0BA 3CSJA 3L0HA 2EFHA 5ENUA 5G1LA 4GRFA 2I1UA 2AAWA 1G7EA 3CSHA 5J4YA 1CQGA 3RDWA 2LQQA 2H1BA 4BL7B 1NM3A 1PQNA 1RW1A 4MCUA 4ZL9A 3CXGA 4K7OA 1Z9HA 5ECQB 2DKHA 1GTAA 3TOUA 1WWJA 4HDEA 3TOTA 4BVXB 4JEDA 4ULXA 2TIRA 4TVEA 2VM1A 1PKZA 5D96A 5ECHB 4O5UA 1GSQA 3RGBC 1X9SB 2H72A 3KH9A 3RHCA 5IPHA 4ICYA 3TJJA 2K18A 3PINA 4PI0C 5IMZA 2I4AA 5ELAA 1IYHA 3LGCA 1X5EA 4JZQA 1BG5A 3TKQA 5B8AA 4I5QA 2R0CA 3KM6A 5EL8A 10GSA 3LEFA 4MP4A 4NXIA 4EUYA 2WULA 3IHQA 1WJKA 4WETA 3EU4A 3WGEA 1NHYA 4IVFA 1BQ7A 4PXOA 1A8LA 4OCEA 3KIJA 1EOHA 1G6WA 4CDOA 4NV5A 4PURA 3EVIA 3IXRA 4MJAA 1O81A 2H6YA 4JR6A 1XCCA 5BRTA 3GRXA 2WB9A 1U6TA 1EV4A 3DEXA 3F0IA 2XHFA 5IO2A 2H71A 2DJ1A 3IHGA 2UZ8A 2HFDA 4L8EA 1M3IA 4RQXA 1TI3A 3D6IA 3ZITA 3GSSA 4YH2A 2ZNMA 2IMFA 1M2AA 3W8JA 1TK8B 4GTUA 1PMTA 5BMUA 3UVHA 3KMNA 2HSHA 3L4NA 4ZBBA 12GSA 2H30A 4JR4A 13GSA 3LG6A 5G30A 4MLYA 5GZZB 4AJ8A 2A2SA 5ECLB 2H0HA 2PU9C 1A8YA 5JWOB 5ECMB 2NVLA 4JBBA 4EKZA 1TK5B 2WW2A 3CRTA 2WS2A 4ZL7A 3I43A 5A4WA 4WR4A 4AI6A 5LD0A 2X99A 4IQ1A 1SENA 4OO4A 4X43A 3ED3A 1EP7A 4J2FA 5CRGA 2C3TA 2HE3A 4AKHA 1TKDB 3ZREA 3IE3A 2CX3A 5KOXA 5F8BA 1AIUA 4HSCX 2PMTA 5GAND 1PL1A 3J7Yk 5B6MA 1GP1A 4OFTA 1SVLA 4HZ2A 1EP8A 1THXA 5ECOB 1GWCA 2OE3A 5IOXA 5ECSA 3E3EA 4Q5NA 3GV1A 1PA3A 3H8QA 3A2XA 2DSAA 1G0TA 2GQLA 5F06A 4TR1A 3G7YA 1M9BA 3LJRA 3ZZXA 2L6CA 2GTUA 2JL4A 4QQ7A 5DCHA 5F07A 3LSZA 4EL1A 4MJCA 4F0BA 3RBTA 3WT2A 1GLQA 1USBA 3C1SA 3IAM2 1R7HA 3TUEA 6GSYA 1SK1A 3FK8A 3VWUA 2LRTA 3VI7A 3HVVA 4IJ3A 3GTUA 4LMWA 2H8LA 1FO5A 4PTSA 1X9WB 2R3XA 4Q5FA 4YQVA 2KUCA 1GSUA 2R2JA 2H6ZA 2XC2A 1VGLA 3HY2A 3HJOA 2B7JA 4E8HA 2EC4A 2ON5A 2MMAA 4DSSB 1ZYNA 3PR8A 2MMNA 1QQ2A 1THOA 3UEMA 3RFRC 2F8FA 2HYXA 4J57E 5FT3A 3JCML 5CRDA 3ME7A 4K5SA 5D93A 5CO3A 1SU9A 3FR6A 4O7HA 2EIQA 5AISA 2QKEA 1R5PA 4TOPA 1T7PB 1SYRA 1M2BA 3GFKA 1E6BA 2GSRA 1DUGA 5EY6A 2B5YA 4PGTA 2XPDA 2C3NA 1SL0B 4QL7A 5IIZA 2EIOA 1EGRA 2VO4A 5B6NA 1PN0A 3KZQA 1U3AA 2EFCA 2MZCA 2X4AA 1T00A 5L71A 3QPMA 2OE0A 2I3YA 4KCAA 4GXZA 3APQA 4G10A 3HCZA 4YQUA 4MJEA 3KP9A 2HRNA 5IMFA 1O8XA 1R4WA 3DMLA 2VKZG 2R5GA 3C8EA 2FD3A 3GUSA 4PUAA 2H1DA 4HUAA 5F05A 2HQTA 1A2LA 2FHEA 3IR4A 3CQFA 2YWIA 3UIWA 5CAXA 3Q74A 2CVBA 4BWSA 5C00A 1ERUA 2YOIA 3IC4A 3M8NA 4Z7XA 2VD1A 1V58A 1ST9A 3WYWA 3BJ5A 1TP9A 3HDCA 4L0WA 3CHXC 2LJRA 2O89A 1GTBA 2HZEB 4G0LA 3HKRA 3UJ1A 4IP6A 4BA7A 2M72A 2J23A 4ACSA 1F3AA 2AYTA 5IMAA 1PFOA 5DQYA 2F9SA 4JRRA 3HZ4A 2X8HA 2GSSA 3GN3A 2GDRA 1JLVA 7GSSA 2NTOA 4HOJA 4ZB6A 4FYUA 5HR3A 3VPTA 4F2IA 1BF5A 1CQHA 4J56E 1TJDA 2QGVA 1M99A 1O6JA 2VL3A 1JLWA 1Q4JA 2O36A 1AQWA 3DXBA 3HA9A 1V98A 5C04A 2XBQA 2R6KA 2GGTA 1S4BP 3IOSA 1U87A 4K8MA 3WGXA 5DALA 3CSIA 2O5VA 2QSIA 3W6GA 1OVNA 3F8UA 1Z7PA 2R0GA 2DIZA 4NWYA 3KD0A 1QK8A 5KN2A 2P0GA 4MZBA 3KTLA 2GQKA 4POKA 1M9AA 2CA8A 3L9VA 3HXSA 3ME8A 2D2ZA 4TKYA 4ID0A 1ZMAA 5ID2B 3UOMA 5A5KA 1B8XA 3LYPA 1MTCA 2HXKA 1HYUA 2CAIA 3D21A 3KXOA 1ZGNA 3FW2A 2O3EA 4F0CA 1M0UA 4DVCA 1O8WA 1QXHA 4L5OA 5J40A 3UVTA 3LORA 2GT5A 4KNDA 4DSRA 2G0FA 2OACA 3CMIA 2P5QA 1KEBA 2C1YA 1BAYA 1PX7A 4MPFA 1K0OA 3M1GA 2H70A 4AKXB 1ZYEA 1YKAA 1WP0A 4FIWA 4TN8A 1W89A 1EV9A 2LSTA 3WT1A 1GUHA 3KH7A 4W66A 2V2GA 2WZSA 1B4PA 1GSEA 4X4JA 3F4SA 1AAZA 3DYRA 2HI7A 2X8CA 3GKNA 4IP1A 4X0XA 1YZXA 3MWHA 2WVXB 3DRNA 1TRVA 3ZMLA 1X5DA 4FH8A 5A34B 1FW1A 2GLRA 2R4VA 1U88A 1SKRB 1GL8A 2MYGA 2NDOA 2PUKC 1PL2A 1Z6MA 2WW1A 2LUSA 1S3RA 2B5EA 5JWRB 2LEGA 1A2JA 5ECNB 5DAKA 2V1MA 5IPGA 2VCTA 4TR0A 5CRWA 2X49A 1ON4A 3MAKA 2JU5A 1XW9A 1RK4A 3S9FA 2C0DA 3F6FA 4PQIA 4BL7A 3GKMA 1BEDA 1OKTA 1EEJA 8GSSA 2LNTA 22GSA 2BJXA 3ZIVA 2MBSA 4BVXA 4CY6A 1C72A 5IMDA 4A5PA 2A2PA 3CTFA 2M80A 1VRSD 1JZWA 2C4JA 1A24A 1XOBA 4OFNA 2VM2A 4HU7A 5G1KA 4ZIJA 5DJMA 3APSA 1HNBA 2XPEA 2BMXA 3PGTA 4KW6A 1AW9A 4GSNA 1N2AA 1GUMA 1S3AA 4K7NA 4TXOB 1GSDA 1QMVA 1YF1A 2AB6A 5J9CA 5CYYA 3FY7A 3BOAA 4ZB8A 1VF2A 4N11A 2DLXA 3H4KA 1XOAA 5ABRA 3VPQA 1YKCA 1Z6NA 4V1Ag 4K2XA 2GZZA 2YWOA 4RUVA 2F3MA 3KEBA 2H1GA 5DCGA 1UVZA 2HZFA 2R37A 1ZOFA 2FWFA 3FZ4A 4XS4B 2PPTA 4OO5A 4K9ZA 4V2LA 2UV8G 3EWLA 1HNCA 3QD9A 2A4VA 4XRDA 4I2TA 4XS6A 3FRCA 1EEMA 1EZKA 2HRKB 4ECCA 5D9TA 4HI7A 2LKUA 1K0AA 1QGVA 2VCVA 5HFGA 1YDKA 3IK9A 1N8JA 1J08A 4N10A 4QL9A 4MH2A 2VCWA 1B9XC 4KX4A 2V41A 3GYKA 3SWLA 4PUFC 2LJAA 5KN1A 1GTIA 3UAPA 2M46A 2CZ3A 2OKAA 5D9XA 3TKSA 5ECIB 3Q6OA 4GSTA 1YEXA 2LNSA 2RLIA 2X64A 1WPIA 2I81A 4NMUA 3V1WA 1GSFA 1SJZA 4ZBAA 4KSOA 1TRSA 3TRQA 1Z3EA 4XS1A 1M3JA 3BCIA 3EMPA 5F0GA 3D4TA 4Z2RA 3C71A 3BCKA 1SD9A 1JZDA 1GULA 2N5AA 2PVOC 4CHSA 1A0FA 2WRTA 1DSBA 3TJFA 3QAGA 3ZL5A 3EINA 1T3BA 2RUEA 4EO3A 4L0UA 1YJ6A 3L9SA 4WKWA 2CAQA 2VL2A 1VF4A 4XTSA 1TK0B 4OD7A 2YN1A 3LW9A 1F2EA 2N5BA 2GSQA 5IMVA 4FO5A 5HR0A 20GSA 4MF5A 4BWQA 1KBNA 4PX1A 3O6TA 2ES7A 1WIKA 4ZILA 5J47A 4O92A 3QCPA 2IMDA 3KTBA 2H01A 3C1RA 5J9BA 2JZSA 1ILOA 6GSTA 1XW6A 1O7UA 1TXUA 4FXYP 1F37A 5A1NB 3QFAC 4KDUA 2Z9SA 5KN0A 3NZNA 4HJ2A 3TJBA 2YZUA 1M2DA 5LCZA 1FVKA 1XXUA 2HSMB 4NHWA 1VF3A 3GSTA 3CYNA 3A5WA 3GKXA 4EIQA 2GT6A 5A5HB 3GKKA 3F9UA 5IMCA 1X9MB 4MF7A 1OE8A 3QR6A 1V9WA 1B48A 4QMKA 3VLNA 1E2YA 2IWTA 4DSSA 3MYDA 2FY6A 3CRUA 1QFNA 3L78A 2F8AA 2C0FA 1PN9A 1PX6A 2B5XA 2P31A 3QMXA 4IHUA 1HQOA 4OCFA 4DSQA 4K2DA 3P8WA 3SBCA 1MD3A 2RIIA 4BIKA 2B6MA 4K6XA 1SVOA 4ECJA 1X5CA 2YPMA 5DDLA 3E9JB 3P90A 5CREA 3G7JA 2B1KA 1GTUA 3KCMA 4KA0A 3GMFA 1XWGA 4MABA 5KN3A 3PPUA 1AC1A 1ERWA 1K3LA 2VOCA 1YVLA 4AJ6A 4NPBA 1G7OA 2YV7A 5DQSA 1JZRA 5G5FA 4KF9A 1OKDA 4PI2C 3KMOA 2QA1A 3HVSA 2HSNB 4BVYB 1UC7A 5IM9A 3TGZA 2EIRA 2C0GA 4K0NA 2DMMA 3BBYA 3KJYA 2DJ2A 6GSVA 4L5LA 1SVMA 2V6OA 9GSSA 5INYA 1ERTA 2I9HA 4GQCA 6GSUA 3IV4A 3FEUA 4NAXA 5G31A 1GRXA 3UARA 5AGYA 1A23A 2GQMA 4Z2TA 2PWJA 1PGTA 1FVJA 4GSSA 2H66A 2HZEA 5HR1A 3IDVA 2LS5A 4ZB9A 4N3ZA 1SL1B 5FWGA 4FYBA 2A4HA 1F3BA 2YP6A 4V2MA 3GL3A 5GSSA 4G2EA 1TRWA 2AJQB 3ZVJA 3D22A 2H74A 2LV3A 2OBIA 4POMA 2FWHA 4E68A 4YAVA 2DBCA 3IAS2 1SL2B 3CWGA 4P3YB 18GSA 4ECIA 2NPBA 4BPYA 1ACVA 4EDYA 5ELGA 2FNOA 5E4WA 2ALBA 2IN3A 1TU7A 3TB2A 1LJRA 4EF0A 1VF1A 3P2AA 4LL4B 1HNAA 2EFEA 3ERFA 3IBHA 4ZXGA 1ZYPA 4TR3A 2IFQB 2O87A 1K0MA 2CZ2A 4IELA 5AIXA 2WFCA 2YWMA 3AY8A 3H1NA 4OFMA 3TJKA 3GX8A 1JZOA 2OA7A 4GCIA 1GH2A 3HVXA 3US3A 1SD8A 2C80A 2WW0A 5IQYA 1WRYA 1FG4A 2L4CA 5ID2A 1YEWC 3N5OA 4HS1A 5D9VA 2CT6A 1K3YA 4IW9A 4TRXA 3R3EA 1XVWA 3PH9A 3FYGA 2OJLA 3OR5A 5HFKA 4GDFA 2YWNA 2HT9A 3ZVJD 4H86A 4WXTA 1FB6A 5H5SA 2YCDA 1YY7A 1WMJA 3RHBA 2YJ7A 3EURA 4LL1B 3GHAA 4HQSA 1JHBA 1RQMA 3VI5A 1NSWA 5CRHA 4MA9A 2CV4A 6GSWA 4G9HA 1YQ1A 5IO0A 2WGRA 1LBKA 1N25A 3F6DA 2MBTA 4N0ZA 1S3DA 3IA1A 2VCQA 2FUG2 1SJ6A 5EVOA 3HHVA 5H5QA 1TTZA 19GSA 2H76A 3O3TA 2WVYA 1J9BA 3ZYWA 3VWVA 2WVXA 4Z2UA 2DJKA 4EXJA 5A34A 2OE1A 1G6YA 3Q18A 4MPGA 4LMVA 3DVXA 3G9BA 4YKFA 4D73B 2V6KA 1K0CA 1R5AA 1EOGA 3FZ9A 1YF0A 4KGIA 3LXZA 1SKSB 3TKSC 3EMXA 3F63A 3VWXA 2VCXA 2LRCA 4G19A 2A2RA 3U5RE 1T4YA 2IIYA 2H0GA 5DBQA 2TRXA 2JSZA 2J9HA 3LYKA 1OC9B 3FZ5A 3ISOA 3GURA 3H93A 5E59A 1XVQA 2HSYA 3ZMKA
chains in the Genus database with same CATH topology
1HD2A 4K0GA 3VWWA 2H19A 2WDUA 2NBSA 14GSA 1Y25A 4I8BA 2VL2C 2LQOA 1ZCPA 1FHEA 2B3SA 2GS3A 1T1VA 2VLTA 3QAWA 4DEJA 4G0KA 1OAZA 1TOFA 5HQPA 5GSTA 1H4OA 2QC7A 4TXOA 1R26A 2L4QA 1AXDA 3DVWA 4WBJA 3HYPA 3L9UA 3FR9A 3I69A 2REMA 3A2VA 5AIVA 5J5NA 3TKRA 1BJXA 2DC5A 3NOFA 1PSQA 1GSYA 4I2UA 2GZPA 1XW5A 4EC0A 1A0RP 4POLA 2FCHA 3TCOA 1Y1UA 1PD21 4ISDA 2O85A 2LJKA 4XS4A 1T4ZA 3RAZA 1XZOA 4V1Ap 3I9V2 4G0IA 2KOKA 4TR4A 2YNXA 2PERA 4JE1A 3O76A 5G2ZA 1UA5A 4AKIA 1SK0A 2QA2A 2HRAA 5COHA 4IJIA 2VUPA 3QDNA 3WGDA 1KNGA 3CBUA 1TXXA 4XIHA 4F9ZA 5J4VA 2HRKA 3EU3A 3FR3A 4EIPA 3TRPA 5A4VA 3UBLA 3QOUA 2HNLA 1XWAA 2FGXA 1S3CA 2IJYA 4I6XA 5A4UA 3U6VA 5KEJA 4MF6A 3MDKA 5D8IA 2JZRA 3QFBC 4KH7A 3P7XA 2H1LA 3M9JA 3UL3A 1XWCA 4GF0A 4PNFA 4LA1A 4WF5A 2H1AA 2H75A 4PNGA 2GZYA 5ECPB 4FYCA 3GX0A 2IMEA 4XHMA 5DJLA 1URMA 1DE2A 4AGSA 4KCEA 1XFLA 4KAEA 2VAFA 2VLVA 1EGOA 4KSMA 2BTOT 4PQHA 4K5RA 1M7TA 1K3OA 1XWKA 2G2QA 2WCIA 2R0PA 2KP2A 3TKSE 5BMUB 4JU5A 3VFIA 5GAPD 1K0DA 2TRCP 2KLXA 4WBRD 4ILFA 5CNWA 1XIYA 1LU4A 2YV9A 3ZIJA 4EDZA 4LLRA 2VCZA 3FMWA 3M3MA 4HU9A 2EFDA 5G5EA 4EE0A 4O32A 1OC8A 1ZL9A 4ZB7A 1WOUA 3F3QA 1J0FA 2IL3A 2FA4A 1SK2A 3ZLPA 3ZTLA 4IGJA 2FLSA 1OE7A 3ZFBA 1X0RA 2AUVA 3F4TA 3APOA 2E7PA 1AUCA 4O5RA 4O5QA 3TRXA 4WEYA 1DBYA 3ERWA 2F51A 3MSZA 2K6VA 1MDIA 4AJ7A 4MDCA 3UMAA 2ZCTA 3IPZA 5A1NA 2OT3A 2XBIA 4K1FA 5EPFA 1WE0A 3DD3A 1ZZYA 4IBPA 3M9KA 1OYJA 1ML6A 2B1LA 3VURA 2HSMA 4POBA 3IC8A 1TI1A 1AQVA 4Q5QA 2KHPA 2PBJA 3CTGA 4TR1B 2WZ9A 4MZCA 5A5HA 2H0IA 1ZYQB 2L5OA 5B7CA 1TW9A 1B9YC 3QAVA 2RM6A 5HFIA 2LTKA 3KP8A 3ZFLA 3KGKA 3FHKA 16GSA 5JCUA 3HMJG 2DKIA 4I97A 3BD2A 3C7MA 3EE2A 1K0NA 3A5IA 3LQ7A 3ERGA 2CVKA 4TW5A 2C3QA 2GVPA 1SYXA 1PRXA 3VK9A 2IPAA 4TXVA 1TDIA 1Z5YE 3GTUB 6GSSA 3IK7A 1OC3A 2DIYA 4XCSA 4N0VA 1UN2A 2YZHA 4V2NA 4HJMA 2DMLA 3EC3A 3ZRDA 2K8SA 2CX4A 4KB3A 2V32A 1ERVA 2PN8A 1PKWA 2O8VB 2CVDA 4RI7A 3IRAA 3K8NA 2VIMA 1QUWA 4WF4A 2E2GA 1Y6EA 1B4QA 4AKGA 2L6DA 2C0EA 3FZAA 4MMMA 4HQZA 2H73A 2HSNA 2DJ0A 3HZ8A 4BVYA 2C8UA 4N30A 2L5LA 3H79A 1I5GA 1Z7RA 2JSYA 2ZUPA 4FQUA 4GLTA 3M0FA 2L59A 5DVBA 1YEPA 6GSXA 1KTEA 1BYEA 5ECKB 4MJBA 4EVMA 3D0ZA 3F4RA 1GNEA 4X1UA 5LNKe 3LXTA 2CQ9A 2FA8A 4ECBA 1O73A 2L57A 3R2QA 1JFUA 4OWYA 4USSA 1V57A 2YJHA 3FKFA 1T8EB 4PQ1A 4ML6A 3J7Yb 2MMZA 4KDYA 17GSA 2AHEA 4KDXA 4RI6A 5H5RA 3HJMA 3TJGA 3C73A 2MMOA 1U3IA 2JACA 1MDKA 2FWEA 1XWBA 1Q98A 4AF2A 2OADA 5HR2A 1O85A 2LRNA 3DWVA 3LWAA 3G7IA 4NHZA 4YQMA 3UBKA 1SJIA 1XPVA 4E8EA 3A2WA 2IFQA 5JCGA 4ZBDA 5B8BA 3MIXA 4F03A 3MNGA 1XBSA 4YAPA 1IYIA 1FB0A 1W4VA 4ML1A 2OBKA 4MK3A 3N9JA 5D73A 3GH6A 4HZ4A 5J41A 3TKPA 5JWQB 4XRAA 3D4MA 1DE1A 1GNWA 3D5JA 2WJUA 3RPPA 2AV4A 1V2AA 1A2MA 5J3RA 1V40A 5DALB 1F9MA 1GUKA 3GH9A 5ECRB 1NHOA 3HJPA 3DIEA 3EPTA 2ON7A 1F6MC 2H6XA 1GLPA 2P5RA 1EWXA 3TDGA 4IN0A 4KUNA 4HEA2 4WR5A 2E2MA 2FWGA 2PGTA 3Q19A 4CW9A 4ZL8A 2YANA 4Q5RA 1TRUA 4YKGA 4IS0A 2X8GA 1MEKA 2RM5A 3DKSA 2KP1A 2DJJA 11GSA 1SKWB 1FOHA 2VLUA 3RPNA 4IQAA 4RQRA 3F3RA 1TU8A 4OMVA 5JCWA 1BG1A 2K9FA 3DGQA 1AQXA 5KOWA 1BX9A 2VL9A 3W8SA 3TU3B 4F82A 5IOWA 2DJ3A 3NIVA 1I9DA 2HLSA 3I6AA 3LFLA 5J4UA 1GSSA 2IMIA 1NW2A 2RUFA 4NV2A 4GWRA 1MD4A 3EYTA 4D73A 4MNNA 1MDJA 3GA4A 4MZWA 2O7KA 5CP1A 1FOVA 2VD0A 3E0UA 2JADA 4MH3A 2HRFA 2PVQA 4G01A 3A3TA 4IKHA 3WD6A 1FAAA 5D9WA 1OC9A 3GIXA 2IMKA 4K7IA 5AN1A 3GL5A 4KE3A 3HD5A 2B7KA 3GNJA 4GQFA 4CY8A 1H75A 1ABAA 2K8VA 5FHIA 2N5FA 5DAKB 2E0QA 2GSTA 2JZTA 1K0BA 3CSJA 3L0HA 2EFHA 5ENUA 5G1LA 4GRFA 2I1UA 2AAWA 1G7EA 3CSHA 5J4YA 1CQGA 3RDWA 2LQQA 2H1BA 4BL7B 1NM3A 1PQNA 1RW1A 4MCUA 4ZL9A 3CXGA 4K7OA 1Z9HA 5ECQB 2DKHA 1GTAA 3TOUA 1WWJA 4HDEA 3TOTA 4BVXB 4JEDA 4ULXA 2TIRA 4TVEA 2VM1A 1PKZA 5D96A 5ECHB 4O5UA 1GSQA 1X9SB 2H72A 3KH9A 3RHCA 5IPHA 4ICYA 3TJJA 2K18A 3PINA 5IMZA 2I4AA 5ELAA 1IYHA 3LGCA 1X5EA 4JZQA 1BG5A 3TKQA 5B8AA 4I5QA 2R0CA 3KM6A 5EL8A 10GSA 3LEFA 4MP4A 4NXIA 4EUYA 2WULA 3IHQA 1WJKA 4WETA 3EU4A 3WGEA 1NHYA 4IVFA 1BQ7A 4PXOA 1A8LA 4OCEA 3KIJA 1EOHA 1G6WA 4CDOA 4NV5A 4PURA 3EVIA 3IXRA 4MJAA 1O81A 2H6YA 4JR6A 1XCCA 5BRTA 3GRXA 2WB9A 1U6TA 1EV4A 3DEXA 3F0IA 2XHFA 5IO2A 2H71A 2DJ1A 3IHGA 2UZ8A 2HFDA 4L8EA 4RQXA 1TI3A 3D6IA 3ZITA 3GSSA 4YH2A 2ZNMA 2IMFA 1M2AA 3W8JA 1TK8B 4GTUA 1PMTA 5BMUA 3UVHA 3KMNA 2HSHA 3L4NA 4ZBBA 12GSA 2H30A 4JR4A 13GSA 3LG6A 5G30A 4MLYA 5GZZB 4AJ8A 2A2SA 5ECLB 2H0HA 2PU9C 1A8YA 5JWOB 5ECMB 2NVLA 4JBBA 4EKZA 1TK5B 3CRTA 2WS2A 4ZL7A 3I43A 5A4WA 4WR4A 4AI6A 5LD0A 2X99A 4IQ1A 1SENA 4OO4A 4X43A 3ED3A 1EP7A 4J2FA 5CRGA 2C3TA 2HE3A 4AKHA 1TKDB 3ZREA 3IE3A 2CX3A 5KOXA 5F8BA 1AIUA 2PMTA 5GAND 1PL1A 3J7Yk 5B6MA 1GP1A 4OFTA 1SVLA 4HZ2A 1EP8A 1THXA 5ECOB 1GWCA 2OE3A 5IOXA 5ECSA 3E3EA 4Q5NA 3GV1A 1PA3A 3H8QA 3A2XA 2DSAA 1G0TA 2GQLA 5F06A 4TR1A 3G7YA 1M9BA 3LJRA 3ZZXA 2L6CA 2GTUA 2JL4A 4QQ7A 5DCHA 5F07A 3LSZA 4EL1A 4MJCA 4F0BA 3RBTA 3WT2A 1GLQA 1USBA 3C1SA 3IAM2 1R7HA 3TUEA 6GSYA 1SK1A 3FK8A 3VWUA 2LRTA 3VI7A 3HVVA 4IJ3A 3GTUA 4LMWA 2H8LA 1FO5A 4PTSA 1X9WB 2R3XA 4Q5FA 4YQVA 2KUCA 1GSUA 2R2JA 2H6ZA 2XC2A 1VGLA 3HY2A 3HJOA 2B7JA 4E8HA 2EC4A 2ON5A 2MMAA 4DSSB 1ZYNA 3PR8A 2MMNA 1QQ2A 1THOA 3UEMA 2F8FA 2HYXA 4J57E 5FT3A 3JCML 5CRDA 3ME7A 4K5SA 5D93A 5CO3A 1SU9A 3FR6A 4O7HA 2EIQA 5AISA 2QKEA 1R5PA 4TOPA 1T7PB 1SYRA 1M2BA 3GFKA 1E6BA 2GSRA 1DUGA 5EY6A 2B5YA 4PGTA 2XPDA 2C3NA 1SL0B 4QL7A 5IIZA 2EIOA 1EGRA 2VO4A 5B6NA 1PN0A 3KZQA 1U3AA 2EFCA 2MZCA 2X4AA 1T00A 5L71A 3QPMA 2OE0A 2I3YA 4KCAA 4GXZA 3APQA 4G10A 3HCZA 4YQUA 4MJEA 3KP9A 2HRNA 5IMFA 1O8XA 1R4WA 3DMLA 2VKZG 2R5GA 3C8EA 2FD3A 3GUSA 4PUAA 2H1DA 4HUAA 5F05A 2HQTA 1A2LA 2FHEA 3IR4A 2YWIA 3UIWA 5CAXA 3Q74A 2CVBA 4BWSA 5C00A 1ERUA 2YOIA 3IC4A 3M8NA 4Z7XA 2VD1A 1V58A 1ST9A 3WYWA 3BJ5A 1TP9A 3HDCA 4L0WA 2LJRA 2O89A 1GTBA 2HZEB 4G0LA 3HKRA 3UJ1A 4IP6A 4BA7A 2M72A 2J23A 4ACSA 1F3AA 2AYTA 5IMAA 5DQYA 2F9SA 4JRRA 3HZ4A 2X8HA 2GSSA 3GN3A 2GDRA 1JLVA 7GSSA 2NTOA 4HOJA 4ZB6A 4FYUA 5HR3A 3VPTA 4F2IA 1BF5A 1CQHA 4J56E 1TJDA 2QGVA 1M99A 1O6JA 2VL3A 1JLWA 1Q4JA 1AQWA 3DXBA 3HA9A 1V98A 5C04A 2XBQA 2R6KA 2GGTA 3IOSA 1U87A 4K8MA 3WGXA 5DALA 3CSIA 2O5VA 2QSIA 3W6GA 1OVNA 3F8UA 1Z7PA 2R0GA 2DIZA 4NWYA 3KD0A 1QK8A 5KN2A 2P0GA 4MZBA 3KTLA 2GQKA 4POKA 1M9AA 2CA8A 3L9VA 3HXSA 3ME8A 2D2ZA 4TKYA 4ID0A 1ZMAA 5ID2B 3UOMA 5A5KA 1B8XA 3LYPA 1MTCA 2HXKA 1HYUA 2CAIA 3D21A 3KXOA 1ZGNA 3FW2A 4F0CA 1M0UA 4DVCA 1O8WA 1QXHA 4L5OA 5J40A 3UVTA 3LORA 2GT5A 4KNDA 4DSRA 2G0FA 2OACA 3CMIA 2P5QA 1KEBA 2C1YA 1BAYA 1PX7A 4MPFA 1K0OA 3M1GA 2H70A 4AKXB 1ZYEA 1YKAA 1WP0A 4FIWA 4TN8A 1W89A 1EV9A 2LSTA 3WT1A 1GUHA 3KH7A 4W66A 2V2GA 1B4PA 1GSEA 4X4JA 3F4SA 1AAZA 3DYRA 2HI7A 2X8CA 3GKNA 4IP1A 4X0XA 1YZXA 3MWHA 3DRNA 1TRVA 3ZMLA 1X5DA 4FH8A 5A34B 1FW1A 2GLRA 2R4VA 1U88A 1SKRB 1GL8A 2MYGA 2NDOA 2PUKC 1PL2A 1Z6MA 2LUSA 2B5EA 5JWRB 2LEGA 1A2JA 5ECNB 5DAKA 2V1MA 5IPGA 2VCTA 4TR0A 5CRWA 2X49A 1ON4A 3MAKA 2JU5A 1XW9A 1RK4A 3S9FA 2C0DA 3F6FA 4PQIA 4BL7A 3GKMA 1BEDA 1OKTA 1EEJA 8GSSA 2LNTA 22GSA 2BJXA 3ZIVA 2MBSA 4BVXA 4CY6A 1C72A 5IMDA 4A5PA 2A2PA 3CTFA 2M80A 1VRSD 1JZWA 2C4JA 1A24A 1XOBA 4OFNA 2VM2A 4HU7A 5G1KA 4ZIJA 5DJMA 3APSA 1HNBA 2XPEA 2BMXA 3PGTA 4KW6A 1AW9A 4GSNA 1N2AA 1GUMA 1S3AA 4K7NA 4TXOB 1GSDA 1QMVA 1YF1A 2AB6A 5J9CA 5CYYA 3FY7A 3BOAA 4ZB8A 1VF2A 4N11A 2DLXA 3H4KA 1XOAA 5ABRA 3VPQA 1YKCA 1Z6NA 4V1Ag 4K2XA 2GZZA 2YWOA 4RUVA 2F3MA 3KEBA 2H1GA 5DCGA 1UVZA 2HZFA 2R37A 1ZOFA 2FWFA 3FZ4A 4XS4B 2PPTA 4OO5A 4K9ZA 4V2LA 2UV8G 3EWLA 1HNCA 3QD9A 2A4VA 4XRDA 4I2TA 4XS6A 3FRCA 1EEMA 1EZKA 2HRKB 4ECCA 5D9TA 4HI7A 2LKUA 1K0AA 1QGVA 2VCVA 5HFGA 1YDKA 3IK9A 1N8JA 1J08A 4N10A 4QL9A 4MH2A 2VCWA 1B9XC 4KX4A 2V41A 3GYKA 3SWLA 4PUFC 2LJAA 5KN1A 1GTIA 3UAPA 2M46A 2CZ3A 2OKAA 5D9XA 3TKSA 5ECIB 3Q6OA 4GSTA 1YEXA 2LNSA 2RLIA 2X64A 1WPIA 2I81A 4NMUA 3V1WA 1GSFA 1SJZA 4ZBAA 4KSOA 1TRSA 3TRQA 1Z3EA 4XS1A 3BCIA 3EMPA 5F0GA 3D4TA 4Z2RA 3C71A 3BCKA 1SD9A 1JZDA 1GULA 2N5AA 2PVOC 4CHSA 1A0FA 2WRTA 1DSBA 3TJFA 3QAGA 3ZL5A 3EINA 1T3BA 2RUEA 4EO3A 4L0UA 1YJ6A 3L9SA 4WKWA 2CAQA 2VL2A 1VF4A 4XTSA 1TK0B 4OD7A 2YN1A 3LW9A 1F2EA 2N5BA 2GSQA 5IMVA 4FO5A 5HR0A 20GSA 4MF5A 4BWQA 1KBNA 4PX1A 3O6TA 2ES7A 1WIKA 4ZILA 5J47A 4O92A 3QCPA 2IMDA 3KTBA 2H01A 3C1RA 5J9BA 2JZSA 1ILOA 6GSTA 1XW6A 1O7UA 1TXUA 1F37A 5A1NB 3QFAC 4KDUA 2Z9SA 5KN0A 3NZNA 4HJ2A 3TJBA 2YZUA 1M2DA 5LCZA 1FVKA 1XXUA 2HSMB 4NHWA 1VF3A 3GSTA 3CYNA 3A5WA 3GKXA 4EIQA 2GT6A 5A5HB 3GKKA 3F9UA 5IMCA 1X9MB 4MF7A 1OE8A 3QR6A 1V9WA 1B48A 4QMKA 3VLNA 1E2YA 2IWTA 4DSSA 3MYDA 2FY6A 3CRUA 1QFNA 3L78A 2F8AA 2C0FA 1PN9A 1PX6A 2B5XA 2P31A 3QMXA 4IHUA 1HQOA 4OCFA 4DSQA 4K2DA 3P8WA 3SBCA 1MD3A 2RIIA 2B6MA 4K6XA 1SVOA 4ECJA 1X5CA 2YPMA 5DDLA 3E9JB 3P90A 5CREA 3G7JA 2B1KA 1GTUA 3KCMA 4KA0A 3GMFA 1XWGA 4MABA 5KN3A 3PPUA 1AC1A 1ERWA 1K3LA 2VOCA 1YVLA 4AJ6A 4NPBA 1G7OA 2YV7A 5DQSA 1JZRA 5G5FA 4KF9A 1OKDA 3KMOA 2QA1A 3HVSA 2HSNB 4BVYB 1UC7A 5IM9A 3TGZA 2EIRA 2C0GA 4K0NA 2DMMA 3BBYA 3KJYA 2DJ2A 6GSVA 4L5LA 1SVMA 2V6OA 9GSSA 5INYA 1ERTA 2I9HA 4GQCA 6GSUA 3IV4A 3FEUA 4NAXA 5G31A 1GRXA 3UARA 5AGYA 1A23A 2GQMA 4Z2TA 2PWJA 1PGTA 1FVJA 4GSSA 2H66A 2HZEA 5HR1A 3IDVA 2LS5A 4ZB9A 4N3ZA 1SL1B 5FWGA 4FYBA 2A4HA 1F3BA 2YP6A 4V2MA 3GL3A 5GSSA 4G2EA 1TRWA 2AJQB 3ZVJA 3D22A 2H74A 2LV3A 2OBIA 4POMA 2FWHA 4E68A 4YAVA 2DBCA 3IAS2 1SL2B 3CWGA 4P3YB 18GSA 4ECIA 2NPBA 4BPYA 1ACVA 4EDYA 5ELGA 2FNOA 5E4WA 2ALBA 2IN3A 1TU7A 3TB2A 1LJRA 4EF0A 1VF1A 3P2AA 4LL4B 1HNAA 2EFEA 3ERFA 3IBHA 4ZXGA 1ZYPA 4TR3A 2IFQB 2O87A 1K0MA 2CZ2A 4IELA 5AIXA 2WFCA 2YWMA 3AY8A 3H1NA 4OFMA 3TJKA 3GX8A 1JZOA 2OA7A 4GCIA 1GH2A 3HVXA 3US3A 1SD8A 2C80A 5IQYA 1WRYA 1FG4A 2L4CA 5ID2A 3N5OA 4HS1A 5D9VA 2CT6A 1K3YA 4IW9A 4TRXA 3R3EA 1XVWA 3PH9A 3FYGA 2OJLA 3OR5A 5HFKA 4GDFA 2YWNA 2HT9A 3ZVJD 4H86A 4WXTA 1FB6A 5H5SA 2YCDA 1YY7A 1WMJA 3RHBA 2YJ7A 3EURA 4LL1B 3GHAA 4HQSA 1JHBA 1RQMA 3VI5A 1NSWA 5CRHA 4MA9A 2CV4A 6GSWA 4G9HA 1YQ1A 5IO0A 2WGRA 1LBKA 1N25A 3F6DA 2MBTA 4N0ZA 1S3DA 3IA1A 2VCQA 2FUG2 1SJ6A 5EVOA 3HHVA 5H5QA 1TTZA 19GSA 2H76A 3O3TA 1J9BA 3ZYWA 3VWVA 4Z2UA 2DJKA 4EXJA 5A34A 2OE1A 1G6YA 3Q18A 4MPGA 4LMVA 3DVXA 3G9BA 4YKFA 4D73B 2V6KA 1K0CA 1R5AA 1EOGA 3FZ9A 1YF0A 4KGIA 3LXZA 1SKSB 3TKSC 3EMXA 3F63A 3VWXA 2VCXA 2LRCA 4G19A 2A2RA 3U5RE 1T4YA 2IIYA 2H0GA 5DBQA 2TRXA 2JSZA 2J9HA 3LYKA 1OC9B 3FZ5A 3ISOA 3GURA 3H93A 5E59A 1XVQA 2HSYA 3ZMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD2 A;  4K0G A;  3VWW A;  2H19 A;  2WDU A;  2NBS A;  14GS A;  1Y25 A;  4I8B A;  2VL2 C;  2LQO A;  1ZCP A;  1FHE A;  2B3S A;  2GS3 A;  1T1V A;  2VLT A;  3QAW A;  4DEJ A;  4G0K A;  1OAZ A;  1TOF A;  5HQP A;  5GST A;  1H4O A;  2QC7 A;  4TXO A;  1R26 A;  2L4Q A;  1AXD A;  3DVW A;  4WBJ A;  3HYP A;  3L9U A;  3FR9 A;  3I69 A;  2REM A;  3A2V A;  5AIV A;  5J5N A;  3TKR A;  1BJX A;  2DC5 A;  3NOF A;  1PSQ A;  1GSY A;  4I2U A;  2GZP A;  1XW5 A;  4EC0 A;  1A0R P;  4POL A;  2FCH A;  3TCO A;  1PD2 1;  4ISD A;  2O85 A;  2LJK A;  4XS4 A;  1T4Z A;  3RAZ A;  1XZO A;  4V1A p;  3I9V 2;  4G0I A;  2KOK A;  4TR4 A;  2YNX A;  2PER A;  4JE1 A;  3O76 A;  5G2Z A;  1UA5 A;  1SK0 A;  2HRA A;  5COH A;  4IJI A;  2VUP A;  3QDN A;  3WGD A;  1KNG A;  3CBU A;  1TXX A;  4XIH A;  4F9Z A;  2HRK A;  3EU3 A;  3FR3 A;  3TRP A;  5A4V A;  3UBL A;  3QOU A;  2HNL A;  1XWA A;  2FGX A;  1S3C A;  2IJY A;  4I6X A;  5A4U A;  3U6V A;  5KEJ A;  4MF6 A;  3MDK A;  5D8I A;  2JZR A;  3QFB C;  4KH7 A;  3P7X A;  3M9J A;  3UL3 A;  1XWC A;  4GF0 A;  4PNF A;  4LA1 A;  4WF5 A;  2H1A A;  2H75 A;  4PNG A;  2GZY A;  5ECP B;  4FYC A;  3GX0 A;  2IME A;  4XHM A;  5DJL A;  1URM A;  1DE2 A;  4AGS A;  4KCE A;  1XFL A;  4KAE A;  2VAF A;  2VLV A;  1EGO A;  4KSM A;  2BTO T;  4PQH A;  1M7T A;  1K3O A;  1XWK A;  2G2Q A;  2WCI A;  2KP2 A;  3TKS E;  3VFI A;  4JU5 A;  5GAP D;  1K0D A;  2TRC P;  2KLX A;  4WBR D;  4ILF A;  5CNW A;  1XIY A;  1LU4 A;  2YV9 A;  3ZIJ A;  4EDZ A;  4LLR A;  2VCZ A;  3M3M A;  4HU9 A;  5G5E A;  4EE0 A;  4O32 A;  1OC8 A;  1ZL9 A;  1WOU A;  3F3Q A;  1J0F A;  2IL3 A;  2FA4 A;  1SK2 A;  3ZLP A;  3ZTL A;  4IGJ A;  2FLS A;  1OE7 A;  3ZFB A;  1X0R A;  2AUV A;  3F4T A;  3APO A;  2E7P A;  1AUC A;  4O5R A;  3TRX A;  4WEY A;  1DBY A;  3ERW A;  2F51 A;  3MSZ A;  2K6V A;  1MDI A;  4AJ7 A;  4MDC A;  3UMA A;  2ZCT A;  3IPZ A;  2XBI A;  4K1F A;  5EPF A;  1WE0 A;  3DD3 A;  1ZZY A;  4IBP A;  3M9K A;  1OYJ A;  1ML6 A;  2B1L A;  3VUR A;  2HSM A;  4POB A;  3IC8 A;  1TI1 A;  1AQV A;  4Q5Q A;  2KHP A;  2PBJ A;  3CTG A;  4TR1 B;  2WZ9 A;  4MZC A;  2H0I A;  1ZYQ B;  2L5O A;  5B7C A;  1TW9 A;  1B9Y C;  3QAV A;  2RM6 A;  5HFI A;  2LTK A;  3KP8 A;  3ZFL A;  3KGK A;  16GS A;  5JCU A;  3FHK A;  3C7M A;  4I97 A;  3BD2 A;  3EE2 A;  1K0N A;  3LQ7 A;  3ERG A;  2CVK A;  4TW5 A;  2C3Q A;  2GVP A;  1SYX A;  1PRX A;  3VK9 A;  2IPA A;  4TXV A;  1TDI A;  1Z5Y E;  3GTU B;  6GSS A;  3IK7 A;  1OC3 A;  2DIY A;  4XCS A;  4N0V A;  1UN2 A;  2YZH A;  4V2N A;  4HJM A;  2DML A;  3EC3 A;  3ZRD A;  2K8S A;  2CX4 A;  4KB3 A;  2V32 A;  1ERV A;  2PN8 A;  1PKW A;  2O8V B;  2CVD A;  4RI7 A;  3IRA A;  3K8N A;  2VIM A;  1QUW A;  4WF4 A;  2E2G A;  1Y6E A;  1B4Q A;  2L6D A;  2C0E A;  3FZA A;  4MMM A;  4HQZ A;  2H73 A;  2DJ0 A;  3HZ8 A;  4BVY A;  2C8U A;  4N30 A;  2L5L A;  3H79 A;  1I5G A;  1Z7R A;  2JSY A;  2ZUP A;  4FQU A;  4GLT A;  3M0F A;  2L59 A;  5DVB A;  1YEP A;  6GSX A;  1KTE A;  1BYE A;  5ECK B;  4MJB A;  4EVM A;  3D0Z A;  3F4R A;  1GNE A;  4X1U A;  5LNK e;  3LXT A;  2CQ9 A;  2FA8 A;  4ECB A;  1O73 A;  2L57 A;  3R2Q A;  1JFU A;  4OWY A;  4USS A;  1V57 A;  2YJH A;  3FKF A;  1T8E B;  4PQ1 A;  4ML6 A;  3J7Y b;  2MMZ A;  4KDY A;  17GS A;  2AHE A;  4KDX A;  4RI6 A;  5H5R A;  3HJM A;  3TJG A;  3C73 A;  2MMO A;  1U3I A;  2JAC A;  1MDK A;  2FWE A;  1XWB A;  1Q98 A;  4AF2 A;  2OAD A;  5HR2 A;  1O85 A;  2LRN A;  3DWV A;  3LWA A;  3G7I A;  4NHZ A;  4YQM A;  3UBK A;  1SJI A;  1XPV A;  4E8E A;  3A2W A;  2IFQ A;  5JCG A;  4ZBD A;  5B8B A;  4F03 A;  3MNG A;  1XBS A;  4YAP A;  1IYI A;  1FB0 A;  1W4V A;  4ML1 A;  2OBK A;  4MK3 A;  3N9J A;  5D73 A;  3GH6 A;  4HZ4 A;  5J41 A;  3TKP A;  5JWQ B;  4XRA A;  3D4M A;  1DE1 A;  1GNW A;  3D5J A;  2WJU A;  3RPP A;  2AV4 A;  1V2A A;  1A2M A;  5J3R A;  1V40 A;  5DAL B;  1F9M A;  1GUK A;  3GH9 A;  5ECR B;  1NHO A;  3HJP A;  3DIE A;  2ON7 A;  1F6M C;  2H6X A;  1GLP A;  2P5R A;  1EWX A;  3TDG A;  4IN0 A;  4KUN A;  4HEA 2;  4WR5 A;  2E2M A;  2FWG A;  2PGT A;  3Q19 A;  4CW9 A;  4ZL8 A;  2YAN A;  4Q5R A;  1TRU A;  4IS0 A;  2X8G A;  1MEK A;  2RM5 A;  3DKS A;  2KP1 A;  2DJJ A;  11GS A;  1SKW B;  2VLU A;  3RPN A;  4IQA A;  4RQR A;  3F3R A;  1TU8 A;  4OMV A;  5JCW A;  2K9F A;  3DGQ A;  1AQX A;  1BX9 A;  2VL9 A;  3W8S A;  4F82 A;  5IOW A;  2DJ3 A;  3NIV A;  1I9D A;  2HLS A;  3I6A A;  3LFL A;  5J4U A;  1GSS A;  2IMI A;  1NW2 A;  2RUF A;  4NV2 A;  4GWR A;  1MD4 A;  3EYT A;  4D73 A;  1MDJ A;  3GA4 A;  4MZW A;  2O7K A;  5CP1 A;  1FOV A;  2VD0 A;  3E0U A;  2JAD A;  4MH3 A;  2HRF A;  2PVQ A;  3A3T A;  4IKH A;  3WD6 A;  1FAA A;  5D9W A;  1OC9 A;  3GIX A;  2IMK A;  4K7I A;  5AN1 A;  3GL5 A;  4KE3 A;  3HD5 A;  2B7K A;  3GNJ A;  4GQF A;  1H75 A;  1ABA A;  2K8V A;  5FHI A;  2N5F A;  5DAK B;  2E0Q A;  2GST A;  2JZT A;  1K0B A;  3CSJ A;  3L0H A;  5ENU A;  5G1L A;  4GRF A;  2I1U A;  2AAW A;  1G7E A;  3CSH A;  1CQG A;  3RDW A;  2LQQ A;  2H1B A;  4BL7 B;  1NM3 A;  1PQN A;  1RW1 A;  4MCU A;  4ZL9 A;  3CXG A;  4K7O A;  1Z9H A;  5ECQ B;  1GTA A;  3TOU A;  1WWJ A;  4HDE A;  3TOT A;  4BVX B;  4JED A;  4ULX A;  2TIR A;  4TVE A;  2VM1 A;  1PKZ A;  5D96 A;  5ECH B;  1GSQ A;  1X9S B;  2H72 A;  3KH9 A;  3RHC A;  5IPH A;  3TJJ A;  2K18 A;  3PIN A;  5IMZ A;  2I4A A;  5ELA A;  1IYH A;  3LGC A;  1X5E A;  4JZQ A;  1BG5 A;  3TKQ A;  5B8A A;  4I5Q A;  3KM6 A;  5EL8 A;  10GS A;  3LEF A;  4MP4 A;  4NXI A;  4EUY A;  2WUL A;  3IHQ A;  1WJK A;  4WET A;  3EU4 A;  3WGE A;  1NHY A;  4IVF A;  1BQ7 A;  4PXO A;  1A8L A;  4OCE A;  3KIJ A;  1EOH A;  1G6W A;  4CDO A;  4NV5 A;  4PUR A;  3EVI A;  3IXR A;  4MJA A;  1O81 A;  4JR6 A;  2H6Y A;  1XCC A;  3GRX A;  2WB9 A;  1U6T A;  1EV4 A;  3DEX A;  3F0I A;  2XHF A;  5IO2 A;  2H71 A;  2DJ1 A;  2UZ8 A;  2HFD A;  4L8E A;  4RQX A;  1TI3 A;  3D6I A;  3ZIT A;  3GSS A;  4YH2 A;  2ZNM A;  2IMF A;  1M2A A;  3W8J A;  1TK8 B;  4GTU A;  1PMT A;  5BMU A;  3UVH A;  3KMN A;  2HSH A;  3L4N A;  4ZBB A;  12GS A;  2H30 A;  4JR4 A;  13GS A;  3LG6 A;  5G30 A;  4MLY A;  5GZZ B;  4AJ8 A;  2A2S A;  5ECL B;  2H0H A;  2PU9 C;  1A8Y A;  5JWO B;  5ECM B;  2NVL A;  4JBB A;  4EKZ A;  1TK5 B;  3CRT A;  2WS2 A;  4ZL7 A;  3I43 A;  5A4W A;  4WR4 A;  5LD0 A;  2X99 A;  4IQ1 A;  1SEN A;  4OO4 A;  4X43 A;  3ED3 A;  1EP7 A;  4J2F A;  5CRG A;  2C3T A;  2HE3 A;  1TKD B;  3ZRE A;  3IE3 A;  2CX3 A;  5F8B A;  1AIU A;  2PMT A;  5GAN D;  1PL1 A;  3J7Y k;  5B6M A;  1GP1 A;  4OFT A;  4HZ2 A;  1EP8 A;  1THX A;  5ECO B;  1GWC A;  2OE3 A;  5IOX A;  5ECS A;  3E3E A;  4Q5N A;  3GV1 A;  1PA3 A;  3H8Q A;  3A2X A;  2DSA A;  1G0T A;  2GQL A;  5F06 A;  4TR1 A;  3G7Y A;  1M9B A;  3LJR A;  3ZZX A;  2L6C A;  2GTU A;  2JL4 A;  4QQ7 A;  5DCH A;  5F07 A;  3LSZ A;  4EL1 A;  4MJC A;  4F0B A;  3RBT A;  3WT2 A;  1GLQ A;  1USB A;  3C1S A;  3IAM 2;  1R7H A;  3TUE A;  6GSY A;  1SK1 A;  3FK8 A;  3VWU A;  2LRT A;  3VI7 A;  3HVV A;  4IJ3 A;  3GTU A;  4LMW A;  2H8L A;  1FO5 A;  4PTS A;  1X9W B;  2R3X A;  4Q5F A;  4YQV A;  2KUC A;  1GSU A;  2R2J A;  2H6Z A;  2XC2 A;  1VGL A;  3HY2 A;  3HJO A;  2B7J A;  4E8H A;  2EC4 A;  2ON5 A;  2MMA A;  4DSS B;  3PR8 A;  2MMN A;  1QQ2 A;  1THO A;  3UEM A;  2F8F A;  2HYX A;  4J57 E;  5FT3 A;  3JCM L;  5CRD A;  3ME7 A;  5D93 A;  5CO3 A;  1SU9 A;  3FR6 A;  4O7H A;  2EIQ A;  5AIS A;  2QKE A;  1R5P A;  4TOP A;  1T7P B;  1SYR A;  1M2B A;  3GFK A;  1E6B A;  2GSR A;  1DUG A;  5EY6 A;  2B5Y A;  4PGT A;  2XPD A;  2C3N A;  1SL0 B;  4QL7 A;  5IIZ A;  2EIO A;  1EGR A;  2VO4 A;  5B6N A;  3KZQ A;  1U3A A;  2MZC A;  1T00 A;  5L71 A;  3QPM A;  2OE0 A;  2I3Y A;  4KCA A;  4GXZ A;  3APQ A;  4G10 A;  3HCZ A;  4YQU A;  4MJE A;  3KP9 A;  2HRN A;  5IMF A;  1O8X A;  1R4W A;  3DML A;  2R5G A;  3C8E A;  2FD3 A;  3GUS A;  4PUA A;  2H1D A;  4HUA A;  5F05 A;  2HQT A;  1A2L A;  2FHE A;  3IR4 A;  2YWI A;  3UIW A;  5CAX A;  3Q74 A;  2CVB A;  4BWS A;  5C00 A;  1ERU A;  2YOI A;  3IC4 A;  3M8N A;  4Z7X A;  2VD1 A;  1V58 A;  1ST9 A;  3WYW A;  3BJ5 A;  1TP9 A;  3HDC A;  4L0W A;  2LJR A;  2O89 A;  1GTB A;  2HZE B;  4G0L A;  3HKR A;  3UJ1 A;  4IP6 A;  4BA7 A;  2M72 A;  2J23 A;  4ACS A;  1F3A A;  2AYT A;  5IMA A;  5DQY A;  2F9S A;  4JRR A;  3HZ4 A;  2X8H A;  2GSS A;  3GN3 A;  2GDR A;  1JLV A;  7GSS A;  2NTO A;  4HOJ A;  4ZB6 A;  4FYU A;  5HR3 A;  3VPT A;  4F2I A;  1CQH A;  4J56 E;  1TJD A;  2QGV A;  1M99 A;  1O6J A;  2VL3 A;  1JLW A;  1Q4J A;  1AQW A;  3DXB A;  3HA9 A;  1V98 A;  5C04 A;  2XBQ A;  2R6K A;  2GGT A;  3IOS A;  1U87 A;  4K8M A;  3WGX A;  5DAL A;  3CSI A;  2QSI A;  3W6G A;  1OVN A;  3F8U A;  1Z7P A;  2DIZ A;  4NWY A;  3KD0 A;  1QK8 A;  5KN2 A;  2P0G A;  4MZB A;  3KTL A;  2GQK A;  4POK A;  1M9A A;  2CA8 A;  3L9V A;  3HXS A;  3ME8 A;  2D2Z A;  4TKY A;  4ID0 A;  1ZMA A;  5ID2 B;  3UOM A;  5A5K A;  1B8X A;  3LYP A;  1MTC A;  2HXK A;  1HYU A;  2CAI A;  3D21 A;  3KXO A;  1ZGN A;  3FW2 A;  4F0C A;  1M0U A;  4DVC A;  1O8W A;  1QXH A;  4L5O A;  3UVT A;  3LOR A;  2GT5 A;  4KND A;  4DSR A;  2G0F A;  2OAC A;  3CMI A;  2P5Q A;  1KEB A;  2C1Y A;  1BAY A;  1PX7 A;  4MPF A;  1K0O A;  3M1G A;  2H70 A;  1ZYE A;  1YKA A;  1WP0 A;  4FIW A;  4TN8 A;  1W89 A;  1EV9 A;  2LST A;  3WT1 A;  1GUH A;  3KH7 A;  2V2G A;  1B4P A;  1GSE A;  3F4S A;  1AAZ A;  3DYR A;  2HI7 A;  2X8C A;  3GKN A;  4IP1 A;  4X0X A;  1YZX A;  3MWH A;  3DRN A;  1TRV A;  3ZML A;  1X5D A;  4FH8 A;  1FW1 A;  2GLR A;  2R4V A;  1U88 A;  1SKR B;  1GL8 A;  2MYG A;  2NDO A;  2PUK C;  1PL2 A;  1Z6M A;  2LUS A;  2B5E A;  5JWR B;  2LEG A;  1A2J A;  5ECN B;  5DAK A;  2V1M A;  5IPG A;  2VCT A;  4TR0 A;  5CRW A;  1ON4 A;  3MAK A;  2JU5 A;  1XW9 A;  1RK4 A;  3S9F A;  2C0D A;  3F6F A;  4PQI A;  4BL7 A;  3GKM A;  1BED A;  1OKT A;  1EEJ A;  8GSS A;  2LNT A;  22GS A;  2BJX A;  3ZIV A;  2MBS A;  4BVX A;  1C72 A;  5IMD A;  3CTF A;  2M80 A;  1VRS D;  1JZW A;  2C4J A;  1A24 A;  1XOB A;  4OFN A;  2VM2 A;  4HU7 A;  5G1K A;  4ZIJ A;  5DJM A;  3APS A;  1HNB A;  2XPE A;  2BMX A;  3PGT A;  4KW6 A;  1AW9 A;  4GSN A;  1N2A A;  1GUM A;  1S3A A;  4K7N A;  4TXO B;  1GSD A;  1QMV A;  1YF1 A;  2AB6 A;  5J9C A;  5CYY A;  3FY7 A;  3BOA A;  4ZB8 A;  1VF2 A;  4N11 A;  2DLX A;  3H4K A;  1XOA A;  5ABR A;  3VPQ A;  1YKC A;  1Z6N A;  4V1A g;  2GZZ A;  2YWO A;  4RUV A;  2F3M A;  3KEB A;  2H1G A;  5DCG A;  1UVZ A;  2HZF A;  2R37 A;  1ZOF A;  2FWF A;  3FZ4 A;  4XS4 B;  2PPT A;  4OO5 A;  4K9Z A;  4V2L A;  3EWL A;  1HNC A;  3QD9 A;  2A4V A;  4XRD A;  4I2T A;  4XS6 A;  3FRC A;  1EEM A;  1EZK A;  2HRK B;  4ECC A;  5D9T A;  4HI7 A;  2LKU A;  1K0A A;  1QGV A;  2VCV A;  5HFG A;  1YDK A;  3IK9 A;  1N8J A;  1J08 A;  4N10 A;  4QL9 A;  4MH2 A;  2VCW A;  1B9X C;  4KX4 A;  2V41 A;  3GYK A;  3SWL A;  4PUF C;  2LJA A;  5KN1 A;  1GTI A;  3UAP A;  2M46 A;  2CZ3 A;  2OKA A;  5D9X A;  3TKS A;  5ECI B;  3Q6O A;  4GST A;  1YEX A;  2LNS A;  2RLI A;  2X64 A;  1WPI A;  2I81 A;  4NMU A;  3V1W A;  1GSF A;  1SJZ A;  4ZBA A;  4KSO A;  1TRS A;  3TRQ A;  1Z3E A;  4XS1 A;  3BCI A;  3EMP A;  5F0G A;  3D4T A;  3C71 A;  3BCK A;  1SD9 A;  1JZD A;  1GUL A;  2N5A A;  2PVO C;  4CHS A;  1A0F A;  2WRT A;  1DSB A;  3TJF A;  3QAG A;  3ZL5 A;  3EIN A;  1T3B A;  2RUE A;  4EO3 A;  4L0U A;  1YJ6 A;  3L9S A;  4WKW A;  2CAQ A;  2VL2 A;  1VF4 A;  4XTS A;  1TK0 B;  4OD7 A;  2YN1 A;  1F2E A;  2N5B A;  2GSQ A;  5IMV A;  4FO5 A;  5HR0 A;  20GS A;  4MF5 A;  4BWQ A;  1KBN A;  4PX1 A;  3O6T A;  2ES7 A;  1WIK A;  4ZIL A;  4O92 A;  3QCP A;  2IMD A;  3KTB A;  2H01 A;  3C1R A;  5J9B A;  2JZS A;  1ILO A;  6GST A;  1XW6 A;  1O7U A;  1F37 A;  3QFA C;  4KDU A;  2Z9S A;  5KN0 A;  3NZN A;  4HJ2 A;  3TJB A;  2YZU A;  1M2D A;  5LCZ A;  1FVK A;  1XXU A;  2HSM B;  4NHW A;  1VF3 A;  3GST A;  3CYN A;  3A5W A;  3GKX A;  2GT6 A;  3GKK A;  3F9U A;  5IMC A;  1X9M B;  4MF7 A;  1OE8 A;  3QR6 A;  1V9W A;  1B48 A;  3VLN A;  1E2Y A;  2IWT A;  4DSS A;  2FY6 A;  3CRU A;  1QFN A;  3L78 A;  2F8A A;  2C0F A;  1PN9 A;  1PX6 A;  2B5X A;  2P31 A;  3QMX A;  4IHU A;  1HQO A;  4OCF A;  4DSQ A;  4K2D A;  3P8W A;  3SBC A;  1MD3 A;  2RII A;  2B6M A;  4K6X A;  4ECJ A;  1X5C A;  2YPM A;  5DDL A;  3E9J B;  3P90 A;  5CRE A;  3G7J A;  2B1K A;  1GTU A;  3KCM A;  4KA0 A;  3GMF A;  1XWG A;  4MAB A;  5KN3 A;  3PPU A;  1AC1 A;  1ERW A;  1K3L A;  2VOC A;  4AJ6 A;  4NPB A;  1G7O A;  2YV7 A;  5DQS A;  1JZR A;  5G5F A;  4KF9 A;  1OKD A;  3KMO A;  3HVS A;  2HSN B;  4BVY B;  1UC7 A;  5IM9 A;  3TGZ A;  2EIR A;  2C0G A;  4K0N A;  2DMM A;  3BBY A;  3KJY A;  2DJ2 A;  6GSV A;  4L5L A;  2V6O A;  9GSS A;  5INY A;  1ERT A;  2I9H A;  4GQC A;  6GSU A;  3IV4 A;  3FEU A;  4NAX A;  5G31 A;  1GRX A;  3UAR A;  5AGY A;  1A23 A;  2GQM A;  2PWJ A;  1PGT A;  1FVJ A;  4GSS A;  2H66 A;  2HZE A;  5HR1 A;  3IDV A;  2LS5 A;  4ZB9 A;  1SL1 B;  5FWG A;  4FYB A;  1F3B A;  2YP6 A;  4V2M A;  3GL3 A;  5GSS A;  4G2E A;  1TRW A;  2AJQ B;  3ZVJ A;  3D22 A;  2H74 A;  2LV3 A;  2OBI A;  4POM A;  2FWH A;  4YAV A;  2DBC A;  3IAS 2;  1SL2 B;  4P3Y B;  18GS A;  4ECI A;  2NPB A;  4BPY A;  1ACV A;  4EDY A;  5ELG A;  2FNO A;  5E4W A;  2ALB A;  2IN3 A;  1TU7 A;  3TB2 A;  1LJR A;  4EF0 A;  1VF1 A;  3P2A A;  4LL4 B;  1HNA A;  3ERF A;  3IBH A;  4ZXG A;  4TR3 A;  2IFQ B;  2O87 A;  1K0M A;  2CZ2 A;  4IEL A;  5AIX A;  2WFC A;  2YWM A;  3AY8 A;  3H1N A;  4OFM A;  3TJK A;  3GX8 A;  1JZO A;  2OA7 A;  4GCI A;  1GH2 A;  3HVX A;  3US3 A;  1SD8 A;  2C80 A;  5IQY A;  1WRY A;  1FG4 A;  2L4C A;  5ID2 A;  3N5O A;  4HS1 A;  5D9V A;  2CT6 A;  1K3Y A;  4IW9 A;  4TRX A;  3R3E A;  1XVW A;  3PH9 A;  3FYG A;  2OJL A;  3OR5 A;  5HFK A;  2YWN A;  2HT9 A;  3ZVJ D;  4H86 A;  4WXT A;  1FB6 A;  5H5S A;  2YCD A;  1YY7 A;  1WMJ A;  3RHB A;  2YJ7 A;  3EUR A;  4LL1 B;  3GHA A;  4HQS A;  1JHB A;  1RQM A;  3VI5 A;  1NSW A;  5CRH A;  4MA9 A;  2CV4 A;  6GSW A;  4G9H A;  1YQ1 A;  5IO0 A;  2WGR A;  1LBK A;  3F6D A;  2MBT A;  4N0Z A;  1S3D A;  3IA1 A;  2VCQ A;  2FUG 2;  1SJ6 A;  5EVO A;  3HHV A;  5H5Q A;  1TTZ A;  19GS A;  2H76 A;  3O3T A;  1J9B A;  3ZYW A;  3VWV A;  2DJK A;  4EXJ A;  2OE1 A;  1G6Y A;  3Q18 A;  4MPG A;  4LMV A;  3DVX A;  3G9B A;  4D73 B;  2V6K A;  1K0C A;  1R5A A;  1EOG A;  3FZ9 A;  1YF0 A;  4KGI A;  3LXZ A;  1SKS B;  3TKS C;  3EMX A;  3F63 A;  3VWX A;  2VCX A;  2LRC A;  4G19 A;  2A2R A;  3U5R E;  1T4Y A;  2IIY A;  2H0G A;  5DBQ A;  2TRX A;  2JSZ A;  2J9H A;  3LYK A;  1OC9 B;  3FZ5 A;  3ISO A;  3GUR A;  3H93 A;  5E59 A;  1XVQ A;  2HSY A;  3ZMK A; 
#chains in the Genus database with same CATH topology
 1HD2 A;  4K0G A;  3VWW A;  2H19 A;  2WDU A;  2NBS A;  14GS A;  1Y25 A;  4I8B A;  2VL2 C;  2LQO A;  1ZCP A;  1FHE A;  2B3S A;  2GS3 A;  1T1V A;  2VLT A;  3QAW A;  4DEJ A;  4G0K A;  1OAZ A;  1TOF A;  5HQP A;  5GST A;  1H4O A;  2QC7 A;  4TXO A;  1R26 A;  2L4Q A;  1AXD A;  3DVW A;  4WBJ A;  3HYP A;  3L9U A;  3FR9 A;  3I69 A;  2REM A;  3A2V A;  5AIV A;  5J5N A;  3TKR A;  1BJX A;  2DC5 A;  3NOF A;  1PSQ A;  1GSY A;  4I2U A;  2GZP A;  1XW5 A;  4EC0 A;  1A0R P;  4POL A;  2FCH A;  3TCO A;  1Y1U A;  1PD2 1;  4ISD A;  2O85 A;  2LJK A;  4XS4 A;  1T4Z A;  3RAZ A;  1XZO A;  4V1A p;  3I9V 2;  4G0I A;  2KOK A;  4TR4 A;  2YNX A;  2PER A;  4JE1 A;  3O76 A;  5G2Z A;  1UA5 A;  4AKI A;  1SK0 A;  2QA2 A;  2HRA A;  5COH A;  4IJI A;  2VUP A;  3QDN A;  3WGD A;  1KNG A;  3CBU A;  1TXX A;  4XIH A;  4F9Z A;  5J4V A;  2HRK A;  3EU3 A;  3FR3 A;  4EIP A;  3TRP A;  5A4V A;  3UBL A;  3QOU A;  2HNL A;  1XWA A;  2FGX A;  1S3C A;  2IJY A;  4I6X A;  5A4U A;  3U6V A;  5KEJ A;  4MF6 A;  3MDK A;  5D8I A;  2JZR A;  3QFB C;  4KH7 A;  3P7X A;  2H1L A;  3M9J A;  3UL3 A;  1XWC A;  4GF0 A;  4PNF A;  4LA1 A;  4WF5 A;  2H1A A;  2H75 A;  4PNG A;  2GZY A;  5ECP B;  4FYC A;  3GX0 A;  2IME A;  4XHM A;  5DJL A;  1URM A;  1DE2 A;  4AGS A;  4KCE A;  1XFL A;  4KAE A;  2VAF A;  2VLV A;  1EGO A;  4KSM A;  2BTO T;  4PQH A;  4K5R A;  1M7T A;  1K3O A;  1XWK A;  2G2Q A;  2WCI A;  2R0P A;  2KP2 A;  3TKS E;  5BMU B;  4JU5 A;  3VFI A;  5GAP D;  1K0D A;  2TRC P;  2KLX A;  4WBR D;  4ILF A;  5CNW A;  1XIY A;  1LU4 A;  2YV9 A;  3ZIJ A;  4EDZ A;  4LLR A;  2VCZ A;  3FMW A;  3M3M A;  4HU9 A;  2EFD A;  5G5E A;  4EE0 A;  4O32 A;  1OC8 A;  1ZL9 A;  4ZB7 A;  1WOU A;  3F3Q A;  1J0F A;  2IL3 A;  2FA4 A;  1SK2 A;  3ZLP A;  3ZTL A;  4IGJ A;  2FLS A;  1OE7 A;  3ZFB A;  1X0R A;  2AUV A;  3F4T A;  3APO A;  2E7P A;  1AUC A;  4O5R A;  4O5Q A;  3TRX A;  4WEY A;  1DBY A;  3ERW A;  2F51 A;  3MSZ A;  2K6V A;  1MDI A;  4AJ7 A;  4MDC A;  3UMA A;  2ZCT A;  3IPZ A;  5A1N A;  2OT3 A;  2XBI A;  4K1F A;  5EPF A;  1WE0 A;  2WW3 A;  3DD3 A;  1ZZY A;  4IBP A;  3M9K A;  1OYJ A;  1ML6 A;  2B1L A;  3VUR A;  2HSM A;  4POB A;  3IC8 A;  1TI1 A;  1AQV A;  4Q5Q A;  2KHP A;  2PBJ A;  3CTG A;  4TR1 B;  2WZ9 A;  4MZC A;  5A5H A;  2H0I A;  1ZYQ B;  2L5O A;  5B7C A;  1TW9 A;  1B9Y C;  3QAV A;  2RM6 A;  5HFI A;  2LTK A;  3KP8 A;  3ZFL A;  3KGK A;  3FHK A;  16GS A;  5JCU A;  3HMJ G;  2DKI A;  4I97 A;  3BD2 A;  3C7M A;  3EE2 A;  1K0N A;  3A5I A;  3LQ7 A;  3ERG A;  2CVK A;  4TW5 A;  2C3Q A;  2GVP A;  1SYX A;  1PRX A;  3VK9 A;  2IPA A;  4TXV A;  1TDI A;  1Z5Y E;  3GTU B;  6GSS A;  3IK7 A;  1OC3 A;  2DIY A;  4XCS A;  4N0V A;  1UN2 A;  2YZH A;  4V2N A;  4HJM A;  2DML A;  3EC3 A;  3ZRD A;  2K8S A;  2CX4 A;  4KB3 A;  2V32 A;  1ERV A;  2PN8 A;  1PKW A;  2O8V B;  2CVD A;  4RI7 A;  3IRA A;  3K8N A;  2VIM A;  1QUW A;  4WF4 A;  2E2G A;  1Y6E A;  1B4Q A;  4AKG A;  3HVN A;  2L6D A;  2C0E A;  3FZA A;  4MMM A;  4HQZ A;  2H73 A;  2HSN A;  2DJ0 A;  3HZ8 A;  4BVY A;  2C8U A;  4N30 A;  2L5L A;  3H79 A;  1I5G A;  1Z7R A;  2JSY A;  2ZUP A;  4FQU A;  4GLT A;  3M0F A;  2L59 A;  5DVB A;  1YEP A;  6GSX A;  1KTE A;  1BYE A;  4PHZ C;  5ECK B;  4MJB A;  4EVM A;  3D0Z A;  3F4R A;  1GNE A;  4X1U A;  5LNK e;  3LXT A;  2CQ9 A;  2FA8 A;  4ECB A;  1O73 A;  2L57 A;  3R2Q A;  1JFU A;  4OWY A;  4USS A;  1V57 A;  2YJH A;  3FKF A;  1T8E B;  4PQ1 A;  4ML6 A;  3J7Y b;  2MMZ A;  4KDY A;  17GS A;  2AHE A;  4KDX A;  4RI6 A;  5H5R A;  3HJM A;  3TJG A;  3C73 A;  2MMO A;  1U3I A;  2JAC A;  1MDK A;  2FWE A;  1XWB A;  1Q98 A;  4AF2 A;  2OAD A;  5HR2 A;  1O85 A;  2LRN A;  3DWV A;  3LWA A;  3G7I A;  4NHZ A;  4YQM A;  3UBK A;  1SJI A;  1XPV A;  4E8E A;  3A2W A;  2IFQ A;  5JCG A;  4ZBD A;  5B8B A;  3MIX A;  4F03 A;  3MNG A;  1XBS A;  4YAP A;  1IYI A;  1FB0 A;  1W4V A;  4ML1 A;  2OBK A;  4MK3 A;  3N9J A;  5D73 A;  3GH6 A;  4HZ4 A;  5J41 A;  3TKP A;  5JWQ B;  1I1I P;  4XRA A;  3D4M A;  1DE1 A;  1GNW A;  3D5J A;  2WJU A;  3RPP A;  2AV4 A;  1V2A A;  1A2M A;  5J3R A;  1V40 A;  5DAL B;  1F9M A;  1GUK A;  3GH9 A;  5ECR B;  1NHO A;  3HJP A;  3DIE A;  3EPT A;  2ON7 A;  1F6M C;  2H6X A;  1GLP A;  2P5R A;  1EWX A;  3TDG A;  4IN0 A;  4KUN A;  4HEA 2;  4WR5 A;  2E2M A;  2FWG A;  2PGT A;  3Q19 A;  4CW9 A;  4ZL8 A;  2YAN A;  4Q5R A;  1TRU A;  4YKG A;  4IS0 A;  2X8G A;  1MEK A;  2RM5 A;  3DKS A;  2KP1 A;  2DJJ A;  11GS A;  1SKW B;  1FOH A;  2VLU A;  3RPN A;  4IQA A;  4RQR A;  3F3R A;  1TU8 A;  4OMV A;  5JCW A;  1BG1 A;  2K9F A;  3DGQ A;  1AQX A;  5KOW A;  1BX9 A;  2VL9 A;  3W8S A;  3TU3 B;  4F82 A;  5IOW A;  2DJ3 A;  3NIV A;  1I9D A;  2HLS A;  3I6A A;  3LFL A;  5J4U A;  1GSS A;  2IMI A;  1NW2 A;  2RUF A;  4NV2 A;  4GWR A;  1MD4 A;  3EYT A;  4D73 A;  4MNN A;  1MDJ A;  3GA4 A;  4MZW A;  1XG8 A;  2O7K A;  5CP1 A;  1FOV A;  2VD0 A;  3E0U A;  2JAD A;  4MH3 A;  2HRF A;  2PVQ A;  2WVZ A;  4G01 A;  3A3T A;  4IKH A;  3WD6 A;  1FAA A;  5D9W A;  1OC9 A;  3GIX A;  2IMK A;  4K7I A;  5AN1 A;  3GL5 A;  4KE3 A;  3HD5 A;  2B7K A;  3GNJ A;  4GQF A;  4CY8 A;  1H75 A;  1ABA A;  2K8V A;  5FHI A;  2N5F A;  5DAK B;  2E0Q A;  2GST A;  2JZT A;  1K0B A;  3CSJ A;  3L0H A;  2EFH A;  5ENU A;  5G1L A;  4GRF A;  2I1U A;  2AAW A;  1G7E A;  3CSH A;  5J4Y A;  1CQG A;  3RDW A;  2LQQ A;  2H1B A;  4BL7 B;  1NM3 A;  1PQN A;  1RW1 A;  4MCU A;  4ZL9 A;  3CXG A;  4K7O A;  1Z9H A;  5ECQ B;  2DKH A;  1GTA A;  3TOU A;  1WWJ A;  4HDE A;  3TOT A;  4BVX B;  4JED A;  4ULX A;  2TIR A;  4TVE A;  2VM1 A;  1PKZ A;  5D96 A;  5ECH B;  4O5U A;  1GSQ A;  3RGB C;  1X9S B;  2H72 A;  3KH9 A;  3RHC A;  5IPH A;  4ICY A;  3TJJ A;  2K18 A;  3PIN A;  4PI0 C;  5IMZ A;  2I4A A;  5ELA A;  1IYH A;  3LGC A;  1X5E A;  4JZQ A;  1BG5 A;  3TKQ A;  5B8A A;  4I5Q A;  2R0C A;  3KM6 A;  5EL8 A;  10GS A;  3LEF A;  4MP4 A;  4NXI A;  4EUY A;  2WUL A;  3IHQ A;  1WJK A;  4WET A;  3EU4 A;  3WGE A;  1NHY A;  4IVF A;  1BQ7 A;  4PXO A;  1A8L A;  4OCE A;  3KIJ A;  1EOH A;  1G6W A;  4CDO A;  4NV5 A;  4PUR A;  3EVI A;  3IXR A;  4MJA A;  1O81 A;  2H6Y A;  4JR6 A;  1XCC A;  5BRT A;  3GRX A;  2WB9 A;  1U6T A;  1EV4 A;  3DEX A;  3F0I A;  2XHF A;  5IO2 A;  2H71 A;  2DJ1 A;  3IHG A;  2UZ8 A;  2HFD A;  4L8E A;  1M3I A;  4RQX A;  1TI3 A;  3D6I A;  3ZIT A;  3GSS A;  4YH2 A;  2ZNM A;  2IMF A;  1M2A A;  3W8J A;  1TK8 B;  4GTU A;  1PMT A;  5BMU A;  3UVH A;  3KMN A;  2HSH A;  3L4N A;  4ZBB A;  12GS A;  2H30 A;  4JR4 A;  13GS A;  3LG6 A;  5G30 A;  4MLY A;  5GZZ B;  4AJ8 A;  2A2S A;  5ECL B;  2H0H A;  2PU9 C;  1A8Y A;  5JWO B;  5ECM B;  2NVL A;  4JBB A;  4EKZ A;  1TK5 B;  2WW2 A;  3CRT A;  2WS2 A;  4ZL7 A;  3I43 A;  5A4W A;  4WR4 A;  4AI6 A;  5LD0 A;  2X99 A;  4IQ1 A;  1SEN A;  4OO4 A;  4X43 A;  3ED3 A;  1EP7 A;  4J2F A;  5CRG A;  2C3T A;  2HE3 A;  4AKH A;  1TKD B;  3ZRE A;  3IE3 A;  2CX3 A;  5KOX A;  5F8B A;  1AIU A;  4HSC X;  2PMT A;  5GAN D;  1PL1 A;  3J7Y k;  5B6M A;  1GP1 A;  4OFT A;  1SVL A;  4HZ2 A;  1EP8 A;  1THX A;  5ECO B;  1GWC A;  2OE3 A;  5IOX A;  5ECS A;  3E3E A;  4Q5N A;  3GV1 A;  1PA3 A;  3H8Q A;  3A2X A;  2DSA A;  1G0T A;  2GQL A;  5F06 A;  4TR1 A;  3G7Y A;  1M9B A;  3LJR A;  3ZZX A;  2L6C A;  2GTU A;  2JL4 A;  4QQ7 A;  5DCH A;  5F07 A;  3LSZ A;  4EL1 A;  4MJC A;  4F0B A;  3RBT A;  3WT2 A;  1GLQ A;  1USB A;  3C1S A;  3IAM 2;  1R7H A;  3TUE A;  6GSY A;  1SK1 A;  3FK8 A;  3VWU A;  2LRT A;  3VI7 A;  3HVV A;  4IJ3 A;  3GTU A;  4LMW A;  2H8L A;  1FO5 A;  4PTS A;  1X9W B;  2R3X A;  4Q5F A;  4YQV A;  2KUC A;  1GSU A;  2R2J A;  2H6Z A;  2XC2 A;  1VGL A;  3HY2 A;  3HJO A;  2B7J A;  4E8H A;  2EC4 A;  2ON5 A;  2MMA A;  4DSS B;  1ZYN A;  3PR8 A;  2MMN A;  1QQ2 A;  1THO A;  3UEM A;  3RFR C;  2F8F A;  2HYX A;  4J57 E;  5FT3 A;  3JCM L;  5CRD A;  3ME7 A;  4K5S A;  5D93 A;  5CO3 A;  1SU9 A;  3FR6 A;  4O7H A;  2EIQ A;  5AIS A;  2QKE A;  1R5P A;  4TOP A;  1T7P B;  1SYR A;  1M2B A;  3GFK A;  1E6B A;  2GSR A;  1DUG A;  5EY6 A;  2B5Y A;  4PGT A;  2XPD A;  2C3N A;  1SL0 B;  4QL7 A;  5IIZ A;  2EIO A;  1EGR A;  2VO4 A;  5B6N A;  1PN0 A;  3KZQ A;  1U3A A;  2EFC A;  2MZC A;  2X4A A;  1T00 A;  5L71 A;  3QPM A;  2OE0 A;  2I3Y A;  4KCA A;  4GXZ A;  3APQ A;  4G10 A;  3HCZ A;  4YQU A;  4MJE A;  3KP9 A;  2HRN A;  5IMF A;  1O8X A;  1R4W A;  3DML A;  2VKZ G;  2R5G A;  3C8E A;  2FD3 A;  3GUS A;  4PUA A;  2H1D A;  4HUA A;  5F05 A;  2HQT A;  1A2L A;  2FHE A;  3IR4 A;  3CQF A;  2YWI A;  3UIW A;  5CAX A;  3Q74 A;  2CVB A;  4BWS A;  5C00 A;  1ERU A;  2YOI A;  3IC4 A;  3M8N A;  4Z7X A;  2VD1 A;  1V58 A;  1ST9 A;  3WYW A;  3BJ5 A;  1TP9 A;  3HDC A;  4L0W A;  3CHX C;  2LJR A;  2O89 A;  1GTB A;  2HZE B;  4G0L A;  3HKR A;  3UJ1 A;  4IP6 A;  4BA7 A;  2M72 A;  2J23 A;  4ACS A;  1F3A A;  2AYT A;  5IMA A;  1PFO A;  5DQY A;  2F9S A;  4JRR A;  3HZ4 A;  2X8H A;  2GSS A;  3GN3 A;  2GDR A;  1JLV A;  7GSS A;  2NTO A;  4HOJ A;  4ZB6 A;  4FYU A;  5HR3 A;  3VPT A;  4F2I A;  1BF5 A;  1CQH A;  4J56 E;  1TJD A;  2QGV A;  1M99 A;  1O6J A;  2VL3 A;  1JLW A;  1Q4J A;  2O36 A;  1AQW A;  3DXB A;  3HA9 A;  1V98 A;  5C04 A;  2XBQ A;  2R6K A;  2GGT A;  1S4B P;  3IOS A;  1U87 A;  4K8M A;  3WGX A;  5DAL A;  3CSI A;  2O5V A;  2QSI A;  3W6G A;  1OVN A;  3F8U A;  1Z7P A;  2R0G A;  2DIZ A;  4NWY A;  3KD0 A;  1QK8 A;  5KN2 A;  2P0G A;  4MZB A;  3KTL A;  2GQK A;  4POK A;  1M9A A;  2CA8 A;  3L9V A;  3HXS A;  3ME8 A;  2D2Z A;  4TKY A;  4ID0 A;  1ZMA A;  5ID2 B;  3UOM A;  5A5K A;  1B8X A;  3LYP A;  1MTC A;  2HXK A;  1HYU A;  2CAI A;  3D21 A;  3KXO A;  1ZGN A;  3FW2 A;  2O3E A;  4F0C A;  1M0U A;  4DVC A;  1O8W A;  1QXH A;  4L5O A;  5J40 A;  3UVT A;  3LOR A;  2GT5 A;  4KND A;  4DSR A;  2G0F A;  2OAC A;  3CMI A;  2P5Q A;  1KEB A;  2C1Y A;  1BAY A;  1PX7 A;  4MPF A;  1K0O A;  3M1G A;  2H70 A;  4AKX B;  1ZYE A;  1YKA A;  1WP0 A;  4FIW A;  4TN8 A;  1W89 A;  1EV9 A;  2LST A;  3WT1 A;  1GUH A;  3KH7 A;  4W66 A;  2V2G A;  2WZS A;  1B4P A;  1GSE A;  4X4J A;  3F4S A;  1AAZ A;  3DYR A;  2HI7 A;  2X8C A;  3GKN A;  4IP1 A;  4X0X A;  1YZX A;  3MWH A;  2WVX B;  3DRN A;  1TRV A;  3ZML A;  1X5D A;  4FH8 A;  5A34 B;  1FW1 A;  2GLR A;  2R4V A;  1U88 A;  1SKR B;  1GL8 A;  2MYG A;  2NDO A;  2PUK C;  1PL2 A;  1Z6M A;  2WW1 A;  2LUS A;  1S3R A;  2B5E A;  5JWR B;  2LEG A;  1A2J A;  5ECN B;  5DAK A;  2V1M A;  5IPG A;  2VCT A;  4TR0 A;  5CRW A;  2X49 A;  1ON4 A;  3MAK A;  2JU5 A;  1XW9 A;  1RK4 A;  3S9F A;  2C0D A;  3F6F A;  4PQI A;  4BL7 A;  3GKM A;  1BED A;  1OKT A;  1EEJ A;  8GSS A;  2LNT A;  22GS A;  2BJX A;  3ZIV A;  2MBS A;  4BVX A;  4CY6 A;  1C72 A;  5IMD A;  4A5P A;  2A2P A;  3CTF A;  2M80 A;  1VRS D;  1JZW A;  2C4J A;  1A24 A;  1XOB A;  4OFN A;  2VM2 A;  4HU7 A;  5G1K A;  4ZIJ A;  5DJM A;  3APS A;  1HNB A;  2XPE A;  2BMX A;  3PGT A;  4KW6 A;  1AW9 A;  4GSN A;  1N2A A;  1GUM A;  1S3A A;  4K7N A;  4TXO B;  1GSD A;  1QMV A;  1YF1 A;  2AB6 A;  5J9C A;  5CYY A;  3FY7 A;  3BOA A;  4ZB8 A;  1VF2 A;  4N11 A;  2DLX A;  3H4K A;  1XOA A;  5ABR A;  3VPQ A;  1YKC A;  1Z6N A;  4V1A g;  4K2X A;  2GZZ A;  2YWO A;  4RUV A;  2F3M A;  3KEB A;  2H1G A;  5DCG A;  1UVZ A;  2HZF A;  2R37 A;  1ZOF A;  2FWF A;  3FZ4 A;  4XS4 B;  2PPT A;  4OO5 A;  4K9Z A;  4V2L A;  2UV8 G;  3EWL A;  1HNC A;  3QD9 A;  2A4V A;  4XRD A;  4I2T A;  4XS6 A;  3FRC A;  1EEM A;  1EZK A;  2HRK B;  4ECC A;  5D9T A;  4HI7 A;  2LKU A;  1K0A A;  1QGV A;  2VCV A;  5HFG A;  1YDK A;  3IK9 A;  1N8J A;  1J08 A;  4N10 A;  4QL9 A;  4MH2 A;  2VCW A;  1B9X C;  4KX4 A;  2V41 A;  3GYK A;  3SWL A;  4PUF C;  2LJA A;  5KN1 A;  1GTI A;  3UAP A;  2M46 A;  2CZ3 A;  2OKA A;  5D9X A;  3TKS A;  5ECI B;  3Q6O A;  4GST A;  1YEX A;  2LNS A;  2RLI A;  2X64 A;  1WPI A;  2I81 A;  4NMU A;  3V1W A;  1GSF A;  1SJZ A;  4ZBA A;  4KSO A;  1TRS A;  3TRQ A;  1Z3E A;  4XS1 A;  1M3J A;  3BCI A;  3EMP A;  5F0G A;  3D4T A;  4Z2R A;  3C71 A;  3BCK A;  1SD9 A;  1JZD A;  1GUL A;  2N5A A;  2PVO C;  4CHS A;  1A0F A;  2WRT A;  1DSB A;  3TJF A;  3QAG A;  3ZL5 A;  3EIN A;  1T3B A;  2RUE A;  4EO3 A;  4L0U A;  1YJ6 A;  3L9S A;  4WKW A;  2CAQ A;  2VL2 A;  1VF4 A;  4XTS A;  1TK0 B;  4OD7 A;  2YN1 A;  3LW9 A;  1F2E A;  2N5B A;  2GSQ A;  5IMV A;  4FO5 A;  5HR0 A;  20GS A;  4MF5 A;  4BWQ A;  1KBN A;  4PX1 A;  3O6T A;  2ES7 A;  1WIK A;  4ZIL A;  5J47 A;  4O92 A;  3QCP A;  2IMD A;  3KTB A;  2H01 A;  3C1R A;  5J9B A;  2JZS A;  1ILO A;  6GST A;  1XW6 A;  1O7U A;  1TXU A;  4FXY P;  1F37 A;  5A1N B;  3QFA C;  4KDU A;  2Z9S A;  5KN0 A;  3NZN A;  4HJ2 A;  3TJB A;  2YZU A;  1M2D A;  5LCZ A;  1FVK A;  1XXU A;  2HSM B;  4NHW A;  1VF3 A;  3GST A;  3CYN A;  3A5W A;  3GKX A;  4EIQ A;  2GT6 A;  5A5H B;  3GKK A;  3F9U A;  5IMC A;  1X9M B;  4MF7 A;  1OE8 A;  3QR6 A;  1V9W A;  1B48 A;  4QMK A;  3VLN A;  1E2Y A;  2IWT A;  4DSS A;  3MYD A;  2FY6 A;  3CRU A;  1QFN A;  3L78 A;  2F8A A;  2C0F A;  1PN9 A;  1PX6 A;  2B5X A;  2P31 A;  3QMX A;  4IHU A;  1HQO A;  4OCF A;  4DSQ A;  4K2D A;  3P8W A;  3SBC A;  1MD3 A;  2RII A;  4BIK A;  2B6M A;  4K6X A;  1SVO A;  4ECJ A;  1X5C A;  2YPM A;  5DDL A;  3E9J B;  3P90 A;  5CRE A;  3G7J A;  2B1K A;  1GTU A;  3KCM A;  4KA0 A;  3GMF A;  1XWG A;  4MAB A;  5KN3 A;  3PPU A;  1AC1 A;  1ERW A;  1K3L A;  2VOC A;  1YVL A;  4AJ6 A;  4NPB A;  1G7O A;  2YV7 A;  5DQS A;  1JZR A;  5G5F A;  4KF9 A;  1OKD A;  4PI2 C;  3KMO A;  2QA1 A;  3HVS A;  2HSN B;  4BVY B;  1UC7 A;  5IM9 A;  3TGZ A;  2EIR A;  2C0G A;  4K0N A;  2DMM A;  3BBY A;  3KJY A;  2DJ2 A;  6GSV A;  4L5L A;  1SVM A;  2V6O A;  9GSS A;  5INY A;  1ERT A;  2I9H A;  4GQC A;  6GSU A;  3IV4 A;  3FEU A;  4NAX A;  5G31 A;  1GRX A;  3UAR A;  5AGY A;  1A23 A;  2GQM A;  4Z2T A;  2PWJ A;  1PGT A;  1FVJ A;  4GSS A;  2H66 A;  2HZE A;  5HR1 A;  3IDV A;  2LS5 A;  4ZB9 A;  4N3Z A;  1SL1 B;  5FWG A;  4FYB A;  2A4H A;  1F3B A;  2YP6 A;  4V2M A;  3GL3 A;  5GSS A;  4G2E A;  1TRW A;  2AJQ B;  3ZVJ A;  3D22 A;  2H74 A;  2LV3 A;  2OBI A;  4POM A;  2FWH A;  4E68 A;  4YAV A;  2DBC A;  3IAS 2;  1SL2 B;  3CWG A;  4P3Y B;  18GS A;  4ECI A;  2NPB A;  4BPY A;  1ACV A;  4EDY A;  5ELG A;  2FNO A;  5E4W A;  2ALB A;  2IN3 A;  1TU7 A;  3TB2 A;  1LJR A;  4EF0 A;  1VF1 A;  3P2A A;  4LL4 B;  1HNA A;  2EFE A;  3ERF A;  3IBH A;  4ZXG A;  1ZYP A;  4TR3 A;  2IFQ B;  2O87 A;  1K0M A;  2CZ2 A;  4IEL A;  5AIX A;  2WFC A;  2YWM A;  3AY8 A;  3H1N A;  4OFM A;  3TJK A;  3GX8 A;  1JZO A;  2OA7 A;  4GCI A;  1GH2 A;  3HVX A;  3US3 A;  1SD8 A;  2C80 A;  2WW0 A;  5IQY A;  1WRY A;  1FG4 A;  2L4C A;  5ID2 A;  1YEW C;  3N5O A;  4HS1 A;  5D9V A;  2CT6 A;  1K3Y A;  4IW9 A;  4TRX A;  3R3E A;  1XVW A;  3PH9 A;  3FYG A;  2OJL A;  3OR5 A;  5HFK A;  4GDF A;  2YWN A;  2HT9 A;  3ZVJ D;  4H86 A;  4WXT A;  1FB6 A;  5H5S A;  2YCD A;  1YY7 A;  1WMJ A;  3RHB A;  2YJ7 A;  3EUR A;  4LL1 B;  3GHA A;  4HQS A;  1JHB A;  1RQM A;  3VI5 A;  1NSW A;  5CRH A;  4MA9 A;  2CV4 A;  6GSW A;  4G9H A;  1YQ1 A;  5IO0 A;  2WGR A;  1LBK A;  1N25 A;  3F6D A;  2MBT A;  4N0Z A;  1S3D A;  3IA1 A;  2VCQ A;  2FUG 2;  1SJ6 A;  5EVO A;  3HHV A;  5H5Q A;  1TTZ A;  19GS A;  2H76 A;  3O3T A;  2WVY A;  1J9B A;  3ZYW A;  3VWV A;  2WVX A;  4Z2U A;  2DJK A;  4EXJ A;  5A34 A;  2OE1 A;  1G6Y A;  3Q18 A;  4MPG A;  4LMV A;  3DVX A;  3G9B A;  4YKF A;  4D73 B;  2V6K A;  1K0C A;  1R5A A;  1EOG A;  3FZ9 A;  1YF0 A;  4KGI A;  3LXZ A;  1SKS B;  3TKS C;  3EMX A;  3F63 A;  3VWX A;  2VCX A;  2LRC A;  4G19 A;  2A2R A;  3U5R E;  1T4Y A;  2IIY A;  2H0G A;  5DBQ A;  2TRX A;  2JSZ A;  2J9H A;  3LYK A;  1OC9 B;  3FZ5 A;  3ISO A;  3GUR A;  3H93 A;  5E59 A;  1XVQ A;  2HSY A;  3ZMK A; 
#chains in the Genus database with same CATH homology
 1HD2 A;  4K0G A;  3VWW A;  2H19 A;  2WDU A;  2NBS A;  14GS A;  1Y25 A;  4I8B A;  2VL2 C;  2LQO A;  1ZCP A;  1FHE A;  2B3S A;  2GS3 A;  1T1V A;  2VLT A;  3QAW A;  4DEJ A;  4G0K A;  1OAZ A;  1TOF A;  5HQP A;  5GST A;  1H4O A;  2QC7 A;  4TXO A;  1R26 A;  2L4Q A;  1AXD A;  3DVW A;  4WBJ A;  3HYP A;  3L9U A;  3FR9 A;  3I69 A;  2REM A;  3A2V A;  5AIV A;  5J5N A;  3TKR A;  1BJX A;  2DC5 A;  3NOF A;  1PSQ A;  1GSY A;  4I2U A;  2GZP A;  1XW5 A;  4EC0 A;  1A0R P;  4POL A;  2FCH A;  3TCO A;  1Y1U A;  1PD2 1;  4ISD A;  2O85 A;  2LJK A;  4XS4 A;  1T4Z A;  3RAZ A;  1XZO A;  4V1A p;  3I9V 2;  4G0I A;  2KOK A;  4TR4 A;  2YNX A;  2PER A;  4JE1 A;  3O76 A;  5G2Z A;  1UA5 A;  4AKI A;  1SK0 A;  2QA2 A;  2HRA A;  5COH A;  4IJI A;  2VUP A;  3QDN A;  3WGD A;  1KNG A;  3CBU A;  1TXX A;  4XIH A;  4F9Z A;  5J4V A;  2HRK A;  3EU3 A;  3FR3 A;  4EIP A;  3TRP A;  5A4V A;  3UBL A;  3QOU A;  2HNL A;  1XWA A;  2FGX A;  1S3C A;  2IJY A;  4I6X A;  5A4U A;  3U6V A;  5KEJ A;  4MF6 A;  3MDK A;  5D8I A;  2JZR A;  3QFB C;  4KH7 A;  3P7X A;  2H1L A;  3M9J A;  3UL3 A;  1XWC A;  4GF0 A;  4PNF A;  4LA1 A;  4WF5 A;  2H1A A;  2H75 A;  4PNG A;  2GZY A;  5ECP B;  4FYC A;  3GX0 A;  2IME A;  4XHM A;  5DJL A;  1URM A;  1DE2 A;  4AGS A;  4KCE A;  1XFL A;  4KAE A;  2VAF A;  2VLV A;  1EGO A;  4KSM A;  2BTO T;  4PQH A;  4K5R A;  1M7T A;  1K3O A;  1XWK A;  2G2Q A;  2WCI A;  2R0P A;  2KP2 A;  3TKS E;  5BMU B;  4JU5 A;  3VFI A;  5GAP D;  1K0D A;  2TRC P;  2KLX A;  4WBR D;  4ILF A;  5CNW A;  1XIY A;  1LU4 A;  2YV9 A;  3ZIJ A;  4EDZ A;  4LLR A;  2VCZ A;  3FMW A;  3M3M A;  4HU9 A;  2EFD A;  5G5E A;  4EE0 A;  4O32 A;  1OC8 A;  1ZL9 A;  4ZB7 A;  1WOU A;  3F3Q A;  1J0F A;  2IL3 A;  2FA4 A;  1SK2 A;  3ZLP A;  3ZTL A;  4IGJ A;  2FLS A;  1OE7 A;  3ZFB A;  1X0R A;  2AUV A;  3F4T A;  3APO A;  2E7P A;  1AUC A;  4O5R A;  4O5Q A;  3TRX A;  4WEY A;  1DBY A;  3ERW A;  2F51 A;  3MSZ A;  2K6V A;  1MDI A;  4AJ7 A;  4MDC A;  3UMA A;  2ZCT A;  3IPZ A;  5A1N A;  2OT3 A;  2XBI A;  4K1F A;  5EPF A;  1WE0 A;  3DD3 A;  1ZZY A;  4IBP A;  3M9K A;  1OYJ A;  1ML6 A;  2B1L A;  3VUR A;  2HSM A;  4POB A;  3IC8 A;  1TI1 A;  1AQV A;  4Q5Q A;  2KHP A;  2PBJ A;  3CTG A;  4TR1 B;  2WZ9 A;  4MZC A;  5A5H A;  2H0I A;  1ZYQ B;  2L5O A;  5B7C A;  1TW9 A;  1B9Y C;  3QAV A;  2RM6 A;  5HFI A;  2LTK A;  3KP8 A;  3ZFL A;  3KGK A;  3FHK A;  16GS A;  5JCU A;  3HMJ G;  2DKI A;  4I97 A;  3BD2 A;  3C7M A;  3EE2 A;  1K0N A;  3A5I A;  3LQ7 A;  3ERG A;  2CVK A;  4TW5 A;  2C3Q A;  2GVP A;  1SYX A;  1PRX A;  3VK9 A;  2IPA A;  4TXV A;  1TDI A;  1Z5Y E;  3GTU B;  6GSS A;  3IK7 A;  1OC3 A;  2DIY A;  4XCS A;  4N0V A;  1UN2 A;  2YZH A;  4V2N A;  4HJM A;  2DML A;  3EC3 A;  3ZRD A;  2K8S A;  2CX4 A;  4KB3 A;  2V32 A;  1ERV A;  2PN8 A;  1PKW A;  2O8V B;  2CVD A;  4RI7 A;  3IRA A;  3K8N A;  2VIM A;  1QUW A;  4WF4 A;  2E2G A;  1Y6E A;  1B4Q A;  4AKG A;  2L6D A;  2C0E A;  3FZA A;  4MMM A;  4HQZ A;  2H73 A;  2HSN A;  2DJ0 A;  3HZ8 A;  4BVY A;  2C8U A;  4N30 A;  2L5L A;  3H79 A;  1I5G A;  1Z7R A;  2JSY A;  2ZUP A;  4FQU A;  4GLT A;  3M0F A;  2L59 A;  5DVB A;  1YEP A;  6GSX A;  1KTE A;  1BYE A;  5ECK B;  4MJB A;  4EVM A;  3D0Z A;  3F4R A;  1GNE A;  4X1U A;  5LNK e;  3LXT A;  2CQ9 A;  2FA8 A;  4ECB A;  1O73 A;  2L57 A;  3R2Q A;  1JFU A;  4OWY A;  4USS A;  1V57 A;  2YJH A;  3FKF A;  1T8E B;  4PQ1 A;  4ML6 A;  3J7Y b;  2MMZ A;  4KDY A;  17GS A;  2AHE A;  4KDX A;  4RI6 A;  5H5R A;  3HJM A;  3TJG A;  3C73 A;  2MMO A;  1U3I A;  2JAC A;  1MDK A;  2FWE A;  1XWB A;  1Q98 A;  4AF2 A;  2OAD A;  5HR2 A;  1O85 A;  2LRN A;  3DWV A;  3LWA A;  3G7I A;  4NHZ A;  4YQM A;  3UBK A;  1SJI A;  1XPV A;  4E8E A;  3A2W A;  2IFQ A;  5JCG A;  4ZBD A;  5B8B A;  3MIX A;  4F03 A;  3MNG A;  1XBS A;  4YAP A;  1IYI A;  1FB0 A;  1W4V A;  4ML1 A;  2OBK A;  4MK3 A;  3N9J A;  5D73 A;  3GH6 A;  4HZ4 A;  5J41 A;  3TKP A;  5JWQ B;  4XRA A;  3D4M A;  1DE1 A;  1GNW A;  3D5J A;  2WJU A;  3RPP A;  2AV4 A;  1V2A A;  1A2M A;  5J3R A;  1V40 A;  5DAL B;  1F9M A;  1GUK A;  3GH9 A;  5ECR B;  1NHO A;  3HJP A;  3DIE A;  3EPT A;  2ON7 A;  1F6M C;  2H6X A;  1GLP A;  2P5R A;  1EWX A;  3TDG A;  4IN0 A;  4KUN A;  4HEA 2;  4WR5 A;  2E2M A;  2FWG A;  2PGT A;  3Q19 A;  4CW9 A;  4ZL8 A;  2YAN A;  4Q5R A;  1TRU A;  4YKG A;  4IS0 A;  2X8G A;  1MEK A;  2RM5 A;  3DKS A;  2KP1 A;  2DJJ A;  11GS A;  1SKW B;  1FOH A;  2VLU A;  3RPN A;  4IQA A;  4RQR A;  3F3R A;  1TU8 A;  4OMV A;  5JCW A;  1BG1 A;  2K9F A;  3DGQ A;  1AQX A;  5KOW A;  1BX9 A;  2VL9 A;  3W8S A;  3TU3 B;  4F82 A;  5IOW A;  2DJ3 A;  3NIV A;  1I9D A;  2HLS A;  3I6A A;  3LFL A;  5J4U A;  1GSS A;  2IMI A;  1NW2 A;  2RUF A;  4NV2 A;  4GWR A;  1MD4 A;  3EYT A;  4D73 A;  4MNN A;  1MDJ A;  3GA4 A;  4MZW A;  2O7K A;  5CP1 A;  1FOV A;  2VD0 A;  3E0U A;  2JAD A;  4MH3 A;  2HRF A;  2PVQ A;  4G01 A;  3A3T A;  4IKH A;  3WD6 A;  1FAA A;  5D9W A;  1OC9 A;  3GIX A;  2IMK A;  4K7I A;  5AN1 A;  3GL5 A;  4KE3 A;  3HD5 A;  2B7K A;  3GNJ A;  4GQF A;  4CY8 A;  1H75 A;  1ABA A;  2K8V A;  5FHI A;  2N5F A;  5DAK B;  2E0Q A;  2GST A;  2JZT A;  1K0B A;  3CSJ A;  3L0H A;  2EFH A;  5ENU A;  5G1L A;  4GRF A;  2I1U A;  2AAW A;  1G7E A;  3CSH A;  5J4Y A;  1CQG A;  3RDW A;  2LQQ A;  2H1B A;  4BL7 B;  1NM3 A;  1PQN A;  1RW1 A;  4MCU A;  4ZL9 A;  3CXG A;  4K7O A;  1Z9H A;  5ECQ B;  2DKH A;  1GTA A;  3TOU A;  1WWJ A;  4HDE A;  3TOT A;  4BVX B;  4JED A;  4ULX A;  2TIR A;  4TVE A;  2VM1 A;  1PKZ A;  5D96 A;  5ECH B;  4O5U A;  1GSQ A;  1X9S B;  2H72 A;  3KH9 A;  3RHC A;  5IPH A;  4ICY A;  3TJJ A;  2K18 A;  3PIN A;  5IMZ A;  2I4A A;  5ELA A;  1IYH A;  3LGC A;  1X5E A;  4JZQ A;  1BG5 A;  3TKQ A;  5B8A A;  4I5Q A;  2R0C A;  3KM6 A;  5EL8 A;  10GS A;  3LEF A;  4MP4 A;  4NXI A;  4EUY A;  2WUL A;  3IHQ A;  1WJK A;  4WET A;  3EU4 A;  3WGE A;  1NHY A;  4IVF A;  1BQ7 A;  4PXO A;  1A8L A;  4OCE A;  3KIJ A;  1EOH A;  1G6W A;  4CDO A;  4NV5 A;  4PUR A;  3EVI A;  3IXR A;  4MJA A;  1O81 A;  2H6Y A;  4JR6 A;  1XCC A;  5BRT A;  3GRX A;  2WB9 A;  1U6T A;  1EV4 A;  3DEX A;  3F0I A;  2XHF A;  5IO2 A;  2H71 A;  2DJ1 A;  3IHG A;  2UZ8 A;  2HFD A;  4L8E A;  4RQX A;  1TI3 A;  3D6I A;  3ZIT A;  3GSS A;  4YH2 A;  2ZNM A;  2IMF A;  1M2A A;  3W8J A;  1TK8 B;  4GTU A;  1PMT A;  5BMU A;  3UVH A;  3KMN A;  2HSH A;  3L4N A;  4ZBB A;  12GS A;  2H30 A;  4JR4 A;  13GS A;  3LG6 A;  5G30 A;  4MLY A;  5GZZ B;  4AJ8 A;  2A2S A;  5ECL B;  2H0H A;  2PU9 C;  1A8Y A;  5JWO B;  5ECM B;  2NVL A;  4JBB A;  4EKZ A;  1TK5 B;  3CRT A;  2WS2 A;  4ZL7 A;  3I43 A;  5A4W A;  4WR4 A;  4AI6 A;  5LD0 A;  2X99 A;  4IQ1 A;  1SEN A;  4OO4 A;  4X43 A;  3ED3 A;  1EP7 A;  4J2F A;  5CRG A;  2C3T A;  2HE3 A;  4AKH A;  1TKD B;  3ZRE A;  3IE3 A;  2CX3 A;  5KOX A;  5F8B A;  1AIU A;  2PMT A;  5GAN D;  1PL1 A;  3J7Y k;  5B6M A;  1GP1 A;  4OFT A;  1SVL A;  4HZ2 A;  1EP8 A;  1THX A;  5ECO B;  1GWC A;  2OE3 A;  5IOX A;  5ECS A;  3E3E A;  4Q5N A;  3GV1 A;  1PA3 A;  3H8Q A;  3A2X A;  2DSA A;  1G0T A;  2GQL A;  5F06 A;  4TR1 A;  3G7Y A;  1M9B A;  3LJR A;  3ZZX A;  2L6C A;  2GTU A;  2JL4 A;  4QQ7 A;  5DCH A;  5F07 A;  3LSZ A;  4EL1 A;  4MJC A;  4F0B A;  3RBT A;  3WT2 A;  1GLQ A;  1USB A;  3C1S A;  3IAM 2;  1R7H A;  3TUE A;  6GSY A;  1SK1 A;  3FK8 A;  3VWU A;  2LRT A;  3VI7 A;  3HVV A;  4IJ3 A;  3GTU A;  4LMW A;  2H8L A;  1FO5 A;  4PTS A;  1X9W B;  2R3X A;  4Q5F A;  4YQV A;  2KUC A;  1GSU A;  2R2J A;  2H6Z A;  2XC2 A;  1VGL A;  3HY2 A;  3HJO A;  2B7J A;  4E8H A;  2EC4 A;  2ON5 A;  2MMA A;  4DSS B;  1ZYN A;  3PR8 A;  2MMN A;  1QQ2 A;  1THO A;  3UEM A;  2F8F A;  2HYX A;  4J57 E;  5FT3 A;  3JCM L;  5CRD A;  3ME7 A;  4K5S A;  5D93 A;  5CO3 A;  1SU9 A;  3FR6 A;  4O7H A;  2EIQ A;  5AIS A;  2QKE A;  1R5P A;  4TOP A;  1T7P B;  1SYR A;  1M2B A;  3GFK A;  1E6B A;  2GSR A;  1DUG A;  5EY6 A;  2B5Y A;  4PGT A;  2XPD A;  2C3N A;  1SL0 B;  4QL7 A;  5IIZ A;  2EIO A;  1EGR A;  2VO4 A;  5B6N A;  1PN0 A;  3KZQ A;  1U3A A;  2EFC A;  2MZC A;  2X4A A;  1T00 A;  5L71 A;  3QPM A;  2OE0 A;  2I3Y A;  4KCA A;  4GXZ A;  3APQ A;  4G10 A;  3HCZ A;  4YQU A;  4MJE A;  3KP9 A;  2HRN A;  5IMF A;  1O8X A;  1R4W A;  3DML A;  2VKZ G;  2R5G A;  3C8E A;  2FD3 A;  3GUS A;  4PUA A;  2H1D A;  4HUA A;  5F05 A;  2HQT A;  1A2L A;  2FHE A;  3IR4 A;  2YWI A;  3UIW A;  5CAX A;  3Q74 A;  2CVB A;  4BWS A;  5C00 A;  1ERU A;  2YOI A;  3IC4 A;  3M8N A;  4Z7X A;  2VD1 A;  1V58 A;  1ST9 A;  3WYW A;  3BJ5 A;  1TP9 A;  3HDC A;  4L0W A;  2LJR A;  2O89 A;  1GTB A;  2HZE B;  4G0L A;  3HKR A;  3UJ1 A;  4IP6 A;  4BA7 A;  2M72 A;  2J23 A;  4ACS A;  1F3A A;  2AYT A;  5IMA A;  5DQY A;  2F9S A;  4JRR A;  3HZ4 A;  2X8H A;  2GSS A;  3GN3 A;  2GDR A;  1JLV A;  7GSS A;  2NTO A;  4HOJ A;  4ZB6 A;  4FYU A;  5HR3 A;  3VPT A;  4F2I A;  1BF5 A;  1CQH A;  4J56 E;  1TJD A;  2QGV A;  1M99 A;  1O6J A;  2VL3 A;  1JLW A;  1Q4J A;  1AQW A;  3DXB A;  3HA9 A;  1V98 A;  5C04 A;  2XBQ A;  2R6K A;  2GGT A;  3IOS A;  1U87 A;  4K8M A;  3WGX A;  5DAL A;  3CSI A;  2O5V A;  2QSI A;  3W6G A;  1OVN A;  3F8U A;  1Z7P A;  2R0G A;  2DIZ A;  4NWY A;  3KD0 A;  1QK8 A;  5KN2 A;  2P0G A;  4MZB A;  3KTL A;  2GQK A;  4POK A;  1M9A A;  2CA8 A;  3L9V A;  3HXS A;  3ME8 A;  2D2Z A;  4TKY A;  4ID0 A;  1ZMA A;  5ID2 B;  3UOM A;  5A5K A;  1B8X A;  3LYP A;  1MTC A;  2HXK A;  1HYU A;  2CAI A;  3D21 A;  3KXO A;  1ZGN A;  3FW2 A;  4F0C A;  1M0U A;  4DVC A;  1O8W A;  1QXH A;  4L5O A;  5J40 A;  3UVT A;  3LOR A;  2GT5 A;  4KND A;  4DSR A;  2G0F A;  2OAC A;  3CMI A;  2P5Q A;  1KEB A;  2C1Y A;  1BAY A;  1PX7 A;  4MPF A;  1K0O A;  3M1G A;  2H70 A;  4AKX B;  1ZYE A;  1YKA A;  1WP0 A;  4FIW A;  4TN8 A;  1W89 A;  1EV9 A;  2LST A;  3WT1 A;  1GUH A;  3KH7 A;  4W66 A;  2V2G A;  1B4P A;  1GSE A;  4X4J A;  3F4S A;  1AAZ A;  3DYR A;  2HI7 A;  2X8C A;  3GKN A;  4IP1 A;  4X0X A;  1YZX A;  3MWH A;  3DRN A;  1TRV A;  3ZML A;  1X5D A;  4FH8 A;  5A34 B;  1FW1 A;  2GLR A;  2R4V A;  1U88 A;  1SKR B;  1GL8 A;  2MYG A;  2NDO A;  2PUK C;  1PL2 A;  1Z6M A;  2LUS A;  2B5E A;  5JWR B;  2LEG A;  1A2J A;  5ECN B;  5DAK A;  2V1M A;  5IPG A;  2VCT A;  4TR0 A;  5CRW A;  2X49 A;  1ON4 A;  3MAK A;  2JU5 A;  1XW9 A;  1RK4 A;  3S9F A;  2C0D A;  3F6F A;  4PQI A;  4BL7 A;  3GKM A;  1BED A;  1OKT A;  1EEJ A;  8GSS A;  2LNT A;  22GS A;  2BJX A;  3ZIV A;  2MBS A;  4BVX A;  4CY6 A;  1C72 A;  5IMD A;  4A5P A;  2A2P A;  3CTF A;  2M80 A;  1VRS D;  1JZW A;  2C4J A;  1A24 A;  1XOB A;  4OFN A;  2VM2 A;  4HU7 A;  5G1K A;  4ZIJ A;  5DJM A;  3APS A;  1HNB A;  2XPE A;  2BMX A;  3PGT A;  4KW6 A;  1AW9 A;  4GSN A;  1N2A A;  1GUM A;  1S3A A;  4K7N A;  4TXO B;  1GSD A;  1QMV A;  1YF1 A;  2AB6 A;  5J9C A;  5CYY A;  3FY7 A;  3BOA A;  4ZB8 A;  1VF2 A;  4N11 A;  2DLX A;  3H4K A;  1XOA A;  5ABR A;  3VPQ A;  1YKC A;  1Z6N A;  4V1A g;  4K2X A;  2GZZ A;  2YWO A;  4RUV A;  2F3M A;  3KEB A;  2H1G A;  5DCG A;  1UVZ A;  2HZF A;  2R37 A;  1ZOF A;  2FWF A;  3FZ4 A;  4XS4 B;  2PPT A;  4OO5 A;  4K9Z A;  4V2L A;  2UV8 G;  3EWL A;  1HNC A;  3QD9 A;  2A4V A;  4XRD A;  4I2T A;  4XS6 A;  3FRC A;  1EEM A;  1EZK A;  2HRK B;  4ECC A;  5D9T A;  4HI7 A;  2LKU A;  1K0A A;  1QGV A;  2VCV A;  5HFG A;  1YDK A;  3IK9 A;  1N8J A;  1J08 A;  4N10 A;  4QL9 A;  4MH2 A;  2VCW A;  1B9X C;  4KX4 A;  2V41 A;  3GYK A;  3SWL A;  4PUF C;  2LJA A;  5KN1 A;  1GTI A;  3UAP A;  2M46 A;  2CZ3 A;  2OKA A;  5D9X A;  3TKS A;  5ECI B;  3Q6O A;  4GST A;  1YEX A;  2LNS A;  2RLI A;  2X64 A;  1WPI A;  2I81 A;  4NMU A;  3V1W A;  1GSF A;  1SJZ A;  4ZBA A;  4KSO A;  1TRS A;  3TRQ A;  1Z3E A;  4XS1 A;  3BCI A;  3EMP A;  5F0G A;  3D4T A;  4Z2R A;  3C71 A;  3BCK A;  1SD9 A;  1JZD A;  1GUL A;  2N5A A;  2PVO C;  4CHS A;  1A0F A;  2WRT A;  1DSB A;  3TJF A;  3QAG A;  3ZL5 A;  3EIN A;  1T3B A;  2RUE A;  4EO3 A;  4L0U A;  1YJ6 A;  3L9S A;  4WKW A;  2CAQ A;  2VL2 A;  1VF4 A;  4XTS A;  1TK0 B;  4OD7 A;  2YN1 A;  3LW9 A;  1F2E A;  2N5B A;  2GSQ A;  5IMV A;  4FO5 A;  5HR0 A;  20GS A;  4MF5 A;  4BWQ A;  1KBN A;  4PX1 A;  3O6T A;  2ES7 A;  1WIK A;  4ZIL A;  5J47 A;  4O92 A;  3QCP A;  2IMD A;  3KTB A;  2H01 A;  3C1R A;  5J9B A;  2JZS A;  1ILO A;  6GST A;  1XW6 A;  1O7U A;  1TXU A;  1F37 A;  5A1N B;  3QFA C;  4KDU A;  2Z9S A;  5KN0 A;  3NZN A;  4HJ2 A;  3TJB A;  2YZU A;  1M2D A;  5LCZ A;  1FVK A;  1XXU A;  2HSM B;  4NHW A;  1VF3 A;  3GST A;  3CYN A;  3A5W A;  3GKX A;  4EIQ A;  2GT6 A;  5A5H B;  3GKK A;  3F9U A;  5IMC A;  1X9M B;  4MF7 A;  1OE8 A;  3QR6 A;  1V9W A;  1B48 A;  4QMK A;  3VLN A;  1E2Y A;  2IWT A;  4DSS A;  3MYD A;  2FY6 A;  3CRU A;  1QFN A;  3L78 A;  2F8A A;  2C0F A;  1PN9 A;  1PX6 A;  2B5X A;  2P31 A;  3QMX A;  4IHU A;  1HQO A;  4OCF A;  4DSQ A;  4K2D A;  3P8W A;  3SBC A;  1MD3 A;  2RII A;  2B6M A;  4K6X A;  1SVO A;  4ECJ A;  1X5C A;  2YPM A;  5DDL A;  3E9J B;  3P90 A;  5CRE A;  3G7J A;  2B1K A;  1GTU A;  3KCM A;  4KA0 A;  3GMF A;  1XWG A;  4MAB A;  5KN3 A;  3PPU A;  1AC1 A;  1ERW A;  1K3L A;  2VOC A;  1YVL A;  4AJ6 A;  4NPB A;  1G7O A;  2YV7 A;  5DQS A;  1JZR A;  5G5F A;  4KF9 A;  1OKD A;  3KMO A;  2QA1 A;  3HVS A;  2HSN B;  4BVY B;  1UC7 A;  5IM9 A;  3TGZ A;  2EIR A;  2C0G A;  4K0N A;  2DMM A;  3BBY A;  3KJY A;  2DJ2 A;  6GSV A;  4L5L A;  1SVM A;  2V6O A;  9GSS A;  5INY A;  1ERT A;  2I9H A;  4GQC A;  6GSU A;  3IV4 A;  3FEU A;  4NAX A;  5G31 A;  1GRX A;  3UAR A;  5AGY A;  1A23 A;  2GQM A;  4Z2T A;  2PWJ A;  1PGT A;  1FVJ A;  4GSS A;  2H66 A;  2HZE A;  5HR1 A;  3IDV A;  2LS5 A;  4ZB9 A;  4N3Z A;  1SL1 B;  5FWG A;  4FYB A;  2A4H A;  1F3B A;  2YP6 A;  4V2M A;  3GL3 A;  5GSS A;  4G2E A;  1TRW A;  2AJQ B;  3ZVJ A;  3D22 A;  2H74 A;  2LV3 A;  2OBI A;  4POM A;  2FWH A;  4E68 A;  4YAV A;  2DBC A;  3IAS 2;  1SL2 B;  3CWG A;  4P3Y B;  18GS A;  4ECI A;  2NPB A;  4BPY A;  1ACV A;  4EDY A;  5ELG A;  2FNO A;  5E4W A;  2ALB A;  2IN3 A;  1TU7 A;  3TB2 A;  1LJR A;  4EF0 A;  1VF1 A;  3P2A A;  4LL4 B;  1HNA A;  2EFE A;  3ERF A;  3IBH A;  4ZXG A;  1ZYP A;  4TR3 A;  2IFQ B;  2O87 A;  1K0M A;  2CZ2 A;  4IEL A;  5AIX A;  2WFC A;  2YWM A;  3AY8 A;  3H1N A;  4OFM A;  3TJK A;  3GX8 A;  1JZO A;  2OA7 A;  4GCI A;  1GH2 A;  3HVX A;  3US3 A;  1SD8 A;  2C80 A;  5IQY A;  1WRY A;  1FG4 A;  2L4C A;  5ID2 A;  3N5O A;  4HS1 A;  5D9V A;  2CT6 A;  1K3Y A;  4IW9 A;  4TRX A;  3R3E A;  1XVW A;  3PH9 A;  3FYG A;  2OJL A;  3OR5 A;  5HFK A;  4GDF A;  2YWN A;  2HT9 A;  3ZVJ D;  4H86 A;  4WXT A;  1FB6 A;  5H5S A;  2YCD A;  1YY7 A;  1WMJ A;  3RHB A;  2YJ7 A;  3EUR A;  4LL1 B;  3GHA A;  4HQS A;  1JHB A;  1RQM A;  3VI5 A;  1NSW A;  5CRH A;  4MA9 A;  2CV4 A;  6GSW A;  4G9H A;  1YQ1 A;  5IO0 A;  2WGR A;  1LBK A;  1N25 A;  3F6D A;  2MBT A;  4N0Z A;  1S3D A;  3IA1 A;  2VCQ A;  2FUG 2;  1SJ6 A;  5EVO A;  3HHV A;  5H5Q A;  1TTZ A;  19GS A;  2H76 A;  3O3T A;  1J9B A;  3ZYW A;  3VWV A;  4Z2U A;  2DJK A;  4EXJ A;  5A34 A;  2OE1 A;  1G6Y A;  3Q18 A;  4MPG A;  4LMV A;  3DVX A;  3G9B A;  4YKF A;  4D73 B;  2V6K A;  1K0C A;  1R5A A;  1EOG A;  3FZ9 A;  1YF0 A;  4KGI A;  3LXZ A;  1SKS B;  3TKS C;  3EMX A;  3F63 A;  3VWX A;  2VCX A;  2LRC A;  4G19 A;  2A2R A;  3U5R E;  1T4Y A;  2IIY A;  2H0G A;  5DBQ A;  2TRX A;  2JSZ A;  2J9H A;  3LYK A;  1OC9 B;  3FZ5 A;  3ISO A;  3GUR A;  3H93 A;  5E59 A;  1XVQ A;  2HSY A;  3ZMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...