4L8OA

Crystal structure of a bile-acid 7-alpha dehydratase (clohylem_06634) from clostridium hylemonae dsm 15053 at 2.20 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
168
structure length
164
Chain Sequence
MSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSPNIVTSYLVFHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKLIFTEESKYAGSGVNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bile-acid 7-alpha dehydratase (CLOHYLEM_06634) from Clostridium hylemonae DSM 15053 at 2.20 A resolution
rcsb
source organism Clostridium hylemonae dsm 15053
molecule tags Lyase
molecule keywords Bile acid 7a-dehydratase, BaiE
total genus 49
structure length 164
sequence length 168
ec nomenclature ec 4.2.1.106: Bile-acid 7-alpha-dehydratase.
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4l8oA00
1CQSA 2A15A 3SOAA 3ECFA 1EA2A 1OF5A 3JUQA 5AIIA 3NHXA 8CHOA 2B1XB 3S5CA 4X2HA 1E97A 1JN5A 2F86B 4XBTA 5IENA 3LYGA 3JUNA 1NWWA 4RZMA 4CDLA 1VZZA 3KSPA 2I9WA 4ORLA 3EF8A 3ER7A 3GWRA 5HGRA 1ULJB 1TP6A 2GBXB 1W02A 3A76A 3F7XA 2Z7AA 3GZYB 1GY5A 3B8LA 5CLKA 4HM6B 3K7CA 3VGNA 3ROBA 3JUOA 5D81A 3EQQB 5JPUA 5AIFA 1GYBA 3EJVA 4PEJA 1QJGA 1Z1SA 2HMNB 3CNMA 3EN8A 4HM1B 3T8UA 3G0KA 1OHOA 2HMLB 3G8ZA 4HM4B 4XM4A 3HK4A 4K1UA 5G2GA 4XBXA 3WMDA 4HM7B 2IMJA 5BXQA 1STDA 3NBRA 3EX9A 4H3UA 2BMQB 4LMIA 2RFRA 3HX8A 3MYTA 3HZPA 5IEOA 5AEUB 1O7NB 1ASKA 4HVNA 5IG5A 3T8NA 5D83A 1OPYA 2OWPA 5STDA 2BMOB 2JQ5A 2RCDA 3FGYA 3KZTA 3MKIA 3NV0B 4HM3B 2BMRB 2PZVA 1OHSA 3CU3A 2YFIB 2F99A 1NU3A 3Q90A 1S5AA 4R1KA 2CHCA 3I0YA 2GXFA 1OUNA 4U13A 5AIHA 3CNXA 1DMNA 3DZLA 3FF0A 1W00A 2QGUA 3NUVA 3F7SA 2XSOB 4KVHA 5CF1A 2Z76A 5AI1A 4LEHA 3G16A 3M8CA 4HKVB 1JN5B 5IG0A 4HZ9B 2HMMB 2XSHB 1W01A 4FCJA 5DRVA 5CF2A 3UJMA 1OH0A 2CKFB 3MG1A 1ISKA 2HMKB 1DMMA 4WYKA 5IEPA 3OWUA 4HM8B 5AIGA 1NDOB 3FLJA 5AEWB 1JB2A 3NM2A 1WQLB 3B7CA 1IDPA 3BB9A 4XB5A 3MG3A 3OWSA 4L8OA 3CPOA 1OCVA 4OVMA 3OWYA 1JKGA 1OGXA 3H51A 3OV4A 1SJWA 3NV0A 3OXAA 4WP5A 1OGZA 5CK6A 1K41A 3SEDA 2INXA 2W2CA 3EN1B 1GY6A 3B4OA 1QMAA 2GEYA 3MSOA 5CXOA 2STDA 3EC9A 5IERA 1U5OA 4IIAA 2QIYA 1O7WB 3DXOA 3FF2A 4XDWA 5TGNA 7STDA 1O7GB 2B24B 3UNLA 3GZXB 3KE7A 3DUKA 4X2OA 5JPPA 5FW5A 5KP4A 4K1VA 2UX0A 3E99A 5IF6A 4J9AA 3DM8A 3F40A 1HKXA 1UUWB 4N3VA 3OX9A 5DREA 4HM5B 3FSDA 1Q40B 5KP3A 1W6YA 1O7PB 2XRXB 4L8PA 2R4IA 1UUVB 4STDA 3MG2A 2GEXA 4HJLB 3BLZA 4HM2B 2RGQA 3B4PA 1O7MB 2YFJB 4OUQA 4XBYA 3VSYA 3F14A 1E3RA 3F8HA 4L7KA 3RGAA 4HZBB 4GB5A 1AR0A 1EG9B 2HMJB 2Z77A 1DMQA 1GS3A 3EHCA 4MJDA 4Q53A 3FH1A 3F8XA 3GZRA 1ULIB 5BVBA 3KKGA 4WWUC 1ZX2A 1OF5B 2K54A 3FKAA 4I4KA 3SOYA 5IG4A 1O7HB 1GY7A 2BNGA 2F98A 3EBYA 3JUMA 2GBWB 2HMOB 4HM0B 1JKGB 1BUQA 3DMCA 4LGQA 5KP1A 4XDVA 4R9KA 1E3VA 3JUPA 5D82A 1A2KA 2XR8B 3NXJA 3MHEA 3IPTA 1Q40A 3F9SA 3FZWA 3K0ZA 3STDA 1ZO2A 1JB5A 1Q42A 2YFLB 3D9RA 3RGRA 3GRDA 3H3HA 3GZBA 1TUHA 3EBTA 5EVHA 1OHPA 6STDA 1JB4A 3LZAA 4WYKB 5IG3A 4R9LA 1C7HA 4FCMA 4J8TA
chains in the Genus database with same CATH superfamily
2A15A 1RLSA 2WGQA 2CFLA 1GOYA 3NHXA 8CHOA 2B1XB 5M1AA 1E97A 1JN5A 2XH9A 4ILFA 2Z6BA 4XBTA 5G1LA 5IENA 2OOVC 4O02B 3K5TA 1JJ22 1C54A 1VQ83 4ORLA 2FNQA 3LTBA 3QRDA 4HOHA 5LC7A 3A76A 3CCL3 1BRJA 4EC6A 1GY5A 2FGTA 3GSPA 1W6GA 3VGNA 1A2PA 3CCV3 2W56B 3LOYA 3J7Yd 1KC84 3EQQB 3KCHA 1N5PA 3PGBA 1OACA 1YIJ3 3G0KA 1MWSA 2HMLB 1D6UA 4EYCA 2OOVA 8RNTA 3CCQ3 1STDA 4MEIA 1BNJA 1RGEA 1IK3A 2BU4A 3MYTA 3BNDA 3FG4A 1N5HA 1GD4A 3EE1A 3PXMA 4KT3B 1OPYA 5EEOA 2BMOB 2JQ5A 3MKIA 4OK0A 3D79A 2ML6A 2PZVA 1FUWA 2XF3A 3V92A 4KZ1A 1YI23 2GU1A 2LQVA 1NU3A 1RGLA 1W7CA 4GL6A 1BRHA 1Q864 4R1KA 1RGGA 1OUNA 3DGLA 3URPA 3CNXA 3A5EA 3NM7A 3FF0A 3U1WA 1W00A 1RNTA 1PYLA 1LRAA 5I97A 1UUGB 4N6NB 1NJI4 5JBSA 1NNVA 4GHOA 4HZ9B 2HMMB 5A0OB 3PYJA 1CEWI 3BU4A 6RNTA 3KFQC 1UW1A 1BANA 4HM8B 3WOFB 1NDOB 3ALAA 3FLJA 1YHQ3 1A67A 3S28A 3NM2A 1QVG2 3BB9A 3AHSA 1YJW3 2RSXA 3DY5A 3OWSA 1X1WA 1OCVA 2PNCA 4OVMA 3OV4A 2OTJ3 4WP5A 2OQEA 3SEDA 4EV5A 2W2CA 3Q3FA 1GY6A 2CW9A 3B4OA 2CG1A 1QMAA 4LYLB 1I2GA 3MSOA 5CXOA 2OQEC 4XDWA 2CC3A 2KF6A 2V1LA 3DGMA 2IUKA 1GMRA 1N9JA 1FGMA 3GZXB 4N6LA 2P0MA 3KE7A 3DUKA 3LT8A 3FG3A 1HYFA 1UCLA 5FW5A 1KD14 2E2UA 5IF6A 1YGEA 3DM8A 1UUWB 1Y4KA 2P38A 4WFOA 1W2B2 3ZFZA 1RKYA 5KP3A 4IT7A 2E2VA 1BSDA 1A2VA 2XRXB 1UUVB 3N9HA 1MWTA 4STDA 1LOXA 3MG2A 4HJLB 3HIGA 3B4PA 4HM2B 1LVNA 5FGOA 2YFJB 3F14A 1E3RA 3IJEB 1YVSA 4HZBB 2BO9B 1AR0A 3V98A 4MJDA 5RNTA 4MMZB 1SIIA 2KCDA 1ZX2A 1RGHA 3SOYA 2F98A 1B21A 1K28A 1I0VA 2SARA 1BNGA 1JKGB 1BUQA 5G1KA 4R9KA 2QA43 5D82A 3S27A 3NXJA 2QEX3 3MHEA 3IPTA 3F9SA 1I2FA 2CFGA 4KFFA 4LSOA 3SYUA 5EVHA 3EBTA 2RNTA 2F56A 3WDGB 2YX9A 2WOHA 2XEPA 3Q2PA 4BTWA 4JF8A 1B2XA 4J8TA 1D6ZA 1CQSA 1WMOA 3ECFA 1OF5A 2XFTA 5AIIA 3SX1A 1DYUA 1US1A 3UL6A 1GOUA 1MGRA 4X2HA 1QVF2 5M19A 4IPBA 3JUNA 1NWWA 4RZMA 4CDLA 1K8A4 1VZZA 1T2IA 2I9WA 3GWRA 3ER7A 1BVIA 3X3XA 1MNLA 2KRTA 2UGIA 1M904 2GBXB 1MWUA 1QALA 1TFKA 1IQ8A 3GZYB 3U97A 3ROBA 3JUOA 2ZDJA 5JPUA 5AIFA 1SIHA 1Z1SA 2HMNB 2CWVA 4HM4B 3G8ZA 1RRLA 1KQS2 1IQXA 5BIRA 4HM7B 1G96A 2HOHA 2IMJA 2W9QA 3DH2A 4NREA 2ZA4A 3KSED 1I3FA 1RGKA 1SQWA 2RFRA 3HX8A 5IEOA 1ASKA 1G02A 4HVNA 2OWPA 1B2ZA 4R4KA 4ZM8A 1RGAA 2AADA 2IA7A 2KF4A 3NV0B 1IQYA 4HM3B 1OHSA 4O3VA 5AYSC 1TFOA 3N54B 3G713 2F99A 1S5AA 4DKIA 1K734 1RRHA 2H0IA 3KIIA 3D3LA 2XSOB 3HIIA 4JRFA 1V57A 2KF3A 3SLUA 3WODG 4BL3A 1KSIA 5CF1A 2Z76A 3L0RA 4LEHA 4HKVB 4NPBA 1BNIA 1JN5B 5CF2A 4RNYA 3NX0A 1W01A 4FCJA 1B2MA 1LQGC 1OH0A 4J5KA 3CCU3 1RN7A 4FMAA 5AIGA 4CPKA 1FW7A 3AGOA 5AEWB 4N6V0 3CCE3 1JB2A 3CPW2 3CCM3 4EXRA 1WQLB 4BU4A 3CMA3 4KFDA 3OWYA 1OGXA 1GMQA 4J5GA 2C4BA 4EV2A 3NV0A 3X41A 1IVUA 3DGOA 4N6UA 1K41A 4BTXA 3BIRA 3G4S3 1L5GB 2GEYA 5IERA 3HOHA 4IIAA 2QIYA 1BRGA 2M7OA 2O3OA 2B24B 4BL2A 4CCVA 2CK3H 2W56A 3KN4A 1LNIA 1BRKA 2UX0A 1YJ93 1NB3I 3WA3A 1PY3A 3VF1A 4O2HA 1Q40B 2JDIH 4R80A 1B2UA 1O7PB 1DVCA 1V74A 2K3DA 2R4IA 3EB8A 1WMNA 1LQMB 1UGHI 2W04A 2CX0A 1IV7A 2RGQA 1U8CB 3NBBA 1AY7A 1UGIA 4OUQA 2ZHXB 3AMOB 4XBYA 4BIRA 2CFWA 3RGAA 2K0MA 3NQYA 4GB5A 1BU4A 2Z77A 3EHCA 1BOXA 3F8XA 3DGNA 3D4AA 3LTCA 1BRIA 1BSAA 1I70A 4I4KA 5IG4A 3BNBA 3EBYA 2HMOB 4G1MB 1DVDA 3JUPA 2P05A 1A2KA 1I0XA 1UI7A 2XR8B 3X42A 1Q40A 3STDA 1Q7HA 2CWTA 3WMDA 1MOLA 1Q42A 4WHAA 3RGRA 3GRDA 3H3HA 3GZBA 1TUHA 1NB5I 2W03A 3LT9A 1K9M4 2Y74A 3LZAA 4WYKB 4FCMA 3SOAA 3CME3 1EA2A 4QWTA 2H0GA 3S5CA 3WA2X 2KF5A 2ML5A 1AV4A 3LYGA 1JNQA 1UI8A 1RMSA 1V58A 5ELUA 1LXEA 1BIRA 3KSPA 1M1K4 3EF8A 3O8YA 1GOVA 5HGRA 3CCS3 7RNTA 3I553 1W02A 1A90A 3X40A 1RCKA 2Z7AA 3G6E3 5AYRB 3B8LA 1GSPA 2ZL8A 1LOYA 1RN4A 1HU9A 5D81A 1T5YA 2IYJA 1GYBA 3EJVA 1QJGA 1W2ZA 2CH9A 3CNMA 4HM1B 3T8UA 3UJMA 1W6CA 5AEUB 3FG1A 1FUTA 2F5WA 3HK4A 4K1UA 2E2TA 4XBXA 1RCLA 4MMYB 4XM4A 4AKZA 4BTYA 5BXQA 1VQM3 1S723 1X1YA 2W0QA 4H3UA 3N8BA 3HZPA 1LNHA 1O7NB 3UL5A 1YGWA 2FXTA 2H0HA 2Q07A 3T8NA 3WR2A 1JV2B 2RCDA 3FGYA 3AHWA 4AEQA 1B20A 2BMRB 3JVCA 3Q90A 1Q824 2WOFA 3GAXA 2CHCA 1FUSA 2GXFA 1JBTA 1IU7A 5AIHA 1YJN3 3DZLA 1TU5A 3NUVA 2QGUA 1AQZA 1ROVA 2W9PA 3SXXA 1T3BA 4KVHA 4I5QA 1R4YA 1BNSA 1TTOA 4HBRA 3G16A 1IT8A 1M1XB 3MPHA 5IG0A 1GD3A 1WNHA 3CCR3 2OTL3 1TIJA 1SPUA 2CKFB 3RNTA 2HMKB 1DMMA 4WYKA 5IEPA 3CXC2 1N9EA 1B27A 1BGSA 4FMBA 3WOEB 3B7CA 4O8SA 1CYVA 2AAEA 7GSPA 1RGCA 3NBJA 5CK6A 1I3IA 1SJWA 3OXAA 3PCSA 4KFEA 1I2EA 1ZGXA 2KXGA 3DGYA 1RTUA 3EN1B 1VQK3 3EC9A 2P0XA 1TRQA 5TGNA 1B2SA 4MMXB 4FMDA 4EBGA 4N6MA 1RNBA 2OCTA 4HYZA 5JPPA 1W5ZA 4FMCA 4X2OA 4H61A 4K1VA 1JZOA 3E99A 2KAAA 1VQ53 3F40A 1HKXA 1QAFA 5DREA 1VQL3 4HM5B 1FGRA 3QK9A 1DETA 1WMPA 3IMAB 1X1UA 4N6OB 1CH0A 3I563 3OW22 1N8R4 3BLZA 2C11A 2GU3A 3VSYA 4GSPA 4RNTA 3TDGA 1EG9B 1PFPA 1RGFA 1J2BA 1Q9EA 3FH1A 3GZRA 1M9GA 3D5GA 3CD63 5HOHA 2F4YA 5M18A 2CIUA 2IUJA 1O7HB 2BNGA 2GBWB 2UUGC 1BUJA 4HM0B 1VQ93 3DMCA 5EQLA 1X1XA 4XDVA 5KP1A 1E3VA 1EQKA 2MC8A 1IYYA 2C10A 1TJDA 3FZWA 3K0ZA 2YFLB 1STFI 1FA3A 6STDA 4LZIA 1OHPA 1D6YA 2W6JH 3PS8A 1FYSA 2J8XB 3JUQA 1AVKA 3ZG5A 1FGOA 2O9UX 1W4NA 1JBRA 1BSCA 2F86B 5GSPA 1VQQA 1TRPA 1RHLA 1BSBA 1GMPA 3BNEA 1VQN3 2XFSA 1ULJB 1TP6A 2RBIA 1EUIC 3K63A 4N6TA 3F7XA 5IW9A 2XGLA 3PCRA 1UDII 4K90B 2CX1A 1BAOA 3K7CA 3LTDA 4HM6B 5CLKA 1BRNL 1YIT3 4PEJA 3EN8A 3CCJ3 2MF7A 1OHOA 1IT7A 5G2GA 2CG0A 1KWIA 3BNCA 3CC23 2F5MA 2LYXA 3EX9A 2BT3A 2BMQB 3NBRA 4LMIA 3LMLA 1VQO3 1BNFA 1HZ1A 3AMOA 1F8NA 5IG5A 5D83A 1UCJA 5STDA 1VQ63 3KZTA 2L1SA 4FCZA 2CFKA 3CU3A 2D1WA 2YFIB 1MGWA 3SVAA 1IV9A 4U13A 3I0YA 2SBLA 4CJNA 1DMNA 3V99A 1EKMA 3F7SA 1IVWA 3S29A 2XGNA 9RNTA 1B3SA 3ZG0A 1SARA 1JBSA 5AI1A 3MWZA 2WGOA 3M8CA 1UCIA 2XSHB 5DRVA 4TX4A 1IVXA 1WTHA 3MG1A 1IVVA 1ISKA 1FGQA 1RSNA 3OWUA 1BNRA 2CFDA 1IDPA 4XB5A 3MG3A 4L8OA 3CPOA 3X3ZA 1RN1A 1JKGA 1I8VA 3H51A 1EEJA 1ROAA 1YNVX 3NQZA 5ELJA 1OGZA 1VQ73 1BRSA 1YVBI 3HI7A 1JZDA 2INXA 1JRQA 1LOVA 3UB1A 1R4CA 2BIRA 2D42A 1FGTA 2IY2A 1RDSA 2BHMA 2STDA 2GSPA 1U5OA 3DXOA 1O7WB 3FF2A 3S67A 4AKYA 7STDA 1O7GB 3UNLA 4RBNA 1BNEA 2L4VA 1RJOA 5LC6A 5KP4A 2P09A 3AGNA 3WHOA 4J9AA 3CC73 3CC43 1QAKA 2WO0A 3OX9A 4N3VA 1Q814 1VQ43 4K61A 3FSDA 2R41A 3T0UA 1W6YA 4L8PA 2CWUA 1MWRA 2GEXA 1O7MB 3X3YA 1UCKA 4L7KA 3F8HA 3LTAA 2HMJB 4NHFA 4R9LA 1DMQA 1GS3A 1N8QA 4Q53A 1ULIB 5BU4A 1G0TA 3KKGA 4WWUC 5BVBA 1OF5B 2K54A 3FKAA 1LOWA 4EW5A 1T2HA 1AVLA 1GY7A 3JUMA 2Y73A 4FR9A 1Q7Y4 4LGQA 1PU4A 1FZUA 3FCSB 1CYUA 4RNZA 3Q1CA 4HAAA 3RDEA 6GSPA 3LH4A 1ZO2A 1JB5A 1DE3A 1NO3A 3D9RA 3D5IA 3LXUX 3K9MC 1BSEA 1JB4A 1VQP3 1ZS7A 3PZWA 1C7HA 5IG3A
chains in the Genus database with same CATH topology
2A15A 2WGQA 2CFLA 3NHXA 8CHOA 2B1XB 1E97A 1JN5A 2XH9A 4XBTA 2Z6BA 5IENA 2OOVC 4O02B 3K5TA 1JJ22 1VQ83 4ORLA 2FNQA 3LTBA 3QRDA 5LC7A 3A76A 3CCL3 4EC6A 1GY5A 2FGTA 1W6GA 3VGNA 3CCV3 2W56B 3LOYA 3J7Yd 1KC84 3EQQB 1N5PA 3PGBA 1OACA 1YIJ3 3G0KA 2HMLB 1D6UA 4EYCA 2OOVA 3CCQ3 1STDA 4MEIA 1IK3A 3MYTA 3BNDA 3FG4A 1N5HA 1GD4A 3EE1A 3PXMA 1OPYA 5EEOA 2BMOB 2JQ5A 3MKIA 4OK0A 2ML6A 2PZVA 1FUWA 2XF3A 3V92A 4KZ1A 1YI23 2GU1A 2LQVA 1NU3A 1W7CA 4GL6A 1Q864 4R1KA 1OUNA 3DGLA 3CNXA 3NM7A 3FF0A 3U1WA 1W00A 5I97A 4N6NB 1NJI4 5JBSA 4HZ9B 2HMMB 5A0OB 3PYJA 1CEWI 3KFQC 1UW1A 4HM8B 3WOFB 1NDOB 3ALAA 3FLJA 1YHQ3 1A67A 3S28A 3NM2A 1QVG2 3BB9A 1YJW3 2RSXA 3DY5A 3OWSA 1OCVA 2PNCA 4OVMA 3OV4A 2OTJ3 4WP5A 2OQEA 3SEDA 4EV5A 2W2CA 2CG1A 1GY6A 2CW9A 3B4OA 1QMAA 3MSOA 5CXOA 2OQEC 4XDWA 3DGMA 2CC3A 2V1LA 2IUKA 1N9JA 1FGMA 3GZXB 4N6LA 2P0MA 3KE7A 3DUKA 3LT8A 3FG3A 5FW5A 1KD14 2E2UA 5IF6A 1YGEA 3DM8A 1UUWB 1Y4KA 2P38A 4WFOA 1W2B2 1RKYA 5KP3A 4IT7A 2E2VA 1A2VA 2XRXB 1UUVB 3N9HA 4STDA 1LOXA 3MG2A 4HJLB 3HIGA 3B4PA 4HM2B 1LVNA 5FGOA 2YFJB 3F14A 1E3RA 3IJEB 4HZBB 2BO9B 1AR0A 3V98A 4MJDA 4MMZB 1SIIA 2KCDA 1ZX2A 3SOYA 2F98A 1K28A 1JKGB 1BUQA 4R9KA 2QA43 5D82A 3S27A 3NXJA 2QEX3 3MHEA 3IPTA 3F9SA 2CFGA 4KFFA 4LSOA 5EVHA 3EBTA 3WDGB 2YX9A 2XEPA 2WOHA 3Q2PA 4BTWA 4JF8A 4J8TA 1D6ZA 1CQSA 1WMOA 3ECFA 1OF5A 2XFTA 5AIIA 3SX1A 1DYUA 1US1A 3UL6A 4X2HA 1QVF2 4IPBA 3JUNA 1NWWA 4RZMA 4CDLA 1K8A4 1VZZA 2I9WA 3GWRA 3ER7A 3X3XA 1M904 1MNLA 2KRTA 2GBXB 1QALA 1TFKA 1IQ8A 3GZYB 3U97A 3ROBA 3JUOA 2ZDJA 5JPUA 5AIFA 1SIHA 1Z1SA 2HMNB 2CWVA 4HM4B 3G8ZA 1RRLA 1KQS2 1IQXA 4HM7B 1G96A 2IMJA 2W9QA 4NREA 3KSED 1SQWA 2RFRA 3HX8A 5IEOA 1ASKA 4HVNA 2OWPA 4R4KA 4ZM8A 3NV0B 2IA7A 4HM3B 5AYSC 1IQYA 4O3VA 1OHSA 3G713 1TFOA 3N54B 2F99A 1S5AA 1K734 1RRHA 3KIIA 3D3LA 2XSOB 3HIIA 4JRFA 3SLUA 3WODG 1KSIA 5CF1A 2Z76A 3L0RA 4LEHA 4HKVB 1JN5B 5CF2A 4RNYA 3NX0A 1W01A 4FCJA 1OH0A 3CCU3 1RN7A 4FMAA 5AIGA 3CCE3 5AEWB 4N6V0 3CCM3 1JB2A 3CPW2 4EXRA 1WQLB 3CMA3 4KFDA 3OWYA 1OGXA 4EV2A 3NV0A 3X41A 1IVUA 3DGOA 4N6UA 1K41A 4BTXA 3G4S3 1L5GB 2GEYA 5IERA 4IIAA 2QIYA 2M7OA 2O3OA 2B24B 4CCVA 2CK3H 2W56A 3KN4A 2UX0A 1YJ93 1NB3I 3WA3A 3VF1A 4O2HA 1Q40B 2JDIH 4R80A 1O7PB 1DVCA 1V74A 2R4IA 3EB8A 1WMNA 3NBBA 2W04A 1IV7A 2RGQA 1U8CB 4OUQA 3AMOB 4XBYA 2CFWA 3RGAA 2K0MA 3NQYA 4GB5A 2Z77A 3EHCA 3F8XA 3DGNA 3LTCA 4I4KA 5IG4A 3BNBA 3EBYA 2HMOB 4G1MB 1DVDA 3JUPA 2P05A 1A2KA 1UI7A 2XR8B 3X42A 1Q40A 3STDA 2CWTA 3WMDA 1MOLA 1Q42A 4WHAA 3RGRA 3GRDA 3H3HA 3GZBA 1TUHA 1NB5I 2W03A 3LT9A 1K9M4 2Y74A 3LZAA 4WYKB 4FCMA 3SOAA 3CME3 1EA2A 4QWTA 3S5CA 3WA2X 2ML5A 1AV4A 3LYGA 1JNQA 1UI8A 5ELUA 1LXEA 3KSPA 1M1K4 3EF8A 3O8YA 5HGRA 3CCS3 3I553 1W02A 1A90A 3X40A 2Z7AA 3G6E3 5AYRB 3B8LA 2ZL8A 5D81A 1HU9A 1T5YA 1GYBA 3EJVA 1QJGA 1W2ZA 2CH9A 3CNMA 4HM1B 3T8UA 3UJMA 1W6CA 5AEUB 3FG1A 4XM4A 3HK4A 4K1UA 2E2TA 4XBXA 4MMYB 4BTYA 1S723 4AKZA 5BXQA 1VQM3 2W0QA 4H3UA 3N8BA 3HZPA 1LNHA 1O7NB 3UL5A 2FXTA 2Q07A 3T8NA 4AEQA 1JV2B 2RCDA 3FGYA 2BMRB 3JVCA 3Q90A 1Q824 2WOFA 3GAXA 2CHCA 2GXFA 1IU7A 5AIHA 1YJN3 3DZLA 1TU5A 3NUVA 2QGUA 3SXXA 1ROVA 2W9PA 4KVHA 4HBRA 3G16A 1IT8A 1M1XB 3MPHA 5IG0A 1GD3A 1WNHA 3CCR3 2OTL3 1TIJA 1SPUA 2CKFB 2HMKB 1DMMA 4WYKA 5IEPA 3CXC2 1N9EA 4FMBA 3WOEB 3B7CA 4O8SA 1CYVA 3NBJA 5CK6A 3OXAA 1SJWA 3PCSA 4KFEA 2KXGA 3EN1B 1VQK3 3EC9A 2P0XA 5TGNA 4MMXB 4FMDA 4EBGA 4N6MA 2OCTA 4HYZA 5JPPA 1W5ZA 4FMCA 4X2OA 4H61A 4K1VA 3E99A 1VQ53 3F40A 1HKXA 1QAFA 5DREA 1VQL3 4HM5B 1FGRA 3QK9A 1WMPA 3IMAB 4N6OB 3I563 3OW22 1N8R4 3BLZA 2C11A 2GU3A 3VSYA 3TDGA 1EG9B 1PFPA 1J2BA 3FH1A 3GZRA 1M9GA 3CD63 2CIUA 2IUJA 1O7HB 2BNGA 2GBWB 4HM0B 1VQ93 3DMCA 5EQLA 5KP1A 4XDVA 1E3VA 1EQKA 2MC8A 2C10A 3FZWA 3K0ZA 2YFLB 1STFI 1FA3A 6STDA 4LZIA 1OHPA 1D6YA 2W6JH 3PS8A 3JUQA 1AVKA 1FGOA 2O9UX 1W4NA 2F86B 3BNEA 1VQN3 2XFSA 1ULJB 1TP6A 3K63A 4N6TA 3F7XA 5IW9A 2XGLA 3PCRA 4K90B 5CLKA 3LTDA 3K7CA 4HM6B 1YIT3 4PEJA 3EN8A 3CCJ3 2MF7A 1OHOA 1IT7A 5G2GA 2CG0A 1KWIA 3BNCA 3CC23 2LYXA 3EX9A 2BT3A 2BMQB 3NBRA 4LMIA 3LMLA 1VQO3 3AMOA 1F8NA 5IG5A 5D83A 5STDA 1VQ63 3KZTA 4FCZA 2CFKA 3CU3A 2D1WA 2YFIB 3SVAA 1IV9A 4U13A 3I0YA 2SBLA 1DMNA 3V99A 1EKMA 3F7SA 1IVWA 3S29A 2XGNA 5AI1A 3MWZA 2WGOA 3M8CA 2XSHB 5DRVA 4TX4A 1IVXA 1WTHA 3MG1A 1IVVA 1ISKA 1FGQA 3OWUA 2CFDA 1IDPA 4XB5A 3MG3A 4L8OA 3CPOA 3X3ZA 1JKGA 3H51A 3NQZA 5ELJA 1ROAA 1OGZA 1VQ73 1YVBI 3HI7A 2INXA 1JRQA 3UB1A 1R4CA 2D42A 1FGTA 2BHMA 2STDA 1U5OA 3DXOA 1O7WB 3FF2A 3S67A 4AKYA 7STDA 1O7GB 3UNLA 4RBNA 2L4VA 1RJOA 5LC6A 5KP4A 2P09A 3CC73 4J9AA 3CC43 1QAKA 2WO0A 3OX9A 4N3VA 1Q814 1VQ43 4K61A 3FSDA 3T0UA 1W6YA 4L8PA 2CWUA 2GEXA 1O7MB 3X3YA 4L7KA 3F8HA 3LTAA 2HMJB 4NHFA 4R9LA 1DMQA 1GS3A 1N8QA 4Q53A 1ULIB 5BVBA 3KKGA 4WWUC 1OF5B 2K54A 3FKAA 1AVLA 1GY7A 3JUMA 2Y73A 4FR9A 1Q7Y4 4LGQA 1PU4A 3FCSB 1CYUA 4RNZA 3Q1CA 3RDEA 3LH4A 1ZO2A 1JB5A 1NO3A 3D9RA 3LXUX 3K9MC 1JB4A 1VQP3 3PZWA 1C7HA 5IG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQS A;  2A15 A;  3SOA A;  3ECF A;  1EA2 A;  1OF5 A;  3JUQ A;  5AII A;  3NHX A;  8CHO A;  2B1X B;  3S5C A;  4X2H A;  1E97 A;  1JN5 A;  2F86 B;  4XBT A;  5IEN A;  3LYG A;  3JUN A;  1NWW A;  4RZM A;  4CDL A;  1VZZ A;  3KSP A;  2I9W A;  4ORL A;  3EF8 A;  3ER7 A;  3GWR A;  5HGR A;  1ULJ B;  1TP6 A;  2GBX B;  1W02 A;  3A76 A;  3F7X A;  2Z7A A;  3GZY B;  1GY5 A;  3B8L A;  5CLK A;  4HM6 B;  3K7C A;  3VGN A;  3ROB A;  3JUO A;  5D81 A;  3EQQ B;  5JPU A;  5AIF A;  1GYB A;  3EJV A;  4PEJ A;  1QJG A;  1Z1S A;  2HMN B;  3CNM A;  3EN8 A;  4HM1 B;  3T8U A;  3G0K A;  1OHO A;  2HML B;  3G8Z A;  4HM4 B;  4XM4 A;  3HK4 A;  4K1U A;  5G2G A;  4XBX A;  3WMD A;  4HM7 B;  2IMJ A;  5BXQ A;  1STD A;  3NBR A;  3EX9 A;  4H3U A;  2BMQ B;  4LMI A;  2RFR A;  3HX8 A;  3MYT A;  3HZP A;  5IEO A;  5AEU B;  1O7N B;  1ASK A;  4HVN A;  5IG5 A;  3T8N A;  5D83 A;  1OPY A;  2OWP A;  5STD A;  2BMO B;  2JQ5 A;  2RCD A;  3FGY A;  3KZT A;  3MKI A;  3NV0 B;  4HM3 B;  2BMR B;  2PZV A;  1OHS A;  3CU3 A;  2YFI B;  2F99 A;  1NU3 A;  3Q90 A;  1S5A A;  4R1K A;  2CHC A;  3I0Y A;  2GXF A;  1OUN A;  4U13 A;  5AIH A;  3CNX A;  1DMN A;  3DZL A;  3FF0 A;  1W00 A;  2QGU A;  3NUV A;  3F7S A;  2XSO B;  4KVH A;  5CF1 A;  2Z76 A;  5AI1 A;  4LEH A;  3G16 A;  3M8C A;  4HKV B;  1JN5 B;  5IG0 A;  4HZ9 B;  2HMM B;  2XSH B;  1W01 A;  4FCJ A;  5DRV A;  5CF2 A;  3UJM A;  1OH0 A;  2CKF B;  3MG1 A;  1ISK A;  2HMK B;  1DMM A;  4WYK A;  5IEP A;  3OWU A;  4HM8 B;  5AIG A;  1NDO B;  3FLJ A;  5AEW B;  1JB2 A;  3NM2 A;  1WQL B;  3B7C A;  1IDP A;  3BB9 A;  4XB5 A;  3MG3 A;  3OWS A;  4L8O A;  3CPO A;  1OCV A;  4OVM A;  3OWY A;  1JKG A;  1OGX A;  3H51 A;  3OV4 A;  1SJW A;  3NV0 A;  3OXA A;  4WP5 A;  1OGZ A;  5CK6 A;  1K41 A;  3SED A;  2INX A;  2W2C A;  3EN1 B;  1GY6 A;  3B4O A;  1QMA A;  2GEY A;  3MSO A;  5CXO A;  2STD A;  3EC9 A;  5IER A;  1U5O A;  4IIA A;  2QIY A;  1O7W B;  3DXO A;  3FF2 A;  4XDW A;  5TGN A;  7STD A;  1O7G B;  2B24 B;  3UNL A;  3GZX B;  3KE7 A;  3DUK A;  4X2O A;  5JPP A;  5FW5 A;  5KP4 A;  4K1V A;  2UX0 A;  3E99 A;  5IF6 A;  4J9A A;  3DM8 A;  3F40 A;  1HKX A;  1UUW B;  4N3V A;  3OX9 A;  5DRE A;  4HM5 B;  3FSD A;  1Q40 B;  5KP3 A;  1W6Y A;  1O7P B;  2XRX B;  4L8P A;  2R4I A;  1UUV B;  4STD A;  3MG2 A;  2GEX A;  4HJL B;  3BLZ A;  4HM2 B;  2RGQ A;  3B4P A;  1O7M B;  2YFJ B;  4OUQ A;  4XBY A;  3VSY A;  3F14 A;  1E3R A;  3F8H A;  4L7K A;  3RGA A;  4HZB B;  4GB5 A;  1AR0 A;  1EG9 B;  2HMJ B;  2Z77 A;  1DMQ A;  1GS3 A;  3EHC A;  4MJD A;  4Q53 A;  3FH1 A;  3F8X A;  3GZR A;  1ULI B;  5BVB A;  3KKG A;  4WWU C;  1ZX2 A;  1OF5 B;  2K54 A;  3FKA A;  4I4K A;  3SOY A;  5IG4 A;  1O7H B;  1GY7 A;  2BNG A;  2F98 A;  3EBY A;  3JUM A;  2GBW B;  2HMO B;  4HM0 B;  1JKG B;  1BUQ A;  3DMC A;  4LGQ A;  5KP1 A;  4XDV A;  4R9K A;  1E3V A;  3JUP A;  5D82 A;  1A2K A;  2XR8 B;  3NXJ A;  3MHE A;  3IPT A;  1Q40 A;  3F9S A;  3FZW A;  3K0Z A;  3STD A;  1ZO2 A;  1JB5 A;  1Q42 A;  2YFL B;  3D9R A;  3RGR A;  3GRD A;  3H3H A;  3GZB A;  1TUH A;  3EBT A;  5EVH A;  1OHP A;  6STD A;  1JB4 A;  3LZA A;  4WYK B;  5IG3 A;  4R9L A;  1C7H A;  4FCM A;  4J8T A; 
#chains in the Genus database with same CATH topology
 2A15 A;  1RLS A;  2WGQ A;  2CFL A;  1GOY A;  3NHX A;  8CHO A;  2B1X B;  5M1A A;  1E97 A;  1JN5 A;  2XH9 A;  4ILF A;  2Z6B A;  4XBT A;  5G1L A;  5IEN A;  2OOV C;  4O02 B;  3K5T A;  1JJ2 2;  1C54 A;  1VQ8 3;  4ORL A;  2FNQ A;  3LTB A;  3QRD A;  4HOH A;  5LC7 A;  3A76 A;  3CCL 3;  1BRJ A;  4EC6 A;  1GY5 A;  2FGT A;  3GSP A;  1W6G A;  3VGN A;  1A2P A;  3CCV 3;  2W56 B;  3LOY A;  3J7Y d;  1KC8 4;  3EQQ B;  3KCH A;  1N5P A;  3PGB A;  1OAC A;  1YIJ 3;  3G0K A;  1MWS A;  2HML B;  1D6U A;  4EYC A;  2OOV A;  8RNT A;  3CCQ 3;  1STD A;  4MEI A;  1BNJ A;  1RGE A;  1IK3 A;  2BU4 A;  3MYT A;  3BND A;  3FG4 A;  1N5H A;  1GD4 A;  3EE1 A;  3PXM A;  4KT3 B;  1OPY A;  5EEO A;  2BMO B;  2JQ5 A;  3MKI A;  4OK0 A;  3D79 A;  2ML6 A;  2PZV A;  1FUW A;  2XF3 A;  3V92 A;  4KZ1 A;  1YI2 3;  2GU1 A;  2LQV A;  1NU3 A;  1RGL A;  1W7C A;  4GL6 A;  1BRH A;  1Q86 4;  4R1K A;  1RGG A;  1OUN A;  3DGL A;  3URP A;  3CNX A;  3A5E A;  3NM7 A;  3FF0 A;  3U1W A;  1W00 A;  1RNT A;  1PYL A;  1LRA A;  5I97 A;  1UUG B;  4N6N B;  1NJI 4;  5JBS A;  1NNV A;  4GHO A;  4HZ9 B;  2HMM B;  5A0O B;  3PYJ A;  1CEW I;  3BU4 A;  6RNT A;  3KFQ C;  1UW1 A;  1BAN A;  4HM8 B;  3WOF B;  1NDO B;  3ALA A;  3FLJ A;  1YHQ 3;  1A67 A;  3S28 A;  3NM2 A;  1QVG 2;  3BB9 A;  3AHS A;  1YJW 3;  2RSX A;  3DY5 A;  3OWS A;  1X1W A;  1OCV A;  2PNC A;  4OVM A;  3OV4 A;  2OTJ 3;  4WP5 A;  2OQE A;  3SED A;  4EV5 A;  2W2C A;  3Q3F A;  1GY6 A;  2CW9 A;  3B4O A;  2CG1 A;  1QMA A;  4LYL B;  1I2G A;  3MSO A;  5CXO A;  2OQE C;  4XDW A;  2CC3 A;  2KF6 A;  2V1L A;  3DGM A;  2IUK A;  1GMR A;  1N9J A;  1FGM A;  3GZX B;  4N6L A;  2P0M A;  3KE7 A;  3DUK A;  3LT8 A;  3FG3 A;  1HYF A;  1UCL A;  5FW5 A;  1KD1 4;  2E2U A;  5IF6 A;  1YGE A;  3DM8 A;  1UUW B;  1Y4K A;  2P38 A;  4WFO A;  1W2B 2;  3ZFZ A;  1RKY A;  5KP3 A;  4IT7 A;  2E2V A;  1BSD A;  1A2V A;  2XRX B;  1UUV B;  3N9H A;  1MWT A;  4STD A;  1LOX A;  3MG2 A;  4HJL B;  3HIG A;  3B4P A;  4HM2 B;  1LVN A;  5FGO A;  2YFJ B;  3F14 A;  1E3R A;  3IJE B;  1YVS A;  4HZB B;  2BO9 B;  1AR0 A;  3V98 A;  4MJD A;  5RNT A;  4MMZ B;  1SII A;  2KCD A;  1ZX2 A;  1RGH A;  3SOY A;  2F98 A;  1B21 A;  1K28 A;  1I0V A;  2SAR A;  1BNG A;  1JKG B;  1BUQ A;  5G1K A;  4R9K A;  2QA4 3;  5D82 A;  3S27 A;  3NXJ A;  2QEX 3;  3MHE A;  3IPT A;  3F9S A;  1I2F A;  2CFG A;  4KFF A;  4LSO A;  3SYU A;  5EVH A;  3EBT A;  2RNT A;  2F56 A;  3WDG B;  2YX9 A;  2WOH A;  2XEP A;  3Q2P A;  4BTW A;  4JF8 A;  1B2X A;  4J8T A;  1D6Z A;  1CQS A;  1WMO A;  3ECF A;  1OF5 A;  2XFT A;  5AII A;  3SX1 A;  1DYU A;  1US1 A;  3UL6 A;  1GOU A;  1MGR A;  4X2H A;  1QVF 2;  5M19 A;  4IPB A;  3JUN A;  1NWW A;  4RZM A;  4CDL A;  1K8A 4;  1VZZ A;  1T2I A;  2I9W A;  3GWR A;  3ER7 A;  1BVI A;  3X3X A;  1MNL A;  2KRT A;  2UGI A;  1M90 4;  2GBX B;  1MWU A;  1QAL A;  1TFK A;  1IQ8 A;  3GZY B;  3U97 A;  3ROB A;  3JUO A;  2ZDJ A;  5JPU A;  5AIF A;  1SIH A;  1Z1S A;  2HMN B;  2CWV A;  4HM4 B;  3G8Z A;  1RRL A;  1KQS 2;  1IQX A;  5BIR A;  4HM7 B;  1G96 A;  2HOH A;  2IMJ A;  2W9Q A;  3DH2 A;  4NRE A;  2ZA4 A;  3KSE D;  1I3F A;  1RGK A;  1SQW A;  2RFR A;  3HX8 A;  5IEO A;  1ASK A;  1G02 A;  4HVN A;  2OWP A;  1B2Z A;  4R4K A;  4ZM8 A;  1RGA A;  2AAD A;  2IA7 A;  2KF4 A;  3NV0 B;  1IQY A;  4HM3 B;  1OHS A;  4O3V A;  5AYS C;  1TFO A;  3N54 B;  3G71 3;  2F99 A;  1S5A A;  4DKI A;  1K73 4;  1RRH A;  2H0I A;  3KII A;  3D3L A;  2XSO B;  3HII A;  4JRF A;  1V57 A;  2KF3 A;  3SLU A;  3WOD G;  4BL3 A;  1KSI A;  5CF1 A;  2Z76 A;  3L0R A;  4LEH A;  4HKV B;  4NPB A;  1BNI A;  1JN5 B;  5CF2 A;  4RNY A;  3NX0 A;  1W01 A;  4FCJ A;  1B2M A;  1LQG C;  1OH0 A;  4J5K A;  3CCU 3;  1RN7 A;  4FMA A;  5AIG A;  4CPK A;  1FW7 A;  3AGO A;  5AEW B;  4N6V 0;  3CCE 3;  1JB2 A;  3CPW 2;  3CCM 3;  4EXR A;  1WQL B;  4BU4 A;  3CMA 3;  4KFD A;  3OWY A;  1OGX A;  1GMQ A;  4J5G A;  2C4B A;  4EV2 A;  3NV0 A;  3X41 A;  1IVU A;  3DGO A;  4N6U A;  1K41 A;  4BTX A;  3BIR A;  3G4S 3;  1L5G B;  2GEY A;  5IER A;  3HOH A;  4IIA A;  2QIY A;  1BRG A;  2M7O A;  2O3O A;  2B24 B;  4BL2 A;  4CCV A;  2CK3 H;  2W56 A;  3KN4 A;  1LNI A;  1BRK A;  2UX0 A;  1YJ9 3;  1NB3 I;  3WA3 A;  1PY3 A;  3VF1 A;  4O2H A;  1Q40 B;  2JDI H;  4R80 A;  1B2U A;  1O7P B;  1DVC A;  1V74 A;  2K3D A;  2R4I A;  3EB8 A;  1WMN A;  1LQM B;  1UGH I;  2W04 A;  2CX0 A;  1IV7 A;  2RGQ A;  1U8C B;  3NBB A;  1AY7 A;  1UGI A;  4OUQ A;  2ZHX B;  3AMO B;  4XBY A;  4BIR A;  2CFW A;  3RGA A;  2K0M A;  3NQY A;  4GB5 A;  1BU4 A;  2Z77 A;  3EHC A;  1BOX A;  3F8X A;  3DGN A;  3D4A A;  3LTC A;  1BRI A;  1BSA A;  1I70 A;  4I4K A;  5IG4 A;  3BNB A;  3EBY A;  2HMO B;  4G1M B;  1DVD A;  3JUP A;  2P05 A;  1A2K A;  1I0X A;  1UI7 A;  2XR8 B;  3X42 A;  1Q40 A;  3STD A;  1Q7H A;  2CWT A;  3WMD A;  1MOL A;  1Q42 A;  4WHA A;  3RGR A;  3GRD A;  3H3H A;  3GZB A;  1TUH A;  1NB5 I;  2W03 A;  3LT9 A;  1K9M 4;  2Y74 A;  3LZA A;  4WYK B;  4FCM A;  3SOA A;  3CME 3;  1EA2 A;  4QWT A;  2H0G A;  3S5C A;  3WA2 X;  2KF5 A;  2ML5 A;  1AV4 A;  3LYG A;  1JNQ A;  1UI8 A;  1RMS A;  1V58 A;  5ELU A;  1LXE A;  1BIR A;  3KSP A;  1M1K 4;  3EF8 A;  3O8Y A;  1GOV A;  5HGR A;  3CCS 3;  7RNT A;  3I55 3;  1W02 A;  1A90 A;  3X40 A;  1RCK A;  2Z7A A;  3G6E 3;  5AYR B;  3B8L A;  1GSP A;  2ZL8 A;  1LOY A;  1RN4 A;  1HU9 A;  5D81 A;  1T5Y A;  2IYJ A;  1GYB A;  3EJV A;  1QJG A;  1W2Z A;  2CH9 A;  3CNM A;  4HM1 B;  3T8U A;  3UJM A;  1W6C A;  5AEU B;  3FG1 A;  1FUT A;  2F5W A;  3HK4 A;  4K1U A;  2E2T A;  4XBX A;  1RCL A;  4MMY B;  4XM4 A;  4AKZ A;  4BTY A;  5BXQ A;  1VQM 3;  1S72 3;  1X1Y A;  2W0Q A;  4H3U A;  3N8B A;  3HZP A;  1LNH A;  1O7N B;  3UL5 A;  1YGW A;  2FXT A;  2H0H A;  2Q07 A;  3T8N A;  3WR2 A;  1JV2 B;  2RCD A;  3FGY A;  3AHW A;  4AEQ A;  1B20 A;  2BMR B;  3JVC A;  3Q90 A;  1Q82 4;  2WOF A;  3GAX A;  2CHC A;  1FUS A;  2GXF A;  1JBT A;  1IU7 A;  5AIH A;  1YJN 3;  3DZL A;  1TU5 A;  3NUV A;  2QGU A;  1AQZ A;  1ROV A;  2W9P A;  3SXX A;  1T3B A;  4KVH A;  4I5Q A;  1R4Y A;  1BNS A;  1TTO A;  4HBR A;  3G16 A;  1IT8 A;  1M1X B;  3MPH A;  5IG0 A;  1GD3 A;  1WNH A;  3CCR 3;  2OTL 3;  1TIJ A;  1SPU A;  2CKF B;  3RNT A;  2HMK B;  1DMM A;  4WYK A;  5IEP A;  3CXC 2;  1N9E A;  1B27 A;  1BGS A;  4FMB A;  3WOE B;  3B7C A;  4O8S A;  1CYV A;  2AAE A;  7GSP A;  1RGC A;  3NBJ A;  5CK6 A;  1I3I A;  1SJW A;  3OXA A;  3PCS A;  4KFE A;  1I2E A;  1ZGX A;  2KXG A;  3DGY A;  1RTU A;  3EN1 B;  1VQK 3;  3EC9 A;  2P0X A;  1TRQ A;  5TGN A;  1B2S A;  4MMX B;  4FMD A;  4EBG A;  4N6M A;  1RNB A;  2OCT A;  4HYZ A;  5JPP A;  1W5Z A;  4FMC A;  4X2O A;  4H61 A;  4K1V A;  1JZO A;  3E99 A;  2KAA A;  1VQ5 3;  3F40 A;  1HKX A;  1QAF A;  5DRE A;  1VQL 3;  4HM5 B;  1FGR A;  3QK9 A;  1DET A;  1WMP A;  3IMA B;  1X1U A;  4N6O B;  1CH0 A;  3I56 3;  3OW2 2;  1N8R 4;  3BLZ A;  2C11 A;  2GU3 A;  3VSY A;  4GSP A;  4RNT A;  3TDG A;  1EG9 B;  1PFP A;  1RGF A;  1J2B A;  1Q9E A;  3FH1 A;  3GZR A;  1M9G A;  3D5G A;  3CD6 3;  5HOH A;  2F4Y A;  5M18 A;  2CIU A;  2IUJ A;  1O7H B;  2BNG A;  2GBW B;  2UUG C;  1BUJ A;  4HM0 B;  1VQ9 3;  3DMC A;  5EQL A;  1X1X A;  4XDV A;  5KP1 A;  1E3V A;  1EQK A;  2MC8 A;  1IYY A;  2C10 A;  1TJD A;  3FZW A;  3K0Z A;  2YFL B;  1STF I;  1FA3 A;  6STD A;  4LZI A;  1OHP A;  1D6Y A;  2W6J H;  3PS8 A;  1FYS A;  2J8X B;  3JUQ A;  1AVK A;  3ZG5 A;  1FGO A;  2O9U X;  1W4N A;  1JBR A;  1BSC A;  2F86 B;  5GSP A;  1VQQ A;  1TRP A;  1RHL A;  1BSB A;  1GMP A;  3BNE A;  1VQN 3;  2XFS A;  1ULJ B;  1TP6 A;  2RBI A;  1EUI C;  3K63 A;  4N6T A;  3F7X A;  5IW9 A;  2XGL A;  3PCR A;  1UDI I;  4K90 B;  2CX1 A;  1BAO A;  3K7C A;  3LTD A;  4HM6 B;  5CLK A;  1BRN L;  1YIT 3;  4PEJ A;  3EN8 A;  3CCJ 3;  2MF7 A;  1OHO A;  1IT7 A;  5G2G A;  2CG0 A;  1KWI A;  3BNC A;  3CC2 3;  2F5M A;  2LYX A;  3EX9 A;  2BT3 A;  2BMQ B;  3NBR A;  4LMI A;  3LML A;  1VQO 3;  1BNF A;  1HZ1 A;  3AMO A;  1F8N A;  5IG5 A;  5D83 A;  1UCJ A;  5STD A;  1VQ6 3;  3KZT A;  2L1S A;  4FCZ A;  2CFK A;  3CU3 A;  2D1W A;  2YFI B;  1MGW A;  3SVA A;  1IV9 A;  4U13 A;  3I0Y A;  2SBL A;  4CJN A;  1DMN A;  3V99 A;  1EKM A;  3F7S A;  1IVW A;  3S29 A;  2XGN A;  9RNT A;  1B3S A;  3ZG0 A;  1SAR A;  1JBS A;  5AI1 A;  3MWZ A;  2WGO A;  3M8C A;  1UCI A;  2XSH B;  5DRV A;  4TX4 A;  1IVX A;  1WTH A;  3MG1 A;  1IVV A;  1ISK A;  1FGQ A;  1RSN A;  3OWU A;  1BNR A;  2CFD A;  1IDP A;  4XB5 A;  3MG3 A;  4L8O A;  3CPO A;  3X3Z A;  1RN1 A;  1JKG A;  1I8V A;  3H51 A;  1EEJ A;  1ROA A;  1YNV X;  3NQZ A;  5ELJ A;  1OGZ A;  1VQ7 3;  1BRS A;  1YVB I;  3HI7 A;  1JZD A;  2INX A;  1JRQ A;  1LOV A;  3UB1 A;  1R4C A;  2BIR A;  2D42 A;  1FGT A;  2IY2 A;  1RDS A;  2BHM A;  2STD A;  2GSP A;  1U5O A;  3DXO A;  1O7W B;  3FF2 A;  3S67 A;  4AKY A;  7STD A;  1O7G B;  3UNL A;  4RBN A;  1BNE A;  2L4V A;  1RJO A;  5LC6 A;  5KP4 A;  2P09 A;  3AGN A;  3WHO A;  4J9A A;  3CC7 3;  3CC4 3;  1QAK A;  2WO0 A;  3OX9 A;  4N3V A;  1Q81 4;  1VQ4 3;  4K61 A;  3FSD A;  2R41 A;  3T0U A;  1W6Y A;  4L8P A;  2CWU A;  1MWR A;  2GEX A;  1O7M B;  3X3Y A;  1UCK A;  4L7K A;  3F8H A;  3LTA A;  2HMJ B;  4NHF A;  4R9L A;  1DMQ A;  1GS3 A;  1N8Q A;  4Q53 A;  1ULI B;  5BU4 A;  1G0T A;  3KKG A;  4WWU C;  5BVB A;  1OF5 B;  2K54 A;  3FKA A;  1LOW A;  4EW5 A;  1T2H A;  1AVL A;  1GY7 A;  3JUM A;  2Y73 A;  4FR9 A;  1Q7Y 4;  4LGQ A;  1PU4 A;  1FZU A;  3FCS B;  1CYU A;  4RNZ A;  3Q1C A;  4HAA A;  3RDE A;  6GSP A;  3LH4 A;  1ZO2 A;  1JB5 A;  1DE3 A;  1NO3 A;  3D9R A;  3D5I A;  3LXU X;  3K9M C;  1BSE A;  1JB4 A;  1VQP 3;  1ZS7 A;  3PZW A;  1C7H A;  5IG3 A; 
#chains in the Genus database with same CATH homology
 2A15 A;  2WGQ A;  2CFL A;  3NHX A;  8CHO A;  2B1X B;  1E97 A;  1JN5 A;  2XH9 A;  4XBT A;  2Z6B A;  5IEN A;  2OOV C;  4O02 B;  3K5T A;  1JJ2 2;  1VQ8 3;  4ORL A;  2FNQ A;  3LTB A;  3QRD A;  5LC7 A;  3A76 A;  3CCL 3;  4EC6 A;  1GY5 A;  2FGT A;  1W6G A;  3VGN A;  3CCV 3;  2W56 B;  3LOY A;  3J7Y d;  1KC8 4;  3EQQ B;  1N5P A;  3PGB A;  1OAC A;  1YIJ 3;  3G0K A;  2HML B;  1D6U A;  4EYC A;  2OOV A;  3CCQ 3;  1STD A;  4MEI A;  1IK3 A;  3MYT A;  3BND A;  3FG4 A;  1N5H A;  1GD4 A;  3EE1 A;  3PXM A;  1OPY A;  5EEO A;  2BMO B;  2JQ5 A;  3MKI A;  4OK0 A;  2ML6 A;  2PZV A;  1FUW A;  2XF3 A;  3V92 A;  4KZ1 A;  1YI2 3;  2GU1 A;  2LQV A;  1NU3 A;  1W7C A;  4GL6 A;  1Q86 4;  4R1K A;  1OUN A;  3DGL A;  3CNX A;  3NM7 A;  3FF0 A;  3U1W A;  1W00 A;  5I97 A;  4N6N B;  1NJI 4;  5JBS A;  4HZ9 B;  2HMM B;  5A0O B;  3PYJ A;  1CEW I;  3KFQ C;  1UW1 A;  4HM8 B;  3WOF B;  1NDO B;  3ALA A;  3FLJ A;  1YHQ 3;  1A67 A;  3S28 A;  3NM2 A;  1QVG 2;  3BB9 A;  1YJW 3;  2RSX A;  3DY5 A;  3OWS A;  1OCV A;  2PNC A;  4OVM A;  3OV4 A;  2OTJ 3;  4WP5 A;  2OQE A;  3SED A;  4EV5 A;  2W2C A;  2CG1 A;  1GY6 A;  2CW9 A;  3B4O A;  1QMA A;  3MSO A;  5CXO A;  2OQE C;  4XDW A;  3DGM A;  2CC3 A;  2V1L A;  2IUK A;  1N9J A;  1FGM A;  3GZX B;  4N6L A;  2P0M A;  3KE7 A;  3DUK A;  3LT8 A;  3FG3 A;  5FW5 A;  1KD1 4;  2E2U A;  5IF6 A;  1YGE A;  3DM8 A;  1UUW B;  1Y4K A;  2P38 A;  4WFO A;  1W2B 2;  1RKY A;  5KP3 A;  4IT7 A;  2E2V A;  1A2V A;  2XRX B;  1UUV B;  3N9H A;  4STD A;  1LOX A;  3MG2 A;  4HJL B;  3HIG A;  3B4P A;  4HM2 B;  1LVN A;  5FGO A;  2YFJ B;  3F14 A;  1E3R A;  3IJE B;  4HZB B;  2BO9 B;  1AR0 A;  3V98 A;  4MJD A;  4MMZ B;  1SII A;  2KCD A;  1ZX2 A;  3SOY A;  2F98 A;  1K28 A;  1JKG B;  1BUQ A;  4R9K A;  2QA4 3;  5D82 A;  3S27 A;  3NXJ A;  2QEX 3;  3MHE A;  3IPT A;  3F9S A;  2CFG A;  4KFF A;  4LSO A;  5EVH A;  3EBT A;  3WDG B;  2YX9 A;  2XEP A;  2WOH A;  3Q2P A;  4BTW A;  4JF8 A;  4J8T A;  1D6Z A;  1CQS A;  1WMO A;  3ECF A;  1OF5 A;  2XFT A;  5AII A;  3SX1 A;  1DYU A;  1US1 A;  3UL6 A;  4X2H A;  1QVF 2;  4IPB A;  3JUN A;  1NWW A;  4RZM A;  4CDL A;  1K8A 4;  1VZZ A;  2I9W A;  3GWR A;  3ER7 A;  3X3X A;  1M90 4;  1MNL A;  2KRT A;  2GBX B;  1QAL A;  1TFK A;  1IQ8 A;  3GZY B;  3U97 A;  3ROB A;  3JUO A;  2ZDJ A;  5JPU A;  5AIF A;  1SIH A;  1Z1S A;  2HMN B;  2CWV A;  4HM4 B;  3G8Z A;  1RRL A;  1KQS 2;  1IQX A;  4HM7 B;  1G96 A;  2IMJ A;  2W9Q A;  4NRE A;  3KSE D;  1SQW A;  2RFR A;  3HX8 A;  5IEO A;  1ASK A;  4HVN A;  2OWP A;  4R4K A;  4ZM8 A;  3NV0 B;  2IA7 A;  4HM3 B;  5AYS C;  1IQY A;  4O3V A;  1OHS A;  3G71 3;  1TFO A;  3N54 B;  2F99 A;  1S5A A;  1K73 4;  1RRH A;  3KII A;  3D3L A;  2XSO B;  3HII A;  4JRF A;  3SLU A;  3WOD G;  1KSI A;  5CF1 A;  2Z76 A;  3L0R A;  4LEH A;  4HKV B;  1JN5 B;  5CF2 A;  4RNY A;  3NX0 A;  1W01 A;  4FCJ A;  1OH0 A;  3CCU 3;  1RN7 A;  4FMA A;  5AIG A;  3CCE 3;  5AEW B;  4N6V 0;  3CCM 3;  1JB2 A;  3CPW 2;  4EXR A;  1WQL B;  3CMA 3;  4KFD A;  3OWY A;  1OGX A;  4EV2 A;  3NV0 A;  3X41 A;  1IVU A;  3DGO A;  4N6U A;  1K41 A;  4BTX A;  3G4S 3;  1L5G B;  2GEY A;  5IER A;  4IIA A;  2QIY A;  2M7O A;  2O3O A;  2B24 B;  4CCV A;  2CK3 H;  2W56 A;  3KN4 A;  2UX0 A;  1YJ9 3;  1NB3 I;  3WA3 A;  3VF1 A;  4O2H A;  1Q40 B;  2JDI H;  4R80 A;  1O7P B;  1DVC A;  1V74 A;  2R4I A;  3EB8 A;  1WMN A;  3NBB A;  2W04 A;  1IV7 A;  2RGQ A;  1U8C B;  4OUQ A;  3AMO B;  4XBY A;  2CFW A;  3RGA A;  2K0M A;  3NQY A;  4GB5 A;  2Z77 A;  3EHC A;  3F8X A;  3DGN A;  3LTC A;  4I4K A;  5IG4 A;  3BNB A;  3EBY A;  2HMO B;  4G1M B;  1DVD A;  3JUP A;  2P05 A;  1A2K A;  1UI7 A;  2XR8 B;  3X42 A;  1Q40 A;  3STD A;  2CWT A;  3WMD A;  1MOL A;  1Q42 A;  4WHA A;  3RGR A;  3GRD A;  3H3H A;  3GZB A;  1TUH A;  1NB5 I;  2W03 A;  3LT9 A;  1K9M 4;  2Y74 A;  3LZA A;  4WYK B;  4FCM A;  3SOA A;  3CME 3;  1EA2 A;  4QWT A;  3S5C A;  3WA2 X;  2ML5 A;  1AV4 A;  3LYG A;  1JNQ A;  1UI8 A;  5ELU A;  1LXE A;  3KSP A;  1M1K 4;  3EF8 A;  3O8Y A;  5HGR A;  3CCS 3;  3I55 3;  1W02 A;  1A90 A;  3X40 A;  2Z7A A;  3G6E 3;  5AYR B;  3B8L A;  2ZL8 A;  5D81 A;  1HU9 A;  1T5Y A;  1GYB A;  3EJV A;  1QJG A;  1W2Z A;  2CH9 A;  3CNM A;  4HM1 B;  3T8U A;  3UJM A;  1W6C A;  5AEU B;  3FG1 A;  4XM4 A;  3HK4 A;  4K1U A;  2E2T A;  4XBX A;  4MMY B;  4BTY A;  1S72 3;  4AKZ A;  5BXQ A;  1VQM 3;  2W0Q A;  4H3U A;  3N8B A;  3HZP A;  1LNH A;  1O7N B;  3UL5 A;  2FXT A;  2Q07 A;  3T8N A;  4AEQ A;  1JV2 B;  2RCD A;  3FGY A;  2BMR B;  3JVC A;  3Q90 A;  1Q82 4;  2WOF A;  3GAX A;  2CHC A;  2GXF A;  1IU7 A;  5AIH A;  1YJN 3;  3DZL A;  1TU5 A;  3NUV A;  2QGU A;  3SXX A;  1ROV A;  2W9P A;  4KVH A;  4HBR A;  3G16 A;  1IT8 A;  1M1X B;  3MPH A;  5IG0 A;  1GD3 A;  1WNH A;  3CCR 3;  2OTL 3;  1TIJ A;  1SPU A;  2CKF B;  2HMK B;  1DMM A;  4WYK A;  5IEP A;  3CXC 2;  1N9E A;  4FMB A;  3WOE B;  3B7C A;  4O8S A;  1CYV A;  3NBJ A;  5CK6 A;  3OXA A;  1SJW A;  3PCS A;  4KFE A;  2KXG A;  3EN1 B;  1VQK 3;  3EC9 A;  2P0X A;  5TGN A;  4MMX B;  4FMD A;  4EBG A;  4N6M A;  2OCT A;  4HYZ A;  5JPP A;  1W5Z A;  4FMC A;  4X2O A;  4H61 A;  4K1V A;  3E99 A;  1VQ5 3;  3F40 A;  1HKX A;  1QAF A;  5DRE A;  1VQL 3;  4HM5 B;  1FGR A;  3QK9 A;  1WMP A;  3IMA B;  4N6O B;  3I56 3;  3OW2 2;  1N8R 4;  3BLZ A;  2C11 A;  2GU3 A;  3VSY A;  3TDG A;  1EG9 B;  1PFP A;  1J2B A;  3FH1 A;  3GZR A;  1M9G A;  3CD6 3;  2CIU A;  2IUJ A;  1O7H B;  2BNG A;  2GBW B;  4HM0 B;  1VQ9 3;  3DMC A;  5EQL A;  5KP1 A;  4XDV A;  1E3V A;  1EQK A;  2MC8 A;  2C10 A;  3FZW A;  3K0Z A;  2YFL B;  1STF I;  1FA3 A;  6STD A;  4LZI A;  1OHP A;  1D6Y A;  2W6J H;  3PS8 A;  3JUQ A;  1AVK A;  1FGO A;  2O9U X;  1W4N A;  2F86 B;  3BNE A;  1VQN 3;  2XFS A;  1ULJ B;  1TP6 A;  3K63 A;  4N6T A;  3F7X A;  5IW9 A;  2XGL A;  3PCR A;  4K90 B;  5CLK A;  3LTD A;  3K7C A;  4HM6 B;  1YIT 3;  4PEJ A;  3EN8 A;  3CCJ 3;  2MF7 A;  1OHO A;  1IT7 A;  5G2G A;  2CG0 A;  1KWI A;  3BNC A;  3CC2 3;  2LYX A;  3EX9 A;  2BT3 A;  2BMQ B;  3NBR A;  4LMI A;  3LML A;  1VQO 3;  3AMO A;  1F8N A;  5IG5 A;  5D83 A;  5STD A;  1VQ6 3;  3KZT A;  4FCZ A;  2CFK A;  3CU3 A;  2D1W A;  2YFI B;  3SVA A;  1IV9 A;  4U13 A;  3I0Y A;  2SBL A;  1DMN A;  3V99 A;  1EKM A;  3F7S A;  1IVW A;  3S29 A;  2XGN A;  5AI1 A;  3MWZ A;  2WGO A;  3M8C A;  2XSH B;  5DRV A;  4TX4 A;  1IVX A;  1WTH A;  3MG1 A;  1IVV A;  1ISK A;  1FGQ A;  3OWU A;  2CFD A;  1IDP A;  4XB5 A;  3MG3 A;  4L8O A;  3CPO A;  3X3Z A;  1JKG A;  3H51 A;  3NQZ A;  5ELJ A;  1ROA A;  1OGZ A;  1VQ7 3;  1YVB I;  3HI7 A;  2INX A;  1JRQ A;  3UB1 A;  1R4C A;  2D42 A;  1FGT A;  2BHM A;  2STD A;  1U5O A;  3DXO A;  1O7W B;  3FF2 A;  3S67 A;  4AKY A;  7STD A;  1O7G B;  3UNL A;  4RBN A;  2L4V A;  1RJO A;  5LC6 A;  5KP4 A;  2P09 A;  3CC7 3;  4J9A A;  3CC4 3;  1QAK A;  2WO0 A;  3OX9 A;  4N3V A;  1Q81 4;  1VQ4 3;  4K61 A;  3FSD A;  3T0U A;  1W6Y A;  4L8P A;  2CWU A;  2GEX A;  1O7M B;  3X3Y A;  4L7K A;  3F8H A;  3LTA A;  2HMJ B;  4NHF A;  4R9L A;  1DMQ A;  1GS3 A;  1N8Q A;  4Q53 A;  1ULI B;  5BVB A;  3KKG A;  4WWU C;  1OF5 B;  2K54 A;  3FKA A;  1AVL A;  1GY7 A;  3JUM A;  2Y73 A;  4FR9 A;  1Q7Y 4;  4LGQ A;  1PU4 A;  3FCS B;  1CYU A;  4RNZ A;  3Q1C A;  3RDE A;  3LH4 A;  1ZO2 A;  1JB5 A;  1NO3 A;  3D9R A;  3LXU X;  3K9M C;  1JB4 A;  1VQP 3;  3PZW A;  1C7H A;  5IG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...