4L8RC

Structure of mrna stem-loop, human stem-loop binding protein and 3'hexo ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
67
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein/hydrolase
molecule keywords HISTONE MRNA STEM-LOOP
total genus 21
structure length 67
sequence length 73
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l8rC00
4TUWA 4L8RC 4QOZC
chains in the Genus database with same CATH superfamily
4DR6M 2BJWA 1L8QA 2MROB 2UXDM 3GRVA 4JI1M 1ZAEA 4M0DA 3VKHA 4A3VB 1NJFA 2QNJA 1I4WA 3K9PA 4DBGB 3SAWA 1Q02A 3GRYA 2C99A 7CATA 1JR3E 3LW5F 5KQ8A 2XF3A 2OPFA 1K3XA 2DWNA 3I4YA 4TUWA 4D80A 1J5EM 1XNRM 1HR0M 1N32M 2R18A 3HU3A 2LVPC 1QUTA 4FCTA 2K9DA 1IBKM 1JQJC 2WSCF 4GEWA 4JYAM 4I8OA 4G4NA 4FD2A 1G59A 1GVNA 4B3TM 2R45A 3A45A 3GLGA 2CV0A 3J7AS 5EP3A 4NOOB 2EKKA 2EUCA 3U60B 2DVWB 4IBKA 2R4EA 2FS1A 2CRUA 3IG8A 2UXCM 3SFZA 4GHLA 1ZMVA 3SMSA 4OU7A 2R62A 2ZANA 3Q8GA 2B3TA 2EJSA 4IBBA 3E9SA 3MMPA 4BBAA 4R3DA 1Z59A 3AFHA 2JZ1A 1JR3D 2X4AA 3U61B 2XFSA 1NHGC 4L16A 4Y28F 3HJQA 1IY1A 2GNOA 2KRUA 1GLNA 1YLAA 3GLIE 1PJTA 2L4FA 4FWGA 4IBEA 1NO1A 3GO8A 1HNXM 2DAEA 1XHBA 2HL7A 2KA6B 2ZTDA 3F92A 3AOEA 2G3QA 3B7ZA 4W5WA 4KT0F 2LNHC 4II7A 2C98A 4JN6A 3SYLA 1OQYA 1NV8A 3ZH9B 5KQDA 4G4QA 2JZ0A 3HHWA 4MGIE 2WSEF 1K3WA 1I94M 1MX0A 1N78A 4YY3M 1HT1E 2K0BX 3GRUA 3C9PA 4B7GA 3DA1A 2C9CA 1H6UA 3I4VA 1R7RA 2KZSA 1DGFA 1QAOA 3E21A 1IN5A 1TDHA 1HQYE 4MH0E 2KRKA 3B89A 4LJAA 4P17A 3HGIA 4L8RC 3CGWA 4ZPXA 1OJLA 2RGHA 4G6ZA 3JR4A 2KEBA 3LVVA 3NBXX 2DHYA 2Q2EB 2G8LA 2UU9M 3E46A 3UJNA 1MJGM 1N33M 3MK6A 3L26A 1IXSA 2BWBA 3QYBA 4LGYA 2KZUA 2LVQD 1L1TA 1W5TA 4WP2A 2EKFA 4IJFA 3WHKA 2XFTA 4PDGA 1IBLM 1D2NA 3E4RA 5KPTA 3KS8A 4PDIA 3B7NA 2VQEM 4RF1A 3IG5A 2EO2A 1IN8A 2YFQA 1NY5A 3FKEA 3GRRA 3TWMA 3T6PA 4JI0M 4L4UA 1ZMUA 1TR8A 4DV6M 1NV9A 1PGYA 3SATA 2K47A 1AUAA 4LF4M 1DV0A 1GJTA 1W5SA 4HLQA 1CUKA 5FSWA 3LVWA 1FJGM 2H5XA 5L8RF 1SXJC 4NXNM 3DOAA 4LF5M 5C18A 1R5LA 1SXJB 3SAUA 3TPZA 1TF0B 3R8FA 1L2BA 4MGYE 1IN7A 3DFZA 1AIPC 3GLFE 4REZA 4D82A 4LFBM 5IWAM 2RGOA 4DV1M 8CATA 2Y21A 4KODA 4AW4A 1WGLA 3HKPA 3KOXE 5FTMA 1LV7A 2CE7A 2JY8A 1N36M 3WHLA 4M9ZA 1Q3CA 2RKOA 1VEKA 4CISA 1WR1B 2QBYA 3U6SA 1IY2A 3VKGA 1ZMWA 4HL4A 2UUCM 2J5YA 2R46A 3K1JA 3Q8XA 4LJ4A 3QAUA 1OFHA 3W68A 4DR3M 3J27B 3U6QA 4MGHA 4BLCA 3M0EA 3GPPA 2CEAA 1GKIA 2XZFA 2WSFF 2JXNA 3FRHA 3GLGE 4AI6A 2FNAA 4FVMA 1ZV1A 3AJIB 1JR3A 4CIZA 2V1UA 2YNMD 2CHGA 5EP2A 4MGKE 5BPVA 1XMQM 3T1YM 4FW9A 1IY0A 4NL4H 2DKLA 2LHGA 2LVOC 2X49A 2Z8YM 3FE3A 4JI8M 4QOZC 1G4AE 1WIVA 2P5TA 4CHTB 4LJ9A 3OTOM 4NXMM 4IBIA 4Z8XA 1TH3A 3KDSE 3CTWB 2OO9A 1VDDA 2G5GX 2L09A 3KW6A 2DI0A 4XBOA 4B3RM 5GKNA 2JUJA 4LZJA 4IBCA 3FYCA 3GQ3A 4AG6A 2UUAM 4DV3M 3PVSA 2QHOB 2MGWA 4JI7M 1V33A 3BOSA 2DZNB 1IXRC 5H37D 2HCBA 5FTNA 3C3DA 1XXHE 2LHCA 3L28A 2CHQA 2OOAA 4LGMA 1QVRA 3FTFA 4IIWA 3U6LA 2JNHA 3I04M 2MJ5B 3RFWA 3U6MA 4G4OA 4LJ8A 5EP1A 1Z5BA 1NHWC 1WJ7A 3K2LA 5ITXA 1YSYA 4GMQA 1VG5A 5ITYA 2R4JA 2JY7A 5DYGA 4WURA 1T3TA 2X8AA 3V76A 1R2YA 3GQ4A 1GO5A 1OIPA 2O01F 4LRTA 4DV7M 1G8PA 1Q3BA 2Y20A 3TL4X 4L15A 1VEJA 4BB9A 3HY5A 3H4MA 3BBZA 3FTCA 4L6V6 4XK8F 5F3WA 3FUTA 1QAMA 3U60A 1IN6A 2V6ZM 3TQSA 2N35A 2HAKA 3T1HM 1PJJA 1OKSA 5EXXA 4P16A 4XGIA 1WXQA 4AKIA 2BJVA 3AKZA 4DV4M 1PJIA 2KHHA 2H1RA 4NRWA 3SC3A 4JI3M 4RNAA 2FOIC 4MM3B 2ERCA 4X66M 3JAMS 3U6OA 1Z5AA 2CP8A 1L1ZA 4JI2M 2JP7A 3K9OA 3PNVA 5FTJA 4LF8M 1XNQM 1IM2A 3HHZA 3QYEA 1OIZA 4LF9M 4LJ6A 1IXZA 1QYRA 4KLNA 2FH0A 4FWDA 4GKJM 4DUYM 2KNZA 1E32A 2XGNA 2O25A 4B7HA 4IBJA 5EQTA 2QQ8A 1T43A 1OFIA 2I7NA 2YQZA 3HJSA 3TE6A 4GHAA 2LWXA 4R7GA 5DYIA 2C96A 2R44A 2Y0TA 2L7HA 3A42A 1XXHA 1HNZM 4IBDA 3VK8A 3GLHE 4AQYM 1QZMA 4B08A 4B3MM 3K92A 2KW0A 3MJ5A 3T15A 5JI2E 4DR1M 3LMMA 2I7PA 1TDZA 5FLXS 3FUWA 1D0MA 1GL6A 2CV1A 2GQFA 3THGA 4X65M 4GITA 2AHMA 2DXIA 3LCUA 2L2DA 2VF7A 1PJSA 3VDPA 3LQRA 3L2AA 2CFOA 2JA2A 1QZEA 4CJ6A 3GLFB 1KFVA 4IBFA 1E9SA 2F4VM 3H4JA 1SXJA 4MGZE 4S12A 3CF2A 3CF6E 3FUVA 1QQWA 5IREB 1XMOM 4LF7M 4LFCM 2F5QA 4DR7M 5FTLA 2ZM6M 4OX9M 4I81A 3T38A 4JV5M 2J7NA 3AOGA 3UMMA 4DR2M 1UM8A 1G41A 4JI6M 5FTKA 1KSFX 1DO0A 2E5LM 2R0IA 4DV2M 3LQQA 3ZQJA 3B9PA 3KP0E 2LTUA 4LFAM 3EIEA 5KPZA 1Z6TA 2UUBM 3B74A 1OAOC 2L4EA 4PT5A 3J80S 2VDBB 1Q39A 2F5OA 2XSZA 4Q7JA 4HEOA 2HHHM 3TWLA 3IECA 4DR4M 4GH9A 2DAMA 1F4IA 3L27A 1SXJD 4LRSA 4DUZM 1J7KA 5EP4A 4AZFA 4JXJA 1OAIA 3HJ8A 4LCBA 3U6PA 2D7HA 3RGSA 3R9XB 1R2ZA 3U61A 1Z5CA 5LMUM 1TH2A 3SAVA 2RRUA 2QPAA 3LCVB 3KSXA 1TGUA 4PD2A 1S3SA 1QUSA 3SBJA 3GLIB 4CGYB 2C9OA 2DWZB 4GRIA 4NRVA 3U6EA 4F1IA 5A2QS 2LH0A 1LTMA 4I5SA 3KOZE 3W0FA 2J7OA 3BXWA 4LZZA 4Z6YA 1N77A 1GABA 1EIJA 2APLA 3GPYA 3UZUA 2DAGA 1WHCA 1MU5A 1DO2A 2W82A 1XXHB 2DAIA 2OOBA 4NSOB 2KNAA 3HWSA 2M60A 2LVAA 2K6BA 3W67A 2R65A 2QSFX 3U5ZA 2HKJA 1A5TA 2LXEA 3I51A 3GLGB 3I01M 2KXEA 1YE9A 2VF8A 3FRIA 4M0WA 5EXPA 5ITRA 3FUUA 1NNUC 1QAQA 3J2PB 4KO8A 1PJQA 2VQFM 2EA0A 1YUBA 3ZCBB 3U6CA 2YR0A 5ITXE 2V1CA 3AL0C 4I4LA 2Z4SA 1DGGA 4B7FA 2L7IA 1JB0F 4IJEA 4M9XA 3KFUG 3C3EA 3GPXA 2VIIA 3NBIA 1NVMA 3L25A 3KP1E 4LJ7A 2DWMA 4JI5M 2UXBM 1QDTA 3K8ZA 4NC6A 2JWSA 2F5NA 4GC9A 2JY5A 3HU1A 1XWIA 3VDUA 4LJ5A 3HX3A 3RGPA 2F5PA 2DNAA 1DGHA 3SHFA 4NSRA 4M9SA 1OTRA 2R6FA 4DR5M 4EIWA 2JY6B 1VQ1A 2M5ZA 1C7YA 1GL7A 1KYIA 5C1BA 3A46A 3D8BA 4KHPM 1FNNA 3GP1A 1TTEA 3VLFB 2Z3XA 1ZQ9A 3PNYA 4IBGA 1IBMM 4OVZB 4AKHA 2QP9X 4ITQA 3SYKA 1EE8A 1IN4A 2DAKA 3KOYE 4WW0A 1V34A 1P3QQ 1PRBA 5ITQA 3FYDA 1IQPA 3FTEA 2DENA 4GC5A 3GLFA 4OVZA 4DV0M 1C1KA 1SXJE 2XH9A 3D8LA 4DV5M 1HQCA 1NSFA 2XEPA 1IFYA 4R71A 3QWLA 1K82A 4MB7A 2QCUA 4X62M 3B7QA 1SG9A 4YHHM 4G4RA 4LF6M 3CF0A 1ORYB 3W0LB 1VEGA 1QANA 2D7GA 2QENA 1NY6A 1WGNA 3U6DA 3VK7A 3M6AA 2L6OA 3U5ZB 1DGHB 4L78A 2CHVA 3GLHA 4X64M 2FE8A 2CV2A 5IT9S 2D7EA 3L29A 4PCZA 1E9RA 3DZDA 4UN2B 2DZLA 3SHGB 1R6BX 5ITUA 1PM5A 3IHPA 3GPUA 4LG2A 5KO3A 2FFJA 4GIPA 3J81S 3FD9A 3MHVC 3HU2A 2CUZA 3TWKA 4QHSA 3GQ5A 1V92A 2LBCA 4QNMA 2BWEA 3FUXA 1N75A 2ZAOA 4AG5A 4QNRA 5DFLA 4QHTA 4FCWA 2BNKA 2CWBA 1XB2B 3ILKA 5EXSA 2OQ4A 1HJPA 4QOSA 3HHXA 4D81A 1L2DA 3PFIA 1N34M 1X37A 2MH8A 4ANRA 4B3SM 2HWJA 3EIHA 3VFDA 1L2CA 3JR5A 2KNVA 3KOWE 3SASA 4FWHA 4LY6A 5IZ7D 3HHYA 2MR9A 1HT2E 2O5RA 3AOEC 4RKUF 2ZTCA 4RF0A 2QBYB 3SARA 2Y0QA 4GKKM 3PXGA 2XZUA 1G3IA 1G71A 3AV0A 4AKGA 1J09A 2XSZD 3FTDA 1NNJA 1BVSA 2DHRA 3GLIA 1XC8A 1TH4A 1R4GA 1GJSA 3UK6A 2C5RA 1T6OA 2Z4RA 5E26A 3UGJA 3M7GA 2XLJA 3ZC7B 1IXSB 1VDLA 3C58A 3RE8A 3KXEC 1UFZA 5DNYA 5LMNM 2KDLA 2WZJA 4F2LA 4OW0A 2Z7JA 3HZJA 4JI4M 1DGBA 4FCVA 3NWLA 2A5YB 5BR8M 1QDRA 4G3OA 1D0LA 3SMPA 2LVNC 3GLHB 4K0KM 1D0KA 1MN3A 5E6JA 5ITTA 3A98B 5EJCA 2ZAMA 2ZBKB 1E94E 2F5SA 1EFUB 2QZ4A 1NJGA 3KSJA 5JI3E 3KVWA 5EXTA 2DWLA 3KS4A 3J7BA 2NQ8C 5KPRA 1HNWM 2DZOB 1Y8GA 1RU3A
chains in the Genus database with same CATH topology
4DR6M 2BJWA 1L8QA 2UXDM 3GRVA 4JI1M 1ZAEA 4M0DA 3VKHA 4A3VB 1NJFA 1I4WA 3SAWA 3GRYA 2C99A 7CATA 2OPFA 5KQ8A 2XF3A 1K3XA 2DWNA 3I4YA 4TUWA 4D80A 1J5EM 1XNRM 1HR0M 1N32M 2R18A 3HU3A 4FCTA 1IBKM 1JQJC 4JYAM 4I8OA 4G4NA 4FD2A 1G59A 1GVNA 4B3TM 2R45A 3A45A 3GLGA 2CV0A 3J7AS 5EP3A 4NOOB 2EUCA 3U60B 2DVWB 4IBKA 2R4EA 3IG8A 2UXCM 3SFZA 4GHLA 3SMSA 4OU7A 2R62A 2ZANA 4IBBA 3E9SA 4BBAA 4R3DA 1Z59A 3AFHA 1JR3D 2X4AA 3U61B 2XFSA 1NHGC 4L16A 3HJQA 1IY1A 2KRUA 1GLNA 4IBEA 3GO8A 1HNXM 1XHBA 2HL7A 2KA6B 4W5WA 3AOEA 3SYLA 3U60A 2LNHC 4II7A 2C98A 4JN6A 5KQDA 4G4QA 3ZH9B 3HHWA 4MGIE 1K3WA 1I94M 1MX0A 1N78A 4YY3M 1HT1E 3GRUA 4B7GA 3DA1A 2C9CA 1H6UA 3I4VA 1R7RA 2KZSA 1DGFA 1QAOA 1IN5A 1TDHA 1HQYE 4MH0E 2KRKA 4LJAA 3HGIA 4L8RC 4ZPXA 1OJLA 2RGHA 4G6ZA 3JR4A 2KEBA 3LVVA 2G8LA 2Q2EB 2UU9M 3UJNA 1N33M 3MK6A 3L26A 4LGYA 2KZUA 1L1TA 1W5TA 4IJFA 3WHKA 2XFTA 4PDGA 1IBLM 1D2NA 3E4RA 5KPTA 3KS8A 4PDIA 2VQEM 4RF1A 3IG5A 2EO2A 1IN8A 2YFQA 1NY5A 3FKEA 3GRRA 3TWMA 4JI0M 4L4UA 4DV6M 3SATA 2K47A 4LF4M 1W5SA 4HLQA 5FSWA 3LVWA 1FJGM 1SXJC 4NXNM 3DOAA 4LF5M 5C18A 1SXJB 3SAUA 3TPZA 3R8FA 1L2BA 4MGYE 1IN7A 3DFZA 4REZA 4D82A 4LFBM 5IWAM 2RGOA 4DV1M 8CATA 2Y21A 4KODA 4AW4A 3HKPA 3KOXE 5FTMA 1LV7A 2CE7A 1N36M 3WHLA 4M9ZA 1Q3CA 2RKOA 4CISA 2QBYA 3U6SA 1IY2A 3VKGA 4HL4A 2UUCM 2R46A 3K1JA 3Q8XA 4LJ4A 3QAUA 1OFHA 4DR3M 3J27B 3U6QA 4MGHA 4BLCA 3M0EA 3GPPA 2CEAA 1GKIA 2XZFA 4AI6A 2FNAA 4FVMA 3AJIB 1JR3A 2V1UA 2YNMD 2CHGA 5EP2A 4MGKE 5BPVA 1XMQM 3T1YM 4FW9A 1IY0A 4NL4H 2X49A 4JI8M 4QOZC 1G4AE 2P5TA 4CHTB 4LJ9A 3OTOM 4IBIA 4Z8XA 1TH3A 3KDSE 3CTWB 1VDDA 2G5GX 2L09A 3KW6A 4XBOA 4B3RM 5GKNA 4LZJA 4IBCA 3FYCA 3GQ3A 4AG6A 2UUAM 4DV3M 3PVSA 4JI7M 3BOSA 2DZNB 1IXRC 5H37D 2HCBA 5FTNA 3L28A 2CHQA 4LGMA 1QVRA 3FTFA 4IIWA 3U6LA 3RFWA 3U6MA 4G4OA 4LJ8A 5EP1A 1Z5BA 1NHWC 3K2LA 5ITXA 1YSYA 4GMQA 5ITYA 2R4JA 5DYGA 4WURA 1T3TA 2X8AA 1R2YA 3GQ4A 4LRTA 4DV7M 1Q3BA 1G8PA 2Y20A 3TL4X 4L15A 4BB9A 3H4MA 3FTCA 5F3WA 3FUTA 1QAMA 1IN6A 2V6ZM 3TQSA 1PJJA 3T1HM 5EXXA 4P16A 4XGIA 1WXQA 4AKIA 2BJVA 3AKZA 4DV4M 1PJIA 2H1RA 4NRWA 3SC3A 4JI3M 4RNAA 2FOIC 4MM3B 2ERCA 4X66M 3JAMS 3U6OA 1Z5AA 1L1ZA 4JI2M 3PNVA 5FTJA 1XNQM 4LF8M 1IM2A 3HHZA 4LF9M 4LJ6A 1IXZA 1QYRA 4KLNA 4FWDA 4GKJM 4DUYM 2XGNA 1E32A 4B7HA 4IBJA 5EQTA 2YQZA 1OFIA 2I7NA 3HJSA 3TE6A 4GHAA 2LWXA 4R7GA 5DYIA 2C96A 2Y0TA 2L7HA 3A42A 1XXHA 1HNZM 4IBDA 3VK8A 4AQYM 1QZMA 4B08A 4B3MM 3K92A 2KW0A 3MJ5A 3T15A 5JI2E 4DR1M 3LMMA 2I7PA 1TDZA 5FLXS 3FUWA 1GL6A 2CV1A 3THGA 4X65M 4GITA 2AHMA 2DXIA 3VDPA 3LQRA 3L2AA 2CFOA 2JA2A 3GLFB 1KFVA 4IBFA 1E9SA 2F4VM 4MGZE 1SXJA 4S12A 1XMOM 3CF2A 3CF6E 3FUVA 1QQWA 5IREB 4DR7M 4LF7M 4LFCM 2F5QA 5FTLA 2ZM6M 4OX9M 4I81A 3T38A 4JV5M 2J7NA 3AOGA 3UMMA 4DR2M 1UM8A 1G41A 4JI6M 5FTKA 1KSFX 1DO0A 2E5LM 4DV2M 3LQQA 3B9PA 3KP0E 4LFAM 3EIEA 5KPZA 1Z6TA 2UUBM 4PT5A 3J80S 2F5OA 1Q39A 2HHHM 2XSZA 3TWLA 4DR4M 4GH9A 3L27A 1SXJD 4LRSA 4DUZM 1J7KA 5EP4A 4AZFA 4JXJA 3HJ8A 4LCBA 3U6PA 2D7HA 3RGSA 3R9XB 1R2ZA 3U61A 1Z5CA 5LMUM 1TH2A 3SAVA 4PD2A 2QPAA 3KSXA 1TGUA 1S3SA 3SBJA 3GLIB 4CGYB 2C9OA 2DWZB 4GRIA 4NRVA 3U6EA 5A2QS 2LH0A 4I5SA 3KOZE 3W0FA 2J7OA 4Z6YA 4LZZA 1N77A 3GPYA 3UZUA 1MU5A 1DO2A 2W82A 1XXHB 4NSOB 3HWSA 2M60A 2R65A 3U5ZA 2HKJA 2LXEA 3I51A 3GLGB 2KXEA 1YE9A 4M0WA 5EXPA 5ITRA 3FUUA 1NNUC 1QAQA 3J2PB 4KO8A 2VQFM 2EA0A 3U6CA 1YUBA 3ZCBB 2YR0A 5ITXE 2V1CA 3AL0C 4I4LA 2Z4SA 1DGGA 4B7FA 2L7IA 4IJEA 4M9XA 3KFUG 3GPXA 2VIIA 3NBIA 1NVMA 3L25A 3KP1E 4LJ7A 2DWMA 4JI5M 2UXBM 3K8ZA 2F5NA 4GC9A 3HU1A 1XWIA 3VDUA 4LJ5A 3RGPA 2F5PA 1DGHA 3SHFA 4NSRA 4M9SA 4DR5M 4EIWA 2M5ZA 1GL7A 1KYIA 5C1BA 3A46A 3D8BA 4KHPM 1FNNA 3GP1A 3VLFB 2Z3XA 1ZQ9A 3PNYA 4IBGA 1IBMM 4OVZB 4AKHA 2QP9X 4ITQA 3SYKA 1EE8A 1IN4A 3KOYE 4WW0A 5ITQA 3FYDA 1IQPA 3FTEA 4GC5A 3GLFA 4OVZA 4DV0M 1C1KA 1SXJE 2XH9A 3D8LA 4DV5M 1HQCA 1NSFA 2XEPA 3QWLA 1K82A 4MB7A 2QCUA 4X62M 4YHHM 4G4RA 4LF6M 3CF0A 1ORYB 3W0LB 1QANA 2D7GA 2QENA 1NY6A 3U6DA 3VK7A 3M6AA 2L6OA 3U5ZB 1DGHB 4L78A 2CHVA 3GLHA 4X64M 2FE8A 2CV2A 5IT9S 2D7EA 3L29A 4PCZA 1E9RA 3DZDA 4NXMM 3SHGB 5ITUA 1R6BX 1PM5A 4LG2A 3GPUA 5KO3A 2FFJA 4GIPA 3J81S 3FD9A 3MHVC 3HU2A 2CUZA 3TWKA 4QHSA 3GQ5A 4QNMA 3FUXA 1N75A 2ZAOA 4AG5A 4QNRA 4QHTA 4FCWA 2BNKA 3ILKA 5EXSA 2OQ4A 4QOSA 3HHXA 4D81A 1L2DA 3PFIA 1N34M 1X37A 4B3SM 3EIHA 3VFDA 1L2CA 3JR5A 3KOWE 3SASA 4FWHA 4LY6A 5IZ7D 3HHYA 1HT2E 2O5RA 3AOEC 4RF0A 2QBYB 3SARA 2Y0QA 4GKKM 3PXGA 2XZUA 1G3IA 3AV0A 4AKGA 1J09A 2XSZD 3FTDA 1NNJA 2DHRA 3GLIA 1XC8A 1TH4A 3UK6A 2C5RA 2Z4RA 3UGJA 5E26A 2XLJA 3M7GA 3ZC7B 1IXSB 3C58A 3RE8A 3KXEC 5DNYA 5LMNM 4OW0A 2Z7JA 4JI4M 1DGBA 4FCVA 3NWLA 2A5YB 5BR8M 3SMPA 3GLHB 4K0KM 5ITTA 5E6JA 3A98B 5EJCA 2ZAMA 2ZBKB 1E94E 2F5SA 2QZ4A 5JI3E 1NJGA 3KSJA 3KVWA 5EXTA 2DWLA 3KS4A 3J7BA 2NQ8C 5KPRA 1HNWM 2DZOB 4FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUW A;  4L8R C;  4QOZ C; 
#chains in the Genus database with same CATH topology
 4DR6 M;  2BJW A;  1L8Q A;  2MRO B;  2UXD M;  3GRV A;  4JI1 M;  1ZAE A;  4M0D A;  3VKH A;  4A3V B;  1NJF A;  2QNJ A;  1I4W A;  3K9P A;  4DBG B;  3SAW A;  1Q02 A;  3GRY A;  2C99 A;  7CAT A;  1JR3 E;  3LW5 F;  5KQ8 A;  2XF3 A;  2OPF A;  1K3X A;  2DWN A;  3I4Y A;  4TUW A;  4D80 A;  1J5E M;  1XNR M;  1HR0 M;  1N32 M;  2R18 A;  3HU3 A;  2LVP C;  1QUT A;  4FCT A;  2K9D A;  1IBK M;  1JQJ C;  2WSC F;  4GEW A;  4JYA M;  4I8O A;  4G4N A;  4FD2 A;  1G59 A;  1GVN A;  4B3T M;  2R45 A;  3A45 A;  3GLG A;  2CV0 A;  3J7A S;  5EP3 A;  4NOO B;  2EKK A;  2EUC A;  3U60 B;  2DVW B;  4IBK A;  2R4E A;  2FS1 A;  2CRU A;  3IG8 A;  2UXC M;  3SFZ A;  4GHL A;  1ZMV A;  3SMS A;  4OU7 A;  2R62 A;  2ZAN A;  3Q8G A;  2B3T A;  2EJS A;  4IBB A;  3E9S A;  3MMP A;  4BBA A;  4R3D A;  1Z59 A;  3AFH A;  2JZ1 A;  1JR3 D;  2X4A A;  3U61 B;  2XFS A;  1NHG C;  4L16 A;  4Y28 F;  3HJQ A;  1IY1 A;  2GNO A;  2KRU A;  1GLN A;  1YLA A;  3GLI E;  1PJT A;  2L4F A;  4FWG A;  4IBE A;  1NO1 A;  3GO8 A;  1HNX M;  2DAE A;  1XHB A;  2HL7 A;  2KA6 B;  2ZTD A;  3F92 A;  3AOE A;  2G3Q A;  3B7Z A;  4W5W A;  4KT0 F;  2LNH C;  4II7 A;  2C98 A;  4JN6 A;  3SYL A;  1OQY A;  1NV8 A;  3ZH9 B;  5KQD A;  4G4Q A;  2JZ0 A;  3HHW A;  4MGI E;  2WSE F;  1K3W A;  1I94 M;  1MX0 A;  1N78 A;  4YY3 M;  1HT1 E;  2K0B X;  3GRU A;  3C9P A;  4B7G A;  3DA1 A;  2C9C A;  1H6U A;  3I4V A;  1R7R A;  2KZS A;  1DGF A;  1QAO A;  3E21 A;  1IN5 A;  1TDH A;  1HQY E;  4MH0 E;  2KRK A;  3B89 A;  4LJA A;  4P17 A;  3HGI A;  4L8R C;  3CGW A;  4ZPX A;  1OJL A;  2RGH A;  4G6Z A;  3JR4 A;  2KEB A;  3LVV A;  3NBX X;  2DHY A;  2Q2E B;  2G8L A;  2UU9 M;  3E46 A;  3UJN A;  1MJG M;  1N33 M;  3MK6 A;  3L26 A;  1IXS A;  2BWB A;  3QYB A;  4LGY A;  2KZU A;  2LVQ D;  1L1T A;  1W5T A;  4WP2 A;  2EKF A;  4IJF A;  3WHK A;  2XFT A;  4PDG A;  1IBL M;  1D2N A;  3E4R A;  5KPT A;  3KS8 A;  4PDI A;  3B7N A;  2VQE M;  4RF1 A;  3IG5 A;  2EO2 A;  1IN8 A;  2YFQ A;  1NY5 A;  3FKE A;  3GRR A;  3TWM A;  3T6P A;  4JI0 M;  4L4U A;  1ZMU A;  1TR8 A;  4DV6 M;  1NV9 A;  1PGY A;  3SAT A;  2K47 A;  1AUA A;  4LF4 M;  1DV0 A;  1GJT A;  1W5S A;  4HLQ A;  1CUK A;  5FSW A;  3LVW A;  1FJG M;  2H5X A;  5L8R F;  1SXJ C;  4NXN M;  3DOA A;  4LF5 M;  5C18 A;  1R5L A;  1SXJ B;  3SAU A;  3TPZ A;  1TF0 B;  3R8F A;  1L2B A;  4MGY E;  1IN7 A;  3DFZ A;  1AIP C;  3GLF E;  4REZ A;  4D82 A;  4LFB M;  5IWA M;  2RGO A;  4DV1 M;  8CAT A;  2Y21 A;  4KOD A;  4AW4 A;  1WGL A;  3HKP A;  3KOX E;  5FTM A;  1LV7 A;  2CE7 A;  2JY8 A;  1N36 M;  3WHL A;  4M9Z A;  1Q3C A;  2RKO A;  1VEK A;  4CIS A;  1WR1 B;  2QBY A;  3U6S A;  1IY2 A;  3VKG A;  1ZMW A;  4HL4 A;  2UUC M;  2J5Y A;  2R46 A;  3K1J A;  3Q8X A;  4LJ4 A;  3QAU A;  1OFH A;  3W68 A;  4DR3 M;  3J27 B;  3U6Q A;  4MGH A;  4BLC A;  3M0E A;  3GPP A;  2CEA A;  1GKI A;  2XZF A;  2WSF F;  2JXN A;  3FRH A;  3GLG E;  4AI6 A;  2FNA A;  4FVM A;  1ZV1 A;  3AJI B;  1JR3 A;  4CIZ A;  2V1U A;  2YNM D;  2CHG A;  5EP2 A;  4MGK E;  5BPV A;  1XMQ M;  3T1Y M;  4FW9 A;  1IY0 A;  4NL4 H;  2DKL A;  2LHG A;  2LVO C;  2X49 A;  2Z8Y M;  3FE3 A;  4JI8 M;  4QOZ C;  1G4A E;  1WIV A;  2P5T A;  4CHT B;  4LJ9 A;  3OTO M;  4NXM M;  4IBI A;  4Z8X A;  1TH3 A;  3KDS E;  3CTW B;  2OO9 A;  1VDD A;  2G5G X;  2L09 A;  3KW6 A;  2DI0 A;  4XBO A;  4B3R M;  5GKN A;  2JUJ A;  4LZJ A;  4IBC A;  3FYC A;  3GQ3 A;  4AG6 A;  2UUA M;  4DV3 M;  3PVS A;  2QHO B;  2MGW A;  4JI7 M;  1V33 A;  3BOS A;  2DZN B;  1IXR C;  5H37 D;  2HCB A;  5FTN A;  3C3D A;  1XXH E;  2LHC A;  3L28 A;  2CHQ A;  2OOA A;  4LGM A;  1QVR A;  3FTF A;  4IIW A;  3U6L A;  2JNH A;  3I04 M;  2MJ5 B;  3RFW A;  3U6M A;  4G4O A;  4LJ8 A;  5EP1 A;  1Z5B A;  1NHW C;  1WJ7 A;  3K2L A;  5ITX A;  1YSY A;  4GMQ A;  1VG5 A;  5ITY A;  2R4J A;  2JY7 A;  5DYG A;  4WUR A;  1T3T A;  2X8A A;  3V76 A;  1R2Y A;  3GQ4 A;  1GO5 A;  1OIP A;  2O01 F;  4LRT A;  4DV7 M;  1G8P A;  1Q3B A;  2Y20 A;  3TL4 X;  4L15 A;  1VEJ A;  4BB9 A;  3HY5 A;  3H4M A;  3BBZ A;  3FTC A;  4L6V 6;  4XK8 F;  5F3W A;  3FUT A;  1QAM A;  3U60 A;  1IN6 A;  2V6Z M;  3TQS A;  2N35 A;  2HAK A;  3T1H M;  1PJJ A;  1OKS A;  5EXX A;  4P16 A;  4XGI A;  1WXQ A;  4AKI A;  2BJV A;  3AKZ A;  4DV4 M;  1PJI A;  2KHH A;  2H1R A;  4NRW A;  3SC3 A;  4JI3 M;  4RNA A;  2FOI C;  4MM3 B;  2ERC A;  4X66 M;  3JAM S;  3U6O A;  1Z5A A;  2CP8 A;  1L1Z A;  4JI2 M;  2JP7 A;  3K9O A;  3PNV A;  5FTJ A;  4LF8 M;  1XNQ M;  1IM2 A;  3HHZ A;  3QYE A;  1OIZ A;  4LF9 M;  4LJ6 A;  1IXZ A;  1QYR A;  4KLN A;  2FH0 A;  4FWD A;  4GKJ M;  4DUY M;  2KNZ A;  1E32 A;  2XGN A;  2O25 A;  4B7H A;  4IBJ A;  5EQT A;  2QQ8 A;  1T43 A;  1OFI A;  2I7N A;  2YQZ A;  3HJS A;  3TE6 A;  4GHA A;  2LWX A;  4R7G A;  5DYI A;  2C96 A;  2R44 A;  2Y0T A;  2L7H A;  3A42 A;  1XXH A;  1HNZ M;  4IBD A;  3VK8 A;  3GLH E;  4AQY M;  1QZM A;  4B08 A;  4B3M M;  3K92 A;  2KW0 A;  3MJ5 A;  3T15 A;  5JI2 E;  4DR1 M;  3LMM A;  2I7P A;  1TDZ A;  5FLX S;  3FUW A;  1D0M A;  1GL6 A;  2CV1 A;  2GQF A;  3THG A;  4X65 M;  4GIT A;  2AHM A;  2DXI A;  3LCU A;  2L2D A;  2VF7 A;  1PJS A;  3VDP A;  3LQR A;  3L2A A;  2CFO A;  2JA2 A;  1QZE A;  4CJ6 A;  3GLF B;  1KFV A;  4IBF A;  1E9S A;  2F4V M;  3H4J A;  1SXJ A;  4MGZ E;  4S12 A;  3CF2 A;  3CF6 E;  3FUV A;  1QQW A;  5IRE B;  1XMO M;  4LF7 M;  4LFC M;  2F5Q A;  4DR7 M;  5FTL A;  2ZM6 M;  4OX9 M;  4I81 A;  3T38 A;  4JV5 M;  2J7N A;  3AOG A;  3UMM A;  4DR2 M;  1UM8 A;  1G41 A;  4JI6 M;  5FTK A;  1KSF X;  1DO0 A;  2E5L M;  2R0I A;  4DV2 M;  3LQQ A;  3ZQJ A;  3B9P A;  3KP0 E;  2LTU A;  4LFA M;  3EIE A;  5KPZ A;  1Z6T A;  2UUB M;  3B74 A;  1OAO C;  2L4E A;  4PT5 A;  3J80 S;  2VDB B;  1Q39 A;  2F5O A;  2XSZ A;  4Q7J A;  4HEO A;  2HHH M;  3TWL A;  3IEC A;  4DR4 M;  4GH9 A;  2DAM A;  1F4I A;  3L27 A;  1SXJ D;  4LRS A;  4DUZ M;  1J7K A;  5EP4 A;  4AZF A;  4JXJ A;  1OAI A;  3HJ8 A;  4LCB A;  3U6P A;  2D7H A;  3RGS A;  3R9X B;  1R2Z A;  3U61 A;  1Z5C A;  5LMU M;  1TH2 A;  3SAV A;  2RRU A;  2QPA A;  3LCV B;  3KSX A;  1TGU A;  4PD2 A;  1S3S A;  1QUS A;  3SBJ A;  3GLI B;  4CGY B;  2C9O A;  2DWZ B;  4GRI A;  4NRV A;  3U6E A;  4F1I A;  5A2Q S;  2LH0 A;  1LTM A;  4I5S A;  3KOZ E;  3W0F A;  2J7O A;  3BXW A;  4LZZ A;  4Z6Y A;  1N77 A;  1GAB A;  1EIJ A;  2APL A;  3GPY A;  3UZU A;  2DAG A;  1WHC A;  1MU5 A;  1DO2 A;  2W82 A;  1XXH B;  2DAI A;  2OOB A;  4NSO B;  2KNA A;  3HWS A;  2M60 A;  2LVA A;  2K6B A;  3W67 A;  2R65 A;  2QSF X;  3U5Z A;  2HKJ A;  1A5T A;  2LXE A;  3I51 A;  3GLG B;  3I01 M;  2KXE A;  1YE9 A;  2VF8 A;  3FRI A;  4M0W A;  5EXP A;  5ITR A;  3FUU A;  1NNU C;  1QAQ A;  3J2P B;  4KO8 A;  1PJQ A;  2VQF M;  2EA0 A;  1YUB A;  3ZCB B;  3U6C A;  2YR0 A;  5ITX E;  2V1C A;  3AL0 C;  4I4L A;  2Z4S A;  1DGG A;  4B7F A;  2L7I A;  1JB0 F;  4IJE A;  4M9X A;  3KFU G;  3C3E A;  3GPX A;  2VII A;  3NBI A;  1NVM A;  3L25 A;  3KP1 E;  4LJ7 A;  2DWM A;  4JI5 M;  2UXB M;  1QDT A;  3K8Z A;  4NC6 A;  2JWS A;  2F5N A;  4GC9 A;  2JY5 A;  3HU1 A;  1XWI A;  3VDU A;  4LJ5 A;  3HX3 A;  3RGP A;  2F5P A;  2DNA A;  1DGH A;  3SHF A;  4NSR A;  4M9S A;  1OTR A;  2R6F A;  4DR5 M;  4EIW A;  2JY6 B;  1VQ1 A;  2M5Z A;  1C7Y A;  1GL7 A;  1KYI A;  5C1B A;  3A46 A;  3D8B A;  4KHP M;  1FNN A;  3GP1 A;  1TTE A;  3VLF B;  2Z3X A;  1ZQ9 A;  3PNY A;  4IBG A;  1IBM M;  4OVZ B;  4AKH A;  2QP9 X;  4ITQ A;  3SYK A;  1EE8 A;  1IN4 A;  2DAK A;  3KOY E;  4WW0 A;  1V34 A;  1P3Q Q;  1PRB A;  5ITQ A;  3FYD A;  1IQP A;  3FTE A;  2DEN A;  4GC5 A;  3GLF A;  4OVZ A;  4DV0 M;  1C1K A;  1SXJ E;  2XH9 A;  3D8L A;  4DV5 M;  1HQC A;  1NSF A;  2XEP A;  1IFY A;  4R71 A;  3QWL A;  1K82 A;  4MB7 A;  2QCU A;  4X62 M;  3B7Q A;  1SG9 A;  4YHH M;  4G4R A;  4LF6 M;  3CF0 A;  1ORY B;  3W0L B;  1VEG A;  1QAN A;  2D7G A;  2QEN A;  1NY6 A;  1WGN A;  3U6D A;  3VK7 A;  3M6A A;  2L6O A;  3U5Z B;  1DGH B;  4L78 A;  2CHV A;  3GLH A;  4X64 M;  2FE8 A;  2CV2 A;  5IT9 S;  2D7E A;  3L29 A;  4PCZ A;  1E9R A;  3DZD A;  4UN2 B;  2DZL A;  3SHG B;  1R6B X;  5ITU A;  1PM5 A;  3IHP A;  3GPU A;  4LG2 A;  5KO3 A;  2FFJ A;  4GIP A;  3J81 S;  3FD9 A;  3MHV C;  3HU2 A;  2CUZ A;  3TWK A;  4QHS A;  3GQ5 A;  1V92 A;  2LBC A;  4QNM A;  2BWE A;  3FUX A;  1N75 A;  2ZAO A;  4AG5 A;  4QNR A;  5DFL A;  4QHT A;  4FCW A;  2BNK A;  2CWB A;  1XB2 B;  3ILK A;  5EXS A;  2OQ4 A;  1HJP A;  4QOS A;  3HHX A;  4D81 A;  1L2D A;  3PFI A;  1N34 M;  1X37 A;  2MH8 A;  4ANR A;  4B3S M;  2HWJ A;  3EIH A;  3VFD A;  1L2C A;  3JR5 A;  2KNV A;  3KOW E;  3SAS A;  4FWH A;  4LY6 A;  5IZ7 D;  3HHY A;  2MR9 A;  1HT2 E;  2O5R A;  3AOE C;  4RKU F;  2ZTC A;  4RF0 A;  2QBY B;  3SAR A;  2Y0Q A;  4GKK M;  3PXG A;  2XZU A;  1G3I A;  1G71 A;  3AV0 A;  4AKG A;  1J09 A;  2XSZ D;  3FTD A;  1NNJ A;  1BVS A;  2DHR A;  3GLI A;  1XC8 A;  1TH4 A;  1R4G A;  1GJS A;  3UK6 A;  2C5R A;  1T6O A;  2Z4R A;  5E26 A;  3UGJ A;  3M7G A;  2XLJ A;  3ZC7 B;  1IXS B;  1VDL A;  3C58 A;  3RE8 A;  3KXE C;  1UFZ A;  5DNY A;  5LMN M;  2KDL A;  2WZJ A;  4F2L A;  4OW0 A;  2Z7J A;  3HZJ A;  4JI4 M;  1DGB A;  4FCV A;  3NWL A;  2A5Y B;  5BR8 M;  1QDR A;  4G3O A;  1D0L A;  3SMP A;  2LVN C;  3GLH B;  4K0K M;  1D0K A;  1MN3 A;  5E6J A;  5ITT A;  3A98 B;  5EJC A;  2ZAM A;  2ZBK B;  1E94 E;  2F5S A;  1EFU B;  2QZ4 A;  1NJG A;  3KSJ A;  5JI3 E;  3KVW A;  5EXT A;  2DWL A;  3KS4 A;  3J7B A;  2NQ8 C;  5KPR A;  1HNW M;  2DZO B;  1Y8G A;  1RU3 A; 
#chains in the Genus database with same CATH homology
 4DR6 M;  2BJW A;  1L8Q A;  2UXD M;  3GRV A;  4JI1 M;  1ZAE A;  4M0D A;  3VKH A;  4A3V B;  1NJF A;  1I4W A;  3SAW A;  3GRY A;  2C99 A;  7CAT A;  2OPF A;  5KQ8 A;  2XF3 A;  1K3X A;  2DWN A;  3I4Y A;  4TUW A;  4D80 A;  1J5E M;  1XNR M;  1HR0 M;  1N32 M;  2R18 A;  3HU3 A;  4FCT A;  1IBK M;  1JQJ C;  4JYA M;  4I8O A;  4G4N A;  4FD2 A;  1G59 A;  1GVN A;  4B3T M;  2R45 A;  3A45 A;  3GLG A;  2CV0 A;  3J7A S;  5EP3 A;  4NOO B;  2EUC A;  3U60 B;  2DVW B;  4IBK A;  2R4E A;  3IG8 A;  2UXC M;  3SFZ A;  4GHL A;  3SMS A;  4OU7 A;  2R62 A;  2ZAN A;  4IBB A;  3E9S A;  4BBA A;  4R3D A;  1Z59 A;  3AFH A;  1JR3 D;  2X4A A;  3U61 B;  2XFS A;  1NHG C;  4L16 A;  3HJQ A;  1IY1 A;  2KRU A;  1GLN A;  4IBE A;  3GO8 A;  1HNX M;  1XHB A;  2HL7 A;  2KA6 B;  4W5W A;  3AOE A;  3SYL A;  3U60 A;  2LNH C;  4II7 A;  2C98 A;  4JN6 A;  5KQD A;  4G4Q A;  3ZH9 B;  3HHW A;  4MGI E;  1K3W A;  1I94 M;  1MX0 A;  1N78 A;  4YY3 M;  1HT1 E;  3GRU A;  4B7G A;  3DA1 A;  2C9C A;  1H6U A;  3I4V A;  1R7R A;  2KZS A;  1DGF A;  1QAO A;  1IN5 A;  1TDH A;  1HQY E;  4MH0 E;  2KRK A;  4LJA A;  3HGI A;  4L8R C;  4ZPX A;  1OJL A;  2RGH A;  4G6Z A;  3JR4 A;  2KEB A;  3LVV A;  2G8L A;  2Q2E B;  2UU9 M;  3UJN A;  1N33 M;  3MK6 A;  3L26 A;  4LGY A;  2KZU A;  1L1T A;  1W5T A;  4IJF A;  3WHK A;  2XFT A;  4PDG A;  1IBL M;  1D2N A;  3E4R A;  5KPT A;  3KS8 A;  4PDI A;  2VQE M;  4RF1 A;  3IG5 A;  2EO2 A;  1IN8 A;  2YFQ A;  1NY5 A;  3FKE A;  3GRR A;  3TWM A;  4JI0 M;  4L4U A;  4DV6 M;  3SAT A;  2K47 A;  4LF4 M;  1W5S A;  4HLQ A;  5FSW A;  3LVW A;  1FJG M;  1SXJ C;  4NXN M;  3DOA A;  4LF5 M;  5C18 A;  1SXJ B;  3SAU A;  3TPZ A;  3R8F A;  1L2B A;  4MGY E;  1IN7 A;  3DFZ A;  4REZ A;  4D82 A;  4LFB M;  5IWA M;  2RGO A;  4DV1 M;  8CAT A;  2Y21 A;  4KOD A;  4AW4 A;  3HKP A;  3KOX E;  5FTM A;  1LV7 A;  2CE7 A;  1N36 M;  3WHL A;  4M9Z A;  1Q3C A;  2RKO A;  4CIS A;  2QBY A;  3U6S A;  1IY2 A;  3VKG A;  4HL4 A;  2UUC M;  2R46 A;  3K1J A;  3Q8X A;  4LJ4 A;  3QAU A;  1OFH A;  4DR3 M;  3J27 B;  3U6Q A;  4MGH A;  4BLC A;  3M0E A;  3GPP A;  2CEA A;  1GKI A;  2XZF A;  4AI6 A;  2FNA A;  4FVM A;  3AJI B;  1JR3 A;  2V1U A;  2YNM D;  2CHG A;  5EP2 A;  4MGK E;  5BPV A;  1XMQ M;  3T1Y M;  4FW9 A;  1IY0 A;  4NL4 H;  2X49 A;  4JI8 M;  4QOZ C;  1G4A E;  2P5T A;  4CHT B;  4LJ9 A;  3OTO M;  4IBI A;  4Z8X A;  1TH3 A;  3KDS E;  3CTW B;  1VDD A;  2G5G X;  2L09 A;  3KW6 A;  4XBO A;  4B3R M;  5GKN A;  4LZJ A;  4IBC A;  3FYC A;  3GQ3 A;  4AG6 A;  2UUA M;  4DV3 M;  3PVS A;  4JI7 M;  3BOS A;  2DZN B;  1IXR C;  5H37 D;  2HCB A;  5FTN A;  3L28 A;  2CHQ A;  4LGM A;  1QVR A;  3FTF A;  4IIW A;  3U6L A;  3RFW A;  3U6M A;  4G4O A;  4LJ8 A;  5EP1 A;  1Z5B A;  1NHW C;  3K2L A;  5ITX A;  1YSY A;  4GMQ A;  5ITY A;  2R4J A;  5DYG A;  4WUR A;  1T3T A;  2X8A A;  1R2Y A;  3GQ4 A;  4LRT A;  4DV7 M;  1Q3B A;  1G8P A;  2Y20 A;  3TL4 X;  4L15 A;  4BB9 A;  3H4M A;  3FTC A;  5F3W A;  3FUT A;  1QAM A;  1IN6 A;  2V6Z M;  3TQS A;  1PJJ A;  3T1H M;  5EXX A;  4P16 A;  4XGI A;  1WXQ A;  4AKI A;  2BJV A;  3AKZ A;  4DV4 M;  1PJI A;  2H1R A;  4NRW A;  3SC3 A;  4JI3 M;  4RNA A;  2FOI C;  4MM3 B;  2ERC A;  4X66 M;  3JAM S;  3U6O A;  1Z5A A;  1L1Z A;  4JI2 M;  3PNV A;  5FTJ A;  1XNQ M;  4LF8 M;  1IM2 A;  3HHZ A;  4LF9 M;  4LJ6 A;  1IXZ A;  1QYR A;  4KLN A;  4FWD A;  4GKJ M;  4DUY M;  2XGN A;  1E32 A;  4B7H A;  4IBJ A;  5EQT A;  2YQZ A;  1OFI A;  2I7N A;  3HJS A;  3TE6 A;  4GHA A;  2LWX A;  4R7G A;  5DYI A;  2C96 A;  2Y0T A;  2L7H A;  3A42 A;  1XXH A;  1HNZ M;  4IBD A;  3VK8 A;  4AQY M;  1QZM A;  4B08 A;  4B3M M;  3K92 A;  2KW0 A;  3MJ5 A;  3T15 A;  5JI2 E;  4DR1 M;  3LMM A;  2I7P A;  1TDZ A;  5FLX S;  3FUW A;  1GL6 A;  2CV1 A;  3THG A;  4X65 M;  4GIT A;  2AHM A;  2DXI A;  3VDP A;  3LQR A;  3L2A A;  2CFO A;  2JA2 A;  3GLF B;  1KFV A;  4IBF A;  1E9S A;  2F4V M;  4MGZ E;  1SXJ A;  4S12 A;  1XMO M;  3CF2 A;  3CF6 E;  3FUV A;  1QQW A;  5IRE B;  4DR7 M;  4LF7 M;  4LFC M;  2F5Q A;  5FTL A;  2ZM6 M;  4OX9 M;  4I81 A;  3T38 A;  4JV5 M;  2J7N A;  3AOG A;  3UMM A;  4DR2 M;  1UM8 A;  1G41 A;  4JI6 M;  5FTK A;  1KSF X;  1DO0 A;  2E5L M;  4DV2 M;  3LQQ A;  3B9P A;  3KP0 E;  4LFA M;  3EIE A;  5KPZ A;  1Z6T A;  2UUB M;  4PT5 A;  3J80 S;  2F5O A;  1Q39 A;  2HHH M;  2XSZ A;  3TWL A;  4DR4 M;  4GH9 A;  3L27 A;  1SXJ D;  4LRS A;  4DUZ M;  1J7K A;  5EP4 A;  4AZF A;  4JXJ A;  3HJ8 A;  4LCB A;  3U6P A;  2D7H A;  3RGS A;  3R9X B;  1R2Z A;  3U61 A;  1Z5C A;  5LMU M;  1TH2 A;  3SAV A;  4PD2 A;  2QPA A;  3KSX A;  1TGU A;  1S3S A;  3SBJ A;  3GLI B;  4CGY B;  2C9O A;  2DWZ B;  4GRI A;  4NRV A;  3U6E A;  5A2Q S;  2LH0 A;  4I5S A;  3KOZ E;  3W0F A;  2J7O A;  4Z6Y A;  4LZZ A;  1N77 A;  3GPY A;  3UZU A;  1MU5 A;  1DO2 A;  2W82 A;  1XXH B;  4NSO B;  3HWS A;  2M60 A;  2R65 A;  3U5Z A;  2HKJ A;  2LXE A;  3I51 A;  3GLG B;  2KXE A;  1YE9 A;  4M0W A;  5EXP A;  5ITR A;  3FUU A;  1NNU C;  1QAQ A;  3J2P B;  4KO8 A;  2VQF M;  2EA0 A;  3U6C A;  1YUB A;  3ZCB B;  2YR0 A;  5ITX E;  2V1C A;  3AL0 C;  4I4L A;  2Z4S A;  1DGG A;  4B7F A;  2L7I A;  4IJE A;  4M9X A;  3KFU G;  3GPX A;  2VII A;  3NBI A;  1NVM A;  3L25 A;  3KP1 E;  4LJ7 A;  2DWM A;  4JI5 M;  2UXB M;  3K8Z A;  2F5N A;  4GC9 A;  3HU1 A;  1XWI A;  3VDU A;  4LJ5 A;  3RGP A;  2F5P A;  1DGH A;  3SHF A;  4NSR A;  4M9S A;  4DR5 M;  4EIW A;  2M5Z A;  1GL7 A;  1KYI A;  5C1B A;  3A46 A;  3D8B A;  4KHP M;  1FNN A;  3GP1 A;  3VLF B;  2Z3X A;  1ZQ9 A;  3PNY A;  4IBG A;  1IBM M;  4OVZ B;  4AKH A;  2QP9 X;  4ITQ A;  3SYK A;  1EE8 A;  1IN4 A;  3KOY E;  4WW0 A;  5ITQ A;  3FYD A;  1IQP A;  3FTE A;  4GC5 A;  3GLF A;  4OVZ A;  4DV0 M;  1C1K A;  1SXJ E;  2XH9 A;  3D8L A;  4DV5 M;  1HQC A;  1NSF A;  2XEP A;  3QWL A;  1K82 A;  4MB7 A;  2QCU A;  4X62 M;  4YHH M;  4G4R A;  4LF6 M;  3CF0 A;  1ORY B;  3W0L B;  1QAN A;  2D7G A;  2QEN A;  1NY6 A;  3U6D A;  3VK7 A;  3M6A A;  2L6O A;  3U5Z B;  1DGH B;  4L78 A;  2CHV A;  3GLH A;  4X64 M;  2FE8 A;  2CV2 A;  5IT9 S;  2D7E A;  3L29 A;  4PCZ A;  1E9R A;  3DZD A;  4NXM M;  3SHG B;  5ITU A;  1R6B X;  1PM5 A;  4LG2 A;  3GPU A;  5KO3 A;  2FFJ A;  4GIP A;  3J81 S;  3FD9 A;  3MHV C;  3HU2 A;  2CUZ A;  3TWK A;  4QHS A;  3GQ5 A;  4QNM A;  3FUX A;  1N75 A;  2ZAO A;  4AG5 A;  4QNR A;  4QHT A;  4FCW A;  2BNK A;  3ILK A;  5EXS A;  2OQ4 A;  4QOS A;  3HHX A;  4D81 A;  1L2D A;  3PFI A;  1N34 M;  1X37 A;  4B3S M;  3EIH A;  3VFD A;  1L2C A;  3JR5 A;  3KOW E;  3SAS A;  4FWH A;  4LY6 A;  5IZ7 D;  3HHY A;  1HT2 E;  2O5R A;  3AOE C;  4RF0 A;  2QBY B;  3SAR A;  2Y0Q A;  4GKK M;  3PXG A;  2XZU A;  1G3I A;  3AV0 A;  4AKG A;  1J09 A;  2XSZ D;  3FTD A;  1NNJ A;  2DHR A;  3GLI A;  1XC8 A;  1TH4 A;  3UK6 A;  2C5R A;  2Z4R A;  3UGJ A;  5E26 A;  2XLJ A;  3M7G A;  3ZC7 B;  1IXS B;  3C58 A;  3RE8 A;  3KXE C;  5DNY A;  5LMN M;  4OW0 A;  2Z7J A;  4JI4 M;  1DGB A;  4FCV A;  3NWL A;  2A5Y B;  5BR8 M;  3SMP A;  3GLH B;  4K0K M;  5ITT A;  5E6J A;  3A98 B;  5EJC A;  2ZAM A;  2ZBK B;  1E94 E;  2F5S A;  2QZ4 A;  5JI3 E;  1NJG A;  3KSJ A;  3KVW A;  5EXT A;  2DWL A;  3KS4 A;  3J7B A;  2NQ8 C;  5KPR A;  1HNW M;  2DZO B;  4FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...