4L8RC

Structure of mrna stem-loop, human stem-loop binding protein and 3'hexo ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
67
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE MRNA STEM-LOOP
publication title Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein/hydrolase
total genus 21
structure length 67
sequence length 73
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l8rC00
4L8RC 4TUWA 4QOZC
chains in the Genus database with same CATH superfamily
3W0LB 4CGYB 3WHKA 5L8RF 3J7AS 2HL7A 1QDRA 3FKEA 2KNAA 1D0LA 1TDZA 2CEAA 3GLGA 4FWHA 4L16A 4QHTA 2J5YA 5EXXA 2NQ8C 2O25A 2Z4SA 3I4VA 2HAKA 1CUKA 2XH9A 3GPUA 3D8BA 4BLCA 4QOSA 4DV3M 3FYCA 3SYKA 2F5SA 3VK7A 1XNQM 3HWSA 2XFSA 1OJLA 2CWBA 3U6QA 1IM2A 4GRIA 4JI4M 3H4MA 4CJ6A 1DO2A 3Q8GA 5F3WA 2DWLA 2C5RA 3J27B 4PDIA 2L7IA 3K1JA 4GC5A 1R6BX 2ZTCA 4D80A 1LV7A 2K9DA 3OTOM 1PGYA 2QCUA 3GLFE 1OIPA 4BB9A 4DV0M 2FE8A 2J7OA 4LGYA 4L15A 2KRKA 3A42A 3THGA 1QAMA 1G59A 3HHWA 2QZ4A 4NSRA 1VDLA 1UM8A 4CISA 1DGHA 3U6CA 3LVVA 4LF5M 3M7GA 1L2CA 1Z5BA 4LRTA 1KYIA 4JI0M 4AG5A 2X8AA 3A98B 4LJ8A 1JR3E 2CP8A 3JAMS 1TF0B 1ZV1A 1DV0A 4LZJA 3HHZA 1VEGA 3KW6A 1RU3A 5IT9S 1PM5A 1Q02A 3IECA 2VQFM 1FJGM 1C1KA 1HJPA 3ZH9B 1NHGC 4X62M 1MX0A 1ZAEA 1PJIA 4F2LA 3PVSA 2VF8A 2QSFX 4WP2A 2CHQA 2DAGA 3KSXA 5DYIA 2L09A 1EIJA 4AZFA 5KPZA 4GITA 2LTUA 3GLHB 1QYRA 3LW5F 2OPFA 3A46A 4QHSA 4IBBA 1IBMM 4OVZA 2D7HA 4MGHA 2LVQD 2LWXA 4UN2B 2N35A 4OW0A 1E32A 3PFIA 4B3SM 1QUTA 2XF3A 4MM3B 4JI5M 4WW0A 3KDSE 2OQ4A 1QUSA 3ZCBB 1OIZA 5LMNM 1ZMVA 3FTCA 1IBKM 2UXCM 4ANRA 1OQYA 2YQZA 3CF0A 3MJ5A 4IBEA 4RNAA 2DXIA 4GHAA 3FYDA 2CRUA 4LF9M 2I7PA 2QPAA 5JI3E 1XMOM 2XFTA 1QAQA 1XXHB 3U5ZA 4WURA 3I04M 1G8PA 1ZMWA 2WZJA 3K2LA 2WSCF 2F5QA 1KFVA 2CE7A 1IN5A 2WSFF 5KQDA 4JI7M 3F92A 3D8LA 1R2ZA 3PNVA 1N77A 3B7NA 4MH0E 5E6JA 1J5EM 3FUVA 3GLHE 4NXMM 3IHPA 1HT1E 5ITXA 4IJFA 4L6V6 4M9XA 1GVNA 2RGOA 1IXRC 4G4NA 3KP0E 7CATA 3VKHA 2UXBM 2CFOA 1R7RA 4DV1M 3L25A 2FH0A 1SG9A 3DOAA 4I5SA 4II7A 1K82A 2BWEA 3QYBA 1SXJA 4HEOA 4NXNM 3UJNA 4RF1A 3U6SA 3L29A 8CATA 2QQ8A 1YSYA 2LVAA 3T6PA 2P5TA 3J7BA 3K8ZA 5ITYA 5ITQA 3SAWA 2BNKA 3JR5A 1XXHE 3SARA 1QAOA 3TE6A 2D7GA 3KS4A 2DWZB 2CV2A 1PJSA 2LVNC 4MGKE 3GLIB 4B3TM 2W82A 1I4WA 4IBIA 3SC3A 3U6DA 2R4JA 4R71A 1R2YA 2QBYB 4AW4A 1WIVA 1OTRA 1HQYE 1IN8A 2F5OA 3LMMA 3T15A 2Z8YM 4MGYE 2RGHA 1TR8A 2K47A 1SXJD 4G3OA 3HZJA 4S12A 4P16A 1GKIA 2C99A 3E21A 4NSOB 2JNHA 4IBGA 1G41A 2EO2A 2LVOC 1IQPA 4P17A 1D2NA 2APLA 2Z4RA 1XMQM 4W5WA 2YNMD 1TTEA 4X64M 2R45A 3QAUA 4M9ZA 4AG6A 1GJSA 3GLGB 3E46A 3FUXA 3TL4X 2GQFA 4G4QA 2R46A 4GHLA 4XGIA 2DKLA 3U60B 1L1ZA 1W5TA 4IBKA 3MMPA 2O5RA 4X65M 1L2BA 4YHHM 4DV5M 1N78A 5H37D 4YY3M 3FUUA 3QYEA 4LY6A 3SATA 3ZQJA 3HY5A 3SMPA 4D81A 5DYGA 3GLIE 2CUZA 1OAOC 4QNRA 1J7KA 3VDUA 2Q2EB 4DR3M 1EFUB 1QDTA 3EIEA 3GLFA 1NVMA 1WJ7A 3MHVC 1GLNA 1NY5A 1X37A 3UMMA 4FCVA 4KHPM 4FW9A 4JI1M 4GIPA 5JI2E 1V92A 2XZFA 2ZANA 3CGWA 2QHOB 5FTMA 4TUWA 1MN3A 3KSJA 2JZ0A 3SASA 4DR6M 1IN4A 3FTDA 2JZ1A 2YR0A 1JR3A 3K9PA 1E94E 3GQ4A 3KP1E 5EP4A 3UK6A 4DR2M 3KS8A 1WGNA 3E4RA 1SXJC 3HJQA 2VQEM 1HNWM 3R8FA 2BJWA 1TH4A 3K92A 3KOWE 3GLGE 1VG5A 2MROB 4LF4M 1IY1A 1R5LA 1XHBA 4G4OA 3L28A 3SHFA 4PD2A 5KQ8A 1NSFA 4FWGA 1G71A 2Z7JA 3B9PA 3DZDA 2Y0TA 4JI3M 3RGSA 4JYAM 1D0MA 4FD2A 2Y0QA 2L7HA 1HNZM 4GMQA 2EA0A 3U6EA 2HKJA 2G3QA 2BJVA 2LNHC 3BOSA 5FTLA 1IBLM 3SMSA 2MH8A 5FTNA 3W68A 4LJAA 3U6MA 2KW0A 1PRBA 4DV4M 3GPPA 4Y28F 1PJJA 3TWMA 4AKIA 2DENA 2JY7A 3J2PB 2B3TA 2DZNB 3U6PA 3W67A 4B7FA 1GL6A 1JQJC 3B89A 3KXEC 3J81S 2VDBB 2F5NA 2QNJA 4ITQA 3SHGB 2GNOA 3E9SA 2ERCA 2LHCA 2OOBA 4MB7A 2M5ZA 2CV0A 5BR8M 4JI6M 4JV5M 2KHHA 3BXWA 3MK6A 4HLQA 3VK8A 1L1TA 3ILKA 2I7NA 2D7EA 5KPRA 2KDLA 4GC9A 3RGPA 2X4AA 4R3DA 3A45A 1S3SA 2DHYA 2R0IA 3AOEA 2HWJA 1J09A 2C98A 4F1IA 3B7ZA 5EXPA 4FVMA 4DV7M 1NJGA 4RKUF 2F5PA 1OKSA 1QZEA 1IN7A 2MR9A 3GRYA 2AHMA 4R7GA 3WHLA 2FNAA 4IBFA 3ZC7B 3HU1A 1VDDA 2CHGA 5IZ7D 3FRHA 4LFBM 3U61B 3PNYA 5EP2A 3AV0A 3UZUA 2R4EA 1WGLA 2LVPC 2R62A 3U6LA 4AKGA 4AI6A 5IWAM 3RFWA 2OO9A 4LF7M 3RE8A 1N36M 3W0FA 2DNAA 1GJTA 3FD9A 3SAUA 3SBJA 2XSZA 4NC6A 2KEBA 1N33M 2E5LM 5FSWA 1GO5A 1XXHA 1IXSB 1T6OA 1VEJA 4GEWA 2ZTDA 1JB0F 2FS1A 4XBOA 4LF8M 1TH2A 3R9XB 2UXDM 2JWSA 4EIWA 1WR1B 2JP7A 1NJFA 4DV2M 3H4JA 4G4RA 3GQ3A 2R18A 3C9PA 2VIIA 2V6ZM 4CHTB 2G5GX 2OOAA 2R44A 1DGGA 1YLAA 3J80S 3TQSA 3CF2A 4DV6M 3V76A 3U6OA 2JUJA 2DVWB 3DA1A 5EXTA 1IY2A 4B3RM 4D82A 3AFHA 1IXZA 3HU3A 4Q7JA 3HHYA 3Q8XA 4B7HA 1ZMUA 1E9RA 5DFLA 4DUZM 3TWLA 1F4IA 1NNJA 2LXEA 1QQWA 2G8LA 3KVWA 1P3QQ 2F4VM 2LBCA 1N32M 1DGBA 3HHXA 4IBJA 3SAVA 3AOEC 2DZLA 4KODA 4BBAA 2XEPA 3GLIA 4LRSA 2QBYA 2DHRA 2XLJA 1AUAA 1Z5CA 2ZAMA 2FOIC 1VEKA 2DI0A 2RKOA 4GH9A 3T1YM 3AJIB 3UGJA 1QZMA 1Z59A 4LCBA 1L8QA 1PJTA 3I51A 4KT0F 4A3VB 2YFQA 4PDGA 2KA6B 1XB2B 1G3IA 3HGIA 3NWLA 3LCVB 2EJSA 1NY6A 3LVWA 1OFIA 1IFYA 4IBCA 1K3XA 1UFZA 4LJ4A 5FTKA 3HKPA 3TPZA 3L27A 4B3MM 5A2QS 2DZOB 3L2AA 5BPVA 4PT5A 5ITTA 4LJ7A 2ZAOA 2A5YB 2EKKA 1ORYB 1NHWC 2H5XA 3KOYE 3U60A 1NV9A 3AOGA 3C58A 2JY8A 3LQQA 1DGFA 4LJ6A 1DGHB 2DAIA 2ZM6M 4DR5M 4LZZA 4NL4H 3VKGA 4IIWA 4K0KM 2UUAM 2L4EA 5LMUM 4FCTA 1H6UA 3GRRA 4NOOB 3SYLA 2CHVA 1Q39A 3CTWB 1HT2E 2JA2A 4LG2A 2RRUA 1T3TA 3EIHA 1T43A 3NBIA 1D0KA 1YE9A 3IG8A 5C1BA 1MU5A 3FRIA 4IJEA 1A5TA 3M6AA 1PJQA 3LQRA 4HL4A 2CV1A 2V1UA 2UUBM 1JR3D 5ITUA 2J7NA 4L78A 1V34A 1G4AE 3B7QA 4LJ9A 4OVZB 3VFDA 3GRUA 4DR4M 2Y21A 4M0DA 4CIZA 4Z6YA 1NO1A 3DFZA 4FWDA 3KFUG 5EXSA 1Z6TA 5ITRA 2KNZA 4DBGB 2V1CA 4OU7A 1N34M 3GP1A 4PCZA 1ZQ9A 3GPXA 4LF6M 1QANA 4JI8M 4MGZE 2HHHM 1NNUC 1KSFX 2WSEF 2VF7A 3QWLA 1OFHA 1XWIA 5KPTA 3HU2A 5DNYA 2Y20A 3GLHA 3GO8A 2KZSA 3U5ZB 1N75A 3TWKA 3HX3A 4B08A 3LCUA 4LGMA 1OAIA 4ZPXA 5C18A 3PXGA 1GABA 2DAKA 4QOZC 1TDHA 3I01M 4REZA 3T1HM 3FTFA 1Q3BA 3HJSA 2KZUA 3KOZE 2Z3XA 2O01F 3AKZA 4X66M 1AIPC 1IN6A 2ZBKB 3B74A 1XNRM 4FCWA 1Q3CA 2JXNA 1W5SA 2JY6B 1TGUA 1IY0A 2L4FA 1L2DA 4QNMA 4LFAM 3GQ5A 1E9SA 1R4GA 2HCBA 1SXJB 2L6OA 5GKNA 5KO3A 4AQYM 3C3DA 2MJ5B 3GRVA 1LTMA 3I4YA 4MGIE 4RF0A 1MJGM 3L26A 4Z8XA 4GKJM 2QP9X 1EE8A 2L2DA 2KRUA 2LH0A 1V33A 3C3EA 2K6BA 1HNXM 5EQTA 3M0EA 3U61A 4JXJA 4L8RC 5FLXS 4NRWA 2FFJA 2BWBA 5IREB 1QVRA 4DR7M 1BVSA 4JN6A 2R6FA 4DUYM 4KO8A 2QENA 3FUWA 3GPYA 4IBDA 2EKFA 3JR4A 4DR1M 4AKHA 2DAEA 1HQCA 3T38A 2XZUA 2DWNA 3FUTA 3VDPA 2XGNA 5ITXE 4I4LA 3SFZA 1IXSA 4KLNA 2XSZD 2KXEA 1VQ1A 4LJ5A 3KOXE 1DO0A 3CF6E 4LFCM 4G6ZA 4M9SA 4NRVA 4L4UA 1SXJE 5EP3A 4OX9M 4GKKM 1XC8A 2LHGA 2KNVA 1FNNA 2C96A 4B7GA 2C9OA 3AL0C 3K9OA 2UUCM 1NV8A 1TH3A 1Z5AA 2C9CA 2DAMA 1WHCA 2JY5A 1WXQA 4I8OA 4I81A 1GL7A 4JI2M 1I94M 1HR0M 4XK8F 5EP1A 1K3WA 2EUCA 3FTEA 3HJ8A 2H1RA 3NBXX 2M60A 3BBZA 1YUBA 3IG5A 2R65A 5FTJA 1C7YA 2DWMA 4M0WA 1Y8GA 3GLFB 2X49A 2K0BX 2MGWA 3VLFB 2UU9M 5E26A 3FE3A 5EJCA
chains in the Genus database with same CATH topology
3W0LB 4CGYB 3WHKA 3J7AS 2HL7A 3FKEA 1TDZA 2CEAA 3GLGA 4FWHA 4L16A 4QHTA 5EXXA 2NQ8C 2Z4SA 3I4VA 2XH9A 3GPUA 3D8BA 4BLCA 4QOSA 4DV3M 3FYCA 3SYKA 2F5SA 3VK7A 1XNQM 3HWSA 2XFSA 1OJLA 3U6QA 1IM2A 4GRIA 4JI4M 3H4MA 1DO2A 5F3WA 2DWLA 2C5RA 3J27B 4PDIA 2L7IA 3K1JA 4GC5A 1R6BX 4D80A 1LV7A 3OTOM 2QCUA 4BB9A 4DV0M 2FE8A 2J7OA 4LGYA 4L15A 2KRKA 3A42A 3THGA 1QAMA 1G59A 3HHWA 2QZ4A 4NSRA 4CISA 1UM8A 1DGHA 3U6CA 3LVVA 4LF5M 3M7GA 1L2CA 1Z5BA 4LRTA 1KYIA 4JI0M 4AG5A 2X8AA 3A98B 4LJ8A 3JAMS 4LZJA 3HHZA 3KW6A 5IT9S 1PM5A 1FJGM 2VQFM 1C1KA 3ZH9B 1NHGC 4X62M 1MX0A 1ZAEA 1PJIA 3PVSA 2CHQA 3KSXA 5DYIA 2L09A 4AZFA 5KPZA 4GITA 3GLHB 1QYRA 2OPFA 3A46A 4QHSA 4IBBA 1IBMM 4OVZA 2D7HA 4MGHA 2LWXA 4OW0A 1E32A 3PFIA 4B3SM 2XF3A 4MM3B 4JI5M 4WW0A 3KDSE 2OQ4A 3ZCBB 5LMNM 3FTCA 1IBKM 2UXCM 2YQZA 3CF0A 3MJ5A 4IBEA 4RNAA 2DXIA 4GHAA 3FYDA 4LF9M 2I7PA 2QPAA 5JI3E 1XMOM 2XFTA 1QAQA 1XXHB 3U5ZA 4WURA 1G8PA 3K2LA 2F5QA 1KFVA 2CE7A 1IN5A 5KQDA 4JI7M 3D8LA 1R2ZA 3PNVA 1N77A 4MH0E 5E6JA 1J5EM 3FUVA 4NXMM 1HT1E 5ITXA 4IJFA 4M9XA 1GVNA 2RGOA 1IXRC 4G4NA 3KP0E 7CATA 3VKHA 2UXBM 2CFOA 1R7RA 4DV1M 3L25A 3DOAA 4I5SA 4II7A 1K82A 4NXNM 1SXJA 3UJNA 4RF1A 3U6SA 3L29A 8CATA 1YSYA 2P5TA 3J7BA 3K8ZA 5ITYA 5ITQA 3SAWA 2BNKA 3JR5A 3SARA 1QAOA 3TE6A 2D7GA 3KS4A 2DWZB 2CV2A 4MGKE 3GLIB 4B3TM 2W82A 1I4WA 4IBIA 3SC3A 3U6DA 2R4JA 2QBYB 1R2YA 4AW4A 2F5OA 1HQYE 1IN8A 3LMMA 3T15A 4MGYE 2RGHA 2K47A 1SXJD 4S12A 4P16A 1GKIA 2C99A 4NSOB 4IBGA 1G41A 2EO2A 1IQPA 1D2NA 2Z4RA 1XMQM 4W5WA 2YNMD 4X64M 2R45A 3QAUA 4M9ZA 4AG6A 3GLGB 3FUXA 3TL4X 4G4QA 4GHLA 2R46A 4XGIA 3U60B 1L1ZA 1W5TA 4IBKA 2O5RA 4X65M 1L2BA 4YHHM 4DV5M 1N78A 5H37D 4YY3M 3FUUA 3SATA 4LY6A 4D81A 3SMPA 5DYGA 2CUZA 4QNRA 1J7KA 3VDUA 2Q2EB 4DR3M 3GLFA 3EIEA 1NVMA 3MHVC 1GLNA 1NY5A 1X37A 3UMMA 4FCVA 4KHPM 4FW9A 4JI1M 4GIPA 5JI2E 2XZFA 2ZANA 4TUWA 5FTMA 3KSJA 3SASA 4DR6M 1IN4A 3FTDA 2YR0A 3GQ4A 1JR3A 1E94E 3KP1E 5EP4A 3UK6A 4DR2M 3KS8A 3E4RA 3HJQA 1SXJC 2VQEM 1HNWM 3R8FA 2BJWA 1TH4A 3K92A 3KOWE 4LF4M 1IY1A 1XHBA 4G4OA 3L28A 3SHFA 4PD2A 5KQ8A 1NSFA 4FWGA 3B9PA 2Z7JA 3DZDA 2Y0TA 4JI3M 3RGSA 4JYAM 4FD2A 2Y0QA 2L7HA 1HNZM 4GMQA 2EA0A 3U6EA 2HKJA 2LNHC 2BJVA 3BOSA 5FTLA 1IBLM 3SMSA 5FTNA 4LJAA 3U6MA 2KW0A 4DV4M 3GPPA 1PJJA 3TWMA 4AKIA 3J2PB 2DZNB 3U6PA 4B7FA 1GL6A 1JQJC 3KXEC 3J81S 2F5NA 4ITQA 3SHGB 3E9SA 2ERCA 4MB7A 2M5ZA 2CV0A 5BR8M 4JI6M 4JV5M 3VK8A 3MK6A 4HLQA 1L1TA 3ILKA 2I7NA 2D7EA 5KPRA 4GC9A 3RGPA 2X4AA 4R3DA 3A45A 1S3SA 3AOEA 1J09A 2C98A 5EXPA 4FVMA 4DV7M 1NJGA 2F5PA 1IN7A 3GRYA 4R7GA 2AHMA 3WHLA 2FNAA 4IBFA 3ZC7B 3HU1A 1VDDA 2CHGA 5IZ7D 4LFBM 3U61B 3PNYA 5EP2A 3AV0A 3UZUA 2R4EA 3U6LA 4AKGA 2R62A 4AI6A 5IWAM 3RFWA 4LF7M 3RE8A 1N36M 3W0FA 3FD9A 3SAUA 3SBJA 2XSZA 1N33M 2KEBA 2E5LM 5FSWA 1XXHA 1IXSB 4XBOA 4LF8M 1TH2A 3R9XB 2UXDM 4EIWA 1NJFA 4DV2M 4G4RA 3GQ3A 2R18A 2VIIA 2V6ZM 4CHTB 2G5GX 1DGGA 3J80S 3TQSA 4DV6M 3CF2A 3U6OA 2DVWB 3DA1A 5EXTA 1IY2A 4B3RM 4D82A 3AFHA 1IXZA 3HU3A 3HHYA 4B7HA 3Q8XA 1E9RA 4DUZM 3TWLA 1NNJA 2LXEA 1QQWA 2G8LA 3KVWA 2F4VM 1N32M 1DGBA 3HHXA 4IBJA 3SAVA 3AOEC 4KODA 4BBAA 2XEPA 3GLIA 4LRSA 2QBYA 2DHRA 2XLJA 1Z5CA 2ZAMA 2FOIC 2RKOA 4GH9A 3T1YM 3AJIB 3UGJA 1QZMA 1Z59A 4LCBA 1L8QA 3I51A 4A3VB 2YFQA 4PDGA 2KA6B 1G3IA 3HGIA 3NWLA 1NY6A 3LVWA 1OFIA 4IBCA 1K3XA 4LJ4A 5FTKA 3HKPA 3TPZA 3L27A 4B3MM 5A2QS 2DZOB 3L2AA 5BPVA 4PT5A 5ITTA 4LJ7A 2ZAOA 2A5YB 1ORYB 1NHWC 3KOYE 3U60A 3AOGA 3C58A 3LQQA 1DGFA 4LJ6A 1DGHB 2ZM6M 4DR5M 4LZZA 4NL4H 3VKGA 4IIWA 4K0KM 2UUAM 5LMUM 4FCTA 1H6UA 3GRRA 4NOOB 3SYLA 2CHVA 1Q39A 3CTWB 1HT2E 2JA2A 4LG2A 1T3TA 3EIHA 3NBIA 3IG8A 1YE9A 5C1BA 1MU5A 4IJEA 3M6AA 4HL4A 3LQRA 2CV1A 2V1UA 2UUBM 1JR3D 5ITUA 2J7NA 4L78A 1G4AE 4LJ9A 4OVZB 3VFDA 3GRUA 4DR4M 2Y21A 4M0DA 4Z6YA 3DFZA 4FWDA 3KFUG 5EXSA 1Z6TA 5ITRA 2V1CA 4OU7A 1N34M 3GP1A 4PCZA 1ZQ9A 3GPXA 4LF6M 1QANA 4JI8M 4MGZE 2HHHM 1NNUC 1KSFX 3QWLA 1OFHA 1XWIA 5KPTA 3HU2A 5DNYA 2Y20A 3GLHA 3GO8A 2KZSA 3U5ZB 1N75A 3TWKA 4B08A 4LGMA 4ZPXA 5C18A 3PXGA 4QOZC 1TDHA 4REZA 3T1HM 3FTFA 1Q3BA 3HJSA 2KZUA 3KOZE 2Z3XA 3AKZA 4X66M 2ZBKB 1IN6A 1XNRM 4FCWA 1Q3CA 1W5SA 1TGUA 1IY0A 1L2DA 4QNMA 4LFAM 3GQ5A 1E9SA 2HCBA 2L6OA 1SXJB 5KO3A 5GKNA 4AQYM 4MGIE 3GRVA 3L26A 3I4YA 4RF0A 4GKJM 4Z8XA 2QP9X 1EE8A 2KRUA 2LH0A 1HNXM 5EQTA 3M0EA 3U61A 4JXJA 4L8RC 5FLXS 4NRWA 2FFJA 5IREB 1QVRA 4DR7M 4JN6A 4DUYM 4KO8A 2QENA 3FUWA 3GPYA 4IBDA 3JR4A 4DR1M 4AKHA 1HQCA 3T38A 2XZUA 2DWNA 3FUTA 3VDPA 2XGNA 5ITXE 4I4LA 3SFZA 4KLNA 2XSZD 2KXEA 4LJ5A 3KOXE 1DO0A 3CF6E 4LFCM 4G6ZA 4M9SA 4NRVA 4L4UA 1SXJE 5EP3A 4OX9M 4GKKM 1XC8A 1FNNA 2C96A 4B7GA 2C9OA 3AL0C 2UUCM 1TH3A 1Z5AA 2C9CA 1WXQA 4I8OA 4I81A 1GL7A 4JI2M 1I94M 1HR0M 5EP1A 1K3WA 2EUCA 3FTEA 3HJ8A 2H1RA 2M60A 5FTJA 3IG5A 1YUBA 2R65A 2DWMA 4M0WA 3GLFB 2X49A 3VLFB 2UU9M 5E26A 5EJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8R C;  4TUW A;  4QOZ C; 
#chains in the Genus database with same CATH topology
 3W0L B;  4CGY B;  3WHK A;  5L8R F;  3J7A S;  2HL7 A;  1QDR A;  3FKE A;  2KNA A;  1D0L A;  1TDZ A;  2CEA A;  3GLG A;  4FWH A;  4L16 A;  4QHT A;  2J5Y A;  5EXX A;  2NQ8 C;  2O25 A;  2Z4S A;  3I4V A;  2HAK A;  1CUK A;  2XH9 A;  3GPU A;  3D8B A;  4BLC A;  4QOS A;  4DV3 M;  3FYC A;  3SYK A;  2F5S A;  3VK7 A;  1XNQ M;  3HWS A;  2XFS A;  1OJL A;  2CWB A;  3U6Q A;  1IM2 A;  4GRI A;  4JI4 M;  3H4M A;  4CJ6 A;  1DO2 A;  3Q8G A;  5F3W A;  2DWL A;  2C5R A;  3J27 B;  4PDI A;  2L7I A;  3K1J A;  4GC5 A;  1R6B X;  2ZTC A;  4D80 A;  1LV7 A;  2K9D A;  3OTO M;  1PGY A;  2QCU A;  3GLF E;  1OIP A;  4BB9 A;  4DV0 M;  2FE8 A;  2J7O A;  4LGY A;  4L15 A;  2KRK A;  3A42 A;  3THG A;  1QAM A;  1G59 A;  3HHW A;  2QZ4 A;  4NSR A;  1VDL A;  1UM8 A;  4CIS A;  1DGH A;  3U6C A;  3LVV A;  4LF5 M;  3M7G A;  1L2C A;  1Z5B A;  4LRT A;  1KYI A;  4JI0 M;  4AG5 A;  2X8A A;  3A98 B;  4LJ8 A;  1JR3 E;  2CP8 A;  3JAM S;  1TF0 B;  1ZV1 A;  1DV0 A;  4LZJ A;  3HHZ A;  1VEG A;  3KW6 A;  1RU3 A;  5IT9 S;  1PM5 A;  1Q02 A;  3IEC A;  2VQF M;  1FJG M;  1C1K A;  1HJP A;  3ZH9 B;  1NHG C;  4X62 M;  1MX0 A;  1ZAE A;  1PJI A;  4F2L A;  3PVS A;  2VF8 A;  2QSF X;  4WP2 A;  2CHQ A;  2DAG A;  3KSX A;  5DYI A;  2L09 A;  1EIJ A;  4AZF A;  5KPZ A;  4GIT A;  2LTU A;  3GLH B;  1QYR A;  3LW5 F;  2OPF A;  3A46 A;  4QHS A;  4IBB A;  1IBM M;  4OVZ A;  2D7H A;  4MGH A;  2LVQ D;  2LWX A;  4UN2 B;  2N35 A;  4OW0 A;  1E32 A;  3PFI A;  4B3S M;  1QUT A;  2XF3 A;  4MM3 B;  4JI5 M;  4WW0 A;  3KDS E;  2OQ4 A;  1QUS A;  3ZCB B;  1OIZ A;  5LMN M;  1ZMV A;  3FTC A;  1IBK M;  2UXC M;  4ANR A;  1OQY A;  2YQZ A;  3CF0 A;  3MJ5 A;  4IBE A;  4RNA A;  2DXI A;  4GHA A;  3FYD A;  2CRU A;  4LF9 M;  2I7P A;  2QPA A;  5JI3 E;  1XMO M;  2XFT A;  1QAQ A;  1XXH B;  3U5Z A;  4WUR A;  3I04 M;  1G8P A;  1ZMW A;  2WZJ A;  3K2L A;  2WSC F;  2F5Q A;  1KFV A;  2CE7 A;  1IN5 A;  2WSF F;  5KQD A;  4JI7 M;  3F92 A;  3D8L A;  1R2Z A;  3PNV A;  1N77 A;  3B7N A;  4MH0 E;  5E6J A;  1J5E M;  3FUV A;  3GLH E;  4NXM M;  3IHP A;  1HT1 E;  5ITX A;  4IJF A;  4L6V 6;  4M9X A;  1GVN A;  2RGO A;  1IXR C;  4G4N A;  3KP0 E;  7CAT A;  3VKH A;  2UXB M;  2CFO A;  1R7R A;  4DV1 M;  3L25 A;  2FH0 A;  1SG9 A;  3DOA A;  4I5S A;  4II7 A;  1K82 A;  2BWE A;  3QYB A;  1SXJ A;  4HEO A;  4NXN M;  3UJN A;  4RF1 A;  3U6S A;  3L29 A;  8CAT A;  2QQ8 A;  1YSY A;  2LVA A;  3T6P A;  2P5T A;  3J7B A;  3K8Z A;  5ITY A;  5ITQ A;  3SAW A;  2BNK A;  3JR5 A;  1XXH E;  3SAR A;  1QAO A;  3TE6 A;  2D7G A;  3KS4 A;  2DWZ B;  2CV2 A;  1PJS A;  2LVN C;  4MGK E;  3GLI B;  4B3T M;  2W82 A;  1I4W A;  4IBI A;  3SC3 A;  3U6D A;  2R4J A;  4R71 A;  1R2Y A;  2QBY B;  4AW4 A;  1WIV A;  1OTR A;  1HQY E;  1IN8 A;  2F5O A;  3LMM A;  3T15 A;  2Z8Y M;  4MGY E;  2RGH A;  1TR8 A;  2K47 A;  1SXJ D;  4G3O A;  3HZJ A;  4S12 A;  4P16 A;  1GKI A;  2C99 A;  3E21 A;  4NSO B;  2JNH A;  4IBG A;  1G41 A;  2EO2 A;  2LVO C;  1IQP A;  4P17 A;  1D2N A;  2APL A;  2Z4R A;  1XMQ M;  4W5W A;  2YNM D;  1TTE A;  4X64 M;  2R45 A;  3QAU A;  4M9Z A;  4AG6 A;  1GJS A;  3GLG B;  3E46 A;  3FUX A;  3TL4 X;  2GQF A;  4G4Q A;  2R46 A;  4GHL A;  4XGI A;  2DKL A;  3U60 B;  1L1Z A;  1W5T A;  4IBK A;  3MMP A;  2O5R A;  4X65 M;  1L2B A;  4YHH M;  4DV5 M;  1N78 A;  5H37 D;  4YY3 M;  3FUU A;  3QYE A;  4LY6 A;  3SAT A;  3ZQJ A;  3HY5 A;  3SMP A;  4D81 A;  5DYG A;  3GLI E;  2CUZ A;  1OAO C;  4QNR A;  1J7K A;  3VDU A;  2Q2E B;  4DR3 M;  1EFU B;  1QDT A;  3EIE A;  3GLF A;  1NVM A;  1WJ7 A;  3MHV C;  1GLN A;  1NY5 A;  1X37 A;  3UMM A;  4FCV A;  4KHP M;  4FW9 A;  4JI1 M;  4GIP A;  5JI2 E;  1V92 A;  2XZF A;  2ZAN A;  3CGW A;  2QHO B;  5FTM A;  4TUW A;  1MN3 A;  3KSJ A;  2JZ0 A;  3SAS A;  4DR6 M;  1IN4 A;  3FTD A;  2JZ1 A;  2YR0 A;  1JR3 A;  3K9P A;  1E94 E;  3GQ4 A;  3KP1 E;  5EP4 A;  3UK6 A;  4DR2 M;  3KS8 A;  1WGN A;  3E4R A;  1SXJ C;  3HJQ A;  2VQE M;  1HNW M;  3R8F A;  2BJW A;  1TH4 A;  3K92 A;  3KOW E;  3GLG E;  1VG5 A;  2MRO B;  4LF4 M;  1IY1 A;  1R5L A;  1XHB A;  4G4O A;  3L28 A;  3SHF A;  4PD2 A;  5KQ8 A;  1NSF A;  4FWG A;  1G71 A;  2Z7J A;  3B9P A;  3DZD A;  2Y0T A;  4JI3 M;  3RGS A;  4JYA M;  1D0M A;  4FD2 A;  2Y0Q A;  2L7H A;  1HNZ M;  4GMQ A;  2EA0 A;  3U6E A;  2HKJ A;  2G3Q A;  2BJV A;  2LNH C;  3BOS A;  5FTL A;  1IBL M;  3SMS A;  2MH8 A;  5FTN A;  3W68 A;  4LJA A;  3U6M A;  2KW0 A;  1PRB A;  4DV4 M;  3GPP A;  4Y28 F;  1PJJ A;  3TWM A;  4AKI A;  2DEN A;  2JY7 A;  3J2P B;  2B3T A;  2DZN B;  3U6P A;  3W67 A;  4B7F A;  1GL6 A;  1JQJ C;  3B89 A;  3KXE C;  3J81 S;  2VDB B;  2F5N A;  2QNJ A;  4ITQ A;  3SHG B;  2GNO A;  3E9S A;  2ERC A;  2LHC A;  2OOB A;  4MB7 A;  2M5Z A;  2CV0 A;  5BR8 M;  4JI6 M;  4JV5 M;  2KHH A;  3BXW A;  3MK6 A;  4HLQ A;  3VK8 A;  1L1T A;  3ILK A;  2I7N A;  2D7E A;  5KPR A;  2KDL A;  4GC9 A;  3RGP A;  2X4A A;  4R3D A;  3A45 A;  1S3S A;  2DHY A;  2R0I A;  3AOE A;  2HWJ A;  1J09 A;  2C98 A;  4F1I A;  3B7Z A;  5EXP A;  4FVM A;  4DV7 M;  1NJG A;  4RKU F;  2F5P A;  1OKS A;  1QZE A;  1IN7 A;  2MR9 A;  3GRY A;  2AHM A;  4R7G A;  3WHL A;  2FNA A;  4IBF A;  3ZC7 B;  3HU1 A;  1VDD A;  2CHG A;  5IZ7 D;  3FRH A;  4LFB M;  3U61 B;  3PNY A;  5EP2 A;  3AV0 A;  3UZU A;  2R4E A;  1WGL A;  2LVP C;  2R62 A;  3U6L A;  4AKG A;  4AI6 A;  5IWA M;  3RFW A;  2OO9 A;  4LF7 M;  3RE8 A;  1N36 M;  3W0F A;  2DNA A;  1GJT A;  3FD9 A;  3SAU A;  3SBJ A;  2XSZ A;  4NC6 A;  2KEB A;  1N33 M;  2E5L M;  5FSW A;  1GO5 A;  1XXH A;  1IXS B;  1T6O A;  1VEJ A;  4GEW A;  2ZTD A;  1JB0 F;  2FS1 A;  4XBO A;  4LF8 M;  1TH2 A;  3R9X B;  2UXD M;  2JWS A;  4EIW A;  1WR1 B;  2JP7 A;  1NJF A;  4DV2 M;  3H4J A;  4G4R A;  3GQ3 A;  2R18 A;  3C9P A;  2VII A;  2V6Z M;  4CHT B;  2G5G X;  2OOA A;  2R44 A;  1DGG A;  1YLA A;  3J80 S;  3TQS A;  3CF2 A;  4DV6 M;  3V76 A;  3U6O A;  2JUJ A;  2DVW B;  3DA1 A;  5EXT A;  1IY2 A;  4B3R M;  4D82 A;  3AFH A;  1IXZ A;  3HU3 A;  4Q7J A;  3HHY A;  3Q8X A;  4B7H A;  1ZMU A;  1E9R A;  5DFL A;  4DUZ M;  3TWL A;  1F4I A;  1NNJ A;  2LXE A;  1QQW A;  2G8L A;  3KVW A;  1P3Q Q;  2F4V M;  2LBC A;  1N32 M;  1DGB A;  3HHX A;  4IBJ A;  3SAV A;  3AOE C;  2DZL A;  4KOD A;  4BBA A;  2XEP A;  3GLI A;  4LRS A;  2QBY A;  2DHR A;  2XLJ A;  1AUA A;  1Z5C A;  2ZAM A;  2FOI C;  1VEK A;  2DI0 A;  2RKO A;  4GH9 A;  3T1Y M;  3AJI B;  3UGJ A;  1QZM A;  1Z59 A;  4LCB A;  1L8Q A;  1PJT A;  3I51 A;  4KT0 F;  4A3V B;  2YFQ A;  4PDG A;  2KA6 B;  1XB2 B;  1G3I A;  3HGI A;  3NWL A;  3LCV B;  2EJS A;  1NY6 A;  3LVW A;  1OFI A;  1IFY A;  4IBC A;  1K3X A;  1UFZ A;  4LJ4 A;  5FTK A;  3HKP A;  3TPZ A;  3L27 A;  4B3M M;  5A2Q S;  2DZO B;  3L2A A;  5BPV A;  4PT5 A;  5ITT A;  4LJ7 A;  2ZAO A;  2A5Y B;  2EKK A;  1ORY B;  1NHW C;  2H5X A;  3KOY E;  3U60 A;  1NV9 A;  3AOG A;  3C58 A;  2JY8 A;  3LQQ A;  1DGF A;  4LJ6 A;  1DGH B;  2DAI A;  2ZM6 M;  4DR5 M;  4LZZ A;  4NL4 H;  3VKG A;  4IIW A;  4K0K M;  2UUA M;  2L4E A;  5LMU M;  4FCT A;  1H6U A;  3GRR A;  4NOO B;  3SYL A;  2CHV A;  1Q39 A;  3CTW B;  1HT2 E;  2JA2 A;  4LG2 A;  2RRU A;  1T3T A;  3EIH A;  1T43 A;  3NBI A;  1D0K A;  1YE9 A;  3IG8 A;  5C1B A;  1MU5 A;  3FRI A;  4IJE A;  1A5T A;  3M6A A;  1PJQ A;  3LQR A;  4HL4 A;  2CV1 A;  2V1U A;  2UUB M;  1JR3 D;  5ITU A;  2J7N A;  4L78 A;  1V34 A;  1G4A E;  3B7Q A;  4LJ9 A;  4OVZ B;  3VFD A;  3GRU A;  4DR4 M;  2Y21 A;  4M0D A;  4CIZ A;  4Z6Y A;  1NO1 A;  3DFZ A;  4FWD A;  3KFU G;  5EXS A;  1Z6T A;  5ITR A;  2KNZ A;  4DBG B;  2V1C A;  4OU7 A;  1N34 M;  3GP1 A;  4PCZ A;  1ZQ9 A;  3GPX A;  4LF6 M;  1QAN A;  4JI8 M;  4MGZ E;  2HHH M;  1NNU C;  1KSF X;  2WSE F;  2VF7 A;  3QWL A;  1OFH A;  1XWI A;  5KPT A;  3HU2 A;  5DNY A;  2Y20 A;  3GLH A;  3GO8 A;  2KZS A;  3U5Z B;  1N75 A;  3TWK A;  3HX3 A;  4B08 A;  3LCU A;  4LGM A;  1OAI A;  4ZPX A;  5C18 A;  3PXG A;  1GAB A;  2DAK A;  4QOZ C;  1TDH A;  3I01 M;  4REZ A;  3T1H M;  3FTF A;  1Q3B A;  3HJS A;  2KZU A;  3KOZ E;  2Z3X A;  2O01 F;  3AKZ A;  4X66 M;  1AIP C;  1IN6 A;  2ZBK B;  3B74 A;  1XNR M;  4FCW A;  1Q3C A;  2JXN A;  1W5S A;  2JY6 B;  1TGU A;  1IY0 A;  2L4F A;  1L2D A;  4QNM A;  4LFA M;  3GQ5 A;  1E9S A;  1R4G A;  2HCB A;  1SXJ B;  2L6O A;  5GKN A;  5KO3 A;  4AQY M;  3C3D A;  2MJ5 B;  3GRV A;  1LTM A;  3I4Y A;  4MGI E;  4RF0 A;  1MJG M;  3L26 A;  4Z8X A;  4GKJ M;  2QP9 X;  1EE8 A;  2L2D A;  2KRU A;  2LH0 A;  1V33 A;  3C3E A;  2K6B A;  1HNX M;  5EQT A;  3M0E A;  3U61 A;  4JXJ A;  4L8R C;  5FLX S;  4NRW A;  2FFJ A;  2BWB A;  5IRE B;  1QVR A;  4DR7 M;  1BVS A;  4JN6 A;  2R6F A;  4DUY M;  4KO8 A;  2QEN A;  3FUW A;  3GPY A;  4IBD A;  2EKF A;  3JR4 A;  4DR1 M;  4AKH A;  2DAE A;  1HQC A;  3T38 A;  2XZU A;  2DWN A;  3FUT A;  3VDP A;  2XGN A;  5ITX E;  4I4L A;  3SFZ A;  1IXS A;  4KLN A;  2XSZ D;  2KXE A;  1VQ1 A;  4LJ5 A;  3KOX E;  1DO0 A;  3CF6 E;  4LFC M;  4G6Z A;  4M9S A;  4NRV A;  4L4U A;  1SXJ E;  5EP3 A;  4OX9 M;  4GKK M;  1XC8 A;  2LHG A;  2KNV A;  1FNN A;  2C96 A;  4B7G A;  2C9O A;  3AL0 C;  3K9O A;  2UUC M;  1NV8 A;  1TH3 A;  1Z5A A;  2C9C A;  2DAM A;  1WHC A;  2JY5 A;  1WXQ A;  4I8O A;  4I81 A;  1GL7 A;  4JI2 M;  1I94 M;  1HR0 M;  4XK8 F;  5EP1 A;  1K3W A;  2EUC A;  3FTE A;  3HJ8 A;  2H1R A;  3NBX X;  2M60 A;  3BBZ A;  1YUB A;  3IG5 A;  2R65 A;  5FTJ A;  1C7Y A;  2DWM A;  4M0W A;  1Y8G A;  3GLF B;  2X49 A;  2K0B X;  2MGW A;  3VLF B;  2UU9 M;  5E26 A;  3FE3 A;  5EJC A; 
#chains in the Genus database with same CATH homology
 3W0L B;  4CGY B;  3WHK A;  3J7A S;  2HL7 A;  3FKE A;  1TDZ A;  2CEA A;  3GLG A;  4FWH A;  4L16 A;  4QHT A;  5EXX A;  2NQ8 C;  2Z4S A;  3I4V A;  2XH9 A;  3GPU A;  3D8B A;  4BLC A;  4QOS A;  4DV3 M;  3FYC A;  3SYK A;  2F5S A;  3VK7 A;  1XNQ M;  3HWS A;  2XFS A;  1OJL A;  3U6Q A;  1IM2 A;  4GRI A;  4JI4 M;  3H4M A;  1DO2 A;  5F3W A;  2DWL A;  2C5R A;  3J27 B;  4PDI A;  2L7I A;  3K1J A;  4GC5 A;  1R6B X;  4D80 A;  1LV7 A;  3OTO M;  2QCU A;  4BB9 A;  4DV0 M;  2FE8 A;  2J7O A;  4LGY A;  4L15 A;  2KRK A;  3A42 A;  3THG A;  1QAM A;  1G59 A;  3HHW A;  2QZ4 A;  4NSR A;  4CIS A;  1UM8 A;  1DGH A;  3U6C A;  3LVV A;  4LF5 M;  3M7G A;  1L2C A;  1Z5B A;  4LRT A;  1KYI A;  4JI0 M;  4AG5 A;  2X8A A;  3A98 B;  4LJ8 A;  3JAM S;  4LZJ A;  3HHZ A;  3KW6 A;  5IT9 S;  1PM5 A;  1FJG M;  2VQF M;  1C1K A;  3ZH9 B;  1NHG C;  4X62 M;  1MX0 A;  1ZAE A;  1PJI A;  3PVS A;  2CHQ A;  3KSX A;  5DYI A;  2L09 A;  4AZF A;  5KPZ A;  4GIT A;  3GLH B;  1QYR A;  2OPF A;  3A46 A;  4QHS A;  4IBB A;  1IBM M;  4OVZ A;  2D7H A;  4MGH A;  2LWX A;  4OW0 A;  1E32 A;  3PFI A;  4B3S M;  2XF3 A;  4MM3 B;  4JI5 M;  4WW0 A;  3KDS E;  2OQ4 A;  3ZCB B;  5LMN M;  3FTC A;  1IBK M;  2UXC M;  2YQZ A;  3CF0 A;  3MJ5 A;  4IBE A;  4RNA A;  2DXI A;  4GHA A;  3FYD A;  4LF9 M;  2I7P A;  2QPA A;  5JI3 E;  1XMO M;  2XFT A;  1QAQ A;  1XXH B;  3U5Z A;  4WUR A;  1G8P A;  3K2L A;  2F5Q A;  1KFV A;  2CE7 A;  1IN5 A;  5KQD A;  4JI7 M;  3D8L A;  1R2Z A;  3PNV A;  1N77 A;  4MH0 E;  5E6J A;  1J5E M;  3FUV A;  4NXM M;  1HT1 E;  5ITX A;  4IJF A;  4M9X A;  1GVN A;  2RGO A;  1IXR C;  4G4N A;  3KP0 E;  7CAT A;  3VKH A;  2UXB M;  2CFO A;  1R7R A;  4DV1 M;  3L25 A;  3DOA A;  4I5S A;  4II7 A;  1K82 A;  4NXN M;  1SXJ A;  3UJN A;  4RF1 A;  3U6S A;  3L29 A;  8CAT A;  1YSY A;  2P5T A;  3J7B A;  3K8Z A;  5ITY A;  5ITQ A;  3SAW A;  2BNK A;  3JR5 A;  3SAR A;  1QAO A;  3TE6 A;  2D7G A;  3KS4 A;  2DWZ B;  2CV2 A;  4MGK E;  3GLI B;  4B3T M;  2W82 A;  1I4W A;  4IBI A;  3SC3 A;  3U6D A;  2R4J A;  2QBY B;  1R2Y A;  4AW4 A;  2F5O A;  1HQY E;  1IN8 A;  3LMM A;  3T15 A;  4MGY E;  2RGH A;  2K47 A;  1SXJ D;  4S12 A;  4P16 A;  1GKI A;  2C99 A;  4NSO B;  4IBG A;  1G41 A;  2EO2 A;  1IQP A;  1D2N A;  2Z4R A;  1XMQ M;  4W5W A;  2YNM D;  4X64 M;  2R45 A;  3QAU A;  4M9Z A;  4AG6 A;  3GLG B;  3FUX A;  3TL4 X;  4G4Q A;  4GHL A;  2R46 A;  4XGI A;  3U60 B;  1L1Z A;  1W5T A;  4IBK A;  2O5R A;  4X65 M;  1L2B A;  4YHH M;  4DV5 M;  1N78 A;  5H37 D;  4YY3 M;  3FUU A;  3SAT A;  4LY6 A;  4D81 A;  3SMP A;  5DYG A;  2CUZ A;  4QNR A;  1J7K A;  3VDU A;  2Q2E B;  4DR3 M;  3GLF A;  3EIE A;  1NVM A;  3MHV C;  1GLN A;  1NY5 A;  1X37 A;  3UMM A;  4FCV A;  4KHP M;  4FW9 A;  4JI1 M;  4GIP A;  5JI2 E;  2XZF A;  2ZAN A;  4TUW A;  5FTM A;  3KSJ A;  3SAS A;  4DR6 M;  1IN4 A;  3FTD A;  2YR0 A;  3GQ4 A;  1JR3 A;  1E94 E;  3KP1 E;  5EP4 A;  3UK6 A;  4DR2 M;  3KS8 A;  3E4R A;  3HJQ A;  1SXJ C;  2VQE M;  1HNW M;  3R8F A;  2BJW A;  1TH4 A;  3K92 A;  3KOW E;  4LF4 M;  1IY1 A;  1XHB A;  4G4O A;  3L28 A;  3SHF A;  4PD2 A;  5KQ8 A;  1NSF A;  4FWG A;  3B9P A;  2Z7J A;  3DZD A;  2Y0T A;  4JI3 M;  3RGS A;  4JYA M;  4FD2 A;  2Y0Q A;  2L7H A;  1HNZ M;  4GMQ A;  2EA0 A;  3U6E A;  2HKJ A;  2LNH C;  2BJV A;  3BOS A;  5FTL A;  1IBL M;  3SMS A;  5FTN A;  4LJA A;  3U6M A;  2KW0 A;  4DV4 M;  3GPP A;  1PJJ A;  3TWM A;  4AKI A;  3J2P B;  2DZN B;  3U6P A;  4B7F A;  1GL6 A;  1JQJ C;  3KXE C;  3J81 S;  2F5N A;  4ITQ A;  3SHG B;  3E9S A;  2ERC A;  4MB7 A;  2M5Z A;  2CV0 A;  5BR8 M;  4JI6 M;  4JV5 M;  3VK8 A;  3MK6 A;  4HLQ A;  1L1T A;  3ILK A;  2I7N A;  2D7E A;  5KPR A;  4GC9 A;  3RGP A;  2X4A A;  4R3D A;  3A45 A;  1S3S A;  3AOE A;  1J09 A;  2C98 A;  5EXP A;  4FVM A;  4DV7 M;  1NJG A;  2F5P A;  1IN7 A;  3GRY A;  4R7G A;  2AHM A;  3WHL A;  2FNA A;  4IBF A;  3ZC7 B;  3HU1 A;  1VDD A;  2CHG A;  5IZ7 D;  4LFB M;  3U61 B;  3PNY A;  5EP2 A;  3AV0 A;  3UZU A;  2R4E A;  3U6L A;  4AKG A;  2R62 A;  4AI6 A;  5IWA M;  3RFW A;  4LF7 M;  3RE8 A;  1N36 M;  3W0F A;  3FD9 A;  3SAU A;  3SBJ A;  2XSZ A;  1N33 M;  2KEB A;  2E5L M;  5FSW A;  1XXH A;  1IXS B;  4XBO A;  4LF8 M;  1TH2 A;  3R9X B;  2UXD M;  4EIW A;  1NJF A;  4DV2 M;  4G4R A;  3GQ3 A;  2R18 A;  2VII A;  2V6Z M;  4CHT B;  2G5G X;  1DGG A;  3J80 S;  3TQS A;  4DV6 M;  3CF2 A;  3U6O A;  2DVW B;  3DA1 A;  5EXT A;  1IY2 A;  4B3R M;  4D82 A;  3AFH A;  1IXZ A;  3HU3 A;  3HHY A;  4B7H A;  3Q8X A;  1E9R A;  4DUZ M;  3TWL A;  1NNJ A;  2LXE A;  1QQW A;  2G8L A;  3KVW A;  2F4V M;  1N32 M;  1DGB A;  3HHX A;  4IBJ A;  3SAV A;  3AOE C;  4KOD A;  4BBA A;  2XEP A;  3GLI A;  4LRS A;  2QBY A;  2DHR A;  2XLJ A;  1Z5C A;  2ZAM A;  2FOI C;  2RKO A;  4GH9 A;  3T1Y M;  3AJI B;  3UGJ A;  1QZM A;  1Z59 A;  4LCB A;  1L8Q A;  3I51 A;  4A3V B;  2YFQ A;  4PDG A;  2KA6 B;  1G3I A;  3HGI A;  3NWL A;  1NY6 A;  3LVW A;  1OFI A;  4IBC A;  1K3X A;  4LJ4 A;  5FTK A;  3HKP A;  3TPZ A;  3L27 A;  4B3M M;  5A2Q S;  2DZO B;  3L2A A;  5BPV A;  4PT5 A;  5ITT A;  4LJ7 A;  2ZAO A;  2A5Y B;  1ORY B;  1NHW C;  3KOY E;  3U60 A;  3AOG A;  3C58 A;  3LQQ A;  1DGF A;  4LJ6 A;  1DGH B;  2ZM6 M;  4DR5 M;  4LZZ A;  4NL4 H;  3VKG A;  4IIW A;  4K0K M;  2UUA M;  5LMU M;  4FCT A;  1H6U A;  3GRR A;  4NOO B;  3SYL A;  2CHV A;  1Q39 A;  3CTW B;  1HT2 E;  2JA2 A;  4LG2 A;  1T3T A;  3EIH A;  3NBI A;  3IG8 A;  1YE9 A;  5C1B A;  1MU5 A;  4IJE A;  3M6A A;  4HL4 A;  3LQR A;  2CV1 A;  2V1U A;  2UUB M;  1JR3 D;  5ITU A;  2J7N A;  4L78 A;  1G4A E;  4LJ9 A;  4OVZ B;  3VFD A;  3GRU A;  4DR4 M;  2Y21 A;  4M0D A;  4Z6Y A;  3DFZ A;  4FWD A;  3KFU G;  5EXS A;  1Z6T A;  5ITR A;  2V1C A;  4OU7 A;  1N34 M;  3GP1 A;  4PCZ A;  1ZQ9 A;  3GPX A;  4LF6 M;  1QAN A;  4JI8 M;  4MGZ E;  2HHH M;  1NNU C;  1KSF X;  3QWL A;  1OFH A;  1XWI A;  5KPT A;  3HU2 A;  5DNY A;  2Y20 A;  3GLH A;  3GO8 A;  2KZS A;  3U5Z B;  1N75 A;  3TWK A;  4B08 A;  4LGM A;  4ZPX A;  5C18 A;  3PXG A;  4QOZ C;  1TDH A;  4REZ A;  3T1H M;  3FTF A;  1Q3B A;  3HJS A;  2KZU A;  3KOZ E;  2Z3X A;  3AKZ A;  4X66 M;  2ZBK B;  1IN6 A;  1XNR M;  4FCW A;  1Q3C A;  1W5S A;  1TGU A;  1IY0 A;  1L2D A;  4QNM A;  4LFA M;  3GQ5 A;  1E9S A;  2HCB A;  2L6O A;  1SXJ B;  5KO3 A;  5GKN A;  4AQY M;  4MGI E;  3GRV A;  3L26 A;  3I4Y A;  4RF0 A;  4GKJ M;  4Z8X A;  2QP9 X;  1EE8 A;  2KRU A;  2LH0 A;  1HNX M;  5EQT A;  3M0E A;  3U61 A;  4JXJ A;  4L8R C;  5FLX S;  4NRW A;  2FFJ A;  5IRE B;  1QVR A;  4DR7 M;  4JN6 A;  4DUY M;  4KO8 A;  2QEN A;  3FUW A;  3GPY A;  4IBD A;  3JR4 A;  4DR1 M;  4AKH A;  1HQC A;  3T38 A;  2XZU A;  2DWN A;  3FUT A;  3VDP A;  2XGN A;  5ITX E;  4I4L A;  3SFZ A;  4KLN A;  2XSZ D;  2KXE A;  4LJ5 A;  3KOX E;  1DO0 A;  3CF6 E;  4LFC M;  4G6Z A;  4M9S A;  4NRV A;  4L4U A;  1SXJ E;  5EP3 A;  4OX9 M;  4GKK M;  1XC8 A;  1FNN A;  2C96 A;  4B7G A;  2C9O A;  3AL0 C;  2UUC M;  1TH3 A;  1Z5A A;  2C9C A;  1WXQ A;  4I8O A;  4I81 A;  1GL7 A;  4JI2 M;  1I94 M;  1HR0 M;  5EP1 A;  1K3W A;  2EUC A;  3FTE A;  3HJ8 A;  2H1R A;  2M60 A;  5FTJ A;  3IG5 A;  1YUB A;  2R65 A;  2DWM A;  4M0W A;  3GLF B;  2X49 A;  3VLF B;  2UU9 M;  5E26 A;  5EJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...