4L8RC

Structure of mrna stem-loop, human stem-loop binding protein and 3'hexo ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
67
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE MRNA STEM-LOOP
publication title Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein/hydrolase
total genus 21
structure length 67
sequence length 73
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l8rC00
4TUWA 4L8RC 4QOZC
chains in the Genus database with same CATH superfamily
1OTRA 1FNNA 1R2ZA 4BLCA 5IREB 3KSXA 2VF8A 4IBJA 4DV7M 3FD9A 5LMUM 2WSCF 1VEKA 2FH0A 1G3IA 5EP3A 4GIPA 1PJSA 1MJGM 4BB9A 4FCVA 4M0WA 4KODA 5H37D 1VEJA 3AOGA 2M60A 3T6PA 4A3VB 3R9XB 3DFZA 3J80S 3GLIB 4DV5M 4LF4M 2DHRA 1V92A 2XGNA 3ZC7B 3FRIA 3KVWA 1HNWM 2ERCA 1T6OA 3TPZA 4KT0F 4HLQA 1QDRA 1SXJC 1HT2E 1VDDA 1K82A 1XXHA 2VDBB 4L16A 4OW0A 2LVAA 4AW4A 4D82A 5BPVA 1XWIA 2LVQD 3L28A 2FE8A 4AKHA 3ILKA 2DNAA 1UFZA 3GLGE 1TR8A 4RF0A 1ZQ9A 3CGWA 3B9PA 5EJCA 1ZMVA 2QHOB 4OVZA 2XH9A 1EIJA 1FJGM 3H4MA 2KRUA 1QZMA 1R2YA 1X37A 5C1BA 5EP1A 3EIHA 4B7GA 4MH0E 4GKJM 4DR1M 3GQ3A 1NNJA 2LVNC 3KOWE 1ZMWA 1NV8A 3M7GA 2B3TA 3BBZA 1IN5A 5E6JA 2C9CA 3GPXA 3VDPA 3D8BA 4JI8M 3H4JA 2DAKA 3GLIE 3ZQJA 4G4NA 4GHLA 4QNMA 1Z59A 2XF3A 1QAOA 3QYBA 3VLFB 1OIZA 3BXWA 4M9SA 1C1KA 1HQYE 4L4UA 4Z8XA 2D7GA 1D0MA 4WURA 3B7NA 3AJIB 3L2AA 1OIPA 3F92A 4IIWA 7CATA 1Q3BA 2DHYA 3FUXA 4P16A 5C18A 3HWSA 3KOYE 4NSRA 3TE6A 3IG5A 3SHGB 1J7KA 2QPAA 2X49A 1KYIA 2DWMA 4GITA 2H5XA 2CP8A 2GQFA 2RRUA 4LJAA 3AOEC 2NQ8C 5GKNA 4CJ6A 1IXRC 5LMNM 1C7YA 3FYCA 4IBGA 2CV0A 3FTFA 4DR5M 2UU9M 1GKIA 4DR7M 4X64M 4GEWA 3I51A 3HJQA 4IBCA 4L15A 2V1UA 2F4VM 1NO1A 2CEAA 2BJVA 2ZANA 2YR0A 4EIWA 2D7HA 3B89A 1G59A 2EKKA 3FTEA 1HNZM 1TF0B 3PFIA 3LCUA 2DI0A 4B7HA 4CGYB 3B7QA 2LH0A 3LVVA 4AQYM 1HJPA 4JI7M 2K6BA 3T1YM 3HZJA 3FTDA 1PJQA 2QZ4A 2KZUA 3LMMA 3SMPA 3SBJA 1ZV1A 1K3WA 4RNAA 1S3SA 1QZEA 4L78A 5ITXA 4G4OA 1TDZA 2F5QA 2V6ZM 1PRBA 2YNMD 3LQQA 4QOSA 1IFYA 2OOAA 2A5YB 3BOSA 4F1IA 4G4RA 2FS1A 2G3QA 4IBBA 4JI2M 2R46A 1E9RA 4KHPM 2JNHA 2XSZD 4LRSA 5ITRA 4XGIA 4MGKE 3DOAA 4G4QA 1NVMA 2DZOB 4D80A 2F5SA 2XZFA 4LJ8A 2KZSA 2UUCM 2QENA 4GHAA 5DYGA 1DGFA 4NC6A 3HHYA 3IHPA 1P3QQ 5KPZA 3WHKA 1QDTA 3KXEC 1T43A 3QWLA 4DUZM 4DV6M 4P17A 3RGPA 3SATA 1A5TA 4AKGA 2Y20A 4HEOA 2KNVA 1HR0M 4LFCM 4XBOA 4WW0A 2Z4SA 3FYDA 2QCUA 4HL4A 1IY2A 3MMPA 3C9PA 3KSJA 5KQ8A 2L2DA 2L7HA 3FUTA 2Q2EB 1YE9A 3GRUA 3J27B 4MM3B 3J2PB 2ZTDA 1N77A 2DZNB 4CISA 2CWBA 2HWJA 3J7BA 1Q3CA 4QNRA 3J7AS 3U60A 4NSOB 1WR1B 2KW0A 1TH4A 2VIIA 1N75A 1D0LA 4LJ9A 1T3TA 3SC3A 3M0EA 2ZBKB 3JAMS 1PM5A 4YY3M 1NHGC 1Z6TA 2JY8A 5FTJA 3W67A 4DV0M 2G5GX 5JI2E 3AFHA 2APLA 4ANRA 2V1CA 4QHSA 2CV2A 2J7OA 5FLXS 3JR4A 4MB7A 2O25A 2DWNA 4JYAM 3HX3A 5ITYA 4W5WA 3DA1A 3KP0E 2DZLA 5FTMA 3U61A 3TWLA 3SYKA 2X4AA 3I04M 5FSWA 2R44A 3HHZA 2KA6B 2YFQA 1EE8A 4LG2A 2DWZB 3HJ8A 4IBIA 3GRYA 2Y0TA 3E4RA 3SARA 3GLHB 2QBYB 4GMQA 3L29A 1N32M 1IBMM 4NL4H 4TUWA 2R18A 4OU7A 1E32A 4GC5A 3NBXX 3GQ4A 1MX0A 4G3OA 4FW9A 4MGHA 2HKJA 1DGHA 1WGLA 5L8RF 4GRIA 4R71A 2HAKA 2X8AA 3FE3A 1IM2A 3T1HM 3SAWA 5IT9S 4PCZA 5ITXE 5E26A 4Q7JA 1G4AE 3JR5A 1GLNA 4B3MM 2JZ0A 3E9SA 2G8LA 4LJ7A 5ITQA 3KW6A 3Q8GA 3FUUA 1WJ7A 3U6QA 1D0KA 2DAIA 3U60B 2O5RA 3A45A 1SXJA 4I5SA 5FTLA 2ZTCA 1OQYA 1IQPA 2J5YA 2R0IA 3OTOM 8CATA 4R7GA 1I94M 2HHHM 3FRHA 2JP7A 4LF6M 3HY5A 1F4IA 5DFLA 2JZ1A 3HGIA 2L4EA 2CV1A 1TTEA 4GC9A 4R3DA 4JI5M 2R6FA 1TH2A 3SMSA 3GLHE 2ZAOA 2DAMA 1PJTA 2Y21A 3I01M 5KPTA 3VK8A 4G6ZA 2K9DA 2DENA 3HU2A 1XXHB 4GKKM 1JR3E 3U61B 2MGWA 1TGUA 3A42A 1IBKM 3K1JA 3HHXA 3W68A 1R4GA 4GH9A 2MR9A 3MHVC 4MGZE 3I4VA 1Y8GA 1G41A 1IN7A 1NSFA 2MROB 2OQ4A 1IY0A 2EUCA 3VDUA 1J5EM 2CUZA 1OFHA 3RGSA 1LTMA 4JN6A 5EXTA 1YUBA 1DGBA 1VG5A 3SAVA 1YSYA 1NY6A 1QAMA 1BVSA 1RU3A 3FUVA 2EKFA 3I4YA 4FWHA 4OVZB 4DR6M 5F3WA 1QYRA 3PXGA 4CHTB 4NRWA 3SASA 3RFWA 4PDIA 1VQ1A 4CIZA 1LV7A 3QYEA 2EO2A 1N78A 3IG8A 3AOEA 2LTUA 2JY6B 3CF2A 2FOIC 1R6BX 2LXEA 3FUWA 3TL4X 2VQFM 1JR3D 2K0BX 1OAIA 1H6UA 1PGYA 4AG6A 3GLFA 1SXJB 4DV1M 3TWMA 4YHHM 1NJGA 2XFTA 1XXHE 4X62M 4M9XA 1HQCA 1SG9A 4DV4M 1Q02A 2GNOA 4FWGA 3EIEA 3KS8A 2CE7A 4LJ6A 2YQZA 2BWEA 2VQEM 3TWKA 4I81A 2ZAMA 1GJTA 1QANA 2D7EA 2LVPC 4KLNA 2I7PA 4X65M 3U6MA 2JY5A 3LVWA 4JI6M 2QP9X 1NJFA 4XK8F 1VEGA 1L2BA 1QUSA 1OFIA 4Z6YA 1L2CA 3GLIA 1Q39A 4L8RC 4LFAM 2BJWA 2M5ZA 1OAOC 4LRTA 1TDHA 4LY6A 4IJFA 3VK7A 3KS4A 1GL6A 2VF7A 4BBAA 3GRVA 1XHBA 2DKLA 1IY1A 1GVNA 1WXQA 3NBIA 1NY5A 3SAUA 1E9SA 2LBCA 4S12A 1NHWC 1QUTA 2R45A 2LWXA 4FCTA 3GO8A 3U6EA 3SHFA 4B08A 2DXIA 3U6SA 2FNAA 1SXJE 3MJ5A 4WP2A 3CF0A 1QAQA 2CRUA 4ITQA 2JUJA 3K9OA 2BNKA 3UMMA 1G8PA 1HT1E 3PVSA 4IJEA 2DAEA 3E46A 4RKUF 1VDLA 3L26A 4DV3M 2R4JA 3FKEA 2CHVA 2KHHA 1L2DA 2QNJA 2XEPA 1J09A 1AIPC 3VKGA 3KOXE 3VKHA 3SYLA 4B3TM 1N33M 2XSZA 3E21A 1L1TA 2Z8YM 3GLFB 2XFSA 1L8QA 3IECA 3T38A 2HCBA 3C3EA 3HU1A 2LHGA 3K2LA 1QVRA 5EP2A 5IWAM 1IN4A 2C5RA 1GL7A 3K92A 5EXPA 2Z3XA 4DUYM 2JXNA 2C98A 3W0FA 5BR8M 3NWLA 4DBGB 1K3XA 2XZUA 1TH3A 1V34A 2OPFA 1IXSA 3T15A 2EA0A 2J7NA 1ZMUA 2Z7JA 4LCBA 3ZH9B 3KFUG 2KXEA 2UXCM 3AKZA 4IBEA 1XC8A 1SXJD 2RGHA 3GP1A 1GJSA 2CFOA 4NOOB 3GPYA 5DNYA 1HNXM 2JA2A 1OJLA 2P5TA 4II7A 4LZJA 5IZ7D 4JI3M 2HL7A 5KQDA 3MK6A 3ZCBB 4PD2A 4LF7M 3AL0C 4QOZC 1JQJC 2BWBA 2L6OA 3KP1E 5EQTA 2F5NA 1WHCA 2I7NA 3LW5F 4K0KM 4Y28F 1JB0F 4B7FA 4M9ZA 3U5ZA 3A98B 4KO8A 4PT5A 3CF6E 3LCVB 2L09A 1DO2A 2N35A 5JI3E 3GLFE 5EXXA 2C9OA 4B3SM 4RF1A 1Z5AA 3W0LB 1IXZA 4FVMA 2L4FA 4IBKA 3V76A 4LZZA 1EFUB 1PJJA 1W5TA 3AV0A 3L27A 3GQ5A 4LJ4A 1IN8A 4NXMM 4LFBM 1OKSA 2LHCA 1DGGA 2FFJA 3HU3A 4LJ5A 4ZPXA 1CUKA 4OX9M 1GABA 2Z4RA 4UN2B 2C96A 1Z5BA 4IBDA 3KOZE 3Q8XA 2C99A 2MJ5B 4DR2M 3PNVA 3HHWA 3J81S 2JY7A 3PNYA 4AKIA 1KSFX 4X66M 2R65A 3M6AA 5KO3A 4FWDA 2LNHC 1ORYB 1IXSB 1WGNA 3B74A 3UJNA 1XNRM 3WHLA 4F2LA 2DAGA 1Z5CA 2JWSA 3RE8A 2DWLA 1N36M 3B7ZA 2OO9A 2QSFX 1IN6A 4LGYA 4NXNM 3GPPA 3GRRA 1XMOM 2CHQA 1DGHB 4I4LA 3L25A 2WSEF 1UM8A 4PDGA 3SFZA 1V33A 2O01F 1NV9A 3HKPA 2F5OA 2UUAM 4LF9M 5FTKA 5EXSA 2XLJA 3C58A 4LGMA 5DYIA 3U5ZB 3U6OA 3R8FA 3GLGA 3U6PA 1L1ZA 3C3DA 1NNUC 3UGJA 2AHMA 2KNZA 5EP4A 1YLAA 4I8OA 4FD2A 3GPUA 2LVOC 4AG5A 2ZM6M 4LF5M 3UK6A 1KFVA 1AUAA 4DR4M 2UXDM 3FTCA 1G71A 3HJSA 2R4EA 4LF8M 2KDLA 2R62A 1MU5A 3LQRA 1XNQM 1DO0A 1E94E 3KDSE 4AZFA 3CTWB 4FCWA 5A2QS 1MN3A 2MH8A 3U6DA 3K9PA 4JI0M 3U6CA 4B3RM 1IBLM 2UXBM 1R5LA 1WIVA 2EJSA 4MGIE 4JV5M 5FTNA 2OOBA 2WSFF 4DR3M 1PJIA 3D8LA 1GO5A 5KPRA 4M0DA 3THGA 1R7RA 2Y0QA 2K47A 3DZDA 1XMQM 2DVWB 2CHGA 3U6LA 4QHTA 3GLHA 1N34M 1ZAEA 2QBYA 4JI4M 2KEBA 4JI1M 3VFDA 1DV0A 4AI6A 4MGYE 4DV2M 4IBFA 4D81A 4REZA 1XB2B 4L6V6 1JR3A 3TQSA 2H1RA 3QAUA 4JXJA 2WZJA 1W5SA 2RKOA 2E5LM 1QQWA 1D2NA 3GLGB 3A46A 5ITTA 2L7IA 3K8ZA 2UUBM 2QQ8A 2KNAA 2RGOA 2W82A 2KRKA 4NRVA 3UZUA 5ITUA 2F5PA 1I4WA
chains in the Genus database with same CATH topology
1FNNA 1R2ZA 4BLCA 5IREB 3KSXA 4IBJA 4DV7M 3FD9A 5LMUM 1G3IA 5EP3A 4GIPA 4BB9A 4FCVA 4M0WA 4KODA 5H37D 3AOGA 2M60A 4A3VB 3R9XB 3DFZA 3J80S 3GLIB 4DV5M 4LF4M 2DHRA 2XGNA 3ZC7B 3KVWA 1HNWM 2ERCA 3TPZA 4HLQA 1K82A 1SXJC 1HT2E 1VDDA 1XXHA 4L16A 4OW0A 4AW4A 4D82A 5BPVA 1XWIA 4AKHA 3L28A 2FE8A 3ILKA 4RF0A 1ZQ9A 3B9PA 5EJCA 4OVZA 2XH9A 1FJGM 3H4MA 2KRUA 1QZMA 1R2YA 1X37A 5C1BA 5EP1A 3EIHA 4B7GA 4MH0E 4GKJM 4DR1M 3GQ3A 1NNJA 3KOWE 3M7GA 1IN5A 5E6JA 2C9CA 3GPXA 3VDPA 3D8BA 4JI8M 4G4NA 4GHLA 4QNMA 1Z59A 2XF3A 1QAOA 3VLFB 3J7AS 4M9SA 1C1KA 1HQYE 4L4UA 4Z8XA 2D7GA 4WURA 3U6MA 3AJIB 3L2AA 4IIWA 7CATA 1Q3BA 3FUXA 4P16A 5C18A 3HWSA 3KOYE 4NSRA 3TE6A 3IG5A 3SHGB 1J7KA 2QPAA 2X49A 1KYIA 2DWMA 4GITA 5LMNM 4LJAA 3AOEC 2NQ8C 5GKNA 1IXRC 3FYCA 4IBGA 2CV0A 3FTFA 4DR5M 2UU9M 1GKIA 4DR7M 4X64M 3I51A 3HJQA 4IBCA 4L15A 2V1UA 2F4VM 2CEAA 2BJVA 2ZANA 2YR0A 4EIWA 2D7HA 1G59A 3FTEA 1HNZM 3PFIA 4B7HA 4CGYB 4JI7M 2LH0A 3LVVA 4AQYM 3T1YM 3FTDA 2QZ4A 2KZUA 3LMMA 3SMPA 3SBJA 1K3WA 4RNAA 1S3SA 4L78A 5ITXA 4G4OA 1TDZA 2F5QA 2V6ZM 2YNMD 3LQQA 4QOSA 2A5YB 3BOSA 4G4RA 4JI2M 4IBBA 2R46A 1E9RA 4KHPM 2XSZD 4LRSA 5ITRA 4MGKE 3DOAA 4G4QA 1NVMA 2DZOB 4D80A 2F5SA 2XZFA 4LJ8A 2KZSA 2UUCM 2QENA 4GHAA 5DYGA 1DGFA 3HHYA 5KPZA 3WHKA 3KXEC 3QWLA 4DUZM 4DV6M 3RGPA 3SATA 4AKGA 2Y20A 1HR0M 4LFCM 4XBOA 4WW0A 2Z4SA 3FYDA 2QCUA 4HL4A 1IY2A 3KSJA 5KQ8A 2L7HA 3FUTA 2Q2EB 1YE9A 3GRUA 3J27B 4MM3B 3J2PB 4CISA 1N77A 2DZNB 3J7BA 1Q3CA 4QNRA 3U60A 4NSOB 2KW0A 1TH4A 2VIIA 1N75A 4LJ9A 1T3TA 3SC3A 3M0EA 2ZBKB 3JAMS 1PM5A 4YY3M 1NHGC 1Z6TA 5FTJA 4DV0M 2G5GX 5JI2E 3AFHA 2V1CA 4QHSA 2CV2A 2J7OA 5FLXS 3JR4A 4MB7A 2DWNA 4JYAM 5ITYA 4W5WA 3DA1A 3KP0E 5FTMA 3U61A 3TWLA 3SYKA 2X4AA 5FSWA 3HHZA 2KA6B 2YFQA 1EE8A 4LG2A 2DWZB 3HJ8A 4IBIA 3GRYA 2Y0TA 3E4RA 3SARA 3GLHB 2QBYB 4GMQA 3L29A 1N32M 1IBMM 4NL4H 4TUWA 2R18A 4OU7A 1E32A 4GC5A 3GQ4A 1MX0A 4FW9A 4MGHA 2HKJA 1DGHA 4GRIA 2X8AA 1IM2A 3T1HM 3SAWA 5IT9S 4PCZA 5ITXE 5E26A 1G4AE 3JR5A 1GLNA 4B3MM 3E9SA 2G8LA 4LJ7A 5ITQA 3KW6A 3U6QA 3FUUA 3U60B 2O5RA 3A45A 1SXJA 4I5SA 5FTLA 1IQPA 1I94M 2HHHM 3OTOM 8CATA 4R7GA 4LF6M 4OX9M 3HGIA 2CV1A 4GC9A 4R3DA 4JI5M 1TH2A 3SMSA 5KPTA 2ZAOA 2Y21A 3VK8A 4G6ZA 3HU2A 1XXHB 4GKKM 3U61B 1TGUA 3A42A 1IBKM 3K1JA 3HHXA 4GH9A 3MHVC 4MGZE 3I4VA 1G41A 1IN7A 1NSFA 2OQ4A 1IY0A 2EUCA 3VDUA 1J5EM 2CUZA 1OFHA 3RGSA 4JN6A 5EXTA 1YUBA 1DGBA 3SAVA 1YSYA 1NY6A 1QAMA 4OVZB 3FUVA 4XGIA 4FWHA 3I4YA 4DR6M 5F3WA 1QYRA 3PXGA 4CHTB 4NRWA 3SASA 3RFWA 4PDIA 1LV7A 1N78A 2EO2A 3IG8A 3AOEA 3CF2A 2FOIC 1R6BX 2LXEA 3FUWA 3TL4X 2VQFM 1JR3D 4DV1M 1H6UA 4AG6A 3GLFA 1SXJB 3TWMA 4YHHM 1NJGA 2XFTA 4X62M 4M9XA 1HQCA 4DV4M 4FWGA 3KS8A 3EIEA 2CE7A 4LJ6A 2YQZA 2VQEM 3TWKA 4I81A 2ZAMA 1QANA 2D7EA 4KLNA 2I7PA 4X65M 3LVWA 4JI6M 2QP9X 1NJFA 1L2BA 1OFIA 4Z6YA 1L2CA 3GLIA 1Q39A 4L8RC 4LFAM 2BJWA 2M5ZA 4LRTA 1TDHA 4LY6A 4IJFA 3VK7A 3KS4A 1GL6A 4BBAA 3GRVA 1XHBA 1IY1A 1GVNA 1WXQA 3NBIA 1NY5A 3SAUA 1E9SA 4S12A 1NHWC 2R45A 2LWXA 4FCTA 3GO8A 3U6EA 3SHFA 4B08A 2DXIA 3U6SA 2FNAA 1SXJE 3MJ5A 3CF0A 1QAQA 4ITQA 2BNKA 3UMMA 1G8PA 1HT1E 3PVSA 4IJEA 3L26A 4DV3M 2R4JA 3FKEA 2CHVA 1L2DA 2XEPA 1J09A 3VKGA 3KOXE 3VKHA 3SYLA 4B3TM 1N33M 2XSZA 1L1TA 3GLFB 2XFSA 1L8QA 3T38A 2HCBA 3HU1A 3K2LA 5EP2A 1QVRA 5IWAM 2C5RA 1IN4A 1GL7A 3K92A 5EXPA 2Z3XA 4DUYM 2C98A 3W0FA 5BR8M 3NWLA 1K3XA 2XZUA 1TH3A 2OPFA 3T15A 2EA0A 2J7NA 2Z7JA 4LCBA 3ZH9B 3KFUG 2KXEA 2UXCM 3AKZA 4IBEA 1XC8A 1SXJD 2RGHA 3GP1A 2CFOA 4NOOB 3GPYA 5DNYA 1HNXM 2JA2A 1OJLA 2P5TA 4II7A 4LZJA 5IZ7D 4JI3M 2HL7A 5KQDA 3MK6A 3ZCBB 4PD2A 4LF7M 3AL0C 4QOZC 1JQJC 2L6OA 3KP1E 5EQTA 2F5NA 2I7NA 4K0KM 4B7FA 4M9ZA 3U5ZA 3A98B 4KO8A 4PT5A 3CF6E 5JI3E 2L09A 1DO2A 5EXXA 2C9OA 4B3SM 4RF1A 1Z5AA 3W0LB 1IXZA 4FVMA 4IBKA 4LZZA 1PJJA 1W5TA 3AV0A 3L27A 3GQ5A 4LJ4A 1IN8A 4NXMM 4LFBM 1DGGA 2FFJA 3HU3A 4LJ5A 4ZPXA 2Z4RA 2C96A 1Z5BA 4IBDA 3KOZE 3Q8XA 2C99A 4DR2M 3PNVA 3HHWA 3J81S 3PNYA 4AKIA 1KSFX 4X66M 2R65A 3M6AA 5KO3A 4FWDA 2LNHC 1ORYB 1IXSB 3UJNA 1XNRM 3WHLA 1Z5CA 3RE8A 2DWLA 1N36M 1IN6A 4LGYA 4NXNM 3GPPA 3GRRA 1XMOM 2CHQA 1DGHB 4I4LA 3L25A 1UM8A 4PDGA 3SFZA 3HKPA 2F5OA 2UUAM 4LF9M 5FTKA 5EXSA 2XLJA 3C58A 4LGMA 5DYIA 3U5ZB 3U6OA 3R8FA 3GLGA 3U6PA 1L1ZA 1NNUC 3UGJA 2AHMA 5EP4A 3GPUA 4I8OA 4FD2A 4AG5A 2ZM6M 4LF5M 3UK6A 1KFVA 4DR4M 2UXDM 3FTCA 3HJSA 2R4EA 4LF8M 2R62A 1MU5A 3LQRA 1XNQM 1DO0A 1E94E 3KDSE 4AZFA 3CTWB 4FCWA 5A2QS 3U6DA 4JI0M 3U6CA 4B3RM 1IBLM 2UXBM 4MGIE 4JV5M 5FTNA 4DR3M 1PJIA 3D8LA 5KPRA 4M0DA 3THGA 1R7RA 2Y0QA 2K47A 3DZDA 1XMQM 2DVWB 2CHGA 3U6LA 4QHTA 3GLHA 1N34M 1ZAEA 2QBYA 4JI4M 2KEBA 4JI1M 3VFDA 4AI6A 4MGYE 4DV2M 4IBFA 4D81A 4REZA 1JR3A 3TQSA 2H1RA 3QAUA 4JXJA 1W5SA 2RKOA 2E5LM 1QQWA 1D2NA 3GLGB 3A46A 5ITTA 2L7IA 3K8ZA 2UUBM 2RGOA 2W82A 2KRKA 4NRVA 3UZUA 5ITUA 2F5PA 1I4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUW A;  4L8R C;  4QOZ C; 
#chains in the Genus database with same CATH topology
 1OTR A;  1FNN A;  1R2Z A;  4BLC A;  5IRE B;  3KSX A;  2VF8 A;  4IBJ A;  4DV7 M;  3FD9 A;  5LMU M;  2WSC F;  1VEK A;  2FH0 A;  1G3I A;  5EP3 A;  4GIP A;  1PJS A;  1MJG M;  4BB9 A;  4FCV A;  4M0W A;  4KOD A;  5H37 D;  1VEJ A;  3AOG A;  2M60 A;  3T6P A;  4A3V B;  3R9X B;  3DFZ A;  3J80 S;  3GLI B;  4DV5 M;  4LF4 M;  2DHR A;  1V92 A;  2XGN A;  3ZC7 B;  3FRI A;  3KVW A;  1HNW M;  2ERC A;  1T6O A;  3TPZ A;  4KT0 F;  4HLQ A;  1QDR A;  1SXJ C;  1HT2 E;  1VDD A;  1K82 A;  1XXH A;  2VDB B;  4L16 A;  4OW0 A;  2LVA A;  4AW4 A;  4D82 A;  5BPV A;  1XWI A;  2LVQ D;  3L28 A;  2FE8 A;  4AKH A;  3ILK A;  2DNA A;  1UFZ A;  3GLG E;  1TR8 A;  4RF0 A;  1ZQ9 A;  3CGW A;  3B9P A;  5EJC A;  1ZMV A;  2QHO B;  4OVZ A;  2XH9 A;  1EIJ A;  1FJG M;  3H4M A;  2KRU A;  1QZM A;  1R2Y A;  1X37 A;  5C1B A;  5EP1 A;  3EIH A;  4B7G A;  4MH0 E;  4GKJ M;  4DR1 M;  3GQ3 A;  1NNJ A;  2LVN C;  3KOW E;  1ZMW A;  1NV8 A;  3M7G A;  2B3T A;  3BBZ A;  1IN5 A;  5E6J A;  2C9C A;  3GPX A;  3VDP A;  3D8B A;  4JI8 M;  3H4J A;  2DAK A;  3GLI E;  3ZQJ A;  4G4N A;  4GHL A;  4QNM A;  1Z59 A;  2XF3 A;  1QAO A;  3QYB A;  3VLF B;  1OIZ A;  3BXW A;  4M9S A;  1C1K A;  1HQY E;  4L4U A;  4Z8X A;  2D7G A;  1D0M A;  4WUR A;  3B7N A;  3AJI B;  3L2A A;  1OIP A;  3F92 A;  4IIW A;  7CAT A;  1Q3B A;  2DHY A;  3FUX A;  4P16 A;  5C18 A;  3HWS A;  3KOY E;  4NSR A;  3TE6 A;  3IG5 A;  3SHG B;  1J7K A;  2QPA A;  2X49 A;  1KYI A;  2DWM A;  4GIT A;  2H5X A;  2CP8 A;  2GQF A;  2RRU A;  4LJA A;  3AOE C;  2NQ8 C;  5GKN A;  4CJ6 A;  1IXR C;  5LMN M;  1C7Y A;  3FYC A;  4IBG A;  2CV0 A;  3FTF A;  4DR5 M;  2UU9 M;  1GKI A;  4DR7 M;  4X64 M;  4GEW A;  3I51 A;  3HJQ A;  4IBC A;  4L15 A;  2V1U A;  2F4V M;  1NO1 A;  2CEA A;  2BJV A;  2ZAN A;  2YR0 A;  4EIW A;  2D7H A;  3B89 A;  1G59 A;  2EKK A;  3FTE A;  1HNZ M;  1TF0 B;  3PFI A;  3LCU A;  2DI0 A;  4B7H A;  4CGY B;  3B7Q A;  2LH0 A;  3LVV A;  4AQY M;  1HJP A;  4JI7 M;  2K6B A;  3T1Y M;  3HZJ A;  3FTD A;  1PJQ A;  2QZ4 A;  2KZU A;  3LMM A;  3SMP A;  3SBJ A;  1ZV1 A;  1K3W A;  4RNA A;  1S3S A;  1QZE A;  4L78 A;  5ITX A;  4G4O A;  1TDZ A;  2F5Q A;  2V6Z M;  1PRB A;  2YNM D;  3LQQ A;  4QOS A;  1IFY A;  2OOA A;  2A5Y B;  3BOS A;  4F1I A;  4G4R A;  2FS1 A;  2G3Q A;  4IBB A;  4JI2 M;  2R46 A;  1E9R A;  4KHP M;  2JNH A;  2XSZ D;  4LRS A;  5ITR A;  4XGI A;  4MGK E;  3DOA A;  4G4Q A;  1NVM A;  2DZO B;  4D80 A;  2F5S A;  2XZF A;  4LJ8 A;  2KZS A;  2UUC M;  2QEN A;  4GHA A;  5DYG A;  1DGF A;  4NC6 A;  3HHY A;  3IHP A;  1P3Q Q;  5KPZ A;  3WHK A;  1QDT A;  3KXE C;  1T43 A;  3QWL A;  4DUZ M;  4DV6 M;  4P17 A;  3RGP A;  3SAT A;  1A5T A;  4AKG A;  2Y20 A;  4HEO A;  2KNV A;  1HR0 M;  4LFC M;  4XBO A;  4WW0 A;  2Z4S A;  3FYD A;  2QCU A;  4HL4 A;  1IY2 A;  3MMP A;  3C9P A;  3KSJ A;  5KQ8 A;  2L2D A;  2L7H A;  3FUT A;  2Q2E B;  1YE9 A;  3GRU A;  3J27 B;  4MM3 B;  3J2P B;  2ZTD A;  1N77 A;  2DZN B;  4CIS A;  2CWB A;  2HWJ A;  3J7B A;  1Q3C A;  4QNR A;  3J7A S;  3U60 A;  4NSO B;  1WR1 B;  2KW0 A;  1TH4 A;  2VII A;  1N75 A;  1D0L A;  4LJ9 A;  1T3T A;  3SC3 A;  3M0E A;  2ZBK B;  3JAM S;  1PM5 A;  4YY3 M;  1NHG C;  1Z6T A;  2JY8 A;  5FTJ A;  3W67 A;  4DV0 M;  2G5G X;  5JI2 E;  3AFH A;  2APL A;  4ANR A;  2V1C A;  4QHS A;  2CV2 A;  2J7O A;  5FLX S;  3JR4 A;  4MB7 A;  2O25 A;  2DWN A;  4JYA M;  3HX3 A;  5ITY A;  4W5W A;  3DA1 A;  3KP0 E;  2DZL A;  5FTM A;  3U61 A;  3TWL A;  3SYK A;  2X4A A;  3I04 M;  5FSW A;  2R44 A;  3HHZ A;  2KA6 B;  2YFQ A;  1EE8 A;  4LG2 A;  2DWZ B;  3HJ8 A;  4IBI A;  3GRY A;  2Y0T A;  3E4R A;  3SAR A;  3GLH B;  2QBY B;  4GMQ A;  3L29 A;  1N32 M;  1IBM M;  4NL4 H;  4TUW A;  2R18 A;  4OU7 A;  1E32 A;  4GC5 A;  3NBX X;  3GQ4 A;  1MX0 A;  4G3O A;  4FW9 A;  4MGH A;  2HKJ A;  1DGH A;  1WGL A;  5L8R F;  4GRI A;  4R71 A;  2HAK A;  2X8A A;  3FE3 A;  1IM2 A;  3T1H M;  3SAW A;  5IT9 S;  4PCZ A;  5ITX E;  5E26 A;  4Q7J A;  1G4A E;  3JR5 A;  1GLN A;  4B3M M;  2JZ0 A;  3E9S A;  2G8L A;  4LJ7 A;  5ITQ A;  3KW6 A;  3Q8G A;  3FUU A;  1WJ7 A;  3U6Q A;  1D0K A;  2DAI A;  3U60 B;  2O5R A;  3A45 A;  1SXJ A;  4I5S A;  5FTL A;  2ZTC A;  1OQY A;  1IQP A;  2J5Y A;  2R0I A;  3OTO M;  8CAT A;  4R7G A;  1I94 M;  2HHH M;  3FRH A;  2JP7 A;  4LF6 M;  3HY5 A;  1F4I A;  5DFL A;  2JZ1 A;  3HGI A;  2L4E A;  2CV1 A;  1TTE A;  4GC9 A;  4R3D A;  4JI5 M;  2R6F A;  1TH2 A;  3SMS A;  3GLH E;  2ZAO A;  2DAM A;  1PJT A;  2Y21 A;  3I01 M;  5KPT A;  3VK8 A;  4G6Z A;  2K9D A;  2DEN A;  3HU2 A;  1XXH B;  4GKK M;  1JR3 E;  3U61 B;  2MGW A;  1TGU A;  3A42 A;  1IBK M;  3K1J A;  3HHX A;  3W68 A;  1R4G A;  4GH9 A;  2MR9 A;  3MHV C;  4MGZ E;  3I4V A;  1Y8G A;  1G41 A;  1IN7 A;  1NSF A;  2MRO B;  2OQ4 A;  1IY0 A;  2EUC A;  3VDU A;  1J5E M;  2CUZ A;  1OFH A;  3RGS A;  1LTM A;  4JN6 A;  5EXT A;  1YUB A;  1DGB A;  1VG5 A;  3SAV A;  1YSY A;  1NY6 A;  1QAM A;  1BVS A;  1RU3 A;  3FUV A;  2EKF A;  3I4Y A;  4FWH A;  4OVZ B;  4DR6 M;  5F3W A;  1QYR A;  3PXG A;  4CHT B;  4NRW A;  3SAS A;  3RFW A;  4PDI A;  1VQ1 A;  4CIZ A;  1LV7 A;  3QYE A;  2EO2 A;  1N78 A;  3IG8 A;  3AOE A;  2LTU A;  2JY6 B;  3CF2 A;  2FOI C;  1R6B X;  2LXE A;  3FUW A;  3TL4 X;  2VQF M;  1JR3 D;  2K0B X;  1OAI A;  1H6U A;  1PGY A;  4AG6 A;  3GLF A;  1SXJ B;  4DV1 M;  3TWM A;  4YHH M;  1NJG A;  2XFT A;  1XXH E;  4X62 M;  4M9X A;  1HQC A;  1SG9 A;  4DV4 M;  1Q02 A;  2GNO A;  4FWG A;  3EIE A;  3KS8 A;  2CE7 A;  4LJ6 A;  2YQZ A;  2BWE A;  2VQE M;  3TWK A;  4I81 A;  2ZAM A;  1GJT A;  1QAN A;  2D7E A;  2LVP C;  4KLN A;  2I7P A;  4X65 M;  3U6M A;  2JY5 A;  3LVW A;  4JI6 M;  2QP9 X;  1NJF A;  4XK8 F;  1VEG A;  1L2B A;  1QUS A;  1OFI A;  4Z6Y A;  1L2C A;  3GLI A;  1Q39 A;  4L8R C;  4LFA M;  2BJW A;  2M5Z A;  1OAO C;  4LRT A;  1TDH A;  4LY6 A;  4IJF A;  3VK7 A;  3KS4 A;  1GL6 A;  2VF7 A;  4BBA A;  3GRV A;  1XHB A;  2DKL A;  1IY1 A;  1GVN A;  1WXQ A;  3NBI A;  1NY5 A;  3SAU A;  1E9S A;  2LBC A;  4S12 A;  1NHW C;  1QUT A;  2R45 A;  2LWX A;  4FCT A;  3GO8 A;  3U6E A;  3SHF A;  4B08 A;  2DXI A;  3U6S A;  2FNA A;  1SXJ E;  3MJ5 A;  4WP2 A;  3CF0 A;  1QAQ A;  2CRU A;  4ITQ A;  2JUJ A;  3K9O A;  2BNK A;  3UMM A;  1G8P A;  1HT1 E;  3PVS A;  4IJE A;  2DAE A;  3E46 A;  4RKU F;  1VDL A;  3L26 A;  4DV3 M;  2R4J A;  3FKE A;  2CHV A;  2KHH A;  1L2D A;  2QNJ A;  2XEP A;  1J09 A;  1AIP C;  3VKG A;  3KOX E;  3VKH A;  3SYL A;  4B3T M;  1N33 M;  2XSZ A;  3E21 A;  1L1T A;  2Z8Y M;  3GLF B;  2XFS A;  1L8Q A;  3IEC A;  3T38 A;  2HCB A;  3C3E A;  3HU1 A;  2LHG A;  3K2L A;  1QVR A;  5EP2 A;  5IWA M;  1IN4 A;  2C5R A;  1GL7 A;  3K92 A;  5EXP A;  2Z3X A;  4DUY M;  2JXN A;  2C98 A;  3W0F A;  5BR8 M;  3NWL A;  4DBG B;  1K3X A;  2XZU A;  1TH3 A;  1V34 A;  2OPF A;  1IXS A;  3T15 A;  2EA0 A;  2J7N A;  1ZMU A;  2Z7J A;  4LCB A;  3ZH9 B;  3KFU G;  2KXE A;  2UXC M;  3AKZ A;  4IBE A;  1XC8 A;  1SXJ D;  2RGH A;  3GP1 A;  1GJS A;  2CFO A;  4NOO B;  3GPY A;  5DNY A;  1HNX M;  2JA2 A;  1OJL A;  2P5T A;  4II7 A;  4LZJ A;  5IZ7 D;  4JI3 M;  2HL7 A;  5KQD A;  3MK6 A;  3ZCB B;  4PD2 A;  4LF7 M;  3AL0 C;  4QOZ C;  1JQJ C;  2BWB A;  2L6O A;  3KP1 E;  5EQT A;  2F5N A;  1WHC A;  2I7N A;  3LW5 F;  4K0K M;  4Y28 F;  1JB0 F;  4B7F A;  4M9Z A;  3U5Z A;  3A98 B;  4KO8 A;  4PT5 A;  3CF6 E;  3LCV B;  2L09 A;  1DO2 A;  2N35 A;  5JI3 E;  3GLF E;  5EXX A;  2C9O A;  4B3S M;  4RF1 A;  1Z5A A;  3W0L B;  1IXZ A;  4FVM A;  2L4F A;  4IBK A;  3V76 A;  4LZZ A;  1EFU B;  1PJJ A;  1W5T A;  3AV0 A;  3L27 A;  3GQ5 A;  4LJ4 A;  1IN8 A;  4NXM M;  4LFB M;  1OKS A;  2LHC A;  1DGG A;  2FFJ A;  3HU3 A;  4LJ5 A;  4ZPX A;  1CUK A;  4OX9 M;  1GAB A;  2Z4R A;  4UN2 B;  2C96 A;  1Z5B A;  4IBD A;  3KOZ E;  3Q8X A;  2C99 A;  2MJ5 B;  4DR2 M;  3PNV A;  3HHW A;  3J81 S;  2JY7 A;  3PNY A;  4AKI A;  1KSF X;  4X66 M;  2R65 A;  3M6A A;  5KO3 A;  4FWD A;  2LNH C;  1ORY B;  1IXS B;  1WGN A;  3B74 A;  3UJN A;  1XNR M;  3WHL A;  4F2L A;  2DAG A;  1Z5C A;  2JWS A;  3RE8 A;  2DWL A;  1N36 M;  3B7Z A;  2OO9 A;  2QSF X;  1IN6 A;  4LGY A;  4NXN M;  3GPP A;  3GRR A;  1XMO M;  2CHQ A;  1DGH B;  4I4L A;  3L25 A;  2WSE F;  1UM8 A;  4PDG A;  3SFZ A;  1V33 A;  2O01 F;  1NV9 A;  3HKP A;  2F5O A;  2UUA M;  4LF9 M;  5FTK A;  5EXS A;  2XLJ A;  3C58 A;  4LGM A;  5DYI A;  3U5Z B;  3U6O A;  3R8F A;  3GLG A;  3U6P A;  1L1Z A;  3C3D A;  1NNU C;  3UGJ A;  2AHM A;  2KNZ A;  5EP4 A;  1YLA A;  4I8O A;  4FD2 A;  3GPU A;  2LVO C;  4AG5 A;  2ZM6 M;  4LF5 M;  3UK6 A;  1KFV A;  1AUA A;  4DR4 M;  2UXD M;  3FTC A;  1G71 A;  3HJS A;  2R4E A;  4LF8 M;  2KDL A;  2R62 A;  1MU5 A;  3LQR A;  1XNQ M;  1DO0 A;  1E94 E;  3KDS E;  4AZF A;  3CTW B;  4FCW A;  5A2Q S;  1MN3 A;  2MH8 A;  3U6D A;  3K9P A;  4JI0 M;  3U6C A;  4B3R M;  1IBL M;  2UXB M;  1R5L A;  1WIV A;  2EJS A;  4MGI E;  4JV5 M;  5FTN A;  2OOB A;  2WSF F;  4DR3 M;  1PJI A;  3D8L A;  1GO5 A;  5KPR A;  4M0D A;  3THG A;  1R7R A;  2Y0Q A;  2K47 A;  3DZD A;  1XMQ M;  2DVW B;  2CHG A;  3U6L A;  4QHT A;  3GLH A;  1N34 M;  1ZAE A;  2QBY A;  4JI4 M;  2KEB A;  4JI1 M;  3VFD A;  1DV0 A;  4AI6 A;  4MGY E;  4DV2 M;  4IBF A;  4D81 A;  4REZ A;  1XB2 B;  4L6V 6;  1JR3 A;  3TQS A;  2H1R A;  3QAU A;  4JXJ A;  2WZJ A;  1W5S A;  2RKO A;  2E5L M;  1QQW A;  1D2N A;  3GLG B;  3A46 A;  5ITT A;  2L7I A;  3K8Z A;  2UUB M;  2QQ8 A;  2KNA A;  2RGO A;  2W82 A;  2KRK A;  4NRV A;  3UZU A;  5ITU A;  2F5P A;  1I4W A; 
#chains in the Genus database with same CATH homology
 1FNN A;  1R2Z A;  4BLC A;  5IRE B;  3KSX A;  4IBJ A;  4DV7 M;  3FD9 A;  5LMU M;  1G3I A;  5EP3 A;  4GIP A;  4BB9 A;  4FCV A;  4M0W A;  4KOD A;  5H37 D;  3AOG A;  2M60 A;  4A3V B;  3R9X B;  3DFZ A;  3J80 S;  3GLI B;  4DV5 M;  4LF4 M;  2DHR A;  2XGN A;  3ZC7 B;  3KVW A;  1HNW M;  2ERC A;  3TPZ A;  4HLQ A;  1K82 A;  1SXJ C;  1HT2 E;  1VDD A;  1XXH A;  4L16 A;  4OW0 A;  4AW4 A;  4D82 A;  5BPV A;  1XWI A;  4AKH A;  3L28 A;  2FE8 A;  3ILK A;  4RF0 A;  1ZQ9 A;  3B9P A;  5EJC A;  4OVZ A;  2XH9 A;  1FJG M;  3H4M A;  2KRU A;  1QZM A;  1R2Y A;  1X37 A;  5C1B A;  5EP1 A;  3EIH A;  4B7G A;  4MH0 E;  4GKJ M;  4DR1 M;  3GQ3 A;  1NNJ A;  3KOW E;  3M7G A;  1IN5 A;  5E6J A;  2C9C A;  3GPX A;  3VDP A;  3D8B A;  4JI8 M;  4G4N A;  4GHL A;  4QNM A;  1Z59 A;  2XF3 A;  1QAO A;  3VLF B;  3J7A S;  4M9S A;  1C1K A;  1HQY E;  4L4U A;  4Z8X A;  2D7G A;  4WUR A;  3U6M A;  3AJI B;  3L2A A;  4IIW A;  7CAT A;  1Q3B A;  3FUX A;  4P16 A;  5C18 A;  3HWS A;  3KOY E;  4NSR A;  3TE6 A;  3IG5 A;  3SHG B;  1J7K A;  2QPA A;  2X49 A;  1KYI A;  2DWM A;  4GIT A;  5LMN M;  4LJA A;  3AOE C;  2NQ8 C;  5GKN A;  1IXR C;  3FYC A;  4IBG A;  2CV0 A;  3FTF A;  4DR5 M;  2UU9 M;  1GKI A;  4DR7 M;  4X64 M;  3I51 A;  3HJQ A;  4IBC A;  4L15 A;  2V1U A;  2F4V M;  2CEA A;  2BJV A;  2ZAN A;  2YR0 A;  4EIW A;  2D7H A;  1G59 A;  3FTE A;  1HNZ M;  3PFI A;  4B7H A;  4CGY B;  4JI7 M;  2LH0 A;  3LVV A;  4AQY M;  3T1Y M;  3FTD A;  2QZ4 A;  2KZU A;  3LMM A;  3SMP A;  3SBJ A;  1K3W A;  4RNA A;  1S3S A;  4L78 A;  5ITX A;  4G4O A;  1TDZ A;  2F5Q A;  2V6Z M;  2YNM D;  3LQQ A;  4QOS A;  2A5Y B;  3BOS A;  4G4R A;  4JI2 M;  4IBB A;  2R46 A;  1E9R A;  4KHP M;  2XSZ D;  4LRS A;  5ITR A;  4MGK E;  3DOA A;  4G4Q A;  1NVM A;  2DZO B;  4D80 A;  2F5S A;  2XZF A;  4LJ8 A;  2KZS A;  2UUC M;  2QEN A;  4GHA A;  5DYG A;  1DGF A;  3HHY A;  5KPZ A;  3WHK A;  3KXE C;  3QWL A;  4DUZ M;  4DV6 M;  3RGP A;  3SAT A;  4AKG A;  2Y20 A;  1HR0 M;  4LFC M;  4XBO A;  4WW0 A;  2Z4S A;  3FYD A;  2QCU A;  4HL4 A;  1IY2 A;  3KSJ A;  5KQ8 A;  2L7H A;  3FUT A;  2Q2E B;  1YE9 A;  3GRU A;  3J27 B;  4MM3 B;  3J2P B;  4CIS A;  1N77 A;  2DZN B;  3J7B A;  1Q3C A;  4QNR A;  3U60 A;  4NSO B;  2KW0 A;  1TH4 A;  2VII A;  1N75 A;  4LJ9 A;  1T3T A;  3SC3 A;  3M0E A;  2ZBK B;  3JAM S;  1PM5 A;  4YY3 M;  1NHG C;  1Z6T A;  5FTJ A;  4DV0 M;  2G5G X;  5JI2 E;  3AFH A;  2V1C A;  4QHS A;  2CV2 A;  2J7O A;  5FLX S;  3JR4 A;  4MB7 A;  2DWN A;  4JYA M;  5ITY A;  4W5W A;  3DA1 A;  3KP0 E;  5FTM A;  3U61 A;  3TWL A;  3SYK A;  2X4A A;  5FSW A;  3HHZ A;  2KA6 B;  2YFQ A;  1EE8 A;  4LG2 A;  2DWZ B;  3HJ8 A;  4IBI A;  3GRY A;  2Y0T A;  3E4R A;  3SAR A;  3GLH B;  2QBY B;  4GMQ A;  3L29 A;  1N32 M;  1IBM M;  4NL4 H;  4TUW A;  2R18 A;  4OU7 A;  1E32 A;  4GC5 A;  3GQ4 A;  1MX0 A;  4FW9 A;  4MGH A;  2HKJ A;  1DGH A;  4GRI A;  2X8A A;  1IM2 A;  3T1H M;  3SAW A;  5IT9 S;  4PCZ A;  5ITX E;  5E26 A;  1G4A E;  3JR5 A;  1GLN A;  4B3M M;  3E9S A;  2G8L A;  4LJ7 A;  5ITQ A;  3KW6 A;  3U6Q A;  3FUU A;  3U60 B;  2O5R A;  3A45 A;  1SXJ A;  4I5S A;  5FTL A;  1IQP A;  1I94 M;  2HHH M;  3OTO M;  8CAT A;  4R7G A;  4LF6 M;  4OX9 M;  3HGI A;  2CV1 A;  4GC9 A;  4R3D A;  4JI5 M;  1TH2 A;  3SMS A;  5KPT A;  2ZAO A;  2Y21 A;  3VK8 A;  4G6Z A;  3HU2 A;  1XXH B;  4GKK M;  3U61 B;  1TGU A;  3A42 A;  1IBK M;  3K1J A;  3HHX A;  4GH9 A;  3MHV C;  4MGZ E;  3I4V A;  1G41 A;  1IN7 A;  1NSF A;  2OQ4 A;  1IY0 A;  2EUC A;  3VDU A;  1J5E M;  2CUZ A;  1OFH A;  3RGS A;  4JN6 A;  5EXT A;  1YUB A;  1DGB A;  3SAV A;  1YSY A;  1NY6 A;  1QAM A;  4OVZ B;  3FUV A;  4XGI A;  4FWH A;  3I4Y A;  4DR6 M;  5F3W A;  1QYR A;  3PXG A;  4CHT B;  4NRW A;  3SAS A;  3RFW A;  4PDI A;  1LV7 A;  1N78 A;  2EO2 A;  3IG8 A;  3AOE A;  3CF2 A;  2FOI C;  1R6B X;  2LXE A;  3FUW A;  3TL4 X;  2VQF M;  1JR3 D;  4DV1 M;  1H6U A;  4AG6 A;  3GLF A;  1SXJ B;  3TWM A;  4YHH M;  1NJG A;  2XFT A;  4X62 M;  4M9X A;  1HQC A;  4DV4 M;  4FWG A;  3KS8 A;  3EIE A;  2CE7 A;  4LJ6 A;  2YQZ A;  2VQE M;  3TWK A;  4I81 A;  2ZAM A;  1QAN A;  2D7E A;  4KLN A;  2I7P A;  4X65 M;  3LVW A;  4JI6 M;  2QP9 X;  1NJF A;  1L2B A;  1OFI A;  4Z6Y A;  1L2C A;  3GLI A;  1Q39 A;  4L8R C;  4LFA M;  2BJW A;  2M5Z A;  4LRT A;  1TDH A;  4LY6 A;  4IJF A;  3VK7 A;  3KS4 A;  1GL6 A;  4BBA A;  3GRV A;  1XHB A;  1IY1 A;  1GVN A;  1WXQ A;  3NBI A;  1NY5 A;  3SAU A;  1E9S A;  4S12 A;  1NHW C;  2R45 A;  2LWX A;  4FCT A;  3GO8 A;  3U6E A;  3SHF A;  4B08 A;  2DXI A;  3U6S A;  2FNA A;  1SXJ E;  3MJ5 A;  3CF0 A;  1QAQ A;  4ITQ A;  2BNK A;  3UMM A;  1G8P A;  1HT1 E;  3PVS A;  4IJE A;  3L26 A;  4DV3 M;  2R4J A;  3FKE A;  2CHV A;  1L2D A;  2XEP A;  1J09 A;  3VKG A;  3KOX E;  3VKH A;  3SYL A;  4B3T M;  1N33 M;  2XSZ A;  1L1T A;  3GLF B;  2XFS A;  1L8Q A;  3T38 A;  2HCB A;  3HU1 A;  3K2L A;  5EP2 A;  1QVR A;  5IWA M;  2C5R A;  1IN4 A;  1GL7 A;  3K92 A;  5EXP A;  2Z3X A;  4DUY M;  2C98 A;  3W0F A;  5BR8 M;  3NWL A;  1K3X A;  2XZU A;  1TH3 A;  2OPF A;  3T15 A;  2EA0 A;  2J7N A;  2Z7J A;  4LCB A;  3ZH9 B;  3KFU G;  2KXE A;  2UXC M;  3AKZ A;  4IBE A;  1XC8 A;  1SXJ D;  2RGH A;  3GP1 A;  2CFO A;  4NOO B;  3GPY A;  5DNY A;  1HNX M;  2JA2 A;  1OJL A;  2P5T A;  4II7 A;  4LZJ A;  5IZ7 D;  4JI3 M;  2HL7 A;  5KQD A;  3MK6 A;  3ZCB B;  4PD2 A;  4LF7 M;  3AL0 C;  4QOZ C;  1JQJ C;  2L6O A;  3KP1 E;  5EQT A;  2F5N A;  2I7N A;  4K0K M;  4B7F A;  4M9Z A;  3U5Z A;  3A98 B;  4KO8 A;  4PT5 A;  3CF6 E;  5JI3 E;  2L09 A;  1DO2 A;  5EXX A;  2C9O A;  4B3S M;  4RF1 A;  1Z5A A;  3W0L B;  1IXZ A;  4FVM A;  4IBK A;  4LZZ A;  1PJJ A;  1W5T A;  3AV0 A;  3L27 A;  3GQ5 A;  4LJ4 A;  1IN8 A;  4NXM M;  4LFB M;  1DGG A;  2FFJ A;  3HU3 A;  4LJ5 A;  4ZPX A;  2Z4R A;  2C96 A;  1Z5B A;  4IBD A;  3KOZ E;  3Q8X A;  2C99 A;  4DR2 M;  3PNV A;  3HHW A;  3J81 S;  3PNY A;  4AKI A;  1KSF X;  4X66 M;  2R65 A;  3M6A A;  5KO3 A;  4FWD A;  2LNH C;  1ORY B;  1IXS B;  3UJN A;  1XNR M;  3WHL A;  1Z5C A;  3RE8 A;  2DWL A;  1N36 M;  1IN6 A;  4LGY A;  4NXN M;  3GPP A;  3GRR A;  1XMO M;  2CHQ A;  1DGH B;  4I4L A;  3L25 A;  1UM8 A;  4PDG A;  3SFZ A;  3HKP A;  2F5O A;  2UUA M;  4LF9 M;  5FTK A;  5EXS A;  2XLJ A;  3C58 A;  4LGM A;  5DYI A;  3U5Z B;  3U6O A;  3R8F A;  3GLG A;  3U6P A;  1L1Z A;  1NNU C;  3UGJ A;  2AHM A;  5EP4 A;  3GPU A;  4I8O A;  4FD2 A;  4AG5 A;  2ZM6 M;  4LF5 M;  3UK6 A;  1KFV A;  4DR4 M;  2UXD M;  3FTC A;  3HJS A;  2R4E A;  4LF8 M;  2R62 A;  1MU5 A;  3LQR A;  1XNQ M;  1DO0 A;  1E94 E;  3KDS E;  4AZF A;  3CTW B;  4FCW A;  5A2Q S;  3U6D A;  4JI0 M;  3U6C A;  4B3R M;  1IBL M;  2UXB M;  4MGI E;  4JV5 M;  5FTN A;  4DR3 M;  1PJI A;  3D8L A;  5KPR A;  4M0D A;  3THG A;  1R7R A;  2Y0Q A;  2K47 A;  3DZD A;  1XMQ M;  2DVW B;  2CHG A;  3U6L A;  4QHT A;  3GLH A;  1N34 M;  1ZAE A;  2QBY A;  4JI4 M;  2KEB A;  4JI1 M;  3VFD A;  4AI6 A;  4MGY E;  4DV2 M;  4IBF A;  4D81 A;  4REZ A;  1JR3 A;  3TQS A;  2H1R A;  3QAU A;  4JXJ A;  1W5S A;  2RKO A;  2E5L M;  1QQW A;  1D2N A;  3GLG B;  3A46 A;  5ITT A;  2L7I A;  3K8Z A;  2UUB M;  2RGO A;  2W82 A;  2KRK A;  4NRV A;  3UZU A;  5ITU A;  2F5P A;  1I4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...