4L8RC

Structure of mrna stem-loop, human stem-loop binding protein and 3'hexo ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
67
Chain Sequence
b'DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE MRNA STEM-LOOP
publication title Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein/hydrolase
total genus 21
structure length 67
sequence length 73
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l8rC00
4QOZC 4TUWA 4L8RC
chains in the Genus database with same CATH superfamily
3SHFA 1QAQA 4DV4M 4AI6A 1VEKA 2D7EA 3V76A 2DZNB 1VEJA 2QHOB 4R3DA 3R9XB 1N33M 3HKPA 4M9ZA 3SASA 1XXHE 2EJSA 2UUCM 2O01F 2Z4RA 3U6MA 3KDSE 3GPUA 4DR5M 2YFQA 4MH0E 3GO8A 1IBKM 4DR1M 3FYDA 1R2YA 2DZOB 1A5TA 3PXGA 2UUBM 1TGUA 3FD9A 2OPFA 2VF8A 2CV0A 1OFHA 1J09A 2VDBB 4B3MM 1G3IA 1JR3A 2B3TA 2I7PA 2JWSA 4X65M 3GLGE 1SXJC 4L15A 2FS1A 2R44A 2E5LM 2C9CA 3IHPA 4DV2M 4LZJA 3KOWE 4KLNA 3LVWA 3PVSA 4L78A 2HAKA 4IIWA 3SAUA 1OQYA 2BJWA 2K6BA 4TUWA 5A2QS 2FE8A 1GL6A 3QYEA 3RGSA 4NL4H 3IECA 2R65A 2JXNA 2Z8YM 1ZMUA 4DV6M 4G4RA 1TDZA 3AV0A 1WGNA 1GKIA 4REZA 3SARA 3U6EA 2I7NA 3JR5A 1NHGC 1C7YA 2G5GX 2DZLA 4KO8A 2MR9A 1IXSB 3GLFA 4NSRA 4JI3M 4OX9M 1TTEA 4FWDA 3T1YM 4F2LA 3SFZA 1ZV1A 5GKNA 4XGIA 3I01M 3LCVB 5ITRA 3GPXA 1Z5BA 4IBEA 5KQ8A 3FTFA 3KOXE 4NRWA 4RF0A 4LJ8A 3SMPA 2QQ8A 3GRUA 4S12A 4JV5M 4MB7A 2ZTCA 4LCBA 3HX3A 1G41A 1QDTA 2CP8A 3B89A 4ZPXA 4NC6A 4D81A 5LMUM 3W0LB 2YR0A 1N36M 1XXHA 3U5ZA 2DVWB 4CIZA 4LRTA 5BPVA 1SXJA 4EIWA 1L2BA 3TPZA 2LWXA 2K47A 4OVZB 1NY5A 1J7KA 2KZUA 3TWMA 1ZMWA 1N34M 1PJTA 5E26A 2KNAA 3I4YA 4Q7JA 2K9DA 1DGBA 2JY7A 3J2PB 2XSZD 4X62M 2KNZA 3W68A 3W0FA 3KSJA 5EXSA 4CGYB 2DKLA 3GRRA 1NY6A 2GNOA 4LFAM 5KPTA 3GLGA 4LJ6A 2G8LA 5IREB 3A98B 2KRUA 1NHWC 5IZ7D 2J7NA 2RRUA 2OOAA 3L2AA 5JI3E 3R8FA 3J80S 3L26A 4LG2A 4MGYE 3HY5A 2QPAA 1XNQM 3M6AA 3D8BA 4A3VB 2L7IA 3J7BA 3KVWA 2KHHA 3Q8XA 1H6UA 1IXZA 1QVRA 2LVAA 4GH9A 3CTWB 3GQ3A 3A46A 1NNJA 2KZSA 3WHKA 1KFVA 1L2CA 2UXBM 2KNVA 1HT1E 3QAUA 3MMPA 2FH0A 1OAOC 4M0DA 3VLFB 1XB2B 1SXJD 3HU1A 4BBAA 1Z59A 3AFHA 1V33A 1IN5A 1VDLA 4LFBM 4GRIA 2LH0A 5ITXE 5EQTA 1TF0B 2VQFM 3RE8A 2JA2A 4W5WA 4DR3M 4X64M 2UU9M 4JI6M 1MX0A 4B3TM 4L16A 4Z8XA 3C3EA 3T15A 4HL4A 5KPRA 2O25A 2DHRA 1OTRA 2H5XA 2L09A 1JQJC 2ZTDA 4ANRA 2JY5A 5EP2A 1YSYA 4GITA 2FOIC 5EXPA 5KPZA 1SG9A 4KT0F 3U61B 5ITYA 3UZUA 2RKOA 2M5ZA 3NBXX 3OTOM 1NV8A 1K3XA 4CJ6A 2JNHA 3A42A 3CGWA 4GMQA 1D0KA 1MU5A 2FFJA 2KRKA 1YLAA 3K1JA 1IFYA 4G4NA 3FUXA 3HGIA 1ORYB 2HKJA 1HNXM 2J7OA 1HNZM 1NO1A 4D80A 2XGNA 4I8OA 4QHTA 4JI8M 4R7GA 5LMNM 4RNAA 3AOGA 1W5TA 2G3QA 1IY0A 3FTDA 3LQQA 3GP1A 4NXNM 1DV0A 1DGHA 3H4MA 4GHAA 2Y20A 1E9RA 2OQ4A 1QQWA 1NJGA 2XLJA 2D7GA 4JN6A 1V34A 3MJ5A 3ILKA 3W67A 2L7HA 3TQSA 2WZJA 2YNMD 1Y8GA 3FUTA 4IBBA 1LV7A 4GEWA 2Z7JA 5KQDA 1AIPC 3LCUA 2R45A 5E6JA 1NV9A 1X37A 2C98A 3FYCA 2BNKA 2CRUA 3KS4A 5FTMA 1GJSA 3LVVA 1IN4A 2J5YA 2JY6B 5ITTA 3TWLA 2LHCA 3L28A 5EP3A 1D0MA 3MK6A 3U6DA 1PJIA 5DNYA 4LJAA 1Z5CA 2JZ1A 2GQFA 3I04M 1E94E 1QZMA 3FUUA 3UK6A 2VQEM 1QUTA 4LJ5A 5IWAM 3CF0A 1I4WA 1C1KA 1Z5AA 4KHPM 2DNAA 5ITXA 3HU3A 4LFCM 1S3SA 1R2ZA 3SC3A 2CFOA 4AW4A 3UMMA 4X66M 2X49A 3NBIA 2MROB 3GQ5A 4AKGA 1OIPA 4GC9A 2KXEA 3DFZA 4AQYM 1IXRC 4HEOA 4JI2M 3KOZE 2DAKA 3SYLA 1J5EM 1DO2A 1JR3D 3GLFB 4LY6A 1NJFA 2DXIA 3VDUA 3T38A 4GC5A 3RFWA 2JUJA 2L2DA 2DI0A 2DHYA 2KW0A 3K2LA 2VIIA 3KXEC 1G8PA 2L4FA 2RGHA 1NSFA 2F5SA 3JAMS 2F5PA 5H37D 2QP9X 2V1CA 3FTEA 4IJFA 1Q39A 3M0EA 4LF7M 4AG5A 3AJIB 4B7FA 3Q8GA 2EA0A 2MH8A 3GLIE 4I4LA 4GKJM 1QDRA 3EIEA 3I4VA 3WHLA 3U5ZB 1ZMVA 3K9OA 5FTKA 2XZFA 2UXDM 4FWHA 1DGGA 1SXJB 3C9PA 3FUWA 1EIJA 2QBYA 2ZANA 1JB0F 5C1BA 1T6OA 4II7A 2Z3XA 3B9PA 3B7NA 2QSFX 3DA1A 4I5SA 3DOAA 4QNRA 4IBGA 4AG6A 1GO5A 4LF6M 2V6ZM 5DYIA 2R62A 3K92A 4IBDA 2ZM6M 1T3TA 2DWNA 3AOEA 1I94M 3VKHA 3PNVA 3GLGB 3CF6E 4LF5M 1GABA 1IY2A 1QZEA 1R6BX 3K8ZA 1D2NA 2XH9A 4NRVA 1F4IA 2R4JA 4RF1A 1EFUB 4XBOA 1PJJA 1K82A 3GRYA 1L1TA 2ZBKB 4LF8M 4MGIE 1FNNA 2KA6B 3KP1E 1N75A 5FSWA 3SAWA 1OIZA 4AKHA 1P3QQ 1TH4A 2CHQA 3BXWA 2XF3A 1TDHA 4K0KM 3U60A 1L8QA 2DAEA 4IBIA 4AZFA 1UM8A 1KSFX 1XMQM 4BB9A 3GLHB 4B08A 2XFTA 4FW9A 1BVSA 4FCVA 1VG5A 1W5SA 1DO0A 3LQRA 2YQZA 3B7ZA 2BJVA 2BWBA 3TWKA 4PCZA 3K9PA 5ITUA 5FTJA 3KP0E 1WJ7A 5F3WA 3C58A 1Q3BA 1YE9A 2CHGA 4JI7M 2W82A 2LXEA 1N32M 4GHLA 2KEBA 2EO2A 3LMMA 2Y21A 3PNYA 1Q02A 2QZ4A 4MGHA 3PFIA 4PD2A 3U6PA 2C99A 2R4EA 4FWGA 4P16A 4DV5M 4PDIA 1G59A 1MN3A 2DWZB 3U6QA 5FLXS 5EP1A 3GLIA 2D7HA 1DGFA 1XNRM 1XMOM 2LVNC 4QOSA 3HHZA 5L8RF 3THGA 3U61A 4FVMA 3U6SA 4FD2A 1R7RA 1WHCA 5EXXA 3T6PA 1QANA 3HHWA 1E32A 2Q2EB 1HT2E 2QENA 2N35A 1HR0M 1GLNA 4Z6YA 4R71A 2APLA 2CHVA 4FCWA 4WURA 1DGHB 5EJCA 3UJNA 1G71A 4DUYM 3AKZA 2O5RA 3DZDA 4F1IA 3U6OA 3VDPA 3SATA 4JI5M 2R46A 1IM2A 3HU2A 3SBJA 4M9XA 3KOYE 3SMSA 4IBCA 1KYIA 3LW5F 1R4GA 4WW0A 4M0WA 3J81S 1FJGM 1GL7A 3HJQA 4DUZM 4JI4M 2LBCA 4DR2M 3AL0C 5IT9S 3EIHA 1SXJE 4I81A 2ZAOA 2V1UA 3E21A 4MM3B 1EE8A 1LTMA 2CEAA 2F4VM 4B3RM 2QCUA 1V92A 2LNHC 3GPYA 1WIVA 2CV2A 4LRSA 3SHGB 2EKFA 3B7QA 4DV1M 2DAMA 2R18A 4L8RC 2HHHM 2R6FA 2P5TA 4B3SM 2RGOA 2C5RA 3KW6A 4B7GA 1XC8A 4RKUF 3ZC7B 3AOEC 1L2DA 3L25A 1WGLA 1T43A 4FCTA 1TH2A 4M9SA 2JZ0A 3VFDA 3ZH9B 8CATA 3KFUG 2L6OA 3J27B 4LJ9A 3FE3A 3FRHA 2LVQD 4LJ4A 7CATA 5KO3A 2Y0TA 4LF9M 4NOOB 2LTUA 3GPPA 4CHTB 2X8AA 1YUBA 2OOBA 4YY3M 3I51A 2DWMA 1IN7A 1ZQ9A 4PDGA 3HJ8A 4DR4M 3T1HM 1E9SA 2FNAA 3E46A 1HQCA 3GLHE 5EXTA 1IXSA 1IBLM 2LVOC 3FTCA 2F5OA 4G4OA 4IBKA 1HQYE 1UFZA 4CISA 5FTNA 1NNUC 2CUZA 2HCBA 2XFSA 3E4RA 2OO9A 3HJSA 3RGPA 1L1ZA 2XSZA 5DFLA 3HHYA 1N78A 4HLQA 4LJ7A 4GKKM 2NQ8C 2CWBA 4LGMA 1XXHB 2XZUA 1IN6A 4L6V6 4G4QA 5DYGA 2UXCM 2DWLA 1GVNA 4MGZE 2CE7A 3VK7A 1PJQA 4P17A 3HZJA 2JP7A 5ITQA 3HWSA 1ZAEA 2HWJA 4JI0M 3FKEA 3BOSA 3ZQJA 3L27A 2QBYB 1IBMM 4L4UA 4DV7M 1G4AE 2R0IA 1Z6TA 4OVZA 3MHVC 3BBZA 4DV0M 4Y28F 5BR8M 1XWIA 4WP2A 2M60A 3CF2A 1GJTA 5C18A 2DAGA 2X4AA 4NSOB 1XHBA 2AHMA 2DENA 3TE6A 2C9OA 1PRBA 5FTLA 2K0BX 1AUAA 2UUAM 4IBJA 3B74A 3M7GA 1VEGA 2Z4SA 1RU3A 2WSCF 2WSEF 2MJ5B 2QNJA 3FRIA 3U6LA 1QYRA 1PGYA 2MGWA 1IN8A 4B7HA 2HL7A 1WR1B 4GIPA 2CV1A 3D8LA 1OKSA 2BWEA 3H4JA 2F5QA 2A5YB 4G3OA 4DR7M 3GRVA 1OJLA 1JR3E 1HJPA 3F92A 4DV3M 1MJGM 3KS8A 2JY8A 3U60B 3ZCBB 4OU7A 4AKIA 3UGJA 4XK8F 4OW0A 1Q3CA 1QAMA 2DAIA 2XEPA 4JI1M 1IQPA 1WXQA 1VQ1A 2H1RA 3FUVA 4KODA 2LVPC 4G6ZA 4QHSA 1PM5A 1N77A 1VDDA 2C96A 3GLHA 3HHXA 2EUCA 4JXJA 4NXMM 1QAOA 3E9SA 2KDLA 3L29A 3QYBA 5JI2E 3VK8A 4IBFA 2F5NA 1CUKA 4ITQA 1K3WA 2WSFF 3NWLA 1HNWM 3GQ4A 3IG5A 4UN2B 3U6CA 3J7AS 4YHHM 4D82A 5EP4A 1TR8A 4LF4M 3GLFE 4DR6M 1TH3A 2Y0QA 4DBGB 2L4EA 4LZZA 4MGKE 1D0LA 2VF7A 3KSXA 2ZAMA 4JYAM 3SYKA 3IG8A 3GLIB 2LHGA 3A45A 3VKGA 4IJEA 1OAIA 3QWLA 4LGYA 1OFIA 3TL4X 3JR4A 4QNMA 4BLCA 3SAVA 4QOZC 1NVMA 1PJSA 2ERCA 2EKKA 3C3DA 1IY1A 1QUSA 4PT5A 1R5LA
chains in the Genus database with same CATH topology
3SHFA 1QAQA 4DV4M 4AI6A 2D7EA 2DZNB 4R3DA 3R9XB 1N33M 3HKPA 4M9ZA 3SASA 2UUCM 2Z4RA 3U6MA 3KDSE 3GPUA 4DR5M 2YFQA 4MH0E 3GO8A 1IBKM 4DR1M 3FYDA 1R2YA 2DZOB 3PXGA 2UUBM 1TGUA 3FD9A 2OPFA 2CV0A 1OFHA 1J09A 4B3MM 1G3IA 1JR3A 2I7PA 4X65M 1SXJC 4L15A 2E5LM 2C9CA 4DV2M 4LZJA 3KOWE 4KLNA 3LVWA 3PVSA 4L78A 4IIWA 3SAUA 2BJWA 4TUWA 5A2QS 2FE8A 1GL6A 3RGSA 4NL4H 2R65A 4G4RA 4DV6M 1TDZA 3AV0A 1GKIA 4REZA 3SARA 3U6EA 2I7NA 3JR5A 1NHGC 2G5GX 4KO8A 4OX9M 1IXSB 3GLFA 4NSRA 4JI3M 4FWDA 3T1YM 3SFZA 5GKNA 4XGIA 5ITRA 3GPXA 1Z5BA 4IBEA 5KQ8A 3FTFA 3KOXE 4NRWA 4RF0A 4LJ8A 3SMPA 3GRUA 4S12A 4JV5M 4MB7A 4LCBA 1G41A 4ZPXA 5LMUM 4D81A 3W0LB 2YR0A 1N36M 1XXHA 3U5ZA 2DVWB 4LRTA 5BPVA 1SXJA 4EIWA 1L2BA 3TPZA 2LWXA 2K47A 4OVZB 1NY5A 1J7KA 2KZUA 3TWMA 1N34M 5E26A 3I4YA 1DGBA 3J2PB 2XSZD 4X62M 3W0FA 3KSJA 5EXSA 4CGYB 3GRRA 1NY6A 4LFAM 5KPTA 3GLGA 4LJ6A 2G8LA 5IREB 3A98B 2KRUA 1NHWC 5IZ7D 2J7NA 3L2AA 5JI3E 3R8FA 3J80S 3L26A 4LG2A 4MGYE 2QPAA 1XNQM 3M6AA 3D8BA 4A3VB 2L7IA 3J7BA 3KVWA 4GH9A 3Q8XA 1H6UA 1IXZA 1QVRA 3GQ3A 3A46A 3CTWB 1NNJA 1L2CA 2KZSA 3WHKA 1KFVA 2UXBM 1HT1E 3QAUA 4M0DA 3VLFB 1SXJD 3HU1A 4BBAA 1Z59A 3AFHA 1IN5A 4LFBM 4GRIA 2LH0A 5ITXE 5EQTA 2VQFM 3RE8A 2JA2A 4W5WA 4DR3M 4X64M 2UU9M 4JI6M 1MX0A 4B3TM 4L16A 4Z8XA 3T15A 4HL4A 5KPRA 2DHRA 2L09A 1JQJC 5EP2A 1YSYA 4GITA 2FOIC 5EXPA 5KPZA 3U61B 5ITYA 3UZUA 2RKOA 2M5ZA 3OTOM 1K3XA 3A42A 4GMQA 1MU5A 2FFJA 2KRKA 3K1JA 4G4NA 3FUXA 3HGIA 1ORYB 2HKJA 1HNXM 2J7OA 1HNZM 4D80A 2XGNA 4I8OA 4QHTA 4JI8M 4R7GA 5LMNM 4RNAA 3AOGA 1W5TA 3FTDA 1IY0A 3LQQA 3GP1A 4NXNM 1DGHA 3H4MA 4GHAA 2Y20A 1E9RA 2OQ4A 1QQWA 1NJGA 2XLJA 2D7GA 4JN6A 3MJ5A 3ILKA 2L7HA 3TQSA 2YNMD 3FUTA 4IBBA 1LV7A 2Z7JA 5KQDA 2R45A 5E6JA 1X37A 2C98A 3FYCA 2BNKA 3KS4A 5FTMA 3LVVA 1IN4A 5ITTA 3TWLA 5EP3A 3L28A 3MK6A 3U6DA 1PJIA 5DNYA 4LJAA 1Z5CA 1E94E 1QZMA 3FUUA 3UK6A 2VQEM 4LJ5A 5IWAM 3CF0A 1I4WA 1C1KA 1Z5AA 4KHPM 5ITXA 3HU3A 4LFCM 1S3SA 1R2ZA 3SC3A 2CFOA 4AW4A 3UMMA 4X66M 2X49A 3NBIA 3GQ5A 4AKGA 4GC9A 2KXEA 3DFZA 4AQYM 1IXRC 4JI2M 3KOZE 1J5EM 3SYLA 1DO2A 1JR3D 3GLFB 4LY6A 1NJFA 2DXIA 3VDUA 3T38A 4GC5A 3RFWA 3K2LA 2KW0A 2VIIA 3KXEC 1G8PA 2RGHA 2F5SA 1NSFA 3JAMS 2F5PA 5H37D 2QP9X 2V1CA 3FTEA 4IJFA 1Q39A 3M0EA 4LF7M 4AG5A 3AJIB 4B7FA 2EA0A 4I4LA 4GKJM 3EIEA 3U5ZB 3I4VA 3WHLA 2XZFA 5FTKA 2UXDM 4FWHA 1DGGA 1SXJB 3FUWA 2QBYA 2ZANA 5C1BA 4II7A 2Z3XA 3B9PA 3DA1A 4AG6A 4I5SA 3DOAA 4QNRA 4IBGA 4LF6M 2V6ZM 5DYIA 2R62A 3K92A 4IBDA 2ZM6M 1T3TA 2DWNA 3AOEA 1I94M 3VKHA 3PNVA 3GLGB 3CF6E 4LF5M 1IY2A 1R6BX 3K8ZA 1D2NA 2XH9A 4NRVA 2R4JA 4RF1A 4XBOA 1K82A 1PJJA 3GRYA 1L1TA 2ZBKB 4LF8M 4MGIE 1FNNA 2KA6B 3KP1E 1N75A 5FSWA 3SAWA 4AKHA 1TH4A 2CHQA 2XF3A 1TDHA 4K0KM 3U60A 1L8QA 4IBIA 4AZFA 1UM8A 1KSFX 1XMQM 4BB9A 3GLHB 4B08A 2XFTA 4FW9A 4FCVA 1W5SA 1DO0A 3LQRA 2YQZA 2BJVA 3TWKA 4PCZA 5ITUA 5FTJA 3KP0E 5F3WA 3C58A 1Q3BA 1YE9A 2CHGA 4JI7M 2W82A 2LXEA 1N32M 4GHLA 2KEBA 2EO2A 3LMMA 2Y21A 3PNYA 2QZ4A 4MGHA 3PFIA 4PD2A 3U6PA 2C99A 2R4EA 4FWGA 4P16A 4DV5M 4PDIA 1G59A 2DWZB 3U6QA 5FLXS 5EP1A 3GLIA 2D7HA 1DGFA 1XNRM 1XMOM 4QOSA 3HHZA 3THGA 3U61A 4FVMA 3U6SA 4FD2A 1R7RA 5EXXA 1QANA 3HHWA 1E32A 2Q2EB 1HT2E 2QENA 1HR0M 1GLNA 4Z6YA 2CHVA 4FCWA 4WURA 5EJCA 1DGHB 3UJNA 4DUYM 3AKZA 2O5RA 3DZDA 3U6OA 3SATA 3VDPA 4JI5M 2R46A 1IM2A 3HU2A 3SBJA 4M9XA 3KOYE 3SMSA 4IBCA 1KYIA 4WW0A 4M0WA 3J81S 1FJGM 1GL7A 3HJQA 4DUZM 4JI4M 4DR2M 3AL0C 5IT9S 3EIHA 1SXJE 4I81A 2ZAOA 2V1UA 4MM3B 1EE8A 2CEAA 2F4VM 4B3RM 2QCUA 2LNHC 3GPYA 2CV2A 4LRSA 3SHGB 4DV1M 2R18A 4L8RC 2HHHM 2P5TA 4B3SM 2RGOA 2C5RA 3KW6A 4B7GA 1XC8A 3ZC7B 3AOEC 1L2DA 3L25A 4M9SA 4FCTA 8CATA 1TH2A 3VFDA 3ZH9B 3KFUG 2L6OA 3J27B 4LJ9A 4LJ4A 7CATA 5KO3A 2Y0TA 4LF9M 4NOOB 3GPPA 4CHTB 2X8AA 1YUBA 4YY3M 3I51A 2DWMA 1IN7A 1ZQ9A 4PDGA 3HJ8A 4DR4M 3T1HM 1E9SA 2FNAA 1HQCA 5EXTA 1IBLM 3FTCA 2F5OA 4G4OA 4IBKA 1HQYE 4CISA 5FTNA 1NNUC 2CUZA 2HCBA 2XFSA 3E4RA 3HJSA 3RGPA 1L1ZA 2XSZA 3HHYA 1N78A 4HLQA 4LJ7A 4GKKM 2NQ8C 4LGMA 1XXHB 2XZUA 1IN6A 4G4QA 5DYGA 2UXCM 2DWLA 1GVNA 4MGZE 2CE7A 3VK7A 5ITQA 3HWSA 1ZAEA 4JI0M 3FKEA 3BOSA 3L27A 2QBYB 1IBMM 4L4UA 4DV7M 1G4AE 1Z6TA 4OVZA 3MHVC 4DV0M 5BR8M 1XWIA 5C18A 2M60A 3CF2A 2X4AA 4NSOB 1XHBA 2AHMA 3TE6A 2C9OA 5FTLA 2UUAM 4IBJA 3M7GA 2Z4SA 3U6LA 1QYRA 1IN8A 4B7HA 2HL7A 4GIPA 2CV1A 3D8LA 2F5QA 2A5YB 4DR7M 3GRVA 1OJLA 4DV3M 3KS8A 4AKIA 3U60B 3ZCBB 4OU7A 3UGJA 4OW0A 1Q3CA 1QAMA 2XEPA 4JI1M 1IQPA 1WXQA 2H1RA 3FUVA 4KODA 4G6ZA 4QHSA 1PM5A 1N77A 1VDDA 2C96A 3GLHA 3HHXA 2EUCA 4JXJA 4NXMM 1QAOA 3E9SA 3L29A 5JI2E 3VK8A 4ITQA 2F5NA 4IBFA 1K3WA 3NWLA 1HNWM 3GQ4A 3IG5A 3U6CA 3J7AS 4YHHM 4D82A 5EP4A 4LF4M 4DR6M 1TH3A 2Y0QA 4LZZA 4MGKE 3KSXA 2ZAMA 4JYAM 3SYKA 3IG8A 3GLIB 3A45A 3VKGA 4IJEA 3QWLA 4LGYA 1OFIA 3TL4X 3JR4A 4QNMA 4BLCA 3SAVA 4QOZC 1NVMA 2ERCA 1IY1A 4PT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOZ C;  4TUW A;  4L8R C; 
#chains in the Genus database with same CATH topology
 3SHF A;  1QAQ A;  4DV4 M;  4AI6 A;  1VEK A;  2D7E A;  3V76 A;  2DZN B;  1VEJ A;  2QHO B;  4R3D A;  3R9X B;  1N33 M;  3HKP A;  4M9Z A;  3SAS A;  1XXH E;  2EJS A;  2UUC M;  2O01 F;  2Z4R A;  3U6M A;  3KDS E;  3GPU A;  4DR5 M;  2YFQ A;  4MH0 E;  3GO8 A;  1IBK M;  4DR1 M;  3FYD A;  1R2Y A;  2DZO B;  1A5T A;  3PXG A;  2UUB M;  1TGU A;  3FD9 A;  2OPF A;  2VF8 A;  2CV0 A;  1OFH A;  1J09 A;  2VDB B;  4B3M M;  1G3I A;  1JR3 A;  2B3T A;  2I7P A;  2JWS A;  4X65 M;  3GLG E;  1SXJ C;  4L15 A;  2FS1 A;  2R44 A;  2E5L M;  2C9C A;  3IHP A;  4DV2 M;  4LZJ A;  3KOW E;  4KLN A;  3LVW A;  3PVS A;  4L78 A;  2HAK A;  4IIW A;  3SAU A;  1OQY A;  2BJW A;  2K6B A;  4TUW A;  5A2Q S;  2FE8 A;  1GL6 A;  3QYE A;  3RGS A;  4NL4 H;  3IEC A;  2R65 A;  2JXN A;  2Z8Y M;  1ZMU A;  4DV6 M;  4G4R A;  1TDZ A;  3AV0 A;  1WGN A;  1GKI A;  4REZ A;  3SAR A;  3U6E A;  2I7N A;  3JR5 A;  1NHG C;  1C7Y A;  2G5G X;  2DZL A;  4KO8 A;  2MR9 A;  1IXS B;  3GLF A;  4NSR A;  4JI3 M;  4OX9 M;  1TTE A;  4FWD A;  3T1Y M;  4F2L A;  3SFZ A;  1ZV1 A;  5GKN A;  4XGI A;  3I01 M;  3LCV B;  5ITR A;  3GPX A;  1Z5B A;  4IBE A;  5KQ8 A;  3FTF A;  3KOX E;  4NRW A;  4RF0 A;  4LJ8 A;  3SMP A;  2QQ8 A;  3GRU A;  4S12 A;  4JV5 M;  4MB7 A;  2ZTC A;  4LCB A;  3HX3 A;  1G41 A;  1QDT A;  2CP8 A;  3B89 A;  4ZPX A;  4NC6 A;  4D81 A;  5LMU M;  3W0L B;  2YR0 A;  1N36 M;  1XXH A;  3U5Z A;  2DVW B;  4CIZ A;  4LRT A;  5BPV A;  1SXJ A;  4EIW A;  1L2B A;  3TPZ A;  2LWX A;  2K47 A;  4OVZ B;  1NY5 A;  1J7K A;  2KZU A;  3TWM A;  1ZMW A;  1N34 M;  1PJT A;  5E26 A;  2KNA A;  3I4Y A;  4Q7J A;  2K9D A;  1DGB A;  2JY7 A;  3J2P B;  2XSZ D;  4X62 M;  2KNZ A;  3W68 A;  3W0F A;  3KSJ A;  5EXS A;  4CGY B;  2DKL A;  3GRR A;  1NY6 A;  2GNO A;  4LFA M;  5KPT A;  3GLG A;  4LJ6 A;  2G8L A;  5IRE B;  3A98 B;  2KRU A;  1NHW C;  5IZ7 D;  2J7N A;  2RRU A;  2OOA A;  3L2A A;  5JI3 E;  3R8F A;  3J80 S;  3L26 A;  4LG2 A;  4MGY E;  3HY5 A;  2QPA A;  1XNQ M;  3M6A A;  3D8B A;  4A3V B;  2L7I A;  3J7B A;  3KVW A;  2KHH A;  3Q8X A;  1H6U A;  1IXZ A;  1QVR A;  2LVA A;  4GH9 A;  3CTW B;  3GQ3 A;  3A46 A;  1NNJ A;  2KZS A;  3WHK A;  1KFV A;  1L2C A;  2UXB M;  2KNV A;  1HT1 E;  3QAU A;  3MMP A;  2FH0 A;  1OAO C;  4M0D A;  3VLF B;  1XB2 B;  1SXJ D;  3HU1 A;  4BBA A;  1Z59 A;  3AFH A;  1V33 A;  1IN5 A;  1VDL A;  4LFB M;  4GRI A;  2LH0 A;  5ITX E;  5EQT A;  1TF0 B;  2VQF M;  3RE8 A;  2JA2 A;  4W5W A;  4DR3 M;  4X64 M;  2UU9 M;  4JI6 M;  1MX0 A;  4B3T M;  4L16 A;  4Z8X A;  3C3E A;  3T15 A;  4HL4 A;  5KPR A;  2O25 A;  2DHR A;  1OTR A;  2H5X A;  2L09 A;  1JQJ C;  2ZTD A;  4ANR A;  2JY5 A;  5EP2 A;  1YSY A;  4GIT A;  2FOI C;  5EXP A;  5KPZ A;  1SG9 A;  4KT0 F;  3U61 B;  5ITY A;  3UZU A;  2RKO A;  2M5Z A;  3NBX X;  3OTO M;  1NV8 A;  1K3X A;  4CJ6 A;  2JNH A;  3A42 A;  3CGW A;  4GMQ A;  1D0K A;  1MU5 A;  2FFJ A;  2KRK A;  1YLA A;  3K1J A;  1IFY A;  4G4N A;  3FUX A;  3HGI A;  1ORY B;  2HKJ A;  1HNX M;  2J7O A;  1HNZ M;  1NO1 A;  4D80 A;  2XGN A;  4I8O A;  4QHT A;  4JI8 M;  4R7G A;  5LMN M;  4RNA A;  3AOG A;  1W5T A;  2G3Q A;  1IY0 A;  3FTD A;  3LQQ A;  3GP1 A;  4NXN M;  1DV0 A;  1DGH A;  3H4M A;  4GHA A;  2Y20 A;  1E9R A;  2OQ4 A;  1QQW A;  1NJG A;  2XLJ A;  2D7G A;  4JN6 A;  1V34 A;  3MJ5 A;  3ILK A;  3W67 A;  2L7H A;  3TQS A;  2WZJ A;  2YNM D;  1Y8G A;  3FUT A;  4IBB A;  1LV7 A;  4GEW A;  2Z7J A;  5KQD A;  1AIP C;  3LCU A;  2R45 A;  5E6J A;  1NV9 A;  1X37 A;  2C98 A;  3FYC A;  2BNK A;  2CRU A;  3KS4 A;  5FTM A;  1GJS A;  3LVV A;  1IN4 A;  2J5Y A;  2JY6 B;  5ITT A;  3TWL A;  2LHC A;  3L28 A;  5EP3 A;  1D0M A;  3MK6 A;  3U6D A;  1PJI A;  5DNY A;  4LJA A;  1Z5C A;  2JZ1 A;  2GQF A;  3I04 M;  1E94 E;  1QZM A;  3FUU A;  3UK6 A;  2VQE M;  1QUT A;  4LJ5 A;  5IWA M;  3CF0 A;  1I4W A;  1C1K A;  1Z5A A;  4KHP M;  2DNA A;  5ITX A;  3HU3 A;  4LFC M;  1S3S A;  1R2Z A;  3SC3 A;  2CFO A;  4AW4 A;  3UMM A;  4X66 M;  2X49 A;  3NBI A;  2MRO B;  3GQ5 A;  4AKG A;  1OIP A;  4GC9 A;  2KXE A;  3DFZ A;  4AQY M;  1IXR C;  4HEO A;  4JI2 M;  3KOZ E;  2DAK A;  3SYL A;  1J5E M;  1DO2 A;  1JR3 D;  3GLF B;  4LY6 A;  1NJF A;  2DXI A;  3VDU A;  3T38 A;  4GC5 A;  3RFW A;  2JUJ A;  2L2D A;  2DI0 A;  2DHY A;  2KW0 A;  3K2L A;  2VII A;  3KXE C;  1G8P A;  2L4F A;  2RGH A;  1NSF A;  2F5S A;  3JAM S;  2F5P A;  5H37 D;  2QP9 X;  2V1C A;  3FTE A;  4IJF A;  1Q39 A;  3M0E A;  4LF7 M;  4AG5 A;  3AJI B;  4B7F A;  3Q8G A;  2EA0 A;  2MH8 A;  3GLI E;  4I4L A;  4GKJ M;  1QDR A;  3EIE A;  3I4V A;  3WHL A;  3U5Z B;  1ZMV A;  3K9O A;  5FTK A;  2XZF A;  2UXD M;  4FWH A;  1DGG A;  1SXJ B;  3C9P A;  3FUW A;  1EIJ A;  2QBY A;  2ZAN A;  1JB0 F;  5C1B A;  1T6O A;  4II7 A;  2Z3X A;  3B9P A;  3B7N A;  2QSF X;  3DA1 A;  4I5S A;  3DOA A;  4QNR A;  4IBG A;  4AG6 A;  1GO5 A;  4LF6 M;  2V6Z M;  5DYI A;  2R62 A;  3K92 A;  4IBD A;  2ZM6 M;  1T3T A;  2DWN A;  3AOE A;  1I94 M;  3VKH A;  3PNV A;  3GLG B;  3CF6 E;  4LF5 M;  1GAB A;  1IY2 A;  1QZE A;  1R6B X;  3K8Z A;  1D2N A;  2XH9 A;  4NRV A;  1F4I A;  2R4J A;  4RF1 A;  1EFU B;  4XBO A;  1PJJ A;  1K82 A;  3GRY A;  1L1T A;  2ZBK B;  4LF8 M;  4MGI E;  1FNN A;  2KA6 B;  3KP1 E;  1N75 A;  5FSW A;  3SAW A;  1OIZ A;  4AKH A;  1P3Q Q;  1TH4 A;  2CHQ A;  3BXW A;  2XF3 A;  1TDH A;  4K0K M;  3U60 A;  1L8Q A;  2DAE A;  4IBI A;  4AZF A;  1UM8 A;  1KSF X;  1XMQ M;  4BB9 A;  3GLH B;  4B08 A;  2XFT A;  4FW9 A;  1BVS A;  4FCV A;  1VG5 A;  1W5S A;  1DO0 A;  3LQR A;  2YQZ A;  3B7Z A;  2BJV A;  2BWB A;  3TWK A;  4PCZ A;  3K9P A;  5ITU A;  5FTJ A;  3KP0 E;  1WJ7 A;  5F3W A;  3C58 A;  1Q3B A;  1YE9 A;  2CHG A;  4JI7 M;  2W82 A;  2LXE A;  1N32 M;  4GHL A;  2KEB A;  2EO2 A;  3LMM A;  2Y21 A;  3PNY A;  1Q02 A;  2QZ4 A;  4MGH A;  3PFI A;  4PD2 A;  3U6P A;  2C99 A;  2R4E A;  4FWG A;  4P16 A;  4DV5 M;  4PDI A;  1G59 A;  1MN3 A;  2DWZ B;  3U6Q A;  5FLX S;  5EP1 A;  3GLI A;  2D7H A;  1DGF A;  1XNR M;  1XMO M;  2LVN C;  4QOS A;  3HHZ A;  5L8R F;  3THG A;  3U61 A;  4FVM A;  3U6S A;  4FD2 A;  1R7R A;  1WHC A;  5EXX A;  3T6P A;  1QAN A;  3HHW A;  1E32 A;  2Q2E B;  1HT2 E;  2QEN A;  2N35 A;  1HR0 M;  1GLN A;  4Z6Y A;  4R71 A;  2APL A;  2CHV A;  4FCW A;  4WUR A;  1DGH B;  5EJC A;  3UJN A;  1G71 A;  4DUY M;  3AKZ A;  2O5R A;  3DZD A;  4F1I A;  3U6O A;  3VDP A;  3SAT A;  4JI5 M;  2R46 A;  1IM2 A;  3HU2 A;  3SBJ A;  4M9X A;  3KOY E;  3SMS A;  4IBC A;  1KYI A;  3LW5 F;  1R4G A;  4WW0 A;  4M0W A;  3J81 S;  1FJG M;  1GL7 A;  3HJQ A;  4DUZ M;  4JI4 M;  2LBC A;  4DR2 M;  3AL0 C;  5IT9 S;  3EIH A;  1SXJ E;  4I81 A;  2ZAO A;  2V1U A;  3E21 A;  4MM3 B;  1EE8 A;  1LTM A;  2CEA A;  2F4V M;  4B3R M;  2QCU A;  1V92 A;  2LNH C;  3GPY A;  1WIV A;  2CV2 A;  4LRS A;  3SHG B;  2EKF A;  3B7Q A;  4DV1 M;  2DAM A;  2R18 A;  4L8R C;  2HHH M;  2R6F A;  2P5T A;  4B3S M;  2RGO A;  2C5R A;  3KW6 A;  4B7G A;  1XC8 A;  4RKU F;  3ZC7 B;  3AOE C;  1L2D A;  3L25 A;  1WGL A;  1T43 A;  4FCT A;  1TH2 A;  4M9S A;  2JZ0 A;  3VFD A;  3ZH9 B;  8CAT A;  3KFU G;  2L6O A;  3J27 B;  4LJ9 A;  3FE3 A;  3FRH A;  2LVQ D;  4LJ4 A;  7CAT A;  5KO3 A;  2Y0T A;  4LF9 M;  4NOO B;  2LTU A;  3GPP A;  4CHT B;  2X8A A;  1YUB A;  2OOB A;  4YY3 M;  3I51 A;  2DWM A;  1IN7 A;  1ZQ9 A;  4PDG A;  3HJ8 A;  4DR4 M;  3T1H M;  1E9S A;  2FNA A;  3E46 A;  1HQC A;  3GLH E;  5EXT A;  1IXS A;  1IBL M;  2LVO C;  3FTC A;  2F5O A;  4G4O A;  4IBK A;  1HQY E;  1UFZ A;  4CIS A;  5FTN A;  1NNU C;  2CUZ A;  2HCB A;  2XFS A;  3E4R A;  2OO9 A;  3HJS A;  3RGP A;  1L1Z A;  2XSZ A;  5DFL A;  3HHY A;  1N78 A;  4HLQ A;  4LJ7 A;  4GKK M;  2NQ8 C;  2CWB A;  4LGM A;  1XXH B;  2XZU A;  1IN6 A;  4L6V 6;  4G4Q A;  5DYG A;  2UXC M;  2DWL A;  1GVN A;  4MGZ E;  2CE7 A;  3VK7 A;  1PJQ A;  4P17 A;  3HZJ A;  2JP7 A;  5ITQ A;  3HWS A;  1ZAE A;  2HWJ A;  4JI0 M;  3FKE A;  3BOS A;  3ZQJ A;  3L27 A;  2QBY B;  1IBM M;  4L4U A;  4DV7 M;  1G4A E;  2R0I A;  1Z6T A;  4OVZ A;  3MHV C;  3BBZ A;  4DV0 M;  4Y28 F;  5BR8 M;  1XWI A;  4WP2 A;  2M60 A;  3CF2 A;  1GJT A;  5C18 A;  2DAG A;  2X4A A;  4NSO B;  1XHB A;  2AHM A;  2DEN A;  3TE6 A;  2C9O A;  1PRB A;  5FTL A;  2K0B X;  1AUA A;  2UUA M;  4IBJ A;  3B74 A;  3M7G A;  1VEG A;  2Z4S A;  1RU3 A;  2WSC F;  2WSE F;  2MJ5 B;  2QNJ A;  3FRI A;  3U6L A;  1QYR A;  1PGY A;  2MGW A;  1IN8 A;  4B7H A;  2HL7 A;  1WR1 B;  4GIP A;  2CV1 A;  3D8L A;  1OKS A;  2BWE A;  3H4J A;  2F5Q A;  2A5Y B;  4G3O A;  4DR7 M;  3GRV A;  1OJL A;  1JR3 E;  1HJP A;  3F92 A;  4DV3 M;  1MJG M;  3KS8 A;  2JY8 A;  3U60 B;  3ZCB B;  4OU7 A;  4AKI A;  3UGJ A;  4XK8 F;  4OW0 A;  1Q3C A;  1QAM A;  2DAI A;  2XEP A;  4JI1 M;  1IQP A;  1WXQ A;  1VQ1 A;  2H1R A;  3FUV A;  4KOD A;  2LVP C;  4G6Z A;  4QHS A;  1PM5 A;  1N77 A;  1VDD A;  2C96 A;  3GLH A;  3HHX A;  2EUC A;  4JXJ A;  4NXM M;  1QAO A;  3E9S A;  2KDL A;  3L29 A;  3QYB A;  5JI2 E;  3VK8 A;  4IBF A;  2F5N A;  1CUK A;  4ITQ A;  1K3W A;  2WSF F;  3NWL A;  1HNW M;  3GQ4 A;  3IG5 A;  4UN2 B;  3U6C A;  3J7A S;  4YHH M;  4D82 A;  5EP4 A;  1TR8 A;  4LF4 M;  3GLF E;  4DR6 M;  1TH3 A;  2Y0Q A;  4DBG B;  2L4E A;  4LZZ A;  4MGK E;  1D0L A;  2VF7 A;  3KSX A;  2ZAM A;  4JYA M;  3SYK A;  3IG8 A;  3GLI B;  2LHG A;  3A45 A;  3VKG A;  4IJE A;  1OAI A;  3QWL A;  4LGY A;  1OFI A;  3TL4 X;  3JR4 A;  4QNM A;  4BLC A;  3SAV A;  4QOZ C;  1NVM A;  1PJS A;  2ERC A;  2EKK A;  3C3D A;  1IY1 A;  1QUS A;  4PT5 A;  1R5L A; 
#chains in the Genus database with same CATH homology
 3SHF A;  1QAQ A;  4DV4 M;  4AI6 A;  2D7E A;  2DZN B;  4R3D A;  3R9X B;  1N33 M;  3HKP A;  4M9Z A;  3SAS A;  2UUC M;  2Z4R A;  3U6M A;  3KDS E;  3GPU A;  4DR5 M;  2YFQ A;  4MH0 E;  3GO8 A;  1IBK M;  4DR1 M;  3FYD A;  1R2Y A;  2DZO B;  3PXG A;  2UUB M;  1TGU A;  3FD9 A;  2OPF A;  2CV0 A;  1OFH A;  1J09 A;  4B3M M;  1G3I A;  1JR3 A;  2I7P A;  4X65 M;  1SXJ C;  4L15 A;  2E5L M;  2C9C A;  4DV2 M;  4LZJ A;  3KOW E;  4KLN A;  3LVW A;  3PVS A;  4L78 A;  4IIW A;  3SAU A;  2BJW A;  4TUW A;  5A2Q S;  2FE8 A;  1GL6 A;  3RGS A;  4NL4 H;  2R65 A;  4G4R A;  4DV6 M;  1TDZ A;  3AV0 A;  1GKI A;  4REZ A;  3SAR A;  3U6E A;  2I7N A;  3JR5 A;  1NHG C;  2G5G X;  4KO8 A;  4OX9 M;  1IXS B;  3GLF A;  4NSR A;  4JI3 M;  4FWD A;  3T1Y M;  3SFZ A;  5GKN A;  4XGI A;  5ITR A;  3GPX A;  1Z5B A;  4IBE A;  5KQ8 A;  3FTF A;  3KOX E;  4NRW A;  4RF0 A;  4LJ8 A;  3SMP A;  3GRU A;  4S12 A;  4JV5 M;  4MB7 A;  4LCB A;  1G41 A;  4ZPX A;  5LMU M;  4D81 A;  3W0L B;  2YR0 A;  1N36 M;  1XXH A;  3U5Z A;  2DVW B;  4LRT A;  5BPV A;  1SXJ A;  4EIW A;  1L2B A;  3TPZ A;  2LWX A;  2K47 A;  4OVZ B;  1NY5 A;  1J7K A;  2KZU A;  3TWM A;  1N34 M;  5E26 A;  3I4Y A;  1DGB A;  3J2P B;  2XSZ D;  4X62 M;  3W0F A;  3KSJ A;  5EXS A;  4CGY B;  3GRR A;  1NY6 A;  4LFA M;  5KPT A;  3GLG A;  4LJ6 A;  2G8L A;  5IRE B;  3A98 B;  2KRU A;  1NHW C;  5IZ7 D;  2J7N A;  3L2A A;  5JI3 E;  3R8F A;  3J80 S;  3L26 A;  4LG2 A;  4MGY E;  2QPA A;  1XNQ M;  3M6A A;  3D8B A;  4A3V B;  2L7I A;  3J7B A;  3KVW A;  4GH9 A;  3Q8X A;  1H6U A;  1IXZ A;  1QVR A;  3GQ3 A;  3A46 A;  3CTW B;  1NNJ A;  1L2C A;  2KZS A;  3WHK A;  1KFV A;  2UXB M;  1HT1 E;  3QAU A;  4M0D A;  3VLF B;  1SXJ D;  3HU1 A;  4BBA A;  1Z59 A;  3AFH A;  1IN5 A;  4LFB M;  4GRI A;  2LH0 A;  5ITX E;  5EQT A;  2VQF M;  3RE8 A;  2JA2 A;  4W5W A;  4DR3 M;  4X64 M;  2UU9 M;  4JI6 M;  1MX0 A;  4B3T M;  4L16 A;  4Z8X A;  3T15 A;  4HL4 A;  5KPR A;  2DHR A;  2L09 A;  1JQJ C;  5EP2 A;  1YSY A;  4GIT A;  2FOI C;  5EXP A;  5KPZ A;  3U61 B;  5ITY A;  3UZU A;  2RKO A;  2M5Z A;  3OTO M;  1K3X A;  3A42 A;  4GMQ A;  1MU5 A;  2FFJ A;  2KRK A;  3K1J A;  4G4N A;  3FUX A;  3HGI A;  1ORY B;  2HKJ A;  1HNX M;  2J7O A;  1HNZ M;  4D80 A;  2XGN A;  4I8O A;  4QHT A;  4JI8 M;  4R7G A;  5LMN M;  4RNA A;  3AOG A;  1W5T A;  3FTD A;  1IY0 A;  3LQQ A;  3GP1 A;  4NXN M;  1DGH A;  3H4M A;  4GHA A;  2Y20 A;  1E9R A;  2OQ4 A;  1QQW A;  1NJG A;  2XLJ A;  2D7G A;  4JN6 A;  3MJ5 A;  3ILK A;  2L7H A;  3TQS A;  2YNM D;  3FUT A;  4IBB A;  1LV7 A;  2Z7J A;  5KQD A;  2R45 A;  5E6J A;  1X37 A;  2C98 A;  3FYC A;  2BNK A;  3KS4 A;  5FTM A;  3LVV A;  1IN4 A;  5ITT A;  3TWL A;  5EP3 A;  3L28 A;  3MK6 A;  3U6D A;  1PJI A;  5DNY A;  4LJA A;  1Z5C A;  1E94 E;  1QZM A;  3FUU A;  3UK6 A;  2VQE M;  4LJ5 A;  5IWA M;  3CF0 A;  1I4W A;  1C1K A;  1Z5A A;  4KHP M;  5ITX A;  3HU3 A;  4LFC M;  1S3S A;  1R2Z A;  3SC3 A;  2CFO A;  4AW4 A;  3UMM A;  4X66 M;  2X49 A;  3NBI A;  3GQ5 A;  4AKG A;  4GC9 A;  2KXE A;  3DFZ A;  4AQY M;  1IXR C;  4JI2 M;  3KOZ E;  1J5E M;  3SYL A;  1DO2 A;  1JR3 D;  3GLF B;  4LY6 A;  1NJF A;  2DXI A;  3VDU A;  3T38 A;  4GC5 A;  3RFW A;  3K2L A;  2KW0 A;  2VII A;  3KXE C;  1G8P A;  2RGH A;  2F5S A;  1NSF A;  3JAM S;  2F5P A;  5H37 D;  2QP9 X;  2V1C A;  3FTE A;  4IJF A;  1Q39 A;  3M0E A;  4LF7 M;  4AG5 A;  3AJI B;  4B7F A;  2EA0 A;  4I4L A;  4GKJ M;  3EIE A;  3U5Z B;  3I4V A;  3WHL A;  2XZF A;  5FTK A;  2UXD M;  4FWH A;  1DGG A;  1SXJ B;  3FUW A;  2QBY A;  2ZAN A;  5C1B A;  4II7 A;  2Z3X A;  3B9P A;  3DA1 A;  4AG6 A;  4I5S A;  3DOA A;  4QNR A;  4IBG A;  4LF6 M;  2V6Z M;  5DYI A;  2R62 A;  3K92 A;  4IBD A;  2ZM6 M;  1T3T A;  2DWN A;  3AOE A;  1I94 M;  3VKH A;  3PNV A;  3GLG B;  3CF6 E;  4LF5 M;  1IY2 A;  1R6B X;  3K8Z A;  1D2N A;  2XH9 A;  4NRV A;  2R4J A;  4RF1 A;  4XBO A;  1K82 A;  1PJJ A;  3GRY A;  1L1T A;  2ZBK B;  4LF8 M;  4MGI E;  1FNN A;  2KA6 B;  3KP1 E;  1N75 A;  5FSW A;  3SAW A;  4AKH A;  1TH4 A;  2CHQ A;  2XF3 A;  1TDH A;  4K0K M;  3U60 A;  1L8Q A;  4IBI A;  4AZF A;  1UM8 A;  1KSF X;  1XMQ M;  4BB9 A;  3GLH B;  4B08 A;  2XFT A;  4FW9 A;  4FCV A;  1W5S A;  1DO0 A;  3LQR A;  2YQZ A;  2BJV A;  3TWK A;  4PCZ A;  5ITU A;  5FTJ A;  3KP0 E;  5F3W A;  3C58 A;  1Q3B A;  1YE9 A;  2CHG A;  4JI7 M;  2W82 A;  2LXE A;  1N32 M;  4GHL A;  2KEB A;  2EO2 A;  3LMM A;  2Y21 A;  3PNY A;  2QZ4 A;  4MGH A;  3PFI A;  4PD2 A;  3U6P A;  2C99 A;  2R4E A;  4FWG A;  4P16 A;  4DV5 M;  4PDI A;  1G59 A;  2DWZ B;  3U6Q A;  5FLX S;  5EP1 A;  3GLI A;  2D7H A;  1DGF A;  1XNR M;  1XMO M;  4QOS A;  3HHZ A;  3THG A;  3U61 A;  4FVM A;  3U6S A;  4FD2 A;  1R7R A;  5EXX A;  1QAN A;  3HHW A;  1E32 A;  2Q2E B;  1HT2 E;  2QEN A;  1HR0 M;  1GLN A;  4Z6Y A;  2CHV A;  4FCW A;  4WUR A;  5EJC A;  1DGH B;  3UJN A;  4DUY M;  3AKZ A;  2O5R A;  3DZD A;  3U6O A;  3SAT A;  3VDP A;  4JI5 M;  2R46 A;  1IM2 A;  3HU2 A;  3SBJ A;  4M9X A;  3KOY E;  3SMS A;  4IBC A;  1KYI A;  4WW0 A;  4M0W A;  3J81 S;  1FJG M;  1GL7 A;  3HJQ A;  4DUZ M;  4JI4 M;  4DR2 M;  3AL0 C;  5IT9 S;  3EIH A;  1SXJ E;  4I81 A;  2ZAO A;  2V1U A;  4MM3 B;  1EE8 A;  2CEA A;  2F4V M;  4B3R M;  2QCU A;  2LNH C;  3GPY A;  2CV2 A;  4LRS A;  3SHG B;  4DV1 M;  2R18 A;  4L8R C;  2HHH M;  2P5T A;  4B3S M;  2RGO A;  2C5R A;  3KW6 A;  4B7G A;  1XC8 A;  3ZC7 B;  3AOE C;  1L2D A;  3L25 A;  4M9S A;  4FCT A;  8CAT A;  1TH2 A;  3VFD A;  3ZH9 B;  3KFU G;  2L6O A;  3J27 B;  4LJ9 A;  4LJ4 A;  7CAT A;  5KO3 A;  2Y0T A;  4LF9 M;  4NOO B;  3GPP A;  4CHT B;  2X8A A;  1YUB A;  4YY3 M;  3I51 A;  2DWM A;  1IN7 A;  1ZQ9 A;  4PDG A;  3HJ8 A;  4DR4 M;  3T1H M;  1E9S A;  2FNA A;  1HQC A;  5EXT A;  1IBL M;  3FTC A;  2F5O A;  4G4O A;  4IBK A;  1HQY E;  4CIS A;  5FTN A;  1NNU C;  2CUZ A;  2HCB A;  2XFS A;  3E4R A;  3HJS A;  3RGP A;  1L1Z A;  2XSZ A;  3HHY A;  1N78 A;  4HLQ A;  4LJ7 A;  4GKK M;  2NQ8 C;  4LGM A;  1XXH B;  2XZU A;  1IN6 A;  4G4Q A;  5DYG A;  2UXC M;  2DWL A;  1GVN A;  4MGZ E;  2CE7 A;  3VK7 A;  5ITQ A;  3HWS A;  1ZAE A;  4JI0 M;  3FKE A;  3BOS A;  3L27 A;  2QBY B;  1IBM M;  4L4U A;  4DV7 M;  1G4A E;  1Z6T A;  4OVZ A;  3MHV C;  4DV0 M;  5BR8 M;  1XWI A;  5C18 A;  2M60 A;  3CF2 A;  2X4A A;  4NSO B;  1XHB A;  2AHM A;  3TE6 A;  2C9O A;  5FTL A;  2UUA M;  4IBJ A;  3M7G A;  2Z4S A;  3U6L A;  1QYR A;  1IN8 A;  4B7H A;  2HL7 A;  4GIP A;  2CV1 A;  3D8L A;  2F5Q A;  2A5Y B;  4DR7 M;  3GRV A;  1OJL A;  4DV3 M;  3KS8 A;  4AKI A;  3U60 B;  3ZCB B;  4OU7 A;  3UGJ A;  4OW0 A;  1Q3C A;  1QAM A;  2XEP A;  4JI1 M;  1IQP A;  1WXQ A;  2H1R A;  3FUV A;  4KOD A;  4G6Z A;  4QHS A;  1PM5 A;  1N77 A;  1VDD A;  2C96 A;  3GLH A;  3HHX A;  2EUC A;  4JXJ A;  4NXM M;  1QAO A;  3E9S A;  3L29 A;  5JI2 E;  3VK8 A;  4ITQ A;  2F5N A;  4IBF A;  1K3W A;  3NWL A;  1HNW M;  3GQ4 A;  3IG5 A;  3U6C A;  3J7A S;  4YHH M;  4D82 A;  5EP4 A;  4LF4 M;  4DR6 M;  1TH3 A;  2Y0Q A;  4LZZ A;  4MGK E;  3KSX A;  2ZAM A;  4JYA M;  3SYK A;  3IG8 A;  3GLI B;  3A45 A;  3VKG A;  4IJE A;  3QWL A;  4LGY A;  1OFI A;  3TL4 X;  3JR4 A;  4QNM A;  4BLC A;  3SAV A;  4QOZ C;  1NVM A;  2ERC A;  1IY1 A;  4PT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...