4L8RC

Structure of mrna stem-loop, human stem-loop binding protein and 3'hexo ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
67
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein/hydrolase
molecule keywords HISTONE MRNA STEM-LOOP
total genus 21
structure length 67
sequence length 73
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4l8rC00
4L8RC 4TUWA 4QOZC
chains in the Genus database with same CATH superfamily
4FWHA 1PJJA 2F5NA 4CJ6A 1IN4A 5FSWA 2LVPC 3Q8GA 1N78A 3C3DA 2UU9M 5FTKA 3TQSA 3VDPA 2R65A 4FWDA 4QHTA 3A46A 3QWLA 3HHXA 4RNAA 4DBGB 4JI7M 1AUAA 1IXZA 4BLCA 4FCTA 1YUBA 4Y28F 5FTMA 3L25A 3QYBA 2JXNA 2C9OA 2XFSA 1N36M 2DENA 2DAEA 2KNVA 4ANRA 1RU3A 1E94E 2R4JA 2CE7A 2V1UA 3GLIA 4DR2M 2VF8A 5JI2E 1MJGM 1TDHA 2CWBA 3M6AA 3MK6A 4I81A 4P17A 3GLGB 1R6BX 1G59A 4NSRA 4X62M 2DWLA 1Q3BA 1QAQA 1TTEA 2R46A 2ZBKB 4GKJM 3GQ4A 2J5YA 3KSJA 2HWJA 4A3VB 2DI0A 2MROB 2OO9A 2Z3XA 4L6V6 2JNHA 3W68A 1IBMM 5C1BA 3FTCA 3FUVA 4AG6A 4DV3M 2EO2A 4G4RA 3PNVA 1N32M 1X37A 3OTOM 4CISA 3J7AS 3SFZA 1OQYA 4DR1M 4IIWA 4L15A 1C7YA 2LH0A 3GLGE 4YY3M 2CRUA 1R5LA 2DXIA 1N77A 5ITUA 1NV8A 1IBLM 1QDTA 3RGPA 3C3EA 3I04M 3KOYE 2M5ZA 3HU1A 3K92A 2HKJA 1VG5A 3KVWA 2G5GX 3V76A 1OAIA 1R2YA 4NXMM 2LHCA 2BNKA 2L09A 3FE3A 3HY5A 2E5LM 3KOXE 1G71A 3ZCBB 1A5TA 1HQYE 1ZMVA 3DOAA 1DV0A 3DZDA 2CFOA 4XBOA 3HHZA 3K8ZA 3UGJA 4IBFA 2K0BX 4CIZA 1N34M 2WSCF 1WIVA 1IY2A 1UFZA 1GLNA 1S3SA 3H4MA 1PJSA 4DV0M 4DV2M 4GMQA 1C1KA 5A2QS 1IQPA 4M9SA 3AFHA 3IG5A 2QZ4A 4X65M 5F3WA 4X64M 4DV5M 4LF7M 5IREB 1SXJD 3AL0C 2FFJA 1GL7A 4G6ZA 3L26A 1QVRA 2UXCM 5BR8M 3GLGA 1PM5A 5FLXS 3GRRA 3LCVB 4PT5A 4DV1M 2MH8A 3KDSE 2H1RA 5E26A 3DFZA 2KRKA 4IBCA 1NY6A 2C99A 1OAOC 4QOSA 5FTNA 3SBJA 5DYGA 3UZUA 1G4AE 2O25A 3L28A 5H37D 1EE8A 3GRUA 4OVZB 3KP0E 3GLHE 3EIEA 4B08A 4M9ZA 3QAUA 2JUJA 3SAVA 4QOZC 4JV5M 3DA1A 3ILKA 4LF8M 3A45A 3U6CA 4WW0A 3PXGA 4MGKE 1IFYA 1DGBA 5EP3A 1G8PA 2I7NA 1L2DA 1XWIA 3LMMA 2XH9A 1VEGA 2BJWA 3U5ZB 4AKHA 1ZMWA 2DVWB 4CGYB 3U6DA 4B3RM 1GO5A 4MGHA 1BVSA 1OJLA 1T6OA 1XXHA 4LJAA 2CV0A 2QBYA 1Z59A 2QHOB 3GO8A 3GQ3A 2G8LA 1EIJA 1CUKA 2JY5A 1PJIA 3HHYA 1ORYB 5E6JA 4DR6M 3KOWE 3LVWA 4BBAA 4ITQA 4LJ9A 4Z6YA 1VEJA 3GLIE 5EXSA 2N35A 2CP8A 2QNJA 3SAWA 4GEWA 1Z6TA 3BXWA 5IZ7D 3U60A 1JB0F 3B89A 4AZFA 1XMOM 3NBIA 3CF0A 3CF6E 4WURA 2DWMA 4M0DA 3J80S 4XGIA 2KEBA 1WXQA 1Z5BA 1HT2E 2DZOB 3LW5F 1QAOA 4JN6A 3H4JA 3LCUA 3TPZA 4EIWA 4M9XA 2CV1A 4PDGA 3K1JA 1XHBA 1VQ1A 2R18A 3M0EA 3VLFB 4G4OA 5IT9S 4L8RC 1Q02A 4RF0A 3U6EA 2L4FA 4NRVA 3NWLA 3WHKA 2V1CA 4F2LA 4LFCM 1QDRA 3I4YA 3T1HM 4GC9A 1LV7A 3FTFA 4GIPA 3GPXA 4B3TM 2Z8YM 1GL6A 1QZMA 4X66M 5L8RF 1L2CA 2D7GA 1G3IA 2XEPA 1MN3A 2YFQA 3PNYA 4QHSA 1WHCA 2DAKA 1V33A 3SMSA 4DV4M 1NVMA 1W5TA 2HCBA 3C9PA 1KSFX 3HU3A 4S12A 2KZSA 2KRUA 4LGYA 5EP2A 2Y0QA 2F5QA 4LF6M 4F1IA 5EJCA 2F5OA 1P3QQ 2D7EA 1SXJE 2LVNC 3B9PA 4IJEA 1PRBA 2MGWA 1Q3CA 2OPFA 1L8QA 2CHVA 3U61A 3GLFB 4PDIA 1K82A 2FNAA 2LHGA 1QYRA 2Z4RA 3SHGB 4CHTB 4MGZE 2UXDM 3K9OA 2KXEA 4JI3M 4D80A 3AV0A 3E21A 3FYDA 5C18A 2X4AA 4LFBM 3ZC7B 2R44A 2W82A 3GP1A 1F4IA 2C96A 3E4RA 4M0WA 2K6BA 2KW0A 2ZTDA 1XMQM 3Q8XA 2WSFF 2ZAOA 2QBYB 1QUSA 4NRWA 2VDBB 1ZV1A 4MH0E 2R45A 2EJSA 5LMNM 4G4QA 2LNHC 5BPVA 2JWSA 2BWBA 2LVQD 3UJNA 1DGFA 3SYLA 1NSFA 4R3DA 1GJTA 2ZTCA 2QQ8A 3R9XB 1HQCA 3VKGA 4AI6A 2LVAA 1SXJC 2UUAM 2XSZD 4GC5A 1PGYA 2F5PA 1IY1A 2VQFM 2UUCM 1TH3A 3HWSA 4G3OA 1QANA 1R2ZA 4JI6M 2YNMD 3A98B 4LG2A 3QYEA 2Z7JA 2DZNB 3UMMA 2OOBA 3FYCA 4LJ6A 3FUTA 3VDUA 7CATA 3U6OA 1D2NA 2CEAA 4GH9A 5ITYA 2XF3A 1DGHA 1JR3A 3A42A 4B7FA 5EQTA 2L7IA 4LJ5A 4MM3B 4B7HA 1FNNA 3BBZA 5DNYA 4D81A 4K0KM 1ZAEA 3SASA 3TE6A 3KS8A 2X8AA 2CV2A 1OFIA 1QQWA 2Y20A 2KDLA 3EIHA 4IBGA 2Q2EB 5IWAM 1EFUB 1E32A 2GQFA 2L4EA 4I4LA 4JI0M 4KT0F 3J81S 2XSZA 2BJVA 1J09A 4JI1M 3U6PA 1HJPA 1N75A 3K2LA 3SMPA 4L78A 3T1YM 1T43A 3B7QA 2CHQA 5ITRA 1ZQ9A 3GPYA 1IXSA 2MJ5B 4JI5M 1D0LA 1VEKA 4OU7A 2QENA 3FD9A 2RRUA 2UXBM 1DO2A 3LQQA 4LGMA 5KQ8A 1TR8A 2KZUA 5EXXA 4IJFA 4B3MM 3L2AA 3F92A 4R71A 2KA6B 3IHPA 1SXJB 1OKSA 3HKPA 1NHGC 3IG8A 1NHWC 5ITXE 1IN7A 3C58A 4NXNM 4DUZM 4LJ8A 4MB7A 2DHYA 4B7GA 3AKZA 3AOEA 2O5RA 2YQZA 3MHVC 1IM2A 1TH2A 2D7HA 1NY5A 2RKOA 5GKNA 1J5EM 2EKKA 3K9PA 1JR3E 4LFAM 5KQDA 2APLA 4IBJA 3AJIB 1YE9A 2CUZA 3PVSA 3PFIA 2P5TA 2FS1A 3HJ8A 1K3XA 2JY6B 2X49A 3HZJA 2XLJA 1XNQM 4IBDA 4L16A 2C5RA 4II7A 3RE8A 4KODA 5KPTA 2QCUA 5DFLA 4LZZA 3KXEC 1Z5AA 2V6ZM 4FCVA 4AG5A 1T3TA 2VF7A 4GRIA 1IXSB 2KHHA 2BWEA 1QAMA 1HR0M 1TDZA 3B74A 4REZA 2J7NA 5DYIA 3W67A 2JP7A 4LJ7A 1GKIA 4NSOB 2KNAA 2EA0A 2XZFA 1NJFA 3L29A 2JY8A 1QUTA 1J7KA 3J2PB 3T15A 2KNZA 3R8FA 2DWNA 1WR1B 5ITTA 1XXHB 4OX9M 1D0KA 4DUYM 4AW4A 4PD2A 4LCBA 1HT1E 1WGLA 2MR9A 3BOSA 5LMUM 4DR5M 3U6QA 1JQJC 2VQEM 1GABA 4DR4M 3KS4A 3JR4A 4FVMA 1H6UA 1JR3D 3KW6A 2R6FA 4LF4M 1Z5CA 2LBCA 2VIIA 2XGNA 3GLHB 1WGNA 1ZMUA 3ZH9B 1I94M 3RFWA 2C98A 2H5XA 1HNZM 2B3TA 5EP1A 3KOZE 4NL4H 3CGWA 3HJQA 1OTRA 2RGOA 1AIPC 4LZJA 2HAKA 4P16A 4Z8XA 1E9SA 5EP4A 3FUUA 1Q39A 4QNRA 4Q7JA 5KO3A 3FKEA 3E46A 3J27B 3HJSA 2R0IA 1NNJA 8CATA 1IXRC 2QSFX 1TF0B 3GRYA 3B7NA 1QZEA 3FUXA 3HHWA 5EXPA 2NQ8C 1UM8A 3RGSA 3GPPA 4W5WA 4FW9A 3HGIA 1R7RA 3GLIB 4DR3M 1KFVA 1XNRM 3JAMS 3I01M 3IECA 4FWGA 1NO1A 3CF2A 3AOEC 4KLNA 2LTUA 3U6LA 1D0MA 4YHHM 2ZM6M 1DO0A 3VK7A 1WJ7A 1K3WA 1N33M 4GITA 4ZPXA 4B3SM 5JI3E 4HL4A 2DHRA 3KSXA 3HX3A 4LF9M 3GQ5A 1GVNA 3AOGA 2OOAA 2ZANA 4IBBA 3U61B 1XC8A 1VDDA 3J7BA 3THGA 5EXTA 4G4NA 3MJ5A 1IBKM 2WZJA 4DV7M 3FRHA 3ZQJA 2JZ0A 4R7GA 1MX0A 5FTJA 3FUWA 4LRTA 1DGGA 3SAUA 2G3QA 3SARA 2DNAA 2O01F 1IN6A 4MGIE 4RF1A 2L7HA 1XB2B 4XK8F 1L1ZA 2FH0A 2LWXA 2FOIC 1GJSA 2I7PA 5ITQA 1TH4A 2DWZB 4LY6A 3SYKA 1MU5A 2ERCA 4JXJA 2XFTA 2EKFA 3TWKA 2F5SA 3W0LB 1KYIA 3NBXX 3B7ZA 1NJGA 4TUWA 2CHGA 2K9DA 4KO8A 1E9RA 2JA2A 3GRVA 3GLFA 4OVZA 5ITXA 4IBIA 2QPAA 2ZAMA 3TWLA 4JI2M 3LVVA 2L2DA 1HNWM 4HLQA 1IN5A 3MMPA 4MGYE 2AHMA 4JI8M 2Z4SA 3L27A 2OQ4A 3U60B 3T6PA 1OFHA 4GHAA 4FCWA 3SC3A 1W5SA 4D82A 1HNXM 1LTMA 3CTWB 4UN2B 2XZUA 1G41A 1YSYA 2JY7A 3U5ZA 2YR0A 4FD2A 2QP9X 4NC6A 4I8OA 1FJGM 4AKIA 1VDLA 4AKGA 2HL7A 4JI4M 1PJQA 2EUCA 1PJTA 3TL4X 2DAGA 3SATA 1R4GA 4WP2A 2FE8A 4NOOB 4GHLA 1I4WA 4LJ4A 2A5YB 2UUBM 3M7GA 3D8BA 3JR5A 2C9CA 2Y21A 2R62A 3VKHA 4KHPM 3VK8A 1DGHB 3FRIA 4IBKA 4IBEA 4GKKM 2DAIA 2JZ1A 4QNMA 1Y8GA 1V34A 3KP1E 4PCZA 2J7OA 4LF5M 2HHHM 1TGUA 3D8LA 1L1TA 4I5SA 1IY0A 3KFUG 4HEOA 1OIZA 2F4VM 1SXJA 3VFDA 5KPZA 3GLHA 3HU2A 1V92A 2L6OA 3T38A 3WHLA 5KPRA 1NNUC 4BB9A 2Y0TA 2R4EA 4DR7M 2M60A 3FTDA 3GLFE 4RKUF 3UK6A 1YLAA 4AQYM 3SHFA 5FTLA 3GPUA 2WSEF 3W0FA 4DV6M 1NV9A 2RGHA 2LXEA 1SG9A 4OW0A 3I4VA 1OIPA 3U6MA 3LQRA 4JYAM 1IN8A 3U6SA 1XXHE 2LVOC 3TWMA 1L2BA 2K47A 2DAMA 3E9SA 2GNOA 2DKLA 4L4UA 4LRSA 3FTEA 2DZLA 3I51A
chains in the Genus database with same CATH topology
4FWHA 1PJJA 2F5NA 1IN4A 5FSWA 1N78A 2UU9M 5FTKA 3TQSA 3VDPA 2R65A 4FWDA 4QHTA 3A46A 3QWLA 3HHXA 4RNAA 4JI7M 1IXZA 4BLCA 4FCTA 1YUBA 5FTMA 3L25A 2C9OA 2XFSA 1N36M 2R4JA 1E94E 2CE7A 2V1UA 3GLIA 4DR2M 5JI2E 1TDHA 3MK6A 3M6AA 4I81A 3GLGB 1R6BX 1G59A 4NSRA 4X62M 2DWLA 1Q3BA 1QAQA 2R46A 2ZBKB 4GKJM 3GQ4A 3KSJA 4A3VB 2Z3XA 1IBMM 5C1BA 3FTCA 3FUVA 4AG6A 4DV3M 2EO2A 4G4RA 3PNVA 1N32M 1X37A 3OTOM 4CISA 3J7AS 3SFZA 4DR1M 4IIWA 4L15A 2LH0A 4YY3M 2DXIA 1N77A 5ITUA 1IBLM 3RGPA 3KOYE 2M5ZA 3HU1A 3K92A 2HKJA 3KVWA 2G5GX 1R2YA 4NXMM 2BNKA 2L09A 2E5LM 3KOXE 3ZCBB 1HQYE 3DOAA 3DZDA 2CFOA 4XBOA 3HHZA 3K8ZA 3UGJA 4IBFA 1N34M 1IY2A 1GLNA 1S3SA 3H4MA 4DV2M 4DV0M 4GMQA 1C1KA 5A2QS 1IQPA 4M9SA 3AFHA 3IG5A 2QZ4A 4X65M 5F3WA 4X64M 4DV5M 4LF7M 5IREB 1SXJD 3AL0C 2FFJA 1GL7A 4G6ZA 3L26A 1QVRA 2UXCM 5BR8M 3GLGA 1PM5A 5FLXS 3GRRA 4PT5A 4DV1M 3KDSE 2H1RA 5E26A 3DFZA 2KRKA 4IBCA 1NY6A 2C99A 5FTNA 4QOSA 3SBJA 5DYGA 3UZUA 1G4AE 3L28A 5H37D 1EE8A 3GRUA 4OVZB 3KP0E 3EIEA 4B08A 4M9ZA 3QAUA 3SAVA 4QOZC 4JV5M 3DA1A 3ILKA 4LF8M 3A45A 3U6CA 4WW0A 3PXGA 4MGKE 1DGBA 5EP3A 1G8PA 2I7NA 1L2DA 1XWIA 3LMMA 2XH9A 2BJWA 3U5ZB 4AKHA 2DVWB 4CGYB 3U6DA 4B3RM 4MGHA 1XXHA 1OJLA 4LJAA 2CV0A 2QBYA 1Z59A 3GO8A 3GQ3A 2G8LA 1PJIA 3HHYA 1ORYB 5E6JA 4DR6M 3KOWE 3LVWA 4BBAA 4ITQA 4LJ9A 4Z6YA 5EXSA 3SAWA 1Z6TA 5IZ7D 3U60A 4AZFA 1XMOM 3NBIA 3CF0A 3CF6E 4WURA 2DWMA 4M0DA 3J80S 4XGIA 2KEBA 1WXQA 1Z5BA 1HT2E 2DZOB 1QAOA 4JN6A 4EIWA 3TPZA 2CV1A 4M9XA 4PDGA 3K1JA 1XHBA 2R18A 3M0EA 3VLFB 4G4OA 5IT9S 4L8RC 4RF0A 3U6EA 4NRVA 3NWLA 3WHKA 2V1CA 4LFCM 3T1HM 3I4YA 4GC9A 1LV7A 3FTFA 4GIPA 3GPXA 4B3TM 4X66M 1GL6A 1QZMA 1L2CA 2D7GA 1G3IA 2XEPA 2YFQA 3PNYA 4QHSA 3SMSA 4DV4M 1NVMA 1W5TA 2HCBA 3HU3A 1KSFX 4S12A 2KZSA 2KRUA 4LGYA 5EP2A 2Y0QA 2F5QA 4LF6M 5EJCA 2F5OA 2D7EA 1SXJE 3B9PA 4IJEA 1Q3CA 2OPFA 1L8QA 2CHVA 3U61A 3GLFB 4PDIA 1K82A 2FNAA 2UXDM 1QYRA 2Z4RA 3SHGB 4CHTB 4MGZE 2KXEA 4JI3M 4D80A 3AV0A 3FYDA 5C18A 2X4AA 4LFBM 3ZC7B 2W82A 3GP1A 2C96A 3E4RA 4M0WA 2KW0A 1XMQM 3Q8XA 2ZAOA 2QBYB 4NRWA 4MH0E 2R45A 5LMNM 4G4QA 2LNHC 5BPVA 3UJNA 1DGFA 3SYLA 1NSFA 4R3DA 3R9XB 1HQCA 3VKGA 4AI6A 2UUAM 1SXJC 2XSZD 4GC5A 2F5PA 1IY1A 2VQFM 2UUCM 1TH3A 3HWSA 4JI6M 1QANA 1R2ZA 2YNMD 3A98B 4LG2A 2Z7JA 2DZNB 3UMMA 3FYCA 4LJ6A 3FUTA 3VDUA 7CATA 3U6OA 1D2NA 2CEAA 4GH9A 5ITYA 2XF3A 1DGHA 1JR3A 3A42A 4B7FA 5EQTA 2L7IA 4LJ5A 4MM3B 4B7HA 1FNNA 5DNYA 4D81A 4K0KM 1ZAEA 3SASA 3TE6A 3KS8A 2X8AA 2CV2A 1OFIA 1QQWA 2Y20A 3EIHA 4IBGA 2Q2EB 5IWAM 1E32A 4JI0M 4I4LA 3J81S 2XSZA 2BJVA 1J09A 4JI1M 3U6PA 1N75A 3K2LA 3SMPA 4L78A 3T1YM 2CHQA 5ITRA 1ZQ9A 3GPYA 4JI5M 4OU7A 2QENA 3FD9A 2UXBM 1DO2A 3LQQA 4LGMA 5KQ8A 5EXXA 2KZUA 4IJFA 4B3MM 3L2AA 2KA6B 1SXJB 3HKPA 1NHGC 3IG8A 1NHWC 5ITXE 1IN7A 3C58A 4NXNM 4DUZM 4LJ8A 4MB7A 4B7GA 3AKZA 3AOEA 2O5RA 2YQZA 3MHVC 1IM2A 1TH2A 2D7HA 1NY5A 2RKOA 5GKNA 1J5EM 4LFAM 5KQDA 4IBJA 3AJIB 1YE9A 2CUZA 3PVSA 3PFIA 2P5TA 3HJ8A 1K3XA 2X49A 2XLJA 1XNQM 4IBDA 4L16A 2C5RA 4II7A 3RE8A 4KODA 5KPTA 2QCUA 4LZZA 3KXEC 1Z5AA 2V6ZM 4FCVA 4AG5A 1T3TA 4GRIA 1IXSB 1QAMA 1HR0M 1TDZA 4REZA 2J7NA 5DYIA 4LJ7A 1GKIA 4NSOB 2EA0A 2XZFA 1NJFA 3L29A 1J7KA 3J2PB 3T15A 3R8FA 2DWNA 5ITTA 1XXHB 4OX9M 4DUYM 4AW4A 4PD2A 4LCBA 1HT1E 3BOSA 5LMUM 3U6QA 4DR5M 1JQJC 2VQEM 4DR4M 3KS4A 3JR4A 4FVMA 1H6UA 1JR3D 3KW6A 4LF4M 1Z5CA 2VIIA 2XGNA 3GLHB 3ZH9B 1I94M 3RFWA 2C98A 1HNZM 5EP1A 3KOZE 4NL4H 3HJQA 2RGOA 4LZJA 4P16A 4Z8XA 1E9SA 5EP4A 3FUUA 1Q39A 4QNRA 5KO3A 3FKEA 3J27B 3HJSA 1NNJA 8CATA 1IXRC 3GRYA 3FUXA 3HHWA 5EXPA 2NQ8C 1UM8A 3RGSA 3GPPA 4W5WA 4FW9A 3HGIA 1R7RA 3GLIB 4DR3M 1KFVA 1XNRM 3JAMS 4FWGA 3CF2A 3AOEC 4KLNA 3U6LA 4YHHM 2ZM6M 1DO0A 3VK7A 1K3WA 1N33M 4GITA 4ZPXA 4B3SM 5JI3E 4HL4A 2DHRA 3KSXA 4LF9M 3GQ5A 1GVNA 3AOGA 2ZANA 4IBBA 3U61B 1XC8A 1VDDA 3J7BA 3THGA 5EXTA 4G4NA 3MJ5A 1IBKM 4DV7M 4R7GA 1MX0A 5FTJA 3FUWA 4LRTA 1DGGA 3SAUA 3SARA 1IN6A 4MGIE 4RF1A 2L7HA 1L1ZA 2LWXA 2FOIC 2I7PA 5ITQA 1TH4A 2DWZB 4LY6A 3SYKA 1MU5A 2ERCA 4JXJA 2XFTA 3TWKA 2F5SA 3W0LB 1KYIA 1NJGA 4TUWA 2CHGA 4KO8A 1E9RA 2JA2A 3GRVA 3GLFA 4OVZA 5ITXA 4IBIA 2QPAA 2ZAMA 3TWLA 4JI2M 3LVVA 1HNWM 4HLQA 1IN5A 4MGYE 2AHMA 4JI8M 2Z4SA 3L27A 2OQ4A 3U60B 1OFHA 4GHAA 4FCWA 3SC3A 1W5SA 4D82A 1HNXM 3CTWB 2XZUA 1G41A 1YSYA 3U5ZA 2YR0A 4FD2A 2QP9X 4I8OA 1FJGM 4AKIA 4AKGA 2HL7A 4JI4M 2EUCA 3TL4X 3SATA 2FE8A 4NOOB 4GHLA 1I4WA 4LJ4A 2A5YB 2UUBM 3M7GA 3D8BA 3JR5A 2C9CA 2Y21A 2R62A 3VKHA 4KHPM 3VK8A 1DGHB 4IBEA 4IBKA 4GKKM 4QNMA 3KP1E 4PCZA 2J7OA 4LF5M 2HHHM 1TGUA 3D8LA 1L1TA 4I5SA 1IY0A 3KFUG 2F4VM 1SXJA 3VFDA 5KPZA 3GLHA 3HU2A 3T38A 2L6OA 3WHLA 5KPRA 1NNUC 4BB9A 2Y0TA 2R4EA 4DR7M 2M60A 3FTDA 3UK6A 4AQYM 3SHFA 5FTLA 3GPUA 3W0FA 4DV6M 2RGHA 2LXEA 4OW0A 3I4VA 3U6MA 3LQRA 4JYAM 1IN8A 3U6SA 3TWMA 1L2BA 2K47A 3E9SA 4L4UA 4LRSA 3FTEA 3I51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8R C;  4TUW A;  4QOZ C; 
#chains in the Genus database with same CATH topology
 4FWH A;  1PJJ A;  2F5N A;  4CJ6 A;  1IN4 A;  5FSW A;  2LVP C;  3Q8G A;  1N78 A;  3C3D A;  2UU9 M;  5FTK A;  3TQS A;  3VDP A;  2R65 A;  4FWD A;  4QHT A;  3A46 A;  3QWL A;  3HHX A;  4RNA A;  4DBG B;  4JI7 M;  1AUA A;  1IXZ A;  4BLC A;  4FCT A;  1YUB A;  4Y28 F;  5FTM A;  3L25 A;  3QYB A;  2JXN A;  2C9O A;  2XFS A;  1N36 M;  2DEN A;  2DAE A;  2KNV A;  4ANR A;  1RU3 A;  1E94 E;  2R4J A;  2CE7 A;  2V1U A;  3GLI A;  4DR2 M;  2VF8 A;  5JI2 E;  1MJG M;  1TDH A;  2CWB A;  3M6A A;  3MK6 A;  4I81 A;  4P17 A;  3GLG B;  1R6B X;  1G59 A;  4NSR A;  4X62 M;  2DWL A;  1Q3B A;  1QAQ A;  1TTE A;  2R46 A;  2ZBK B;  4GKJ M;  3GQ4 A;  2J5Y A;  3KSJ A;  2HWJ A;  4A3V B;  2DI0 A;  2MRO B;  2OO9 A;  2Z3X A;  4L6V 6;  2JNH A;  3W68 A;  1IBM M;  5C1B A;  3FTC A;  3FUV A;  4AG6 A;  4DV3 M;  2EO2 A;  4G4R A;  3PNV A;  1N32 M;  1X37 A;  3OTO M;  4CIS A;  3J7A S;  3SFZ A;  1OQY A;  4DR1 M;  4IIW A;  4L15 A;  1C7Y A;  2LH0 A;  3GLG E;  4YY3 M;  2CRU A;  1R5L A;  2DXI A;  1N77 A;  5ITU A;  1NV8 A;  1IBL M;  1QDT A;  3RGP A;  3C3E A;  3I04 M;  3KOY E;  2M5Z A;  3HU1 A;  3K92 A;  2HKJ A;  1VG5 A;  3KVW A;  2G5G X;  3V76 A;  1OAI A;  1R2Y A;  4NXM M;  2LHC A;  2BNK A;  2L09 A;  3FE3 A;  3HY5 A;  2E5L M;  3KOX E;  1G71 A;  3ZCB B;  1A5T A;  1HQY E;  1ZMV A;  3DOA A;  1DV0 A;  3DZD A;  2CFO A;  4XBO A;  3HHZ A;  3K8Z A;  3UGJ A;  4IBF A;  2K0B X;  4CIZ A;  1N34 M;  2WSC F;  1WIV A;  1IY2 A;  1UFZ A;  1GLN A;  1S3S A;  3H4M A;  1PJS A;  4DV0 M;  4DV2 M;  4GMQ A;  1C1K A;  5A2Q S;  1IQP A;  4M9S A;  3AFH A;  3IG5 A;  2QZ4 A;  4X65 M;  5F3W A;  4X64 M;  4DV5 M;  4LF7 M;  5IRE B;  1SXJ D;  3AL0 C;  2FFJ A;  1GL7 A;  4G6Z A;  3L26 A;  1QVR A;  2UXC M;  5BR8 M;  3GLG A;  1PM5 A;  5FLX S;  3GRR A;  3LCV B;  4PT5 A;  4DV1 M;  2MH8 A;  3KDS E;  2H1R A;  5E26 A;  3DFZ A;  2KRK A;  4IBC A;  1NY6 A;  2C99 A;  1OAO C;  4QOS A;  5FTN A;  3SBJ A;  5DYG A;  3UZU A;  1G4A E;  2O25 A;  3L28 A;  5H37 D;  1EE8 A;  3GRU A;  4OVZ B;  3KP0 E;  3GLH E;  3EIE A;  4B08 A;  4M9Z A;  3QAU A;  2JUJ A;  3SAV A;  4QOZ C;  4JV5 M;  3DA1 A;  3ILK A;  4LF8 M;  3A45 A;  3U6C A;  4WW0 A;  3PXG A;  4MGK E;  1IFY A;  1DGB A;  5EP3 A;  1G8P A;  2I7N A;  1L2D A;  1XWI A;  3LMM A;  2XH9 A;  1VEG A;  2BJW A;  3U5Z B;  4AKH A;  1ZMW A;  2DVW B;  4CGY B;  3U6D A;  4B3R M;  1GO5 A;  4MGH A;  1BVS A;  1OJL A;  1T6O A;  1XXH A;  4LJA A;  2CV0 A;  2QBY A;  1Z59 A;  2QHO B;  3GO8 A;  3GQ3 A;  2G8L A;  1EIJ A;  1CUK A;  2JY5 A;  1PJI A;  3HHY A;  1ORY B;  5E6J A;  4DR6 M;  3KOW E;  3LVW A;  4BBA A;  4ITQ A;  4LJ9 A;  4Z6Y A;  1VEJ A;  3GLI E;  5EXS A;  2N35 A;  2CP8 A;  2QNJ A;  3SAW A;  4GEW A;  1Z6T A;  3BXW A;  5IZ7 D;  3U60 A;  1JB0 F;  3B89 A;  4AZF A;  1XMO M;  3NBI A;  3CF0 A;  3CF6 E;  4WUR A;  2DWM A;  4M0D A;  3J80 S;  4XGI A;  2KEB A;  1WXQ A;  1Z5B A;  1HT2 E;  2DZO B;  3LW5 F;  1QAO A;  4JN6 A;  3H4J A;  3LCU A;  3TPZ A;  4EIW A;  4M9X A;  2CV1 A;  4PDG A;  3K1J A;  1XHB A;  1VQ1 A;  2R18 A;  3M0E A;  3VLF B;  4G4O A;  5IT9 S;  4L8R C;  1Q02 A;  4RF0 A;  3U6E A;  2L4F A;  4NRV A;  3NWL A;  3WHK A;  2V1C A;  4F2L A;  4LFC M;  1QDR A;  3I4Y A;  3T1H M;  4GC9 A;  1LV7 A;  3FTF A;  4GIP A;  3GPX A;  4B3T M;  2Z8Y M;  1GL6 A;  1QZM A;  4X66 M;  5L8R F;  1L2C A;  2D7G A;  1G3I A;  2XEP A;  1MN3 A;  2YFQ A;  3PNY A;  4QHS A;  1WHC A;  2DAK A;  1V33 A;  3SMS A;  4DV4 M;  1NVM A;  1W5T A;  2HCB A;  3C9P A;  1KSF X;  3HU3 A;  4S12 A;  2KZS A;  2KRU A;  4LGY A;  5EP2 A;  2Y0Q A;  2F5Q A;  4LF6 M;  4F1I A;  5EJC A;  2F5O A;  1P3Q Q;  2D7E A;  1SXJ E;  2LVN C;  3B9P A;  4IJE A;  1PRB A;  2MGW A;  1Q3C A;  2OPF A;  1L8Q A;  2CHV A;  3U61 A;  3GLF B;  4PDI A;  1K82 A;  2FNA A;  2LHG A;  1QYR A;  2Z4R A;  3SHG B;  4CHT B;  4MGZ E;  2UXD M;  3K9O A;  2KXE A;  4JI3 M;  4D80 A;  3AV0 A;  3E21 A;  3FYD A;  5C18 A;  2X4A A;  4LFB M;  3ZC7 B;  2R44 A;  2W82 A;  3GP1 A;  1F4I A;  2C96 A;  3E4R A;  4M0W A;  2K6B A;  2KW0 A;  2ZTD A;  1XMQ M;  3Q8X A;  2WSF F;  2ZAO A;  2QBY B;  1QUS A;  4NRW A;  2VDB B;  1ZV1 A;  4MH0 E;  2R45 A;  2EJS A;  5LMN M;  4G4Q A;  2LNH C;  5BPV A;  2JWS A;  2BWB A;  2LVQ D;  3UJN A;  1DGF A;  3SYL A;  1NSF A;  4R3D A;  1GJT A;  2ZTC A;  2QQ8 A;  3R9X B;  1HQC A;  3VKG A;  4AI6 A;  2LVA A;  1SXJ C;  2UUA M;  2XSZ D;  4GC5 A;  1PGY A;  2F5P A;  1IY1 A;  2VQF M;  2UUC M;  1TH3 A;  3HWS A;  4G3O A;  1QAN A;  1R2Z A;  4JI6 M;  2YNM D;  3A98 B;  4LG2 A;  3QYE A;  2Z7J A;  2DZN B;  3UMM A;  2OOB A;  3FYC A;  4LJ6 A;  3FUT A;  3VDU A;  7CAT A;  3U6O A;  1D2N A;  2CEA A;  4GH9 A;  5ITY A;  2XF3 A;  1DGH A;  1JR3 A;  3A42 A;  4B7F A;  5EQT A;  2L7I A;  4LJ5 A;  4MM3 B;  4B7H A;  1FNN A;  3BBZ A;  5DNY A;  4D81 A;  4K0K M;  1ZAE A;  3SAS A;  3TE6 A;  3KS8 A;  2X8A A;  2CV2 A;  1OFI A;  1QQW A;  2Y20 A;  2KDL A;  3EIH A;  4IBG A;  2Q2E B;  5IWA M;  1EFU B;  1E32 A;  2GQF A;  2L4E A;  4I4L A;  4JI0 M;  4KT0 F;  3J81 S;  2XSZ A;  2BJV A;  1J09 A;  4JI1 M;  3U6P A;  1HJP A;  1N75 A;  3K2L A;  3SMP A;  4L78 A;  3T1Y M;  1T43 A;  3B7Q A;  2CHQ A;  5ITR A;  1ZQ9 A;  3GPY A;  1IXS A;  2MJ5 B;  4JI5 M;  1D0L A;  1VEK A;  4OU7 A;  2QEN A;  3FD9 A;  2RRU A;  2UXB M;  1DO2 A;  3LQQ A;  4LGM A;  5KQ8 A;  1TR8 A;  2KZU A;  5EXX A;  4IJF A;  4B3M M;  3L2A A;  3F92 A;  4R71 A;  2KA6 B;  3IHP A;  1SXJ B;  1OKS A;  3HKP A;  1NHG C;  3IG8 A;  1NHW C;  5ITX E;  1IN7 A;  3C58 A;  4NXN M;  4DUZ M;  4LJ8 A;  4MB7 A;  2DHY A;  4B7G A;  3AKZ A;  3AOE A;  2O5R A;  2YQZ A;  3MHV C;  1IM2 A;  1TH2 A;  2D7H A;  1NY5 A;  2RKO A;  5GKN A;  1J5E M;  2EKK A;  3K9P A;  1JR3 E;  4LFA M;  5KQD A;  2APL A;  4IBJ A;  3AJI B;  1YE9 A;  2CUZ A;  3PVS A;  3PFI A;  2P5T A;  2FS1 A;  3HJ8 A;  1K3X A;  2JY6 B;  2X49 A;  3HZJ A;  2XLJ A;  1XNQ M;  4IBD A;  4L16 A;  2C5R A;  4II7 A;  3RE8 A;  4KOD A;  5KPT A;  2QCU A;  5DFL A;  4LZZ A;  3KXE C;  1Z5A A;  2V6Z M;  4FCV A;  4AG5 A;  1T3T A;  2VF7 A;  4GRI A;  1IXS B;  2KHH A;  2BWE A;  1QAM A;  1HR0 M;  1TDZ A;  3B74 A;  4REZ A;  2J7N A;  5DYI A;  3W67 A;  2JP7 A;  4LJ7 A;  1GKI A;  4NSO B;  2KNA A;  2EA0 A;  2XZF A;  1NJF A;  3L29 A;  2JY8 A;  1QUT A;  1J7K A;  3J2P B;  3T15 A;  2KNZ A;  3R8F A;  2DWN A;  1WR1 B;  5ITT A;  1XXH B;  4OX9 M;  1D0K A;  4DUY M;  4AW4 A;  4PD2 A;  4LCB A;  1HT1 E;  1WGL A;  2MR9 A;  3BOS A;  5LMU M;  4DR5 M;  3U6Q A;  1JQJ C;  2VQE M;  1GAB A;  4DR4 M;  3KS4 A;  3JR4 A;  4FVM A;  1H6U A;  1JR3 D;  3KW6 A;  2R6F A;  4LF4 M;  1Z5C A;  2LBC A;  2VII A;  2XGN A;  3GLH B;  1WGN A;  1ZMU A;  3ZH9 B;  1I94 M;  3RFW A;  2C98 A;  2H5X A;  1HNZ M;  2B3T A;  5EP1 A;  3KOZ E;  4NL4 H;  3CGW A;  3HJQ A;  1OTR A;  2RGO A;  1AIP C;  4LZJ A;  2HAK A;  4P16 A;  4Z8X A;  1E9S A;  5EP4 A;  3FUU A;  1Q39 A;  4QNR A;  4Q7J A;  5KO3 A;  3FKE A;  3E46 A;  3J27 B;  3HJS A;  2R0I A;  1NNJ A;  8CAT A;  1IXR C;  2QSF X;  1TF0 B;  3GRY A;  3B7N A;  1QZE A;  3FUX A;  3HHW A;  5EXP A;  2NQ8 C;  1UM8 A;  3RGS A;  3GPP A;  4W5W A;  4FW9 A;  3HGI A;  1R7R A;  3GLI B;  4DR3 M;  1KFV A;  1XNR M;  3JAM S;  3I01 M;  3IEC A;  4FWG A;  1NO1 A;  3CF2 A;  3AOE C;  4KLN A;  2LTU A;  3U6L A;  1D0M A;  4YHH M;  2ZM6 M;  1DO0 A;  3VK7 A;  1WJ7 A;  1K3W A;  1N33 M;  4GIT A;  4ZPX A;  4B3S M;  5JI3 E;  4HL4 A;  2DHR A;  3KSX A;  3HX3 A;  4LF9 M;  3GQ5 A;  1GVN A;  3AOG A;  2OOA A;  2ZAN A;  4IBB A;  3U61 B;  1XC8 A;  1VDD A;  3J7B A;  3THG A;  5EXT A;  4G4N A;  3MJ5 A;  1IBK M;  2WZJ A;  4DV7 M;  3FRH A;  3ZQJ A;  2JZ0 A;  4R7G A;  1MX0 A;  5FTJ A;  3FUW A;  4LRT A;  1DGG A;  3SAU A;  2G3Q A;  3SAR A;  2DNA A;  2O01 F;  1IN6 A;  4MGI E;  4RF1 A;  2L7H A;  1XB2 B;  4XK8 F;  1L1Z A;  2FH0 A;  2LWX A;  2FOI C;  1GJS A;  2I7P A;  5ITQ A;  1TH4 A;  2DWZ B;  4LY6 A;  3SYK A;  1MU5 A;  2ERC A;  4JXJ A;  2XFT A;  2EKF A;  3TWK A;  2F5S A;  3W0L B;  1KYI A;  3NBX X;  3B7Z A;  1NJG A;  4TUW A;  2CHG A;  2K9D A;  4KO8 A;  1E9R A;  2JA2 A;  3GRV A;  3GLF A;  4OVZ A;  5ITX A;  4IBI A;  2QPA A;  2ZAM A;  3TWL A;  4JI2 M;  3LVV A;  2L2D A;  1HNW M;  4HLQ A;  1IN5 A;  3MMP A;  4MGY E;  2AHM A;  4JI8 M;  2Z4S A;  3L27 A;  2OQ4 A;  3U60 B;  3T6P A;  1OFH A;  4GHA A;  4FCW A;  3SC3 A;  1W5S A;  4D82 A;  1HNX M;  1LTM A;  3CTW B;  4UN2 B;  2XZU A;  1G41 A;  1YSY A;  2JY7 A;  3U5Z A;  2YR0 A;  4FD2 A;  2QP9 X;  4NC6 A;  4I8O A;  1FJG M;  4AKI A;  1VDL A;  4AKG A;  2HL7 A;  4JI4 M;  1PJQ A;  2EUC A;  1PJT A;  3TL4 X;  2DAG A;  3SAT A;  1R4G A;  4WP2 A;  2FE8 A;  4NOO B;  4GHL A;  1I4W A;  4LJ4 A;  2A5Y B;  2UUB M;  3M7G A;  3D8B A;  3JR5 A;  2C9C A;  2Y21 A;  2R62 A;  3VKH A;  4KHP M;  3VK8 A;  1DGH B;  3FRI A;  4IBK A;  4IBE A;  4GKK M;  2DAI A;  2JZ1 A;  4QNM A;  1Y8G A;  1V34 A;  3KP1 E;  4PCZ A;  2J7O A;  4LF5 M;  2HHH M;  1TGU A;  3D8L A;  1L1T A;  4I5S A;  1IY0 A;  3KFU G;  4HEO A;  1OIZ A;  2F4V M;  1SXJ A;  3VFD A;  5KPZ A;  3GLH A;  3HU2 A;  1V92 A;  2L6O A;  3T38 A;  3WHL A;  5KPR A;  1NNU C;  4BB9 A;  2Y0T A;  2R4E A;  4DR7 M;  2M60 A;  3FTD A;  3GLF E;  4RKU F;  3UK6 A;  1YLA A;  4AQY M;  3SHF A;  5FTL A;  3GPU A;  2WSE F;  3W0F A;  4DV6 M;  1NV9 A;  2RGH A;  2LXE A;  1SG9 A;  4OW0 A;  3I4V A;  1OIP A;  3U6M A;  3LQR A;  4JYA M;  1IN8 A;  3U6S A;  1XXH E;  2LVO C;  3TWM A;  1L2B A;  2K47 A;  2DAM A;  3E9S A;  2GNO A;  2DKL A;  4L4U A;  4LRS A;  3FTE A;  2DZL A;  3I51 A; 
#chains in the Genus database with same CATH homology
 4FWH A;  1PJJ A;  2F5N A;  1IN4 A;  5FSW A;  1N78 A;  2UU9 M;  5FTK A;  3TQS A;  3VDP A;  2R65 A;  4FWD A;  4QHT A;  3A46 A;  3QWL A;  3HHX A;  4RNA A;  4JI7 M;  1IXZ A;  4BLC A;  4FCT A;  1YUB A;  5FTM A;  3L25 A;  2C9O A;  2XFS A;  1N36 M;  2R4J A;  1E94 E;  2CE7 A;  2V1U A;  3GLI A;  4DR2 M;  5JI2 E;  1TDH A;  3MK6 A;  3M6A A;  4I81 A;  3GLG B;  1R6B X;  1G59 A;  4NSR A;  4X62 M;  2DWL A;  1Q3B A;  1QAQ A;  2R46 A;  2ZBK B;  4GKJ M;  3GQ4 A;  3KSJ A;  4A3V B;  2Z3X A;  1IBM M;  5C1B A;  3FTC A;  3FUV A;  4AG6 A;  4DV3 M;  2EO2 A;  4G4R A;  3PNV A;  1N32 M;  1X37 A;  3OTO M;  4CIS A;  3J7A S;  3SFZ A;  4DR1 M;  4IIW A;  4L15 A;  2LH0 A;  4YY3 M;  2DXI A;  1N77 A;  5ITU A;  1IBL M;  3RGP A;  3KOY E;  2M5Z A;  3HU1 A;  3K92 A;  2HKJ A;  3KVW A;  2G5G X;  1R2Y A;  4NXM M;  2BNK A;  2L09 A;  2E5L M;  3KOX E;  3ZCB B;  1HQY E;  3DOA A;  3DZD A;  2CFO A;  4XBO A;  3HHZ A;  3K8Z A;  3UGJ A;  4IBF A;  1N34 M;  1IY2 A;  1GLN A;  1S3S A;  3H4M A;  4DV2 M;  4DV0 M;  4GMQ A;  1C1K A;  5A2Q S;  1IQP A;  4M9S A;  3AFH A;  3IG5 A;  2QZ4 A;  4X65 M;  5F3W A;  4X64 M;  4DV5 M;  4LF7 M;  5IRE B;  1SXJ D;  3AL0 C;  2FFJ A;  1GL7 A;  4G6Z A;  3L26 A;  1QVR A;  2UXC M;  5BR8 M;  3GLG A;  1PM5 A;  5FLX S;  3GRR A;  4PT5 A;  4DV1 M;  3KDS E;  2H1R A;  5E26 A;  3DFZ A;  2KRK A;  4IBC A;  1NY6 A;  2C99 A;  5FTN A;  4QOS A;  3SBJ A;  5DYG A;  3UZU A;  1G4A E;  3L28 A;  5H37 D;  1EE8 A;  3GRU A;  4OVZ B;  3KP0 E;  3EIE A;  4B08 A;  4M9Z A;  3QAU A;  3SAV A;  4QOZ C;  4JV5 M;  3DA1 A;  3ILK A;  4LF8 M;  3A45 A;  3U6C A;  4WW0 A;  3PXG A;  4MGK E;  1DGB A;  5EP3 A;  1G8P A;  2I7N A;  1L2D A;  1XWI A;  3LMM A;  2XH9 A;  2BJW A;  3U5Z B;  4AKH A;  2DVW B;  4CGY B;  3U6D A;  4B3R M;  4MGH A;  1XXH A;  1OJL A;  4LJA A;  2CV0 A;  2QBY A;  1Z59 A;  3GO8 A;  3GQ3 A;  2G8L A;  1PJI A;  3HHY A;  1ORY B;  5E6J A;  4DR6 M;  3KOW E;  3LVW A;  4BBA A;  4ITQ A;  4LJ9 A;  4Z6Y A;  5EXS A;  3SAW A;  1Z6T A;  5IZ7 D;  3U60 A;  4AZF A;  1XMO M;  3NBI A;  3CF0 A;  3CF6 E;  4WUR A;  2DWM A;  4M0D A;  3J80 S;  4XGI A;  2KEB A;  1WXQ A;  1Z5B A;  1HT2 E;  2DZO B;  1QAO A;  4JN6 A;  4EIW A;  3TPZ A;  2CV1 A;  4M9X A;  4PDG A;  3K1J A;  1XHB A;  2R18 A;  3M0E A;  3VLF B;  4G4O A;  5IT9 S;  4L8R C;  4RF0 A;  3U6E A;  4NRV A;  3NWL A;  3WHK A;  2V1C A;  4LFC M;  3T1H M;  3I4Y A;  4GC9 A;  1LV7 A;  3FTF A;  4GIP A;  3GPX A;  4B3T M;  4X66 M;  1GL6 A;  1QZM A;  1L2C A;  2D7G A;  1G3I A;  2XEP A;  2YFQ A;  3PNY A;  4QHS A;  3SMS A;  4DV4 M;  1NVM A;  1W5T A;  2HCB A;  3HU3 A;  1KSF X;  4S12 A;  2KZS A;  2KRU A;  4LGY A;  5EP2 A;  2Y0Q A;  2F5Q A;  4LF6 M;  5EJC A;  2F5O A;  2D7E A;  1SXJ E;  3B9P A;  4IJE A;  1Q3C A;  2OPF A;  1L8Q A;  2CHV A;  3U61 A;  3GLF B;  4PDI A;  1K82 A;  2FNA A;  2UXD M;  1QYR A;  2Z4R A;  3SHG B;  4CHT B;  4MGZ E;  2KXE A;  4JI3 M;  4D80 A;  3AV0 A;  3FYD A;  5C18 A;  2X4A A;  4LFB M;  3ZC7 B;  2W82 A;  3GP1 A;  2C96 A;  3E4R A;  4M0W A;  2KW0 A;  1XMQ M;  3Q8X A;  2ZAO A;  2QBY B;  4NRW A;  4MH0 E;  2R45 A;  5LMN M;  4G4Q A;  2LNH C;  5BPV A;  3UJN A;  1DGF A;  3SYL A;  1NSF A;  4R3D A;  3R9X B;  1HQC A;  3VKG A;  4AI6 A;  2UUA M;  1SXJ C;  2XSZ D;  4GC5 A;  2F5P A;  1IY1 A;  2VQF M;  2UUC M;  1TH3 A;  3HWS A;  4JI6 M;  1QAN A;  1R2Z A;  2YNM D;  3A98 B;  4LG2 A;  2Z7J A;  2DZN B;  3UMM A;  3FYC A;  4LJ6 A;  3FUT A;  3VDU A;  7CAT A;  3U6O A;  1D2N A;  2CEA A;  4GH9 A;  5ITY A;  2XF3 A;  1DGH A;  1JR3 A;  3A42 A;  4B7F A;  5EQT A;  2L7I A;  4LJ5 A;  4MM3 B;  4B7H A;  1FNN A;  5DNY A;  4D81 A;  4K0K M;  1ZAE A;  3SAS A;  3TE6 A;  3KS8 A;  2X8A A;  2CV2 A;  1OFI A;  1QQW A;  2Y20 A;  3EIH A;  4IBG A;  2Q2E B;  5IWA M;  1E32 A;  4JI0 M;  4I4L A;  3J81 S;  2XSZ A;  2BJV A;  1J09 A;  4JI1 M;  3U6P A;  1N75 A;  3K2L A;  3SMP A;  4L78 A;  3T1Y M;  2CHQ A;  5ITR A;  1ZQ9 A;  3GPY A;  4JI5 M;  4OU7 A;  2QEN A;  3FD9 A;  2UXB M;  1DO2 A;  3LQQ A;  4LGM A;  5KQ8 A;  5EXX A;  2KZU A;  4IJF A;  4B3M M;  3L2A A;  2KA6 B;  1SXJ B;  3HKP A;  1NHG C;  3IG8 A;  1NHW C;  5ITX E;  1IN7 A;  3C58 A;  4NXN M;  4DUZ M;  4LJ8 A;  4MB7 A;  4B7G A;  3AKZ A;  3AOE A;  2O5R A;  2YQZ A;  3MHV C;  1IM2 A;  1TH2 A;  2D7H A;  1NY5 A;  2RKO A;  5GKN A;  1J5E M;  4LFA M;  5KQD A;  4IBJ A;  3AJI B;  1YE9 A;  2CUZ A;  3PVS A;  3PFI A;  2P5T A;  3HJ8 A;  1K3X A;  2X49 A;  2XLJ A;  1XNQ M;  4IBD A;  4L16 A;  2C5R A;  4II7 A;  3RE8 A;  4KOD A;  5KPT A;  2QCU A;  4LZZ A;  3KXE C;  1Z5A A;  2V6Z M;  4FCV A;  4AG5 A;  1T3T A;  4GRI A;  1IXS B;  1QAM A;  1HR0 M;  1TDZ A;  4REZ A;  2J7N A;  5DYI A;  4LJ7 A;  1GKI A;  4NSO B;  2EA0 A;  2XZF A;  1NJF A;  3L29 A;  1J7K A;  3J2P B;  3T15 A;  3R8F A;  2DWN A;  5ITT A;  1XXH B;  4OX9 M;  4DUY M;  4AW4 A;  4PD2 A;  4LCB A;  1HT1 E;  3BOS A;  5LMU M;  3U6Q A;  4DR5 M;  1JQJ C;  2VQE M;  4DR4 M;  3KS4 A;  3JR4 A;  4FVM A;  1H6U A;  1JR3 D;  3KW6 A;  4LF4 M;  1Z5C A;  2VII A;  2XGN A;  3GLH B;  3ZH9 B;  1I94 M;  3RFW A;  2C98 A;  1HNZ M;  5EP1 A;  3KOZ E;  4NL4 H;  3HJQ A;  2RGO A;  4LZJ A;  4P16 A;  4Z8X A;  1E9S A;  5EP4 A;  3FUU A;  1Q39 A;  4QNR A;  5KO3 A;  3FKE A;  3J27 B;  3HJS A;  1NNJ A;  8CAT A;  1IXR C;  3GRY A;  3FUX A;  3HHW A;  5EXP A;  2NQ8 C;  1UM8 A;  3RGS A;  3GPP A;  4W5W A;  4FW9 A;  3HGI A;  1R7R A;  3GLI B;  4DR3 M;  1KFV A;  1XNR M;  3JAM S;  4FWG A;  3CF2 A;  3AOE C;  4KLN A;  3U6L A;  4YHH M;  2ZM6 M;  1DO0 A;  3VK7 A;  1K3W A;  1N33 M;  4GIT A;  4ZPX A;  4B3S M;  5JI3 E;  4HL4 A;  2DHR A;  3KSX A;  4LF9 M;  3GQ5 A;  1GVN A;  3AOG A;  2ZAN A;  4IBB A;  3U61 B;  1XC8 A;  1VDD A;  3J7B A;  3THG A;  5EXT A;  4G4N A;  3MJ5 A;  1IBK M;  4DV7 M;  4R7G A;  1MX0 A;  5FTJ A;  3FUW A;  4LRT A;  1DGG A;  3SAU A;  3SAR A;  1IN6 A;  4MGI E;  4RF1 A;  2L7H A;  1L1Z A;  2LWX A;  2FOI C;  2I7P A;  5ITQ A;  1TH4 A;  2DWZ B;  4LY6 A;  3SYK A;  1MU5 A;  2ERC A;  4JXJ A;  2XFT A;  3TWK A;  2F5S A;  3W0L B;  1KYI A;  1NJG A;  4TUW A;  2CHG A;  4KO8 A;  1E9R A;  2JA2 A;  3GRV A;  3GLF A;  4OVZ A;  5ITX A;  4IBI A;  2QPA A;  2ZAM A;  3TWL A;  4JI2 M;  3LVV A;  1HNW M;  4HLQ A;  1IN5 A;  4MGY E;  2AHM A;  4JI8 M;  2Z4S A;  3L27 A;  2OQ4 A;  3U60 B;  1OFH A;  4GHA A;  4FCW A;  3SC3 A;  1W5S A;  4D82 A;  1HNX M;  3CTW B;  2XZU A;  1G41 A;  1YSY A;  3U5Z A;  2YR0 A;  4FD2 A;  2QP9 X;  4I8O A;  1FJG M;  4AKI A;  4AKG A;  2HL7 A;  4JI4 M;  2EUC A;  3TL4 X;  3SAT A;  2FE8 A;  4NOO B;  4GHL A;  1I4W A;  4LJ4 A;  2A5Y B;  2UUB M;  3M7G A;  3D8B A;  3JR5 A;  2C9C A;  2Y21 A;  2R62 A;  3VKH A;  4KHP M;  3VK8 A;  1DGH B;  4IBE A;  4IBK A;  4GKK M;  4QNM A;  3KP1 E;  4PCZ A;  2J7O A;  4LF5 M;  2HHH M;  1TGU A;  3D8L A;  1L1T A;  4I5S A;  1IY0 A;  3KFU G;  2F4V M;  1SXJ A;  3VFD A;  5KPZ A;  3GLH A;  3HU2 A;  3T38 A;  2L6O A;  3WHL A;  5KPR A;  1NNU C;  4BB9 A;  2Y0T A;  2R4E A;  4DR7 M;  2M60 A;  3FTD A;  3UK6 A;  4AQY M;  3SHF A;  5FTL A;  3GPU A;  3W0F A;  4DV6 M;  2RGH A;  2LXE A;  4OW0 A;  3I4V A;  3U6M A;  3LQR A;  4JYA M;  1IN8 A;  3U6S A;  3TWM A;  1L2B A;  2K47 A;  3E9S A;  4L4U A;  4LRS A;  3FTE A;  3I51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...