4L8SA

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
b'NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCASMDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA02
1S9YB 2RCSH 3RVWC 4YXKL 2FBOJ 2DLTA 4ZTPH 4GKSA 1JI1A 2H3NA 1W0YT 4LDOB 3K80A 3RWJB 1DLHA 1WZMA 2YC1B 4OLVH 5DD0H 2G2RA 3SKJH 4KHTL 4AG4L 1K6QL 2XNAB 3LN9A 5SX5K 1WBXB 3MLSH 1RURH 4K23L 5TF1H 5HXMA 2RGSA 2NY3C 1I3VA 4FQIL 2A74B 3TBSB 4LGRB 5T3XL 4ODWB 3S37X 3S36L 1RJZB 3DJ9A 3HPJB 3WFHB 3ZYOA 1S7UA 4NPYA 2D7NA 5CSGA 2W60A 4PGZA 2FJGA 3QHFH 3VXUE 1MCSA 2JJUA 3SDCC 4XXDB 5CP7B 4BH8B 3RWDA 2R2CA 5IKCB 3SE9L 4EEEA 1FV1B 1G0DA 4JLRA 5GGTL 3E6FB 3N1MC 1NCTA 4ZFFA 5CD3A 3FFDB 4OGAC 4ZXBB 4GXUN 3FT2A 4H0GA 4YGVB 5FYLL 4X4XB 3L3HA 2FX9L 3QXDB 4QRPD 4JHZA 1G1YA 3GSVA 3RVWD 3TYFB 1PAMA 5KOMC 3NIDF 4CDGC 2NX5B 3NIGF 3BSZL 4ODXB 5BV7L 3UTSA 4XBPB 5I1AB 4HG4J 1DJSA 4L3AA 1IM3A 3C2AH 4ZNEE 3IFNH 5FEBA 1Y6KR 3LSOA 4TUKH 1TETL 1F6FB 5FYKU 2X1QA 3QNZB 2W9EL 3GSRB 4UNVA 4M6OL 3V0WL 4LVNB 3NPZB 5EULV 3ZDZE 2HFGL 2ZUSA 1OWRM 2GHWB 2X89A 4KKAC 1Z6JT 4J8RB 5GGSA 1FNLA 3D18A 4I0PD 4RAUB 2R29H 2D9CA 4RMWA 4UB0H 3SO3B 3VFRB 3RL1B 2DD8H 4EXKA 1VADA 2OR9L 4JM2F 5EU6B 1MCIA 1EMTH 4X99A 2JELH 2YA2A 3JWNC 3IDNA 4JM4H 3SCMB 1SMAA 3MQIA 5FV2A 1DBBL 3AM8A 1YPZA 1V7MH 1UWGL 5HHOA 1IKFH 2D7OA 2VAAB 4MWFA 2R0LH 5F7WC 1FO0B 2B1HH 2NXYC 2VKWA 2X40A 3RZCC 1NDGA 4PJ5E 1HH9A 3BZ4A 4PGBA 4LRNH 4P2OD 5HDLA 5K9JL 3WFCH 2X2YA 3ARWA 1NCWL 4XMKH 3GMQA 3BE1L 2OTUB 5JQ6H 1XGRB 3FQRB 5FV1L 2AJUH 2IPUK 5D1XA 1C16A 3QWRD 1WIPA 1JMXA 3CSBA 3WV0A 5D2NC 1LO2L 4M6NH 3BP5A 2ED8A 2YS4A 3ZYZA 3EZJB 3ZKNC 4MA7H 1RJLB 2EIZA 5L0QC 1UWEH 4X6DE 5FO7A 5JTWA 4U1MB 4A6YA 3CFBA 4YUEL 5KW9H 1OTUD 1NLDH 4UNUA 4X5XA 5FOBA 2R1XA 1EFXA 3ULVD 3CXDL 3OZ9H 4GKOA 4FABH 1NPUA 4M62H 4ZUVA 3WBDA 3A67L 4EKXA 5GRJL 3QI9C 1P4LA 5LWYH 4F7PA 1U95B 4LPWA 4WI9A 5KTEL 3DXAB 1QSEA 2JIXA 4JPIB 1CQKA 2VDKL 2YUVA 3P0VL 3WIFA 4JG0H 2ARJA 3B9EA 3BPCB 1NBZB 1DQDL 1UVQB 1RUKL 4HX1B 3BKYL 4P3DA 5EIQA 5I1DB 5E8EA 4AH2A 2A1WH 2X1OA 3KXFE 2OMNA 1ADQA 1A0QL 2YUWA 3MRLA 2GITA 5HYJA 3QO1B 25C8H 3QA3B 4KUZH 4MCYA 2VZ3A 1IGMH 2VR4A 1QFWI 2O5ZH 2QJDA 4W4NA 2E9IA 1ZXQA 2HN7B 3EW3B 1YNTA 4ZFZA 3L5JA 2ZSVB 4WWKB 3SDXE 3P0YH 1SYVA 5HGDB 5HHPA 5TQ2L 1I1YB 4L3CA 1RUQL 2FZ3A 5IMOB 5LGHL 2HLAB 5DJ8A 4N8VA 1UQSB 1A1MA 1ZA6B 4OCSL 4K9EH 5E9DD 1GPOL 5FGSA 2D9QB 3ARXA 4P46A 2VDMH 4QRPE 2B4CH 1A3RL 4IMLA 4J23A 1JNLL 4LOUC 4I0KA 1I7UA 4H25B 5DJ6A 4ZS6D 4Z8FH 3NCEB 1ERNA 1I3UA 4R4NC 4UU9B 1UACH 1A6UL 1UEYA 1V3LA 5C2BH 5I1LA 1C5DA 3GBNH 4PRAB 3W0WB 5EO1A 3BGMB 1IC4H 4IMKC 3ZT7A 3DVFA 3CH8A 4EQ3A 1KTKE 3EYSL 4UIMA 3FFCE 4MD4A 3VCLB 4XI5C 5BJTA 4LVEA 4D0CB 5JQHC 2G75A 4P0DA 3GHEH 4QRRD 1OAUH 2Y06L 5IF0B 3BDYH 3TJHD 4NO2A 1N4XL 4MJ5B 3ZE0F 2BZDA 2NY5L 3ARDC 1YQ2A 3DX6A 4PJAF 5KANI 1NSNL 1MHPH 2IALB 3LQZB 3NVQA 2N7AA 2ADGB 3CVHA 3VA6A 1WIUA 1MQKL 5FHBH 2BJML 3QPQC 2PO6A 3BT2L 1L6ZA 2Y25A 4GRLC 3D1MC 1ONQB 2IANA 2YXFA 3IETB 5C0AD 1IQDB 3BQUB 3VFNA 1CGSL 3G5ZB 2ORBL 1JNJA 4DVRH 2IQ9H 5F9OH 1VKXA 3EIFA 4R4ND 5I76B 4U3XA 1GIGH 1WZLA 4JE4B 4HWEH 1CWVA 4XCFH 1HSAA 4JFPB 4LLYA 4F37F 1VGEL 4G43B 2IWGA 3VXUA 5E2VL 2CUIA 1WFTA 4YPGA 1JYVA 4OTXH 4YBLB 3QUXC 3M17B 4N90D 4WWID 4Z7UA 4OZ4B 4JO2L 1KIRB 4XC1L 5T1KD 4FFWD 4MDIA 1BGXH 4UT6L 4I3RH 3S98A 1FNEA 3K4ZA 5C71A 2AXGB 5HGHB 1X5YA 1FGVH 4GAJH 1W72A 1RZGA 3T4AA 2VLLB 4ISVA 5D93B 5D7IE 2FYYA 4XNQA 1J9CT 1T3FA 5D7JC 3RI5K 1YC7A 3O8XB 5HGBA 1UJ3A 3BIKB 3VH8B 1G9NL 4NN7C 3C5ZA 3SDDC 2FX7L 4K3EL 1HE7A 2A6DA 4UT9H 3ZDXE 3S3SA 3QPQD 1S9VB 5AUMA 1G1CA 4OCLC 4ZNEA 3EAKA 2X9WA 5DQJB 3VD5A 1KPUA 1K2DB 2AI0L 4BQ9A 1A2YB 1WBZB 5DRZB 5TE6L 3O4OC 5C3LD 2FNBA 4K3HA 3BGFB 4U2ZA 2YZ8A 1MCFA 4YC2C 1CGYA 3OB0H 3PJSB 4OM0H 5L2JA 1VGKA 1YNKL 1ZOXA 4GQPH 3SDYL 3P30L 3U0WL 3H9HB 4M03A 5D2NE 3LKQB 1I7RA 3OAUH 3UAJC 1ZHKA 1KENH 3V8CA 3CPLB 3HMXL 3T0EC 2AEQL 5KVGH 4E42B 3QUXD 1A7RH 2M2DA 3FQTB 1OD7A 4PFEA 4GRWB 5IVNA 3U46B 3T3PE 4C54A 3SE4A 5IGXH 3MV9D 4HWZA 4W6XB 3ZL4L 1Z9LA 3T2OA 1T0NA 3LCYA 4N0UA 4U6YB 3WNPA 4XPBL 2WP3T 4E9LA 4PREB 1J8KA 4P5KB 3I85A 2XXMB 3PIQB 5K9KA 3IFLH 2A9NL 4QHNB 1OY3B 2KPNA 4OKVB 4WO4A 1U8KB 1MHHA 1QLRA 4PJ5A 5MENB 3DRTB 1HQRB 1MCOL 2AK4E 4YDIL 3UO1H 3OJDB 1YEJL 4Q6IA 2X9XA 5SWQA 1TNMA 1E27B 5D7LB 2EH7L 4KWUA 4P5TA 5JW4N 5B38A 5MI0C 1URLA 3BMWA 5JUEL 2A6JB 4LLQB 3OV6A 3Q2CA 4FFVD 4QHKI 3KPOA 3EYQC 5I8CA 2O5XH 1PSKL 5KSVA 5F3BB 2OSLA 3T4YA 4NQVB 5ISZE 4X4ZA 2VXSH 4XH2B 3ZKMD 1JZ3A 3HRPA 3GI9H 4FNLL 2BDNL 1NUFA 1XIWC 4YR6A 1YDPA 1U8MB 4MB4A 3V0VB 1B6DA 2CUMA 1ZTXL 5TDNA 1K85A 3ARGC 2P7TA 4L8DA 3O3DA 4DN3H 5DHVA 4GBXA 3U0PB 5E95B 4AQOA 1N7ML 4H8WH 3ARTA 4ZPVB 4CADA 4ODSL 1H8OA 1ED3B 4N1HB 4HLZG 1MSPA 2HG5B 1U92A 5ESVB 1MUJA 3INUH 5D7KD 2WM0A 4OF3A 4NZRL 5CHNB 3S6CA 3S5LB 4F7EB 1P6FA 3VU2A 3QDMD 4LVOC 2GJZB 3ES6A 4P59H 1QQDB 4DGVL 5IIEB 1YEGL 5DD6B 5HJ3A 3PABB 3K74B 4FQCH 2ZUXA 1T2QH 5E6YA 4EN3B 4KQ3H 3KXFA 4QHUB 2VITB 3BKJH 4QT5B 1R3IH 4KHXL 5L2KD 4XVJL 3HTLX 3V4VL 4LCUA 3EYQD 3E6HA 4P2QB 5D1QA 3WJLC 3LEXB 3FTGB 1UKTA 4PG9A 4PP2B 4WFED 1F02I 1W0VB 1ZLWK 2V7NB 3SDXA 2WWMC 1FLTX 3TIEB 4NQED 4JY5L 3H7BA 2PYFB 3JUZA 1CCZA 2R1YB 5F89B 1D5XA 4HLZH 4QRUA 4MVBD 4PRHE 1U9KA 1R6VA 3AS1A 3VXPB 4PS4L 4ERSL 5E1AB 2EXYC 4L4TB 4OLUH 3IVKA 1D3CA 3MACL 3NCJL 4OZIF 1H5BA 1S78C 3WYRA 2Y36L 1NANI 1VEMA 2DQIL 1LEGB 3BZDA 4I5BA 3BXNB 4H1LB 4Z7QE 3VXNA 3JWDH 5DJAA 1V3MA 3UC0L 1QLEH 1QEWB 3BYYA 3CC5A 1CT8B 2KBGA 3Q6GH 3UBXB 1EFQA 3L7EA 4NP4L 4HWBH 5ESQB 4B50A 1HEZA 4XB8A 5E8OB 4HIIB 5DSCB 3A6BH 2VZ1A 3QDGE 4XBEH 4C83B 1KCKA 2C3VA 5CMAB 3TT3H 4LASL 1T7WA 1IKNC 3S7GA 3G6JB 1AO7B 2Z31B 1OHQA 3GNMH 5E5UB 2YEZB 4HWNA 3SDCA 3U9UB 2AVGA 2ICWI 1T1ZB 4PJEE 2I5YH 4GS7C 4QHMB 3V0AC 1CIDA 3HCVB 1JHLL 1QBMH 5KSAC 4IIQA 2X4QB 4O51B 4D0DB 1EO7A 4WEBH 3FHQA 1FL6B 4NJ9H 2MPAH 2EIBA 4HC1H 1RZJL 4WUKH 1P2CA 5AZ2L 1U91B 2C4FT 3B6SA 1A5FH 1YUHA 2P5WE 5E4IA 3ULVF 1U2CA 5L8KB 1A8JH 1T2XA 1MREL 1MWAL 4NZUL 1AFVL 5J11C 4X7SH 5JXEC 2APFA 5DT1H 4JKPH 3TV3L 3ISWA 5TE4L 1ZLVK 2J88H 1CXKA 1RUAL 3SGDH 4M43H 1ZT7A 5BXFB 2E9BA 4WGWB 2NW2B 4YAQB 1TITA 4ZPTA 5T1LB 3T0EE 5F88A 5MP6L 3PL6D 4LLUA 3O2VH 3MBEB 4OFKA 1BX2A 3EOAA 4ORGB 3SDAB 3IGAA 3DX7A 2HKFH 2R0WH 3QQ4B 4XP4L 5F9WB 3MROB 5KSAD 3TH4T 3DBXA 2BOCB 4H26A 3V52H 3E1F1 2F19H 1JNNL 4JR9H 1D9KC 1NC2D 3CFJB 4P5MB 4PJGE 3B9DA 2FLRT 4QXWA 4LCIH 4TNVK 3MUJA 3LEYH 2ATPA 4KU1A 5CD5D 3NFPA 4JFHD 4K7FB 4NM8H 1MFAH 1UM4L 4WFFD 1HHJB 3N1GC 4X7EC 2I07B 5F6IB 2HVJA 3H7LA 4PJIE 5EWIH 3S4SA 2P8PA 3V6OC 2Y4SA 4I1NB 5FGBC 1E4WL 4IRSA 5DR5L 3FJTA 3IFPB 5KJRL 1TVDA 3TA3A 3VMNA 2VXTH 4W6WB 2C5DC 3MJ7B 5CZVH 1JUFB 1RUPL 5D7SH 4NN6C 1F4YH 2CR3A 3FB5A 1OB1B 3CGTA 1ZWIB 1RU9L 4Z7WE 3V6ZA 1N0XH 1ULVA 2J8OA 3NBNA 3QJHB 5GS1B 5D96B 1IGYB 4I48A 3ZO0A 4R90L 1SY6H 3D39D 3VXRE 3U48A 4NT6B 4LF3A 4Y2OA 4HPYH 1JWSA 5A2LH 4WCYH 3NZ8B 5E7FA 2FB4L 4FZEL 1A6AB 4XP6L 1F90H 3BH8A 2NXZC 3OTTA 2ITCA 1FNSH 5IB4B 3VGBA 3LDBC 1FNGA 4OCRH 1AXSB 3H6JA 1CXLA 3GSOB 5JHLL 1T4KB 4M93C 4Q9RL 1S9XA 4JZNA 2R23A 2Z91A 2OL3B 3FRUA 1FYTB 5C9JB 2NY4D 2A9MH 4ZUWA 1JPTL 4K9EC 4QOKB 1RK1B 4AL8L 2B4CC 2GCYB 4F7MA 4ZYKA 5ISZA 2BFVH 1YMMA 4G6FD 5JHDE 1B0RB 1XEDA 1F2XK 3WUZA 4LARL 4R4BA 4PJHE 3WD5L 1YJDH 1A7QL 5TDPB 3V5KA 3NCMA 2A73B 5GS2H 1UCBH 3D69B 3O3AA 4FXKB 2Q7YB 1F6LL 1LO0L 3BRFA 2BHUA 5J6HA 1JNHA 3QPXL 3CCHB 3RVTD 3O6FC 5F7EL 1IEAA 1HN1A 3FONB 2P49B 4HFWB 2L0DA 2R4SL 4LSTL 5DK0B 1I3RB 3QAZB 5B8CC 5JIIA 4KZEH 3QIUB 2DM4A 1QFUH 2AXJA 2VIRA 3SOBH 2N7BA 5E6ZA 2ICEA 4O2FA 5EBLB 1JTTA 3ULSA 3G5YB 3DGGA 3OPZH 5F21B 3F8UB 1PZ5B 4P3WA 3UYRL 1OP5K 4BFEA 3TFKD 1FO0H 4YDJB 1ORQA 1DBML 5T33H 1PG7X 2WNGA 4NIKB 1J18A 4MJID 1E4XH 5JOFB 1LE5A 1RZFL 3PV6B 4MNGE 1D6EA 5IMMA 1UC6A 1MI5D 1S9WA 4HQQL 1EK3A 3BPNC 3HNSH 4HH9B 4U6VL 4M6AA 1FSKC 2I9LA 4LQFH 3KYOA 2X4PB 4LHUB 4OFYA 1FFOB 2QSTA 1XR9A 2HRPH 1A02N 2PR4L 4XGZB 1P4BH 1RVFH 1HKLH 4PRHA 1IAKA 5HGAB 4XAWL 4U1GC 4QWWC 1CU4L 3MMEA 3GMOA 2EDLA 4RQQB 1RULH 4U1JA 4HXAL 4NNYA 4BZ1H 4ELKA 5C07B 4JRXD 2OMBA 3LQAL 1EEQA 4IDLA 2GFBA 1WT5A 4S2SB 4BKLA 1P4IL 1ZLUH 3RNQA 3WO4C 3RGVC 1ZANL 1HOCB 4OIAA 3QCVH 4HBQA 1K5NA 4FFZL 3X12A 2FECL 1MCBA 1ZEAL 4IRJD 1CTOA 3R0NA 1XF3A 4EUPA 3VE0B 3QJFA 5FGCE 2Q1EA 4OLEA 4OGXL 3QDGA 4J3TA 4X6EB 1M6OA 3M45A 4Y4KA 5ITBH 1EGJH 2XRAL 4GAYB 2NY0D 5DI8A 5BZDB 4V1DD 4UQ2B 1SEBA 5BOPA 4MB5A 5CBEB 4HDIB 3N85L 3I84A 3JSSA 4OGZA 3WFDH 3ARUA 4S10A 2VSCA 2P8MB 2DTMH 1NJ9A 3FOMA 3W2DH 3QUMB 5TH2B 3UJTL 2YPVH 3O3EA 5DJCB 4ZUTA 2D0HA 4QXGH 1ES0B 1Q0YH 5DGRA 1UG9A 1JRHL 3D39E 5D7JA 1HHKA 2P5WA 1CQYA 4MSWA 4N8CL 5IG7A 4IRZH 3GI8L 4KROC 3G08A 3NTCH 3WFEH 4KDTA 3QG7H 3V6BR 4PTUB 5E8NA 1XCTA 3RDTC 1BREA 2CUHA 2QKIA 1B0GA 1BQUA 3RTQC 4FQHB 3O4LD 5HI5D 2XICA 1AJ7H 5C6PB 2LV4A 3IDMB 2XWBA 3WKML 4NWTL 5J89A 3ILQD 4OI8A 2XN9A 1T04A 1RZKL 4HT1L 2BVYA 1MCKA 5DDHA 2H9GB 4L3EB 3RJDA 3MRPB 4N1CA 4XP5H 1Q94A 1IEHA 4MXQD 2GTWA 5F7YC 3V6OE 2VAJA 3L5WA 3MLYL 3O6KL 2OBGA 3CSGA 5B39B 3QSKB 3T0BA 4OD2A 1HDMB 2R2EA 4YX2H 5JPNB 3T0EA 3FB6A 2YOCA 3GKWH 4PJBB 5F6HI 4FMFA 4AQ1B 1OPGL 5C0EA 5EZLA 4F3FA 3VXTB 3IDXL 1AC6A 4WI2A 5DVLA 3MRRB 3D48R 3O9WA 4LSUH 4KKLD 4WTZG 5CP3H 2VLJE 1KNOB 1MJUL 4XVTH 1A9BB 1GOHA 5IJKA 1S3KL 3VG0L 1DUZA 4YHNB 1UT9A 3GJEA 1CF8H 2CDEA 3J8F7 5FF6A 3AB0B 1S7VB 3H9SA 1KJ3L 5DVOA 3QUYA 5L88L 4UTBH 3KR3H 5TE7H 3RDTD 4Z7VF 3IU4H 4LBEB 2VXUH 3Q1SH 4JO1L 4HIXH 5D8JL 3NCCB 4GLRH 5DUML 4ZFGL 3ROLA 3FT4B 4PJIA 4GW4A 4NYLB 1WUNT 5I17B 3MLWH 3A0OA 3MRCA 2L7UA 3WN5B 4POZC 2XTJD 5FECA 4H8WC 1DBAL 3MREA 4GMSH 3KLAB 4NDMB 4XAKE 5SWSD 4S1SL 3C5JB 3HZMA 3EOBA 4AT6B 3ZT5A 4ZS7L 1KN2H 3L3OB 1CDCA 1CXHA 2F8VA 4J4PA 4HJGB 3MTRA 3QNYA 4LFHG 3VH8G 5CCKL 4Z7WA 5HPMA 2VXVH 4HJJH 4KRPD 3OKDB 1U3HA 4HKJA 3KPLB 3GIVA 4Z7OE 1KJ2A 4FN0A 1QR1B 1S9KC 1JBJA 1KIPA 4OZGF 3VXRA 3ARGA 2F5BL 2H3NB 3BVNB 8FABA 4Y5VB 5C7XL 3QIBC 1DBJL 3L9RB 3TPUA 1DLHB 4GXVH 5K9OA 1AGBA 4M7LT 1FPTL 4G6AD 3RNKB 2IGFH 5F70A 1GHFH 1NCBL 4AMKH 1WQVT 2HWZH 5IV2A 1VFMA 3TT1L 3OHXB 3PWLB 1WAAE 1TJIL 5EDXA 1VFOA 4N8PA 3LZFL 2AABH 4NPYB 4KVCH 2W60B 1TJGH 3D0LA 3NACH 4XP9L 3GMMA 4P49A 1SMOA 4RIRB 3QFDB 5F1KC 1XFPA 2JJVA 2JB5H 1GYAA 3RWDB 4RZCA 3BDBA 3REWB 3JWDC 3VFGH 5JHDA 5J1SC 3CJJA 4X9IA 5E08H 4PJHA 3S36X 2IH3A 4ZFFB 1XCQA 5CD3B 1X5GA 1WJ3A 2DIBA 3UP1A 4MHHG 4MQXC 3IRZA 2G60H 5J7CC 3MO1A 3MUHL 1HYSC 4AZ8A 3CZFA 2WQRA 3SE3C 3K8KA 3OSKA 1OLLA 3VW3L 3QIBD 1QSVA 1RZ8A 4FQ1H 1QNZH 3IDIA 4O9HL 4D3CH 4GRWH 1Q0XH 2Z93B 3PQYD 3L7FA 1OAYL 2Q3ZA 4OIIL 1NGZA 1ZVSA 5DJZA 1ZHNA 4KRLB 4FG6D 1X5JA 4WI8A 2QHLA 4UDTA 5GGRY 3S35H 4NGHL 4PJ7E 4WU5B 2N56A 3VI3E 2R8SL 2CDGA 5ETUA 1BPVA 4XWGH 2D03L 1FG2A 4G8FA 4QKXB 3KPRB 3MOAH 1EBAA 4MNGA 4RFEB 5GGSB 4JGMA 3D18B 1CFSB 3MRJB 1P1ZA 3V5DB 5GSRB 2DWDB 1VADB 3ZTNL 1WGOA 3RY4A 4M7ZB 2ZOLA 3S5LG 4LQ1A 2AERT 5BVJA 1YPZB 5DLML 4OZFB 5I1JL 5EO0A 2WSKA 4WNQB 1OM3L 5IB3A 1EUUA 1IGJB 4LDEB 5JW5B 2CLVA 2ED9A 4Y4HB 1HH9B 4UAOB 2F53E 3BZ4B 4KQ4L 3HZKA 4GSDH 3QUKB 4DKDC 3TVMC 1H3GA 2VISA 3VGDA 3RA7L 2ATKA 1UCTA 2PYEA 3TCXA 5J6GA 1OSPH 1QLFA 3ESVF 5TPWL 1OW0C 1MFEL 1BAFH 2C9AA 1MRFH 1R5IA 1XGQA 3KPPB 4X6CE 4XRCA 1ZLSL 5CZXC 2J12B 3NMEA 3UTQA 2VLRD 4WUUB 3O2WH 3QQ9C 1UB5A 3BN3B 5FO7B 5JXAH 1MJ8L 3QISA 5F7LB 3TZVD 4A6YB 3H9YA 1GGIH 3CFBB 4GUPB 3DI2B 1MFNA 4YNYB 4X5XB 1S7WA 1MJJA 3HI5L 3WLWD 2R1XB 3NIFF 3LAFA 3DIFA 4GAGL 4ODHL 4H1LG 4P9HH 2Y23A 4BZYA 4F7TB 4B5EA 3PWPA 5J3HC 3U1SH 3EJZC 3UROR 4LEXL 1KUMA 4ZUVB 1R3JB 3D3VE 3BI9X 1P4LB 3MCLH 2XZCH 4IDJH 4F7PB 3UBXG 2VDQH 3QHTC 5INDB 5DURD 3BZFA 4Q0XH 1IZKA 1WFOA 2A83A 1WF5A 1IBGH 3WIFB 4OFDA 5T3ZL 3RWIA 2ARJB 3JTTA 5I8OL 2PETA 4EDWH 1X6LA 3L3KA 1NFDF 4MNQE 1SQ2N 5E8EB 1T83C 4MLIA 4ELME 4JFFA 5DFVD 4QYOA 5IFAL 3MRLB 5HYJB 2GITB 1XR8A 2HKHL 4MCYB 4BJLA 3V6OA 5E6IA 4C55A 4EJ1C 1UKQA 4H1LH 1LMKA 1BFOA 1YNTB 3X3FH 1QBLH 1NC4A 2W0FA 3MYJA 4HS6A 4DQOL 4HGMA 3DUSB 5TGBA 3BZEA 1I9JL 5HHPB 3RIFF 4PB0H 4L3CB 2FZ3B 1F3JA 5DJ8B 4N8VB 3BX7C 2DI9A 2EH8L 3MA7B 5J4MA 4KV5F 4ZXBC 5BVPH 5C8JA 3QUZD 1A1MB 1BOYA 1IGTB 1TCRB 1DQJA 5J3HD 1J8HB 1JJUA 2FGWL 3DSNA 4K8RH 4P46B 2IBGA 1CLZH 1OOAA 3W39B 5E5MA 2HLFC 1NEZA 1WWBX 3MJ9A 1AHWB 2LABA 2XZQL 4OCYL 1JGLH 4HFUL 3QWOA 3RL2A 4LSQH 4RGMB 5DJ6B 1L7TL 4JFDD 3X3GL 1N6UA 2ZNXA 3BGAA 5I1LB 1C5DB 4EOWH 2A77H 1YJDC 4BH7A 1RUMH 1MJ7L 2LVCA 2D7TL 4CU6A 1S7TA 4JDTL 4Q6YA 1MPAL 5HY9A 5C0BA 4NRXA 3IDYB 3SKMA 4LVNC 4MD4B 4UIMB 2ZSWA 2Z8VC 5L9DL 4OZHF 5BS0E 4U1SB 5GRWA 1IQWH 5HD8D 4HS8H 1I1AD 4MXWL 4YH6A 5ANMA 2XQBL 4XNXH 3KPTA 4PJDE 4OQTA 4Z6AT 3QDJA 5H94A 5DYOA 2VXQH 5CJOH 5DMKB 2AEPL 3KYMA 3SCMC 1T1WB 4L4VD 4GFTB 5SX4I 9CGTA 4OD1L 4ZXBD 5GZOD 3DV6A 1A6ZA 1RV6X 5I1CL 4JRYB 4PJFB 1N2RA 4Z0XB 3LOWA 1BM3L 2PO6B 3CMOL 3KWWA 3O6FA 3P0GB 2R15A 5FDWB 2IANB 4WY7H 2KL6A 4AY0A 1YEIH 2MTPA 2J7LA 4UV7L 1PBYA 2YPLD 4KI5D 3VFNB 1SVCP 1VKXB 3BEVA 4LEOA 4DKFH 1WAAA 3ULUL 3MODL 3CK0L 1CFVH 1U2HA 1LO4H 2HJLA 5D1ZA 2AJSL 5EO9A 4LLYB 5GS2D 1FE8L 3B8SA 1BZQK 3VXUB 1AGEA 3RUGF 4EI5A 4YPGB 2V17H 1DFBL 2D31B 4JKWA 4DTGL 4I9WE 4Z7UB 3GIZL 2Q6WB 5JW3L 4N0CD 4YHPA 2YWZA 1W8NA 4MDIB 1ZGLM 1VHPA 4HD9A 1FNEB 5FO8B 3CX5K 3STZA 2H2SD 5SX5H 1W72B 1RZGB 3MV7E 4OT1H 2FYYB 1Q9KA 5AZEL 1NGYB 1T3FB 5IJVB 4HIEA 5GS0D 2DQCL 5KSBF 1AQKH 2D7MA 3R06A 4ZQKA 5KVMC 4OV5B 2YMXH 5FA3A 2HTLC 3WHE0 1S7RA 2NR6D 2WWKT 5AUMB 1I9RH 3B9AA 1KPUB 4MZ3A 3QCTH 1QR4A 1P7KB 3HMWL 1QO3A 2EDHA 1ZT4B 1KCRL 2VR5A 4M1CC 3RGVA 4P23D 4PPTA 1NFIB 4PJ7A 3BKCH 1VGKB 1MWAB 3UPCA 1A6VL 3MGTA 2PW1A 5ALBL 3VXSD 3GK8H 1I7RB 4F2MA 2VDRH 43CAB 4FS0A 1LDPL 2E7LC 1KC5H 1AKJA 5IQ9A 4WWKC 1INEH 4JZOA 4FP8L 5FKPB 4GKNA 1O7VA 3G6DH 3VFVA 4M3JA 4YHLL 1MLBB 2FLBT 4LKCB 4N0UB 5FHAL 2OL3H 2HT3C 2ZJSL 3W9DB 3F12A 4U6TA 3QB7C 5D70L 3QFJB 5GHWL 3ARFB 1CDYA 1ZT1A 4X9GA 4PB9H 5DD5H 1IGFL 1XF4A 1KLUA 4TULH 1JF6A 2F53A 3O0RL 3DXAD 2HTLD 2PTVA 2IPUG 1IAIM 5DVNA 3UCRA 4NZTL 3DYOA 5SWQB 1KPVA 2YSSB 3FCTA 3WIHH 2R4RH 5J8OA 1DBKL 3TO4D 3QEHA 5SWZE 3HC4L 3RTQA 3CDCA 1CGVA 4P5TB 4X6CA 5ID1A 5JA9A 4X8JA 3KPOB 4N9OB 4LHUG 1RHHB 2G5BA 2FATL 5GJSL 1KACB 4YXKH 2EKJA 5I16A 2V2XB 5KSVB 2DYPA 2CDFB 4JRWA 2OSLB 3T4YB 2DRUA 4HPOL 3IJSA 2GEEA 5ADOL 5F9DC 4M1DH 5IEKB 4LPUA 4AG4H 1K6QH 1Y0LA 3VFMA 3I6LE 3WFBL 1MLCA 3NH7H 5FFLA 4NKMA 1YDPB 3JV5A 4YR6B 3SE8L 5TDNB 2LAAA 4FQIH 2P7TB 1XMWA 4ONGL 2HT3D 1HXYA 3O3DB 4WENB 2ITDB 5T3XH 2CMRL 3D3VA 4GBXB 5DHVB 5HHXH 1U42A 1JK8B 2BHYA 4CADB 1SM3H 4MCZA 4CW1A 2IBZX 3L3JB 3AFLA 3DMMA 4XWOD 4F33A 4JQVC 3MLXL 1U92B 5KG9A 2NX5E 2AKRA 3BP4B 4YDVA 3BQUC 4PGDA 3L95B 3FAWA 4H20L 5HJ3B 3SE9H 4JQXA 2XXCB 1ND0B 3VD9A 1BJ1J 5GGTH 4MNQA 4HZLB 5EA0H 3MZTA 3TP4A 2JCCF 1HZHL 4LCUB 3U36A 5D1QB 5FYLH 4YHZL 2FX9H 4D9QD 4PRBB 4PG9B 3MLPA 1WV7T 2DQFA 3C60D 4OQTL 1EUTA 4EBQL 2M26A 3RIAK 4Y4FD 3GRWH 2PCPB 2Z92A 2FEEI 1V3JA 5D4QA 1V7NH 4BFBD 3CDFA 4YBQC 3VGEA 4L8BB 2O61A 2QHRL 5IVOA 5IESL 4RFOL 5D93C 4QRUB 3C8DA 5EU6E 1EPFA 1W0WA 3GSUA 1JL8A 1TETH 4L5FL 4L8CA 3O8XC 1ZGLA 2AQ3A 1A1OB 4F57L 5DD1H 5HYQA 3IVKB 5B22A 1JGUL 4R26H 1WCBA 2CGRL 4M6OH 1H5BB 3GMPB 4XC3H 3HFML 3SGEH 1CG9A 2HFGH 3VXNB 5DJAB 1HIML 1NKRA 1G6RA 3CC5B 3QUMH 1GC1H 2YK1L 3BGFC 2BNUA 2OR9H 1HEZB 4LLDA 4FQXA 2YD7A 3ME0A 1DBBH 3ARPA 4MJ6A 5BS0A 5CAYB 1UWGH 5C0CD 1BD2D 3GBML 5D5MB 1IGIL 1KT2B 4TSAL 3IDJA 2Q76B 1FVDA 3UTTE 1CIUA 2BSTA 3BOVA 5CJ8A 3MFFB 4PJDA 5K9JH 2V2TA 2XWTA 3RQ3A 1KXVC 4YBQD 3BE1H 5C92A 1MHEB 4X6FA 2Z4QA 3BD4A 3P11H 1B2WL 4IIQB 5DJ2B 1IAOA 1T7XA 2OJEA 5DK2B 3EO9L 2EKSA 3MRGA 3C08L 3MZGB 1LO2H 1K3ZA 1FC1A 3B6SB 4R4FL 3SE3A 4K94H 3NZHH 4LFHD 5DRNB 1I7TA 4ZUUB 3CX5J 5HYIA 5AYUL 3WMSA 4POUB 2VLKD 2VYRE 5IBUB 1UA6L 3LKSB 4G8GD 4WHYG 3FN0H 4XTRD 3HNVL 1FDLH 4YHOH 1JMZA 2OP4L 1HK6A 5DJ0A 5E99L 3CXDH 2B39A 5CEZL 1XF1A 4DGIL 1UM5L 2E6QA 1R24A 2DDQL 1YC8A 3A67H 5GRJH 1FHGA 5I1GL 4L9DA 3VXMD 3O6ML 2W91A 4P57A 1MVUA 3GM0A 5TJWK 2D4FA 3RPIA 2VDKH 4H5SA 3DVGB 3P0VH 3IXAB 2NMSA 4JCLA 2BY0A 5CUSL 3MV7A 3EOAB 4MAYC 1DQDH 1VDGA 4I0PA 1RUKH 3IGAB 3DX7B 3BKYH 2YA1A 5LBSH 3T0XA 4G3YL 2AJXL 3MLVL 4TPRL 2D7PA 1A0QH 1CLOL 1I4FA 1ZV5A 4NCC2 4PBXA 1N6QH 1RHFA 1I3GH 2VDOL 3LPGA 3NFPB 1QFPA 5ELIA 3RVUC 1DEEB 3FQXB 1G7IB 3TVMA 2XZZA 5D7LD 4OLYH 4EN3C 1DQQA 3AAZB 3SKUD 2E8ZA 5LGHH 2MCPH 4P9HC 1OW0A 4ZAKB 4S0TD 4HJ0C 2P8PB 1FH5H 3W0WE 4WI4A 1M05A 4IRSB 1VACA 2J8UE 1UENA 3I3EA 3FO2A 4OCSH 3TA3B 3MLUL 4OBSA 4APQD 3U0TB 3WKNA 1PKQE 4D9RE 1C8PA 5L0QB 2UWEF 4X4YA 5IK3A 1KCVH 2J5LB 3FB5B 3QIWD 3HRZA 3LN4B 3OJVC 1JNLH 1RIHH 3CXHK 2WBJD 5C0GA 3TNMB 1DQTA 1T1XA 4NFDA 5FUZH 3S37L 1YECH 1MCNA 2YR3A 4JAMB 4YO0A 4LF3B 1FVCA 1S9YA 4Y19D 3EYSH 1UZ8A 3Q5TA 4MLSA 5IVXA 3BH8B 2XNAA 1FNGB 2L7JA 4ODTL 5SWZA 1WBXA 3CDGA 5HBBA 2Y06H 4J3OC 5GZND 3ARRA 1DP0A 3TBSA 4JZNB 4TVPD 1N4XH 2Z91B 4XPTL 3FRUB 4ODWA 5C0DA 5J1TC 2NY5H 3WFHA 4HMDA 1LE9B 3K2UH 1EEYB 3DURA 2HT2C 4Y89A 4K8RC 2WK2A 3THML 3U4BL 1SY6A 2Z31C 2XI9A 4F7MB 5DMJB 5ISZB 5D6CB 1MQKH 4OZFG 4XXDA 1JV5B 5CP7A 2X4RA 2DLFL 1YMMB 4BH8A 3BT2H 3M8OL 2VKXA 4EDXA 5IKCA 3AU1B 1EEZB 1FV1A 3N1QC 4R4BB 3RP1A 3F62A 3RU8L 4WJ5B 1D5MA 3O3AB 3FFDA 1NCAL 4P48A 1PLGL 2OZ4L 5F7KC 1JNHB 5KVFL 5DQ9B 2CD0A 1E4KC 5IOPA 4X4XA 3QXDA 1IEAB 1VGEH 3TYFA 1PYWB 5MHSE 1MFCL 5E2VH 2V7HB 4K2UL 5F7MC 2NX5A 4W4OA 4TTDC 4F37K 3ZHLA 5I1AA 2VZSA 3FMGH 5FYKD 1A7PH 4XC1H 2VIRB 1S7XA 4HF5H 4UT6H 2C7UB 3ULSB 1IC7H 5FM4A 1INDL 3PE9A 4OZFH 1JPGA 1F8TH 2D0FA 1ORQB 1HKFA 3QNZA 3RX5A 1R3LA 3TF7C 5DQDL 4DUVA 3CLFL 5I75B 4MMZC 1LE5B 2GI7A 5IMMB 3OKNA 1G9NH 4PJ8D 1S9WB 4K3EH 1NMBL 4J8RA 3MBEC 2ZUUA 4GRWE 2FEDC 5EBMB 1B88A 4PG2A 4FHBD 2CK0L 3SDAC 3AREA 3VFRA 3RL1A 2CJUL 5EU6A 1IAKB 4BQ6A 4QRRA 3QP3A 5F9WC 5TE6H 3SCMA 1EAJA 3EGSB 1SBSH 3MMEB 1I85C 3GMOB 1C08B 1YNKH 4U1JB 4NNYB 3NFSH 1YMHB 2VAAA 4FFYL 3SDYH 3U0WH 4A6YH 4NBYB 3BYTA 2X5PA 4BKLB 4TTDD 3HMXH 4MA8L 5MENE 3RNQB 2DAVA 1F4XL 1MCWW 2WP3O 1SEQH 3H3BC 1JVKA 5E56A 5F1IB 1UZ6F 1ZLWH 1OWWA 3X12B 2OTUA 1XGRA 1I8IB 1XF3B 3ZL4H 4P2RB 3BPLB 5F6IC 3QJFB 3QDHA 4BFIA 4XPBH 4NO0A 2QSVA 3VRJA 4Y4KB 4N8VG 4ZUSB 5KVEL 2A9NH 1DZBA 1JE6A 1L9MA 3FO0H 4XCCH 1RJLA 4P4KB 4G5ZL 4IM8A 3UTTA 2LTQB 5GGQL 4XT1C 2DIJA 1WVZA 2DQDL 1MCOH 4YDIH 1YEJH 1NJ9B 12E8L 5GS1C 3L1OL 5D96C 1EO8L 2AXFB 1ADQH 3O3EB 3SDAD 2H41A 2EH7H 2Q86B 5LJYH 4HHAB 3BDXA 3E3QC 4U31A 2LU4A 5JUEH 1U8JB 5J06A 2YA0A 4XBGA 3U82B 5D2LF 3T77B 4YIQB 3GKZA 3MXVL 4FQJL 1U95A 4TNWF 1PSKH 2COQA 1S5IL 2AJYL 2I25N 1JF1A 3IDGA 1RK0B 1F4AA 3BPCA 3WL9B 4FNLH 1UVQA 3B9KD 2XWBB 5EFIA 1NAML 2VLME 2XN9B 1T04B 2W65A 4E41B 3BIAX 5DO2C 2NZIA 2ZCLL 3O2DA 1CK0L 2KQNA 4LCYB 1TXKA 1Q94B 2NY6D 2GTWB 3I9GL 3MRKA 3L5WB 3QA3A 4XNUL 4OD2B 4P2QE 1QKZL 5ABDE 4EXPX 3FZUC 4GKZB 2HT4C 3FB6B 2B0SL 2E7LA 4Y16D 1MHCB 3QRFM 1F6AB 1OAXL 2MSPA 1L4IA 5HGDA 3ULVL 4NO3A 5FUOL 1I1YA 5IMOA 5EIVA 3FN9A 3O9WB 1DQMH 4XCEB 4JFED 1UQSA 2FL5A 1ZA6A 4XVSL 3ZE1F 4LCWB 1CXIA 3WS6C 3P9LA 1MCDA 4XVJH 2DTSA 1DUZB 4L4TE 2CDEB 1ZLVH 3H9SB 3MLRH 2R69L 3QUYB 4KJQC 3QAZC 2E27H 3CXHJ 4PRID 4XZUB 4Y8AA 3QIUC 4PRNB 1F4WL 4PYGA 2RR3A 5KAQF 5AAMA 4V2BA 4JY5H 4KJWD 3ROLB 1A47A 3MRMB 4PJIB 1DLFL 4BUGA 2V9TA 4PRAA 5JO5B 3W0WA 3KLHD 5MI0B 3MRCB 3BGMA 2J8UA 2DQUL 2O93L 2EDDA 5EU7C 3MREB 4ERSH 4JDVB 4PS4H 1AY1H 1PKQA 4QOKD 3VCLA 3MACH 4AK1A 1Z3GL 3NCJH 3QEQD 2Y36H 4DN4H 1AO7E 3FZUD 5E5RB 3QNYB 4JHWL 5HPMB 3PWNA 1U3HB 3UC0H 4EZMA 4HKJB 5IF0A 1EHLL 5FO9B 2RAMA 2V5RA 1KIPB 8FABB 3KPSB 1AXTL 4PTTA 3TPUB 3BKML 1BIIB 2HMIC 3LQZA 5F97E 3RWEA 2ADGA 2NYYD 1BQLL 4LASH 3HR5B 4LSVL 5K9OB 4TQEL 2E7BA 5T1DL 2ARJQ 3IKCA 5E2WH 5ID0B 1I75A 1ONQA 4I77H 1W72H 1IQDA 2ZUQB 4LAQL 3BQUA 2NW3A 3G5ZA 3T1FA 2BC4A 5C09B 4WI7A 4UBDC 4LVHB 3QNXB 3T2PA 3D0LB 1JHLH 4AEIH 2XV6B 4G6JH 1UWXK 4QRTB 3GMMB 3BWUC 4AJ0A 1DSFL 4HULB 4JFPA 3ROOA 2C1OB 1RZJH 3F6IA 1KIUA 3M17A 4RZCB 4OZ4A 4O4YH 1MREH 3H0TA 4M1GL 3T8XA 4PJHB 2IH3B 1XCQB 2CLRB 1GC1C 3VDCA 1M7IB 1WCQA 3FB7A 2I27N 3S88L 1MWAH 4DUXA 4NZUH 4GQ9L 1AFVH 4NC2B 1P7QD 4NQEA 3CZFB 5GGRA 2EC9U 4JVPA 3TV3H 1XH3B 3WXWL 1GOGA 3O8XA 5TE4H 2FECI 4YFLF 3IDIB 2DI7A 2HMID 4IS6A 5DFTA 3X17A 4M61B 1U8NA 1ZVSB 1ZHNB 1S9VA 1IFHL 4PP1C 1LP9F 5DQJA 4OF8A 4JHAH 2H2PC 5I9QB 4Q58C 5MP6H 4HIHA 1D5IH 3LRSA 2WIMA 1A2YA 1WBZA 3TBTB 1CD9B 4UBDD 2CDGB 1MCPL 5T5NG 5BMFH 3D25B 3PJSA 5EBGA 1FG2B 3LB6C 4G8FB 5FGRA 3HUJA 3MA9L 1J87A 1NLBL 3LKQA 4MNGB 1J0YA 1KB9K 4K94C 1WBYA 1JNNH 5JZ7D 1L0QA 4NWUH 2EEDA 4YFDB 4E42A 1P1ZB 5GJTL 3WNNA 4FRWA 4C59B 2V9RA 3FQTA 2B2XL 3OF6D 4JFZL 3U46A 1QA9A 3OGOE 3FO9B 2ZP0T 2N1KA 5KS9E 1QSZA 3STBA 4OZGA 4GS7B 1UM4H 3LMJL 4OAWA 1GGCH 5BVJB 4U6YA 4FTVD 3VFSB 3PXJA 4PREA 4WW2F 2FO1A 4FQQB 5CJQH 5IB3B 2WUBL 3E3QE 3VD7A 5DR5H 4OKVA 1U8KA 3AB0C 1PG7W 5KJRH 1EJOL 2GW5A 3IXTA 3TBWB 5KN5A 1ZHLB 5MENA 1HQRA 2PYEB 3Q48A 3ARBD 1QLFB 1FNFA 5JDSB 5A3ID 4DK3A 4R97B 1HQ4A 3GHBH 1C7TA 2E6JA 2FH6A 2OTPA 4NJAH 1RU9H 5DHVH 1T0MA 1H3PL 4XRCB 3K2MC 4UUJA 1AD9A 1OD9A 5CIPA 2A6KB 2XG4A 3WN5C 3C9NB 4LLQA 3REVB 4R90H 1FYTE 2OLDA 3UTQB 1UB5B 4U7SA 2DLIA 4M5YL 4J12A 5F3BA 2F54B 2FB4H 2EE6A 1MIEL 1S7WB 1MJJB 4FZEH 4RX4A 4XP6H 5BZWA 4HUMB 3CX2A 4LSSL 1X6NA 1Q1JL 5F9JA 1ROWA 2AV7A 3PWPB 5JHLH 5KOVC 3BIBX 3CSYB 4MAYA 4Q9RH 1QTYT 1BOGB 5EC2A 3U0PA 4Y5VC 2K9UA 5DJXA 4ZPVA 2VDPL 1JPTH 3BZFB 4C56B 3HG1D 2A83B 5FYJU 1N64L 3RWIB 2HG5A 3JTTB 5ESVA 1CE6B 5CHNA 4G8IB 2HH0L 1OTTC 1QQDA 1MF2L 1H3VA 3IF1B 4X9FA 2EEBA 4LARH 3ZHDA 4JFFB 1A7QH 4EN3A 4QHUA 2VITA 3LD8B 4Z76B 4R2GB 2F5AL 2HA1A 5E6IB 3F5WB 5T3XE 3MRHA 4RDQG 3QPXH 4LHQB 4P2QA 1BFOB 1HYRC 5EU7E 5F7EH 2W0FB 1ZLUK 5KZCB 4HS6B 4JM2B 2R4SH 5F93C 1PY4A 3BZEB 4LSTH 4M6ML 3WSQL 2V7NA 1KTLA 1CDJA 3OWEA 1YN6B 2SEBA 4NQSA 3Q6FB 3TIEA 2E7CA 1F3JB 1FFPB 4NHCL 2B20A 3LRHA 1UFUA 2BSSA 4HUWB 5C8JB 1IM9D 3G6JF 1JN6B 2R1YA 5F89A 1DQJB 5IBUG 1TFHA 1KXQE 1TZHA 2NY5C 5EUKA 1NCCH 5I8KL 3VXPA 5E1AA 1DBMH 4L4TA 1NEZB 1S8DB 2DM2A 4NKIH 4ACPA 8CGTA 5C07E 5M94B 5FYLE 1E6OL 3RL2B 1LEGA 1RZFH 1U8QA 4K3DL 2XY2A 4RMVA 4HQQH 3QXVA 2NTFB 3V4PL 3NCBB 3V79C 4U6VH 4ZSOB 3C09B 1OTTD 2OK0H 3WO3B 4BH7B 3ULUD 3UBXA 1S7TB 2QLVB 2PR4H 5HY9B 5HI3C 4MGXA 5C0BB 5FCSH 3SKMB 4XAWH 2E6PA 2ZSWB 1C7SA 5GRUL 3W9EB 2A38A 1CLYH 1X5ZA 1QRNE 5CMAA 3ZDYE 4ZOBA 2KQMA 1AO7A 2Z31A 3U30B 4F7CB 4PRPE 5ANMB 5EIIA 2YEZA 3U9UA 3PNWB 3RBSA 3QDJB 1P4IH 5H94B 5DYOB 4DZBB 1E6JH 1T1ZA 2BRRH 4M7ZC 1ZANH 3WDHA 3KYMB 5IT2L 4M7KL 1ZEAH 1A6ZB 1UM6L 2XFXA 4O51A 3LS4H 5AEAA 4OGXH 3OXRA 2V2WA 3QO0A 1E4KA 4QHKJ 4Y4HC 4UAOC 1A6TB 1U91A 3KWWB 4JQIL 3O6FB 2XRAH 3DOSA 3UTSD 4JPKL 5L8LB 5F9AC 2QSCL 3LKOA 1G9NC 1VB9A 1NUGA 1FG9C 5JPMA 1IT9L 3N85H 4GMTL 3O3UN 3VWJD 2ESVD 5D1ZB 3RY5A 4JJ5A 5EO9B 3UJTH 4H0IA 1AGEB 3MJ8A 4EI5B 4L3EE 2F58H 3LN5B 4RGND 2RCSL 4F80A 1JRHH 5FCUH 2X89D 3AVEA 3GI8H 3OKLB 2EDQA 4YZFF 4PBWD 3UTPE 2A6IA 4YAQA 4C4KT 4HS3B 3SKJL 4MJIA 4L29B 3STZB 4KK6D 1A7OH 4M7LH 4PJBE 1CZ8L 1MI5A 3MBEA 2QADB 1RZ7L 3MLSL 3TNNA 5TF1L 3GMLA 4ORGA 3WKMH 2XYCA 4HIEB 4YDKH 1KB9J 3R06B 3EFDH 5HHOD 3MROA 4HT1H 1QBBA 5FA3B 5TF0A 1I85A 3U4AA 3O3BB 4U6XB 4XCNA 1BWMA 1DEDA 4P5MA 3CFJA 3QHFL 1CDBA 3MLYH 3O6KH 1AIFB 1H3TA 4QNPF 1XF2A 1N26A 4ONFH 5D1XD 2VUOA 1OPGH 3NN8A 4NZJA 2KZ1B 4CU7A 3IDXH 4XMPH 2PW1B 5CEYB 1OP3K 1G7PB 2BCKA 3T0VA 3LPWA 1C12B 3H3PH 1MJUH 2XZAL 4F2MB 3DETC 2YRZA 4KMTL 1GL4B 3TC9A 3IFPA 3L3GA 1T1YA 2R56L 1AKJB 1PQZB 1KJ3H 3MJ7A 1JUFA 4I3GA 3VFVB 3KPMB 4U1IA 4WDIA 2OYPA 3X14B 5KS9A 1EFXD 3ARSA 1ZWIA 2BSED 3KLSA 5J1AB 3BD5A 1PDKA 4JO1H 5DWUL 4MAUH 5D8JH 5GS1A 4TUKL 1ZT1B 5DUMH 4NOFA 3CFEA 2BVTA 5HHQA 4P46C 1XF4B 4P2YA 2BVEA 3U9PL 1KLUB 3CLEL 4WFHE 1AHWC 1QSED 2JIXD 5EG6C 3NZ8A 1SJEB 4S1SH 5HDOA 4RGMC 4ZS7H 1U6AH 3FCTB 1A6AA 3QEHB 4U1NA 2R29L 5IB4A 2ICWJ 1G7JA 3GSOA 4QXTA 5FAAA 5IBLD 5ID1B 4PLJD 3IKKA 1EMTL 2JELL 3IDYC 3O4LA 2DICA 1FYTA 2IJ0C 4LL9A 3ALPA 5I16B 2F5BH 3D0VB 2DYPB 1RK1A 4BM7A 1DBJH 3DLQR 1CD1A 2GCYA 2YD1A 4QHLA 4OFIA 4A2LA 3VFMB 1B4RA 2MFNA 2VZVA 4H88L 1FPTH 3WFCL 4NKMB 2IAMA 5DEGB 1NCBH 5E2JA 1XGTA 1KB5L 4AEEA 2DBLL 2AV1B 2GUOA 3WIHA 1AGFA 1HXYB 3D3VB 5TDPA 1VERA 2AJUL 3T3ME 3UPRB 1TJIH 5HI4D 2WLYA 3LZFH 4IJ3C 3TIDB 4MCZB 4CW1B 5A16A 3DMMB 3Q5OA 4M6NL 2DN7A 1IL1B 2PO6C 3WS6A 5KG9B 1PG7L 4MA7L 1JYXA 2AKRB 4HFWA 2P5EB 3FRPA 4PGDB 3FHAA 4G9FB 1I3RA 5KW9L 1NLDL 4MNQB 2NZ9C 1DANU 1PFCA 2ADJB 2W0KA 4NZDA 5F7DB 3JWOL 1PZ5A 4PYHA 1V3KA 1AI1L 3OZ9L 4YDJA 5C0JB 4XCYA 2VRAA 5CEXB 3G5VA 3PWUA 2DQFB 4OB5L 3KPRE 4MX7A 1UB6B 1UH4A 3TCLA 2XQYK 5JOFA 4O9HH 1J1PL 2AGJL 1OAYH 2GYSA 4OIIH 2O61B 2AAVA 2GT9A 4JG0L 1CR9L 5CKAA 2X4PA 3U4EA 4LHUA 2GY7B 4RMUA 5DC4B 4DVBA 4CDHA 3GSUB 2M1KA 5GGTA 4ZDHB 4L8CB 5HGAA 3SQOH 4NGHH 1YPZE 2A1WL 2R8SH 4Z0BH 1SYSA 4Z78A 4NQDB 4RQQA 2E7MA 3MR9B 1RZJC 1CG9B 2O5ZL 2PO6D 4FOMA 5C07A 1OP9A 1JGVL 5DMGC 1QSFE 4KKCC 3B3IB 4S2SA 1YQVL 1G6RB 2APWA 4FXLA 1LEIA 5IBTH 1HOCA 3PDOA 2BNUB 4HBCL 4LLDB 4BSWA 4I2XA 4FQXB 2VMFA 5GGVH 3CZJA 4DK6A 2CRYA 1KBGH 5DVKA 3JVGC 3VXUD 5DLMH 1QRNA 5I1JH 3P4OB 1BJ1H 1OM3H 1FVDB 4WUUE 4XHJC 2B4CL 4PRPA 1AH1A 4UQ2A 3RKPA 3VWKA 4PJDB 1K3IA 4KQ4H 7FABL 5CBEA 3TM6A 4XP1L 3RA7H 3WNOA 4PLKD 5DTFA 2P8MA 1TVHA 5TPWH 2DL9A 3MGOB 1IAOB 1MFEH 3ARFC 1V05A 5TH2A 1FGNL 5C2BL 2EKSB 3MRGB 4G42B 4ZFOL 3C5ZD 5IQ7L 1I7TB 4JGJA 5JR1H 3RWFA 5EUOA 3IU3A 5DJDB 5I8EA 3HZVB 2AJZB 2J8HA 3T1WA 1BFTA 2JCCA 3PQYA 3HI5H 1GZQA 4FQHA 4P5TC 1OAUL 3BDYL 3DHMA 4ODHH 1FLRL 3V6FA 2DM7A 3O81A 1ZA3A 4L3EA 5HYJE 2VTFA 3MRPA 2EXWD 4WHDA 5I74B 5B39A 4X4ME 2Q8BL 3ORJA 1EZVX 1HDMA 1MVUB 3GBLA 4MB3A 2ERJB 2PF6A 3VFOB 3MV7B 3ZHKA 5C0NC 4I0PB 3VXTA 4GBXC 4Z7NF 1VA9A 4GG6F 4OZIB 4NKOB 3ZKXB 3MRRA 1CVSC 3ARZA 3QEGL 5IFAH 5ILTH 1KNOA 1I4FB 1TVBB 1J8HE 4WO4D 1MAML 2HKHH 4L9LB 4PJ5D 4NQUA 4YHNA 1FN4B 2QQNL 1H9VA 4OTXL 3X11B 4LP5A 1S7VA 5T5FH 1MRCL 4JKLA 4DQOH 1I9JH 4P2OB 4Y2DC 2WBKA 1DQQB 4FQPA 2I24N 1DDHB 2EH8H 3P40A 3RIFK 2FBJL 3FT4A 4NYLA 1VACB 2FX8L 1VESA 5D1QC 1NAMB 3EYFB 3FO2B 4DAGL 4NM4L 1KEML 2YXMA 4Z95L 4X4YB 4NDMA 1VENA 5IK3B 1H3WM 3T08A 4AT6A 2XZQH 5B3NA 3L3OA 4M5ZL 3HRZB 4HJGA 2JLLA 1BMGA 3TZVA 4OQ1A 4UV4H 3X3GH 2O5YL 2XY1A 4RCAA 1Y6NR 1DVFC 2E7HA 1KCUL 1UXSA 2D7TH 4JDTH 4YO0B 1MPAH 3PWJA 4OM0L 1H5BC 4JRYE 4RWYL 3TN0A 3BVNA 4PJFE 1UZ8B 4QTIL 4Y5VA 5L9DH 3L9RA 1NBQA 3LKRA 5IVXB 3F7VB 1EDQA 2CKBA 1KENL 2DKSA 4MXWH 5SWZB 3ZTJG 4X7TB 1NGPL 2IANE 1CGWA 4OM1H 3RNKA 2XQBH 3CDGB 1U8OA 1F42A 3LRGA 3KXFD 3OHXA 3PWLA 3VRLE 5C0DB 5K59E 3HB3D 4CMHB 4OD1H 3N0PB 3DURB 1RJYB 2J6EL 2Y6SC 5I1CH 3A6OA 3EUUA 3N06B 3VFPA 3U83A 3NPSB 4RIRA 3QFDA 2BVUA 4B41A 1T66D 5IEHA 3SPVB 4GW5B 2X4RB 5FDYA 3S96B 3IS1X 4Z7UE 3OAYK 5DEZA 4KUCF 1U41A 4EDXB 3LPFA 5CS7A 3UO1L 3REWA 2GJ6E 4UV7H 1BVLB 4IIQC 3LV3B 1D5MB 3IJHB 1FAIL 2FR4B 3MODH 3CK0H 1K8DB 1UXWA 4S1QL 1NCDL 5IOPB 3ZTJH 3EYVB 1FE8H 1I1RA 3QUZA 2EO1A 1ZVHA 1TQBB 3SHSA 5E9DB 1DFBH 2O5XL 4DTGH 2Z93A 3GIZH 1YPZF 4N0YL 4Y8DC 3VXQA 1NDMB 1S7XB 2J3SA 1KSRA 3LKNB 1CL7I 1EX0A 4JG1L 5F6HJ 5GRZA 2NY3D 1PY9A 1JPGB 4JVUA 4JFDA 4WU5A 5AZEH 1R3LB 3FFCD 2OR7A 4DN3L 3U79A 1U58B 4HUVA 1A4JB 2WIIA 4MMXC 4MYWB 4G7VL 1QYGL 3KPRA 3OKNB 4KDWA 4MZ2A 1GOFA 2BNRE 3D2UD 5LXGH 4Q97A 5AWNL 3SDCD 4RFEA 3PG2A 2CQVA 1CFSA 3MRJA 3INUL 5EN2B 1CBVH 1WFUA 4GT7A 3V5DA 4KZDL 1ZK9A 1I1AA 2DQJH 3AREB 5GSRA 3WEXA 2DWDA 4P59L 3S97C 4UTAL 1KCRH 4QRRB 1BJMA 1HINL 3PGDA 4HGKC 4N0UE 4QLRA 4OGAD 1V5JA 1WWWX 3QFJE 2VQ1A 1WC7A 1A6VH 4OZFA 3VFUA 1HCFX 3PUCA 3QEUA 5ALBH 4WNQA 5DMIL 1IGJA 4OFVA 5JW5A 2ICWB 4Y4HA 1QSFA 4NQCA 4LCCA 3MUY1 2HFEA 3QUKA 1J0KA 4F8QA 4KXZI 3LEVL 4ZAKC 4YHLH 5AYQA 5C0AB 5IB1A 4RGOL 2LE9A 5FHAH 2YPLA 4GJTB 4BFIB 3BEWA 4NO0B 3OBAA 3VRJB 3KPPA 4IRSC 5D70H 5GHWH 5B4MC 2VZUA 2JJTA 3TA3C 1BF8A 1IGFH 2EICA 3RVVC 4LMQE 3CUPA 5I1EH 4NSKB 4WUUA 3UTTB 4EI6A 4OLUL 4UINL 3O0RH 3H8NA 3AROA 2J5LC 4KKAD 3AGVA 5CJXC 4GUPA 1C5BL 1NEZG 4NZTH 4YNYA 3HMXA 5B21A 1NGWA 1AQDA 5T1KB 1DBKH 1JCKA 4PJXE 3HC4H 4F7TA 4LSPL 4HWBL 3HE7A 5ICYA 3MBXL 1R3JA 1KCLA 1KJMB 4XBGB 2Y72A 2QR0B 2AJ3B 5INDA 4XBEL 3NCYS 2NXYD 1N3NB 5A43C 1UADC 1U8PA 2NLJB 4UIKH 3RZCD 1T03L 4FQLL 3Q3GA 3OKOB 4HPOH 1JF1B 3IDGB 4MD0B 5GGSY 2H6PB 3EHBC 3B2UC 3I6KA 4FMKA 4TYUA 3E2HB 5EFIB 4LSDA 3SE8H 4K7PX 1VFBB 3DROB 2W65B 4WEMB 1FZJA 4Y5YB 5BOZG 1IAIL 1QFOA 4R8WH 2CMRH 4IRSD 3MRKB 3MJ9H 1T89A 4WEBL 3TA3D 1G9MH 4NJ9L 3ZKND 4WUKL 4X4MA 1A6WL 2F15A 3MLXH 2HVKB 1X5KA 5CKGA 3DUSA 1QVOA 3CFKB 4NO3B 1XGPA 1T0PB 4OCWH 4H20H 5TDOA 1UYWL 3MA7A 5H37G 2RQ8A 2FL5B 3RVXC 1IGTA 2BRQA 1TCRA 4PY8I 3P9LB 1J8HA 2CKBL 5CLTA 3QI9D 4YHZH 3W39A 3C6LA 2AK4D 1JPFA 1AHWA 4LSRL 1NQBA 4OQTH 4NNPL 5HSFA 4B7IA 5I1IH 1I8MA 1BQHB 3NFNB 3IAPA 1MCRA 3EHBD 2MQ3A 3RPKA 3K46A 4O02L 4RFOH 4M3KB 3TO4A 4U3CA 1NMCB 4KPHL 2J8UB 4LPCA 3MNZB 2HKFL 4L5FH 2B8OT 5I75C 1PKQB 4F57H 4V2CB 1BWWA 1JGUH 2CGRH 5MEOA 5ISZD 4U1SA 3V52L 1ORSA 2F19L 1RZIA 5D5ME 5H37H 5C0RH 2YRPA 3AXLA 4NFCA 4WV1B 3PWNB 4LCIL 1IARB 5DHYA 4LIQL 5ICXA 5DMKA 3TH2T 4NM8L 5ENWA 2YK1H 4O2EA 1T1WA 4MD5B 2Z0BA 3FO1B 5I1KL 1VCAA 2EDFA 1Y6MR 4LP4A 4JEGB 4M4RA 2P8LA 4PTTB 4JRYA 2FEEL 4PJFA 3RWEB 2YZ1A 4Z0XA 2OJZH 1BJ8A 3GBMH 1WT5C 3HLAB 1IGIH 1JZ6A 3UMTA 4AIOA 4TSAH 3IKCB 5FDWA 5JORA 5CINH 1MCJA 5HGGS 3DWTA 5D7SL 5CZVL 4LOUD 2NW3B 4X9HA 1JGDB 1F4YL 3BP7A 1MNUL 5CJBA 2BC4B 3T1FB 4C57C 2EDXA 3BPLC 3QDMB 3L3IB 4BSVA 3R8QA 1B2WH 4Y4KC 5I1HL 3EO9H 3RWCA 1GAFL 3ROOB 4X98B 3GO1H 2AW2A 3C08H 4P4KC 2LTQC 4XI5D 5L2KB 1WEJL 2FIRT 4KRNA 2D31A 3KJ6L 4WCYL 3BP6B 4LDLB 3U2SA 4RNRA 2Q6WA 3SN6N 3H0TB 3T8XB 1DL7H 2GJ6A 3C60A 1F90L 4OFYD 4K71B 5DF0A 5FO8A 1A3LL 3FB7B 1UA6H 1T80A 4QTHB 2UY6A 2ENYA 3ZDZF 4PRHD 1T6WA 3B4NA 2Q8AL 2B1AH 4NQEB 1JTOA 3ARDD 5GGRB 1AGDB 1NGYA 5DMYA 5IJVA 1KFAL 3UYPA 5CEZH 4U4BA 4DGIH 4OV5A 1ZS8B 4IS6B 1UM5H 4KDTC 4Z7VB 2YD5A 1U8NB 1QRKA 1CFBA 4KJPC 3O6MH 4I13B 2BFVL 4GRLD 4HIHB 1P7KA 1K4DB 3LRSB 3U7WH 2ZPKH 1ZT4A 1BZ9A 3OKKA 4YHIA 3JV6A 4WI6A 3S8WA 1YJDL 1NFIA 3QDGD 5C0FA 4CVWA 4J6RL 1MWAA 4G3YH 3HUJB 3MLTA 2AJXH 4WU7A 3MLVH 2X09A 4TPRH 5EOTB 1HXMA 3JVGA 1WBYB 2X4TA 1CLOH 1JWMA 43CAA 2BNRA 5F1NA 3I3BA 2EE9A 3KVQA 2YBRA 4HXBH 3PGCB 5C0CA 2MJWA 2IADB 1EIBA 2VDOH 1FCGA 5FK9B 3S34L 1QA9B 3W11C 5C6WH 5FKPA 4WTWA 2UV3A 3WDJA 4OZGB 1EZVY 5HDBE 4X6DF 3O9WC 1MLBA 4OAWB 1HNGA 4LKCA 4RA3A 3SOBL 3W9DA 3STLA 5DC9B 3QFJA 5GS0L 3ARFA 2YD3A 3MXWL 5IJKC 4ZG1A 5D7JD 2XKNA 1FO0L 3MRDB 2P5WD 4XHQA 1VFAA 4JANA 3MLUH 3E8UL 3QUYC 3IXTB 5KN5B 3SDDD 5FIEA 1A14H 3NCFB 2YUXA 3TYGL 1YEHL 4KJPD 5CZKA 4CJ0A 2DWEA 2YSSA 3NAAH 5L6YL 1HQ4B 3HNSL 2GAZB 1T0MB 1CTNA 1QFWH 3KHQA 4UUJB 1AD9B 1OT1A 2HRPL 5CIPB 1P4BL 4I18A 2EZ0C 3S37H 1RHHA 2UZYB 3KPNB 2V2XA 1TJHH 2V5TA 4GW1A 4J4PC 4BZ1L 2R0ZL 2CDFA 3UAJD 3MJ6A 3T0ED 4QO1A 1B3JA 5BZWB 5IEKA 2P42B 1U3HC 1YMME 4KC3B 5F9JB 3VXMA 1N5YL 4ODTH 2AV7B 1MFBL 1ZMYA 4PJXA 2W59A 3PL6B 4M7JL 2XPGB 4L1DA 4MAYB 4N5EC 2W9DH 4K07A 4XPTH 2ITDA 4ZO7A 5EC2B 2X1WL 3SDXF 4OLXL 5DJXB 1JK8A 4JPVH 5KANG 3PHOB 2W92A 1LP9A 3L3JA 3THMH 4HZAA 3U4BH 2DB8A 1EGJL 2PXYA 3QUYD 3O41A 3ARYA 5D9SA 3BP4A 1JZ5A 1A6PA 2ZUQC 3M8OH 2MQ0A 3L95A 43C9A 1KXTB 4UNTA 2PW2B 1ND0A 4LVHC 4Y2DA 4YPJA 4HZLA 3RU8H 2B5IB 2EYTB 5T1MA 2YPVL 3UEZA 1NCAH 4NUGH 3MRHB 1PLGH 2OZ4H 2EZ0D 4RA0C 1ACZA 4PRBA 1REIA 1MFCH 5FXCH 4K2UH 1G6RH 4J4PD 5CJ5A 5I73B 1KTLB 5IW6A 5EC1B 3WFEL 2SEBB 3QG7L 4NQSB 2PCPA 5EU4B 2OX5A 4HMEA 2BSSB 4L8BA 1XIWD 3PGFH 1TZHB 1INDH 4N5ED 3VXRD 3ARGD 4O2CB 5EUKB 2Y5TB 2K7QA 3WFZA 6FABH 1DVFA 4R0LB 1A1OA 2K3TA 3GFUA 1HHHA 1T5XA 2WUCL 5DQDH 2UZIL 3CLFH 3GMPA 4EIZC 4QY8B 1U8QB 4AEHL 3F7YA 3WUWB 5I9QC 4MA3A 1NMBH 2P48B 4X8XA 1JHKL 1KV3A 3MRIB 3ZE2E 3G6AA 3KYKL 3UTZB 1G7HA 2DQGL 1UEMA 2CJUH 4P2RE 1QZ1A 1YYLL 3B43A 1AR1C 5JW4Q 4FFYH 1AD0A 5D5MA 2NY4B 4UDUA 4HGWA 3EFFB 1KT2A 5EIIB 2Q76A 1CF8L 1VFUA 1FORL 5JHDD 3MFFA 2WWMD 4XMLL 5K9QI 1GZPA 1NMAL 3CU1A 1JF5A 3HI6L 4AM0B 3AMKA 4UTBL 5TE7L 3ZYJA 3IU4L 2Q87A 4E0RB 1MHEA 3P9MA 4G6FB 1IMHC 3DX9A 5DJ2A 4FXGB 2XFXB 2V6HA 5DK2A 2N4IA 1DQLL 3OXRB 2V2WB 4WFGD 4JFXB 1I8LA 4Q2ZB 4YWGL 3QO0B 4JPWH 2EXYD 2XKSA 4IEFB 5DRNA 4PJCE 5IHLB 1S78D 1TZIA 3LKOB 5D7IF 4ZUUA 4GMSL 4G5ZH 3FOLB 4ZO9A 4OD3H 1NFDB 5GGQH 3OAZK 5JPMB 2LAGB 4R97C 2DQDH 2GSGB 3MV8E 3LKSA 4J3WA 12E8H 3ZDXF 1KJVB 3I50H 4JJ5B 5FYJH 5C2UB 5F3HB 1EO8H 1DUYA 4DCQA 2GY5A 2XN9E 2VZTA 3MJ8B 2WLZA 2BY1A 4E41E 2RBLA 5EZJB 2W9LA 1GXEA 3VI4E 3MXVH 4DKEL 4FQJH 2A6IB 4MJIB 2AJYH 1CGXA 3FQUA 5AAWA 1KGCE 2ZNWA 3MGAA 3PP3K 3DVGA 3IXAA 1MI5B 4ZO6A 3TNNB 3GMLB 3C2SA 1J10A 5CGYC 5EOQL 4HCRL 1NAMH 2ARWA 4JDZA 3MX0A 3X13A 1FL5A 2DJ4A 1SJHA 3T3PF 2AABL 4M4PA 4NRYB 1RIVH 1X3DA 2ZCLH 4KVCL 2R2BA 3R4DA 1VPOH 1ZKAA 1UWXH 4XCNB 5HDBF 4LCWE 1OSZA 4XNUH 1QKZH 2RJMA 3RWGA 3H9SE 3MRFB 3MPCA 2JB5L 1N59B 1XF2B 1DEEA 3FQXA 1G7IA 2UVFA 3SJVE 3NN8B 1OAXH 4OZHB 3WXVL 4DJMA 3AAZA 5T3ZE 3ULVH 1OLZA 3HR6A 4ZAKA 3LD8C 5JXED 2PTTA 2BCKB 3DRQA 4R2GC 5E6IC 4MXVE 3DVIA 2G60L 4K7PY 4RAHA 4NHUB 3SBWC 3L3GB 1T1YB 3L5XL 3U0TA 4JM2C 2OTWA 1N8ZA 4D3CL 2R69H 2NY0B 4U1IB 4O00A 4WDIB 4V1DB 5KS9B 3GJFK 5CJXA 3QRGL 3C8HA 3LN4A 1F4WH 3TBYB 1OT2A 3JV0A 3CFEB 3TNMA 3VGHA 5HHQB 1DLFH 4JAMA 1U8LA 2DQUH 3KPSE 2NTSP 5J13C 1G9MC 1I1CA 1D9KD 2VB5A 3MOAL 5F44A 1Z3GH 3ELAT 3UJIH 1P5VA 5E00B 3OKEA 2E5EA 4PUBL 4U1NB 3C09C 5CGTA 1G7JB 4JHWH 1FNHA 2LVEA 4QXTB 1FZKA 4L1HA 1S7QA 1YNLL 4JFFD 5C09E 3L3DA 3O4LB 3NABL 2C26A 5I0ZA 3LHPH 3B9KA 3BAEH 1LE9A 1EEYA 1P6AB 5EU3A 1AXTH 5HHMB 5JOPE 2WINA 1CD1B 3U30C 2FD6L 1NC4D 4QHLB 5D6CA 1BQLH 4Y0GA 1OARL 4S1DC 1XF5A 2CLZB 1NFKA 2R39A 1JV5A 1FQ9C 1WISA 4GSDL 1PW3A 2YHGA 2IAMB 3GB7A 5T1DH 5FB8A 5KSBB 3AU1A 1EEZA 1XGTB 5JW4R 3RWHA 2GUOB 1AGFB 3EDJA 1B0WA 4Y16A 2AS5M 2VLJD 2H8PB 4WJ5A 1NANH 5HVWA 4JB9H 5A16B 1J12A 5CBAB 2A0LC 2FRGP 5DQ9A 4WFGE 1DSFH 2HJFA 1J05B 1PYWA 5IMKB 2V7HA 4M48L 5JXAL 3KYNA 4KTEL 1Q9WA 5H2BB 2NXZD 4M1GH 4PIRF 4BZ2L 2C7UA 2LU3A 2VERN 5D1ZC 4YHML 5J9PA 4KTDL 1OAQL 4TVPL 1JYNA 3DHJA 3HE6A 1FBIL 4BK4A 4Z7QF 3S88H 4P9HL 3GM8A 2OCFD 2C4FU 4EI5C 5F7UA 4XCYB 3U1SL 1Y18A 3G5VB 3PWUB 4XAKD 3WXWH 3MCLL 2XZCL 2BXYA 4IDJL 4MX7B 3TCLB 5IVZA 2XTJB 5LQBL 1R3KA 4CVXB 4YHYB 5E8DH 4ZTOL 4QF1B 5SWSB 1IFHH 3QH3A 2GT9B 1HWGB 1YEDB 4CRPA 2RIKA 3U4EB 2QADC 5EBMA 5GIRA 4DVBB 3BN9C 1N0LA 4KRPB 5ADPH 2NY1C 2BSRB 4YXHL 4PV8A 1YY8B 4PJEF 3EGSA 1SYSB 1MCPH 2IMMA 4IHOB 4K55A 4Z78B 1C08A 1YMHA 2VH5H 3B9VA 1BIHA 5F7NC 3O6FD 5GS3A 1NLBH 3OX8B 3BUYA 3X3FL 1LEIB 3BHBA 2VN7A 5FYKL 5GJTH 5BV7B 1L0YA 2PYEE 5F1IA 3PDOB 2B2XH 4JFZH 3ILPA 4M00A 4URTB 4BSWB 4I2XB 1I8IA 5D1ZD 3LMJH 4P2RA 3IFOB 4KKNA 1WTLA 4YE4H 35C8L 4KK9C 5BVPL 1Q38A 4X7DC 1QRNB 3HAEA 3WCYA 4JY6A 4FA8A 1NBYA 4ZUSA 4PRPB 4P4KA 3VWKB 1EJOH 1U8IB 2HRLA 4N68A 4FZ8L 5DRWA 3C6SB 2F54E 2JE8A 3CU7A 3HKFA 2O26U 4LSQL 5DTFB 3OXSA 1TVHB 5LCVL 4HKZA 3O2DH 4GXUM 3ZYIA 2AXFA 3N9GL 1BQHG 1KEGL 5JNYB 4HUKB 3WIIL 3PWPE 3F7RA 2Q86A 5AD0B 2EE2A 3NIDE 1RUML 4HHAA 3BJ91 3NIGE 3V5HA 2X1PA 4QWWD 4LPVA 1U8JA 2X4NB 1P7QA 3T65B 4PJCA 3T77A 3RWFB 4YIQA 1CD0A 5EUOB 4C56E 3IU3B 4M5YH 5I8EB 2W1NA 4QRQA 5BRZE 3UXFA 2MNUA 1MIEH 2JCCB 1RK0A 3PQYB 1GZQB 3MV8A 4HSQA 2R9HC 3RGVD 4XNXL 4LSSH 3WL9A 1Q1JH 4PJGF 3V6FB 3FB8A 2P1YA 3NGBB 4JFFE 1ZA3B 4E41A 3IAGC 4LCYA 3H3KA 2EC8A 3RX8A 1P9MA 1AGCA 2VDPH 1AKJD 4JO4L 4WGVB 4PJIF 1J1XH 4GKZA 1N64H 4MXVF 3MRBB 2A2QT 1MHCA 1F6AA 2AEIT 1YEIL 2FHCA 1R5VB 5DFWH 1M4KA 1II4E 1FVEB 2BOBA 4XCEA 4XNYL 4QGTA 3DMMC 4QEGA 4CN6A 4LCWA 4Z7WF 1QHPA 4FTVA 1XZ0B 2F53D 4Q9QH 2CO7B 1U3JA 4KROD 5DA4A 2VDNH 4JQXC 4M6MH 4XZUA 2BNQA 3WSQH 3SJVA 5LAXB 1YN7A 4PRNA 3AS3A 3RTQD 2R9HD 4ZSOE 3ARBA 4XVUC 1CDUA 4NHCH 3RKDC 4O58H 3MRMA 2BVPB 4FQ2L 1X7QB 5JO5A 3T2NL 5C0BE 1BBJB 1TZGL 5GRYA 3D6GA 5GSVA 4OLZL 2H26B 1G6VK 4JDVA 4CMMB 3I2CL 3PHSA 4LNRB 5I30L 2VLRB 1HILA 4OKDA 4OJFH 1JPSH 2ZCKL 1CDIA 3WHXA 5HVGB 1I9RL 5ANME 4K3DH 3TZVB 4ALAH 3QCTL 3P4MA 3QDJE 3V4PH 1BLNB 2DQTL 5FO9A 3CFDB 2QQKL 3D3VD 2J1KA 4PRDA 1UXSB 1T22B 3PWJB 1YEFL 3TN0B 3UZEA 3KPSA 1OP3H 5TFSL 3B5GA 4U1KA 5GRUH 4PJHF 3LKRB 1BIIA 5BO1H 1N6VA 3DPBA 2VDRL 3HR5A 2CKBB 5DURB 4F58L 1HI6A 4CBPA 4O5LH 5ID0A 1INEL 1U8OB 3F58L 3GEWB 4MNQD 3G6DL 2D0GA 4FQXC 5D71L 5C09A 5IT2H 1FCCA 5ESAB 2DQHH 2OL3L 3QNXA 4JFOA 3IJYA 5BQ7A 1A9EB 1FZMA 3VFPB 2FWOB 2JKXA 3FQNB 4QRTA 3SKOB 3PDGA 3FAXA 4POZD 3NA9L 2C1OA 1PGRB 5IEHB 4JQIH 2FJFB 4JCMA 4JPKH 2QSCH 3MCKA 3QG6A 4P9ML 1MEXL 5E4EB 4BQBA 1TTUA 1I9IL 1IT9H 1MCCA 2CLRA 4GMTH 4CGTA 1M7IA 1UXWB 1U8HB 1Q9LA 4MQSB 1NAKL 3ZT6A 4P99A 3QUZB 1XH3A 2EDNA 3U6RA 5F96L 3MC0A 4G6ML 3V4UL 3TESA 1T7ZA 3H42L 4M61A 1T7VA 3VXQB 4M1DL 4PGEB 1YYML 3ARVA 4XXCC 5IHUL 3NH7L 1CZ8H 1RZ7H 4JFDB 4FQXD 3TBTA 2UWEB 4YQXL 4Y7MA 2XQYG 5HHXL 5BS0D 4M8VA 4HUVB 3D25A 2WIIB 4UOJA 2GK2A 2XTLA 5I74C 3LS5H 4B0MM 1SM3L 2EDTA 1OGTA 5HTSA 4ESKA 3CFCL 5CEZE 2NNAA 1E28A 4UQ3A 2ERJC 5C6TL 3JV4B 2HFFA 4I0CC 3ZE0E 5IFHH 3TBVA 5EZIL 3PP4L 4I0PC 4Y5XA 1I1AB 3WEXB 4WEUD 4LLAA 4OLWH 3FO9A 4PJAE 5CIPH 3PGDB 3ZKXC 5IWLA 2AQ2A 5EA0L 2VQ1B 4MQXD 1WC7B 3JBG7 3VFSA 1OGAE 4L4VB 3VFUB 1HYSD 4ONHB 3QEUB 4L9LC 4FQQA 1KLGA 1ACYH 2XZAH 2VL5A 1F58L 4KMTH 3RIAF 1QSFB 4NQCB 1M71A 4LCCB 4N0FA 2HFEB 3G5XB 5JIPA 2R56H 2X1XR 4LLWA 3TBWA 1ZHLA 3EJYC 5CILH 2W0PA 1R3HA 3RHWK 1P5UA 2Z9TA 4P2OC 4WIQA 5JDSA 3GRWL 4L8SC 5ALCL 1V7NL 4HV8A 4YXLL 5IB1B 2YPLB 1H15B 3BEWB 5GPRA 1BZ7A 5DWUH 3KYAA 1LK3L 2A6KA 2J4WL 3C9NA 3VWJA 2ESVA 4XPHL 2IPTH 3REVA 4Z77B 3CUPB 3U9PH 4EI6B 5DD1L 4I9WD 1WSST 3CLEH 4R26L 5IB5B 3TWCH 1CGUA 4XC3L 2VSDA 1A7BA 2APVA 2UVEA 2F54A 2MKLC 5DZLA 2X70A 4L4JA 1NGWB 1AQDB 4NO5A 5F7FA 3MV7D 1OTUC 5GGUB 3QUML 1GC1L 3WUWG 3ULVC 4NC0B 3HE7B 3CSYA 5FYJD 5ICYB 2VN4A 1NBVL 1BOGA 1GCFA 5EOCL 2GK0A 4RBPK 2KH2B 1U8PB 4C56A 4KGLA 3Q3GB 5BRZA 4TTGA 3PWVB 1WLHA 2DMKA 2Y7QA 3EOTL 2P5EE 3GUTB 3I6KB 3TVMD 1CE6A 3EJYD 4G8IA 4J3XA 2CIIB 3OQ3B 2YN3A 4G9FE 4H88H 3KS0J 3IRPX 4HKXB 1FZJB 1NGQL 1CE1H 1KCSL 3IF1A 4CMHC 1KB5H 2DBLH 3VRIB 3P11L 3MOBL 4P23B 4Z76A 4U1LB 1GVIA 5CZXD 1DE4B 3VGAB 3F5WA 3NPSC 3VXSB 3EDFA 3QQ9D 4K94L 3NZHL 4R7NA 3SBWA 1PG7H 3U7YL 4G8EB 4JM2A 4NKQB 1QVOB 2DKUA 3EYUL 1BEYL 1XGPB 1YN6A 3Q6FA 4D8PA 3QBTB 1A1NA 1MRDL 5TDOB 1FFPA 3FN0L 4HEPG 4HUWA 1FDLL 1C5CL 4YHOL 1JN6A 3LH2H 4M9OA 3EJZD 3ZLQC 3JWOH 5DK3A 4Y1AE 5SV4A 1AI1H 1WZ1H 2VQTA 1Z2KA 4W4OC 1TQBC 3KAAA 3C6LB 1JPFB 1S8DA 4Z7OF 5I2IA 3MNWA 4NQDE 4OB5H 1BFVL 1I8MB 4HW6A 5SWZD 1J1PH 2AGJH 3SY0B 4X7CC 2X4SB 2NTFA 2WW8A 2IG2L 3UTOA 4ZSOA 3VGGA 5JW4M 1CR9H 4ZS6C 2W0LA 2D4DA 3TO4B 5DVMA 3BO8A 3GSNL 1J1OL 4IBLT 5LBSL 1BECA 2IFFL 1G0XA 3OKYA 3W9EA 5MEOB 1NCUA 1ORSB 4J7RA 4R3SB 1RZIB 1WAAF 2R2HB 1N6QL 3AXLB 4ZOEA 4F7CA 3I6LD 1JGVH 1QFWM 4JHBA 1I3GL 2B7DT 4PG2C 1C1EH 1U93B 3PNWA 5DHYB 1YQVH 3AREC 5GISH 2CXKA 4DZBA 5ICXB 1F2QA 5C08A 4ONOA 2DMCA 5ENWB 4O2EB 3UJJL 4I8DA 1IGCL 3TJHC 5D2LB 4OLYL 2UYLB 4HBCH 3HPLA 2Z35A 5E94A 2MCPL 2P8LB 4KJYB 1FL3A 1UJTA 1FH5L 4IJ3B 1NH6A 2NX5D 4LLMB 2HLFD 1A6TA 3DX8A 1KN4H 5JORB 4HKBB 3CVIL 1EHAA 1SJVA 2I9TB 3BP7B 1KCVL 5CWSB 3MRNA 5C3TA 7FABH 4XP1H 1CXEA 2EYRA 3DI3B 4NNXB 4BSVB 1RIHL 3K7UA 4HUNB 1T21B 1FGNH 3RWCB 4J3SA 3P73A 5FUZL 1P84K 1YECL 4RFNB 3QULB 3LN5A 4D9LL 2FO4B 4CVUA 5I18H 1JFQH 5E2TH 5IQ7H 4PJ7F 3U2SB 4RNRB 1BBDH 3OKLA 3VI3F 4MS8C 3HC3L 4OBRA 1MELA 2GJ6B 3C60B 5DC0A 4HS3A 4OCXL 1FRGL 3QR2A 4L29A 2X10A 3O6LH 4FFWC 3ARED 4Y4FB 5EU6D 3N1FC 6CGTA 3G04A 3SCMD 3GJFB 1FLRH 4OZIE 5FYJE 1SHMA 2NY2B 3K2UL 4HIJA 2W07A 4HWUA 3O3BA 4U6XA 1F97A 1T2JA 2Q8BH 5IROA 1AIFA 2XG5A 3QQ3B 1I9EA 1QACA 4D0BB 3E2HC 3OAYH 5HYSA 3OKKB 1BZ9B 4YHIB 3JV6B 5I15L 4WI3A 4Y5YC 5C0FB 4NO0D 4TUJA 4XX1G 1VEOA 3MLTB 4UT7H 1AE6L 1G7MB 1G7PA 4WU7B 5CEYA 3QEGH 5B3JE 1C12A 1HXMB 2EDRA 1OQOA 2X4TB 1JWMB 2BNRB 5F1NB 1MAMH 3UTTD 5A2FA 1TQCB 4X6CF 2UY7A 2YBRB 5C0CB 1BD2B 1PQZA 2QQNH 4MS8D 2V5YA 5HYFA 1MRCH 3KPMA 3X14A 3FMGL 4PJ9A 2ENSA 1A7PL 3FRPG 4PJAA 3WS3B 5JMRA 5J1AA 4HF5L 3STLB 1T20A 3ECBA 5KVDL 1IC7L 3PHQA 1OGAA 4R7DA 2FBJH 2XKNB 1LK2B 3ULVE 1F8TL 2FX8H 1VFAB 4JANB 4DAGH 4NM4H 1KEMH 1IAII 4Z95H 2E9WA 4ZO8A 1YY9C 4GAFB 5IVXE 1SJEA 3WDIA 2MQCA 3DTXA 1LNUA 2DWEB 4M5ZH 1QPXA 1W2KT 3NA4A 1CYGA 2ADIB 4W68A 3GSQB 2VLKB 1MH5B 4M1CD 4JZJA 2X4UB 1R0AL 2O5YH 4OI7A 1NMCC 4G8GB 4I18B 1TNNA 2CRMA 3HI1B 4OGYH 3OR6A 4BK5A 1FJ1B 2JJSA 4X0KB 2IPKA 4TRPL 1KCUH 1SBSL 3B8YA 5DEFA 4FFVC 1G7LA 5HVFB 4GW1B 1LO5B 4RWYH 3D0VA 4QTIH 3NFSL 4DEPB 4ELMF 4A6YL 1EERB 3DO7A 2V5SA 4WV1C 4KHTH 4WWKD 4KMLB 3VJ6B 5IMLB 3VXMB 1SEQL 3ABZA 1NUDA 1NGPH 2KKQA 3D85A 4NRZA 4DZ8B 5DEGA 4PJXB 4K23H 3ZKMC 3SGDI 5IR1A 2AV1A 2OR8A 3GSXB 3MV01 3S36H 3UPRA 3QHZL 4JO3L 2J6EH 3TIDA 5DRXA 1LP9B 1DCLA 1LO3L 1IL1A 2PXYB 1W8OA 3O41B 3FO0L 4XCCL 2BHZA 5D9SB 5E9DE 2P5EA 1YY9D 2R0KL 3MUGA