4L8SA

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCASMDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA02
3EGSA 1T2QL 1MVUB 1MCQA 1VESA 5BZDB 4WFGD 4BFBD 3GK8L 2BNQA 2I60L 1VB9A 5EBGA 4P4RB 15C8H 1OAYH 3NCMA 2XI9A 3ZTNL 3MV7A 2VOTA 43C9B 4O2EA 1LEIB 3PP3H 5C0BA 4CW1B 4KQ4L 4BFIA 4NDMA 3RA7H 3DXAD 1GOGA 3SPVA 2WSKA 1MFDH 2YMXL 4YXKH 4NO0A 1QR1B 3T2NL 4DUWA 2C4XA 4P9HC 3TV3H 5GGUA 1KCRL 5DEGA 3Q6FB 5HGBB 3DXAA 3LQAH 1NGYA 1Y18A 1DBAL 1NGQH 4BSVB 1N7ML 3P0VL 2NY2B 3B9DA 5E5MA 4WNQA 5EU3A 4MX7B 3VGEA 1MHEA 1Z9MA 1KFAL 4WUKH 1U8HB 4PJ8B 2I9LB 2APTA 1P2CA 3MJ9L 1UZ8A 3SQOH 1A7BA 5IEKA 4LF3A 3F12B 3ABZA 4Y1AB 5MI0C 4FFWD 4Q6IB 1R3LA 2P48B 1YMMB 2O26U 3I9GL 4XWOD 3FHAA 4BFEA 4PJXB 3BPCA 1FZKB 5KVDH 1ZT1B 5DC0A 1NBZA 5JOFA 4O58L 2XKSA 1P6FA 4LKXA 4CVZB 1D9KD 5D6CA 1PLGH 1AKJA 3WEXA 4ODTL 1J10A 1MAJA 4O51B 2X4TB 4I2XA 3IGAA 2MKWA 2Q6WB 2VZTA 4R97B 2VQUA 2FX9L 3UPRA 3EYSH 2JKXA 3H7LA 4QRPD 4NQEB 3UYOD 1MCHA 5C08E 3WYRA 1KTDB 4W6YB 5CMAA 3C09C 3SGJC 3TBYA 2LTQC 3T3ME 4Q74A 4HG4J 5HVWA 3ZE2E 2WP3O 5DZNA 1RK1B 4QRPA 5DJDB 5ID1B 4JY5H 2HT4D 3FFCA 1QO3B 5K9JL 2C3GA 3O8XC 3UC0L 3QHTC 4X6BB 5L0QC 1NUGA 1WAAE 3DGGA 4NRZB 32C2B 1JI1A 1KB5L 2JJWA 4JFZH 4EVNA 3BOVA 2BZDA 5LAXB 3DROB 5JA8B 3WS6C 1IGFL 5I1GL 1HHKA 2O61B 1A21A 3CMOL 4YDIH 3P4MA 1CVSC 4K9EL 4JPIA 2NY0C 3HZYB 1BJ1H 4AEHH 5DHYA 3T4YB 3VXSE 2V5RA 5DURB 2F54B 2R69H 2AK4B 4PJ7B 5CSBA 1NPUA 4FN0A 1T2JA 4F7PA 4M00A 5FGSA 2H1PL 5D70H 1C08A 3M45A 2EEDA 3WFBL 3UZQA 1LE5A 3H7BA 5IGXH 4M02A 4ZO6A 1BECA 1RU9H 1UB5B 1CICD 5IWLC 3TH2T 1MFAH 4F80A 4FQ2L 3EYOB 4ZS7L 6FABL 3NH7H 5L88H 4JPWH 1T4KB 3I84A 1CICA 3PJSA 1Z3GH 4G3YL 5TGBA 2ZSVA 4WO4B 1S9XB 3PABA 1P53A 4NQUA 1BVLB 4LARH 1V7NL 1SY6L 3D69A 5D2NC 2FR4B 1DEDA 2DQTH 3EJYD 4PR5B 5KANI 4AIXA 5DWUH 3UTOA 1HEZA 2BC4A 4R3SA 1HYSC 4PRAA 3ROLB 1U3HB 2ARWA 2NNAB 1E4WL 1H3VA 3EYQD 3VJ6A 3CH8A 1UWXK 1FLRH 2F19L 5F6IC 1YJDL 3IDYC 3P11L 1IEHA 5CEZH 2XA3A 5INDB 3C6LD 4PRID 1NL0H 3KJ6L 2IJ0C 1F2XK 1SMOA 2D7QA 1AIFB 4XCYA 1QFWM 3BP7A 1XGUA 5C09A 1I1FA 5E8OA 3TT3H 4S2SB 5IMKA 1VKXB 1MFNA 1WV7T 4AIZA 4FQXB 1KIRB 4HH8A 1CBVL 2CRYA 3ARGB 5EO9A 3MRHB 4ZAKC 4DN3H 1OTTD 3WL9A 4RX4A 3QO1B 4MQSB 4RA3A 4EIGB 4KUZH 5ILTL 2K1MA 2ADIA 1ORSA 1HQ4B 3DO3A 3S6CA 3P30H 1I7ZA 4OLWL 3SDYH 1C5DA 5IMLA 2FEEI 4Z7QF 2XA8L 1EFXB 2IQ9L 3HMWL 5KSAA 5ID0B 4MDIA 2F53D 4R96A 4HBCH 3RPIB 1T03H 2WUBH 1IC4H 3E3QC 1FV1A 3VWJD 5KSBA 4ZO9A 1G6RH 3VCLB 3U2SB 1I7TA 1MJ7H 1ZWIA 5ICZA 1DR9A 3RVXD 2AVGA 3MYZA 3D0VB 3HC3L 1K2DB 1S7VB 2EDFA 1CGVA 1UG9A 4DAGH 3EO0B 4N0FA 1RJYA 2ESVE 2HLAB 2F5AH 2P8PB 3BKYH 2VDKL 4G8IB 4M62L 3ZKND 4Z8FL 4PJAA 2GAZB 4NO2B 1MY5A 2HYMA 1FG9C 2E27H 3HCVB 2R2CA 2OZ4A 4C56E 3TN0D 4S1RL 1KELL 2OK0L 1D6EB 2BY1A 2FJFA 5JNYA 4POZC 1YYLL 3VXSB 1CXEA 2UYLA 1URLA 3PWNA 1T7ZA 2BSRB 4P0DA 2YRLA 1YEDA 1OD7A 1TZHA 2CLZA 3QQ3A 1FYTE 2EC9T 4W70A 3ARDC 5F97E 2P4AB 5CJ8A 3X14B 3WFDL 1FAKT 2VDPH 1TQBC 5F9JB 1T89A 1PD6A 3B6SB 5KN5A 1OPGH 2VZUA 2W38A 3A67H 1N59A 4NM8H 5JIHA 2ZCKL 2YKLL 3FCTB 5ALBL 1QRNE 1DBKL 2APXA 5JQ6H 1PYWA 2YWYA 3FB8A 1RHHB 2VDMH 4RZCA 2V5YA 3FN3A 3GKZA 3D85D 1H0DA 4P4KC 1IKNA 4Z0BL 1K9TA 2EE3A 4NQSB 2A6IA 5E95B 1QSVA 2P46B 3OKDB 4YXHL 1HN1A 2PW1A 1GAFH 1M05B 3DJ9A 5B3JE 2I27N 4YR6A 3N1MC 3RA7L 2VLKD 3D85A 2Z8VC 4JKMA 2FIRT 1DQJA 2X4QB 2AKRA 3KWWB 2EDHA 3NA9H 5IIEA 5JW4N 2PKDA 5TDPA 4YXKL 2HFEB 1CS6A 2XZQH 4MA7L 3U7AA 4ZUUA 3D0LA 1DN0A 3LQAL 4NNYB 3L95A 1A6PA 1UA6H 2C26A 4NQXB 5JW4Q 1I8LA 1S7QB 4JR9H 1EEQA 1YMHB 2FO4B 2GIYA 3DX9A 4N0UB 3CVHB 3DUSA 3BW9A 3SQOL 3QNXB 1FSKC 4GW4B 4HWEL 1NBYB 3BJLA 4IBLT 2F8XC 2Z31C 1JNHB 3RWIA 5B21A 3VFSA 3PGFH 4OTXH 1ROWA 4PJFF 5EZIH 5DXWA 2G75B 5F1NA 2CLVA 1GGTA 1M7IA 2HMIC 2ZSWA 3F65A 4PP2B 5SX5K 1P7QB 2VDRH 4WU7A 3WSQH 5FYKU 5KVDL 2DQIH 4JHZA 5DFWH 4RQQA 5F7FA 1IEAA 4MXVE 5H35A 4IEFB 1FG2A 3QXAA 4GMTL 3N1GC 3RNQB 1AO7E 5D2NE 3NIDE 2VN7A 5IJKA 3SJVA 4X6CB 1NSNL 3MGOA 2XICA 4PJHE 3O2VH 3O9WC 4XTRD 5GGSB 5EUOA 2HN7B 3FO1A 3VFMB 1R24B 1NMBH 2LVEA 1R3JB 4JPVH 1KLUB 4UIMB 5IG7B 2ESVB 4GKSB 4A2LA 4FQJH 4WEBH 5CZXD 3HG1B 4UV7H 2VABB 1WWWX 2JCCA 3HPJA 3WN5B 1FN4B 2QLVB 4JY5L 2DRUA 4I77L 4MA8H 4FA8A 1AFVH 3QRGH 5DD6A 3MXVH 1KXVC 3PQYB 4QHMA 1RSFA 1QHPA 1T6VN 4JFZL 1VHPA 3HA0A 3CUPB 4N90E 4WHYG 4PLKC 4LLVB 4ERSL 3X13B 5FV2A 1B0GB 1I4FA 1F42A 1U8IB 1EEYA 4OFIA 2BVPA 1GZPB 3VH8A 4AEHL 3FRPG 4PREA 4WUUB 4KI5D 5FDWA 1EJOL 1KSRA 1OM3H 1BGXL 3I6GB 2R69L 3NPZB 1J05A 4K8RH 1EV2E 1QRNB 2QTEA 2GKIA 2R1YA 4FG6D 1T5XA 3RTQB 2NTSP 3C09B 3E3QE 5T5NF 2NR6D 3HS0A 2EIBA 2LTQB 1V05A 4XNYL 4Z7UA 1JYVA 1HXYB 2BX5A 3QPQC 3GJEB 4OF8A 3MV11 1MFAL 3O8XB 3NH7L 4HKXB 4M8QB 5L0QB 1KULA 4FZEH 2EEBA 5DRXB 3TP4A 4JPWL 1NEUA 5CIPA 3MRNA 4F7EA 1UM6H 2EYSB 3QFJB 1Z3GL 3CJJA 1LE9B 4OZFA 5HY9B 3WCYA 1IT9H 4J3SA 4LARL 1DE4A 5HVFB 5K59E 4FQ1H 4L1DA 5L2KE 5ADOL 3VFPB 2RFXB 2NY0B 1X6LA 2EICA 4BKLB 1TPXC 1L9MA 3DX8B 4HIEA 4OM0H 1BFVL 3VXME 1U93A 4KROC 1A9BA 3QEUB 1BVKB 3G6AB 1J0KA 2MHAA 3NFPB 4LGRB 1JI2A 1IAIM 4P9HL 2F15A 2GY7B 3LKOB 4W6XB 4HC1H 4OQ1A 4EJ1C 2V7NA 4Y4FD 4PJ5B 1MUJB 3NCYS 1NL0L 3QDHA 5HGAB 1UWGL 1NCAL 3PIQA 3IXTA 5FFLA 2V2WA 1H3XA 1QFWL 3MQIA 4L9LB 2L0DA 2PW2A 3N9GH 4HK0A 3TT3L 2FDBP 3C2SA 4G8GB 4K71C 5E00B 2EE9A 2VXSH 3EOBA 3LB6D 3UTZA 4KWUA 3LHPH 1ZT4A 2DM4A 4X6EB 4M7LL 3T04D 1AO7B 1S9VB 4EI5C 4JG1H 5F8QC 4U2ZA 1CFTA 1N2RB 1F00I 4PJHB 1FL3B 3P30L 4CNIA 4EZMA 5I76B 3CPLB 4HG4K 5E94A 1CDCA 1B6DA 5FYLD 4HV8A 1E4XI 4YDJA 4HBCL 2ORBH 3VXNA 3GSWB 5HHVH 1T03L 2WUBL 3PL6C 5F6IB 3IDYB 1G6RL 3BXNB 1MJ7L 5DJ2A 4XXCC 3NVQA 3DVGA 1R6VA 4XHQA 1VFBB 5AYUL 4J8RA 4ZNEA 4DN4L 4JFFD 4YBHA 4TNWF 1X9QA 2I5YH 4A6YA 1DVFB 5FYJU 4ZFFB 5DVMA 5IB1B 2F5AL 1HWHB 2V6HA 3BKYL 3TJEH 1MIML 4WI8A 2B5IC 4PS4H 2HFFA 4JFFA 1R5WA 1K3IA 2ZUUA 1MCEA 2CIKB 5B38B 1H5BA 3VFVB 1XGYH 2WW8A 2XTJD 3TIDB 5C0AE 2YPVH 4O2CB 1IGJB 1ZEAH 4FHBD 4R2GC 5IVXA 3IRZA 1F13A 1ZHKA 3FKUS 4OCRH 1WZ1H 4WY7L 4WFHE 1P4IH 5HHQA 1R3IL 4JJ5A 3WBDA 3TO4D 1AR1C 3V5HB 4LMQE 2VDPL 3HZKA 3BH8B 4OGXL 4OGZA 3AY4A 1OPGL 4NM8L 3A67L 4P5TA 4X6FB 3RVVC 3V4PH 3DX7A 3BEVA 3KXFB 3TO4A 2DICA 1EZVX 2GK0A 3U1SH 5EIVA 5JQ6L 2P47B 2VDML 5FOBA 4YWGH 2D7MA 4KRMB 4PGCA 2YBRA 4DUVA 1NAMB 3SDCB 5SX4I 1HKLH 4N0RA 3PE9A 2VB5A 5E8DH 3B2UC 1RVFL 1K5NA 1G7MA 3FONB 1HHJA 1NGPH 2D0GA 3F7RA 3NA9L 4P2RE 4POUB 3H9SA 2XZQL 4NSKB 3OX8B 3OKMB 2AV1A 1F3DH 5GGQL 5HHXH 1PKOA 3VRLE 3VXQB 3O4LD 3VXMB 3WLBA 1UA6L 3ARDB 4XZUA 2Q76B 4HLZG 1U41A 4L1HA 2J8UE 1S78C 3CZFB 3JV4B 1MEXL 3VD3A 1U91B 4JR9L 3QO0A 1JWSB 3T65A 4X7SH 4UZGA 3TYFA 3OJ2C 3HRZA 4YHNB 4P4KB 1NC2D 4LGPB 1QSFD 3LQZA 3PGFL 4OTXL 4PRHD 5EZIL 2GJ6D 1U42A 2HJLA 3C08L 1ZVYA 5KVFH 4UU9A 4U1KB 4XCNA 5HPMA 4KK5D 2FYYA 2DQDH 4TNVK 1U8JA 3WSQL 1MFEL 2BNRE 3WNPA 3BN9C 4B7LA 1PZUB 3MV8E 2JJTA 4LHUG 1T7VA 1MWAH 1NC2A 2DQIL 1QSFA 3G6JB 4PRHA 3MLYH 2GJ6A 3HE6D 4Y2DA 1F4WH 2FEDD 4GW1A 2EDJA 3ECBA 1ITCA 3QXUA 4G42A 4LLQA 3VFRB 1XCQB 4V2BA 4E41D 1DBBH 2JB5H 5J6HA 1IGYA 3VFUA 2DAVA 3DUUB 2BCKB 2I07A 3O2VL 3ZLQC 4I5BB 3V5KA 4WEMB 4C57C 1MI5D 1N8ZB 4E41A 4OQTH 1NMBL 3VGFA 1FSKB 3HUJE 4WU5A 2Z31B 2W59A 3BKJL 4FQJL 1S5HA 1SJEB 3QUXB 5B39A 4WEBL 1MI5A 4I3GA 4KKBC 4ZXBD 1ZLUH 4IHOB 3ARBB 1WT5A 1MLCB 4NKMA 1YPZF 3THML 2ZCHH 1LP9E 4MA8L 4GG6F 2BXZA 1AFVL 2FECI 1QRKA 2WBJD 5D93C 1YY9C 4D9QE 2BHUA 3MXVL 4GRLD 1FRGH 2ZUSA 4ZDHB 5C0AB 4ZYKB 3TBSB 3TBWA 2PYED 2VDQH 3P4OB 1OT2A 4LHUA 5EA0H 4GW5B 4WJ5A 3HI1A 4JQIL 4NZUH 3RWDA 4NPYB 4ODSL 2WBJA 4PJEA 2RBLA 1H8NA 2WV3A 4GRLA 3IDIB 2APVA 2L7UA 4U1HA 4L4VE 1P5UA 4HKZB 2OR9H 1A64A 1KNOA 5BZWA 3CCHA 5D5MA 1OM3L 1YEEH 3UTSE 1AD0B 4HT1H 2BSTB 1EJ6A 5HI5C 5IFHH 1A9EA 1FGVH 4RDQG 1M6OA 2P24B 1P4LB 2H2PD 3L3KB 5LG1A 2QHRH 2FIKA 5DQDH 4GS7B 4AH2B 2Z4QB 3P9WB 1RZ8A 2YD8A 4MQTB 5FKPA 2P8MB 2QSQA 2Q7YB 1FVDA 3MRIB 2A6DB 2HJKA 4HH9A 1EZVY 2YPKA 5GS2H 2LU3A 1KG0B 4FZEL 4P2RB 4YO0B 1UM6L 4OZ4B 2YRPA 4TUKH 2JJUA 3UROR 4YHPA 5FHBL 4NNXB 1IKFH 4DVRH 4YH6A 1R3KB 1MJJB 4EXPX 3D25B 3IU4H 3GMMA 3O11B 1RIVL 2ICES 3JVGC 5LBSH 4MDJB 3ILPA 2J8UB 1P7KB 4JFEE 3TPUA 1HH6B 4KK9D 4QY8B 2BVUA 5IESL 4NN7B 2EDBA 5MEPB 1ZHLA 4M1CC 1EFQA 1PAMA 3CC5B 3Q6GL 3STZB 1HH9B 5H2BB 4LLMA 3W2DL 1R0AH 4I0PD 4Z7WA 5EC1B 1BD2A 4HC1L 5EBWB 3X11A 1KJVA 3UEZA 5I30H 5IHZB 1OAUL 4L5FL 2IH1B 3GHEH 4I0PA 1XMWA 2BNRB 1BF8A 4HMDA 3MV8B 1ZHNA 1MREH 2IALB 4U6XA 3HLAB 3N9GL 3GHBH 4OF6A 4NZDA 2GJJA 5CILH 1DUZA 2VXSL 3QA3B 2E7BA 1JF5A 2W07A 3RWHA 3T09A 3AU1A 1WSST 1G1CA 4JG1L 5FB8A 1IC1A 1MCCA 3GBMH 3PWJA 8FABA 2BP3A 5ICYA 2ICWI 1PX4A 3SDDD 4ORZC 2CIIB 4KROB 4LBEA 5FYKH 3IFLH 2JJSC 3VG9C 4ZUSA 5IKCB 2ORBL 4DKDC 5MENB 4OD2A 4L29A 5GS1C 5GRUL 2WBWB 3SDDA 5JW5B 3E6FB 4PJIE 3KPSD 1EUTA 2J8HA 4PP1D 5HYIA 1XGPA 1V3KA 1OQOA 2IQAB 4U1JB 5DHVA 2VR5A 3TZVA 3KPSA 1INDL 3L7EA 1HSAB 3MV7E 4K71B 1EXUA 3TJEL 5C0BE 5KSUB 4M7ZC 5IBTL 3QUKA 2X5PA 5FYKE 1KJMB 3QJFB 2VJXA 3KYAA 4L4VB 2P42B 4FXLA 1K8IB 3MRJB 5DD0H 4MSWB 1KF9B 1ZEAL 2DWDB 4PY7B 4M61A 5DYOA 5DK3A 5ETUA 1FZMA 3D18A 4OCRL 1WZ1L 3KPTA 4NJAH 5KSAC 1P4IL 5AAMA 3O3DB 3IB4A 4JKKA 3ZKSD 3UTSB 1LK2A 1VSCA 4HFUH 4LCWB 4NQVB 3BIAX 1P5VA 3GSNH 1GVIA 4RFEA 1T1YB 5I8CB 3PL6B 1QVOA 4ELKA 1JWUA 3V4PL 3L3JA 5JHDD 4H1LG 3L3DB 4NQTA 2E3VA 5HVGB 1EHXA 3EDFA 4HIHA 3QDGE 4PRPB 5BW7A 3ZDYF 1J87A 5T5FH 5TDOA 5E6ID 3PDOB 3W81A 1BF2A 5JHDA 1MCFA 1HKLL 1U8LA 3GI9H 1OVZA 3VDBA 2OL3B 3B8YA 5E8DL 2YD4A 1AXIB 3GSUB 1MCIA 3WO4C 4D8PA 1MPAH 3WIIH 3CXDH 1NGPL 3SE8H 4TRPH 5D6DA 2Y4SA 4AY0A 5DJYA 2E6JA 4PGBB 4AEFA 5F3HB 3U4EA 3QFDB 3ZKNC 2AJSH 3HAEG 4RAUA 1FJ1A 1MRDL 1G7PB 5IOPA 3V79C 3VMNA 1TNMA 5FO7B 1YEFH 1CK0H 4Z7NE 4I2XE 2NW3A 4NKOA 3MBED 1T89C 1X5FA 2OJEA 1U8PB 1W8NA 3MRGA 3PDGA 1VFAA 5FECB 3UTQA 1T5WB 3STLA 5FV1L 4WV1C 4UIKH 4MA1C 3QRFM 5CJXA 4X7SL 5TQ0H 3IDGB 2RR3A 3MBEA 3RJDA 4MCZA 2Q8BH 3BP4A 3CFDA 4HEME 1WC7B 4N9GB 5AD0B 3UAJC 3ZO0A 2XWJB 4FP8H 4LP4A 4F3FA 2R23A 1CFQA 3FFCE 3OGOE 1HOCA 5SWZD 1AP2B 1AGCA 3RHWF 1DQLH 3IFPB 1WBXA 1RJLA 3FB6B 1U8NA 4KK6C 3CVIH 4M7KL 4UAOB 3GBLA 5IHBA 5IV2A 3BGFB 3NIFF 5SWZA 1KTLB 3MJ7A 4NIKB 2VERN 4LEOB 1VFMA 5HDBE 2J88H 3WNNA 4MAYA 4NBXB 3DTXA 5MEOB 1DBBL 3E6HA 4JQVA 1EHAA 2JJVA 5IB5A 3KLHC 3QUMB 3WNMA 1U3YA 4QRUA 3KPLA 2H3NA 1XF5B 4P23A 4KHXL 3B9KB 3RP1A 4MB4A 1S7UA 4XXDB 4IS6B 3DV6B 3EIFA 2DBJA 1G9NC 1KIQA 1CE6A 3MV7B 1SYVA 2W9EH 4O2EB 4YDVA 5C0BB 2MMXA 4BFIB 4NDMB 4CBPA 2ZCHL 3BWAA 4HK3N 5DC9B 3SPVB 3SGDI 4L9DA 5EIQA 1FGNH 4NBZB 4NO0B 1FFOA 1NCDL 2CR6A 1FRGL 5GGUB 3S9DB 5F21B 5DEGB 4WW2A 4OGAC 3AS0A 2VDQL 2HTKD 4BSJA 1L6ZA 4XVTL 3DXAB 5EA0L 4TTGA 4QXUH 2NZ9C 1NGYB 1Y18B 4G9FD 5HDLA 3S37H 5HYFA 2VXVH 4H25A 5ESAA 1S7TA 5IJKC 1PSKH 4XPFH 4QT5A 4LIQH 3ZL4L 5FYJH 2FX7H 5E5MB 4WNQB 4YK4C 2G9HA 5F6HI 5EU3B 4UUJA 4JDVA 1MHEB 1J8KA 1EO8H 5JXEA 4G9FA 4PJDF 1P2CB 1UZ8B 5E56A 3KYKH 4YUEH 5IEKB 5JO5A 4GG8A 4LF3B 4HEPG 5FA4A 1TVBA 4HT1L 4Y2OA 2XZAH 3BQUC 2MKLC 5IFHL 1FGVL 1R3LB 3K74B 4NWUH 1IAOA 1QUNA 1ZKAA 5HHPA 5DD3H 4MCYA 2V5MA 3S3JA 3WXVH 2QHRL 4OIAA 5EH1A 5DQDL 5AZ2H 3E0GA 3KYNA 5J0BA 2XN9D 2DJUA 5TH2A 5C09E 5F9DC 5E08H 1NBZB 5JOFB 1NH6A 4ZTOL 2GI7A 3P4NA 5D93B 5IT2H 4JM2F 2FWOA 5FYJE 4LKXB 5D6CB 3G5YA 1ETZA 3Q1SH 1J1XH 3FB5A 2XN9A 3BPNC 5DJZA 1IKFL 1AKJB 2VR9A 4DVRL 3WEXB 5CEYB 5ITBL 3IU4L 4WTZG 1OGAD 1ZK9A 4LVNC 4JFXA 4I2XB 3BPOC 3L5JA 3N06B 1H3GA 3IGAB 5LBSL 3UTTE 3VI3E 5BJTA 1YDPA 5F9AC 4ZS6C 1EMTH 1BFOA 2E5EA 3UPRB 2MQ3A 3EUUA 1L4IA 5D7LD 3BGMA 4MB5A 3ARED 1OGAA 4MXQC 4NBYB 1NGWA 5C0NC 2YN5A 4P49A 2WNGA 4GBXA 1R0AL 4MJ4A 1N5YL 3TBYB 4EDWH 2KQMA 5ELIA 1Q9KA 5CD5C 4GUPA 3AREA 4QRPB 1GGCL 3E2HC 3FFCB 1J8HD 4MNQD 4JLRA 2D7OA 3GHEL 3MRDA 2R9HC 5CWSA 3DGGB 5F9WC 3OKOA 3QULA 4QOKD 4Y5XC 4EVNB 1ZS8A 4KZDH 3GHBL 1JIBA 4Q0XH 1J8HA 3OTTA 5CILL 5F1SA 2X4PA 3DMMD 4MNQA 5EBMA 1HHKB 2EDEA 4OLXH 1F11A 3RVTC 1GGBH 2QR0A 3P4MB 5T33H 1QSEE 4F9PA 4JPIB 4LSDA 4MD5A 5FCSH 2CPCA 4HUUA 4QOKA 5DHYB 2YC1A 3Q2CA 3GBML 2HRPH 1P4BL 2GTZA 1EHLL 4OCSH 1G9MC 1RUQH 5FYKL 1Q0YH 3IFLL 2LE9A 3A6CH 4PG9A 1C08B 4YEEA 4R7DA 1FFNA 4CKVX 1LE5B 3GNML 3JWDC 3H7BB 4OFVA 4K7PH 4FFYL 4RISH 1RULH 5HVHB 1A22B 3SOBH 3TA3D 1N26A 2DI9A 3FO0H 2VSCA 4XP4L 3GSOA 1DQDH 4GQ9L 4NN5C 3VXUE 3PJSB 4K3EL 2Y7QA 2W0LA 3T3PF 3HKFA 5E1HB 3S88H 2ZSVB 3HPLB 3ZSTA 3KVQA 3PABB 4M3KB 2VTFA 4TVPD 1KEGH 2OQJA 5D2LE 3D69B 4WI6A 4ALAH 2LVCA 1G9NH 5DD0L 1WK0A 4LRIA 1HEZB 2BC4B 3NAAH 4R3SB 1U0QA 1FFPA 2NY4C 4PRAB 1TJHH 4NJAL 4J3WA 1P9MC 4ZPVA 1BQLL 1WUNT 4HFUL 1BWMA 4NKQB 3VJ6B 1J86A 3QISA 2J2ZA 2OP4H 4U6YA 1UM4L 5GS1B 2KPNA 1E27A 1U2CA 3MREA 5F1IA 3ZDXE 5AUMA 3KYMA 4PRNA 4XCYB 3KLSA 4QHKI 3BP7B 1D5IH 1XGUB 5C09B 3K7UA 1I1FB 2BSSA 5L2JA 5TFSH 2FL5A 5E8OB 3QDMA 4F8QA 5IMKB 2Y6SC 5EO0A 3SKJH 4AIZB 1WWCA 5M7QA 2WWKT 5EO9B 4M7ZB 5FCUL 2YA0A 5SWSD 5HJ3A 2OX5A 4JFDD 1LEGA 4K23H 1C5CH 1MPAL 1JGUL 3CXDL 5FHAH 2IWGA 4TRPL 3SE8L 2ADIB 1JE6A 1ORSB 1X44A 5KS9F 2BXYA 2AJSL 4APQD 1I7ZB 1C5DB 5IMLB 4NHUA 2PETA 1JPGA 3FO9B 3QHZH 4TSBH 5SWSA 4JFDA 1UJ3C 5KSAB 4WTXA 1ULVA 4MDIB 3LIZL 5ISZD 2DTMH 4R96B 4BA8A 1II4E 3SJVE 1FV1B 2QQQA 4DKEH 4HS6A 5KSBB 4N1HB 5BRZE 2QJDA 4P5TC 4D0BA 1ZWIB 5ICZB 3CSBA 3HNVH 1EBAA 2IH3A 4NP4H 2M2DA 2KDGA 4TVSa 3SCMA 1I9IH 3CU7A 1QTYT 2QQKL 5I2IA 4N0FB 1RJYB 3H9HA 2H26A 3CAFA 3OAUH 4HPOH 3AFLA 2FATH 3D3VD 25C8L 2HKFH 1UCBH 5IHLB 5AYQA 2A73A 4FP8L 4PJAB 1DUYA 1MHPH 1T04A 1LO3H 1QSEB 1DQLL 2ZOLA 4QLRA 3D3VA 3TEUA 5DMKA 2FJFB 3CVIL 4Y19E 1RZGA 1RUAH 1DSFH 2UYLB 1FIGL 1I1CA 1I1AD 1CDIA 1TZHB 2CLZB 3PG2A 2EH7H 2J88L 4HHAA 5JXAH 1Y6MR 4FABL 1JZ2A 3DSNA 3PWUA 4BFGA 1A4KA 4QTIL 3EW3B 3G5XA 2X41A 1K8DA 5KN5B 1N59B 2CDFA 1KCVH 1UXWA 3SDXF 1V5JA 1MELA 5I66A 1ZVHA 4MA1B 3OKKA 1E4KC 1PYWB 2LAGB 3U9UB 3FB8B 4RZCB 4YHYC 4EN3D 1H0DB 3IF1A 3VXUB 2A6KA 3HI6H 3MLRH 2FEEL 4NJ9H 2A6IB 3DVFA 3GRWA 3LRGA 1G9MH 2PW1B 2YN3A 4IOFC 1E4XH 4L3CA 3JWNC 5HI4D 3G6DH 4YR6B 4HUWA 1G0YR 3FQTA 3D85B 4EN3A 2JJTC 4IRSD 1VPOL 1DQJB 4YHZL 2AKRB 5IIEB 1FGNL 2EH8L 4Y2DC 2V7HA 5TDPB 4XGZA 2YWZA 2NY3D 3VDCA 4N0CC 4ZUWA 4ZUUB 1DN0B 1JZ3A 4IRSA 3HZVA 3L95B 4QXUL 1A7RH 5CCKH 5FXCH 3I6LD 12E8H 1PSKL 5IJVA 1KCLA 4XPFL 2FD6L 1BX2A 4GSDH 4RGND 4JG0H 5FYJL 2FX7L 1X7QA 3OKLA 3AUVA 3IT8D 4I18C 2NY1C 3JWOC 1EO8L 3DX9B 4ACPA 3JTTA 5D1QD 3BW9B 3KYKL 4CDGC 4YUEL 1Q9LA 4R4FH 4FS0A 3TWCH 3VFSB 2XZAL 5IB3A 3CK0H 1BJ8A 5F1NB 2O5YH 4KY1H 4NWUL 5DD3L 1TTGA 5EWIL 2CLVB 3WXVL 1M7IB 2ZSWB 1A7QH 3I85A 2QV2A 4WU7B 2VYRE 2MNUA 4MD0A 3OXRB 3RKDC 2PTVA 5E08L 1VACA 3QR2A 3UYRH 4XH2B 5IVOA 5I1IH 4U2YA 1TLKA 1IEAB 2WIIA 3MC0A 5H35B 1RUPL 1NCCL 2Q1EA 1FG2B 1J1XL 5D7JC 1PDKA 1IGIH 3QXAB 5F7UA 4UDUA 3DI3B 2Z93B 3CGTA 1JJUA 1JK8A 1MHHA 1SM3H 3CXHK 1PJ9A 3MJ9A 1FZOA 4JFHD 3V6OA 3FZUC 5SX4H 4YK4B 3SJVB 5FUOL 3PGCA 3MGOB 1XCTA 5EUOB 5EZOH 3FO1B 3ZT7A 3H9ZA 2OZ4L 5E24E 1HZHL 1W0WA 1YC7A 3DRTA 4MWFA 4EDWL 3GZKA 5E8EB 5ESQA 2JCCB 1LDPL 3HPJB 4P2OC 4P46D 3QUYC 1UXSA 4GRWF 3KPQA 5DD6B 4ETYA 2MSPA 4FZ8H 4HIJA 4OLYH 3CNKA 4QHMB 5IHUL 3BAEH 5CBAA 1JTOA 1KT2A 5H37G 5DI8B 4ENED 3D6GA 4P46A 4Q0XL 5ANMA 1X5JA 2EO1A 4KJYA 4OLXL 1I4FB 4TULL 1EEYB 1RZFL 2GTWA 2BVPB 5CGYD 3BPOB 3VH8B 4Z0XB 5FDWB 2NLJA 5EFIA 4LCCA 1SEQL 3MRQA 2HRPL 1J05B 3MRLA 3A6OA 2VAAB 1RUQL 3EFFA 3I02A 2R1YB 3MA9H 3NFNA 1RIHL 1HHIA 3GIVA 3HS0B 3QAZC 2OJZH 4RISL 4Z7UB 4IIQC 1KB5A 3SOBL 3VE0A 1B2WH 5DO2C 3RDTC 5DMGC 3FO0L 2Y5TA 5F9WB 1DQDL 5BZDA 4FTVA 5CIPB 3MRNB 4V1DD 3WDJA 4F7EB 2QADC 2VLRD 2AJZB 3S88L 2HT2D 4Y7MA 3MPCA 3QIWD 3GGWA 1DE4B 3QCTL 1IZKA 2Y72A 1TENA 5IQ9B 4MJIA 4V1DA 1G9NL 4EUPA 1CXFA 3H9SE 2VLRA 2APBA 3QDJE 4X5XA 3FB7A 2NY2D 4PJGF 4HIEB 4GOSA 3QIWA 1TJHL 2KZ1B 1U93B 1A9BB 4HBQA 4DZ8A 3T0WA 3BRFA 1QBMH 2MHAB 3CFIC 3JUYA 1KTKE 2OP4L 5CJQH 2XY1A 1OTSD 2E8YA 1A6ZA 2V7NB 4KKCC 4K3DH 1F5WA 5C3TA 1LHZA 2ATKA 4OZGA 4ZFZA 3PIQB 1ODAA 3IXTB 2H2SD 2V2WB 5E4EC 4LLUA 4H88H 3M07A 3WFCH 5TFSL 4XBEH 2MFNA 2PW2B 3FL7A 4HK0B 2EZ0D 2CH8A 3TZVC 3PDDA 3SKJL 3EOBB 4NUJA 1NGZA 3UTZB 5IQ7H 1MIEH 4PRBB 2AV7A 3PWLB 2ADGA 4HCRL 2KBGA 1NFDF 5I19H 4Z7VA 1BBJA 1C5CL 3BDXA 3Q0HA 5FHAL 5HDQH 4S1SL 1XH3A 5TE6L 3NABH 5GZOC 4CNIB 4TSBL 1JYWA 3V0WH 1QPXA 5E94B 4HV8B 2EKSB 4YDJB 5CUSH 2DTML 5CS7A 5EOCJ 3EYVA 3SE4A 3VXNB 5C07D 3QH3A 4NQED 3GFUA 1X5LA 4OZIF 3FAWA 4FQHA 5DJ2B 1QEWA 5K9OB 3VGBA 2DQCL 3LPGA 4FMKA 4QXTA 4J8RB 3U30C 4Z78B 1I9IL 3ARWA 5C07A 3VD7A 4NQEA 4A6YB 2IAND 4JO3H 3RPKA 5BW7C 1KTDA 2CRMA 3OAUL 4HPOL 4WFFE 2FATL 2R1WB 2HKFL 4MVBD 1TVDA 1UCBL 4HXBL 4UB0L 2HFFB 4MYWB 5GS0C 1R5WB 2YS4A 3KPPA 5IVNA 4N5EC 1H5BB 2IANA 3FQXA 4UOJA 2YK1L 5GZND 1LO3L 4X6BA 4ZG1A 1Q72H 2A0LC 4N0YH 1KLFA 5IVXB 2L4OA 1EVUA 3B83A 4NZRH 5IW6A 2W0FA 1ZHKB 2CGRH 1RUAL 2AEQH 5HHQB 5E2TL 4JJ5B 2XTJB 1UJ3B 4QXGH 3RAJH 4Y8AA 2F54D 1L0QA 5ADPH 2R2HA 4UI2A 5HI3C 4B5EA 4XCEB 3BIBX 2AK4D 5JXAL 3HZKB 3ARPA 1D6VL 4MNGE 5D5ME 3NCFB 4I3RL 4P5TB 1QLEH 1GSMA 3DX7B 3BEVB 3TO4B 1BIHA 3TT1H 5CJXC 5D71H 3TBVA 2GK0B 2AK4A 2NZIA 2WWMD 1QG3A 3PV7A 5FOBB 4RFOH 2V9QA 4JM4H 3U4BL 3HI6L 3MLRL 1E28A 3PGDA 1LGVA 4XCFH 3BP6A 1G7IA 1G7QA 1Z0NA 1G9ML 1XGRA 4WO4D 1K5NB 1IQWH 2MQCA 1G7MB 4U1IA 2JELH 1HHJB 4BZ1H 1XF4A 4LVOB 3JWDL 1B90A 3H9SB 4LFHD 5F8RC 5JDSB 1L0XA 5F7DA 4IOSD 2AV1B 3O6KL 1ZGLA 1TTUA 5FO8A 1CGTA 2OI9B 4MAYC 3WLBB 1A7RL 1NDMA 5CCKL 5F1OB 4XZUB 4JQVC 4F2MA 1CQKA 4GSDL 2X89D 2J6EH 3UJIL 4P23C 2R39A 1JNLH 2X42A 2HH0H 1QNZH 3QO0B 4X0KA 3ALXA 3T65B 1T3FB 4LNRA 3QZWA 3ROLA 3D5OF 4LSTH 3TYFB 1YA5A 2VZ3A 1FCCA 3BKCH 4FQCH 4NRYA 4Z7WE 3HRZB 3MOBH 1BD2E 4YHYB 2XT1B 3LQZB 2BY0A 2O5YL 2P5ED 4KY1L 4OAWA 4YHOH 1OW0A 1I75A 4OT1H 4UU9B 4O4YH 4XCNB 5HPMB 1A7QL 5E9DA 2FYYB 1U8JB 4FQXD 1AIFA 1NC2B 3QG7H 4PRHB 2GJ6B 1I7RA 5BO1L 4Y2DB 2P5EA 5I1IL 1CDYA 4GW1B 5J89A 3ECBB 4G42B 3TO2A 3BUYA 3KNBB 3WIHH 3VFNA 2PTTA 5IBLC 4FQXA 5HHME 2GT9A 1NBQA 1XF3A 3MBXH 4M1GH 1QLFA 3MRHA 3ET9F 1U8QA 1SM3L 2IADA 5J6HB 3W9DA 2OR7A 4TTDD 1IGYB 3VFUB 4PD4J 4QHLA 1TIUA 4JRYE 2I07B 5C08D 5JXEC 5EZOL 2NY1B 3V5KB 4E41B 2DM7A 4JY4A 2YSSB 4PJFE 2GFBB 3AXLB 4XC1H 4KJPD 5EBLA 4WU5B 3AAZA 4MS8D 1EO7A 5C08A 2HTLC 5EDXA 2VUYA 1S5HB 4MLSA 5LGJA 1UC6A 4NKMB 4OKVB 5HYSA 4NFCA 3GSRA 2YPLA 4M7JH 5BVPL 5I1KH 4F15C 5EU4A 3EO0A 1EK3A 3IAQA 3TBWB 2EDWA 4E42A 4M43H 1FORH 2UZYB 4LHUB 1FNAA 4WJ5B 3HI1B 3I2CH 1R5IA 5D7JB 3P40A 4DCQA 5I1DB 2WBJB 4ISVA 5M94B 4GRLB 1PZ5A 4U1HB 3HCVA 5I17A 5KSVA 3K2UH 1O0VA 3TCXA 4CDHA 1ACZA 1D6EA 1KNOB 5BZWB 5D5MB 5GS0H 1HHHA 4GBXC 1EIBA 3OAYK 1YUHA 2W9LA 2V2XB 1A9EB 3X14A 1M6OB 3IETA 4X7FC 1DFBH 2OJZL 4S0SD 2FIKB 4OUUA 5D7IF 3VFOA 1RHFA 1RZ8B 5FKPB 2X1QA 3ILQC 3TCLA 3ZKQD 1FVDB 4XT1C 2FB4H 2HJKB 4HH9B 1REIA 2YPKB 4M5ZH 1KUMA 2A9MH 4GAJH 5LXGH 4YHPB 1T7YA 2NPLX 5MP6H 3OWEA 1DLFH 3GMMB 5ALCL 5JW4R 4F9PC 1JL8A 3I6KA 1AC6A 1AE6L 3EZ8A 1Y6NR 4K94C 3ILPB 3TPUB 1X5IA 2DQEH 3IDJB 3LKPA 4XNXH 3SGDH 1ZHLB 4WGVB 2FECL 2KKQA 5F7KC 4LVHB 4G8EA 4LLMB 1QBML 3UP1A 5DEFB 4Z7WB 4LLYA 1NUFA 1BD2B 4P3CL 3X11B 5CJQL 1KJVB 1RURH 3QAZB 5LCVH 5E70A 1MQKH 4UBDC 4HKJA 3EHBC 3HAEH 4OCNC 2FO4A 5C0RH 4FFZH 1NFKA 4JANA 4I0PB 2DF3A 3QNXA 3RDTB 1ZHNB 3LZFH 2X1PA 4YXLH 1JNHA 2UWEF 4AQ1B 1CFSB 4U6XB 3JWOL 3N85L 1ZT7A 1MIEL 1YQVH 1FNHA 2VAJA 5IFAL 1MCPH 3AU1B 3H9YA 5I19L 1K6QH 5FB8B 1JFQH 1U9KA 8FABB 3PWJB 3S98A 2R8SL 5DGQA 1FDLL 1P84K 1MAMH 3RBGA 1ZTXH 5ICYB 2K7PA 3NCCB 3NABL 3RZCC 4LBEB 2VC2L 3BI9X 1ZA3A 2AEPH 2UVFA 3ARVA 4YDLB 4DUXA 2XYCA 4RMUA 1M71A 2D7TH 4LPVA 4OD2B 1N3NA 2AI0H 3EOAA 4L29B 5DJXA 5F70A 3SDDB 3QIUC 2VE6A 2ESVD 4NOFA 2HN7A 4C4KO 4M5YL 5JW4M 1XGPB 4U6TA 5E4EB 3BO8A 1F90H 4JO3L 3IFOB 1A14L 2FJHA 1WTLA 5DHVB 2ESVA 4LRNH 4C56D 3TZVB 3KPSB 2NY5C 3BFOA 1EXUB 1KPUA 3QUKB 1FN4A 1BQSA 1DQQA 3MROA 2MCPH 4C56A 4H5SB 5C0CE 1FYTD 3BT2H 2GJZB 4NZRL 3UCRA 4M61B 5DYOB 3IS0X 3VG0H 5ETUB 1FZMB 3D18B 3FN0H 1LWRA 5GIRA 2AEQL 3CUPA 1G6RA 1LK2B 4QXGL 4NZTL 4RGMC 1CIUA 1AHWA 1FYTA 1LO2H 4RMQA 4RFEB 3QEGH 5TQ2L 1QRND 2Z8RA 3B8SA 5JQHC 1F02I 4DEPB 1QVOB 1WFTA 4JJHA 4JVPA 1JWUB 3MTRA 3OAZK 4J3VA 3L3JB 1KBGH 3TT1L 5E7BA 5I74C 1Q38A 3S3SA 3SCMC 3GJFH 5D71L 4ZD3H 3RRQA 4RFOL 4EI6A 4HIHB 1SBSH 5TDOB 3O8XD 3PXJA 5J12C 1A0QL 1VERA 4FRWA 4NHCL 1WIUA 3MCLH 5JHDB 1U8LB 1XAUA 5M95B 3MRMA 4NRXA 3A6BH 5F7WC 1IQWL 4D8PB 3WFZA 1W2KT 1CQYA 2JELL 4M8QA 4HKXA 5DJYB 5CZVH 4PLNC 4ELMF 2CLRA 4X4YB 1IGMH 3RWGA 4OZHF 5EU7C 2NY0D 1IM9D 4RAUB 1FJ1B 4N1CA 1CFNB 3UZVB 1HKFA 1NCUA 3WS6A 1F2QA 4UDTA 2NW3B 5I1CH 3SQBA 3ARFC 4NKOB 1L0YA 2OJEB 4LGSB 3B9VA 3MRGB 2CK0L 1VFAB 4RBPK 1U6AH 2RFXA 3UTQB 1IM9A 1JNLL 3STLB 1F6LL 4BKLA 2HH0L 3HI5H 2HAZA 4G43A 4K94H 4LSTL 3BKCL 4MCZB 2DIJA 3BP4B 4O9HH 4ZQKA 4FQCL 4XC3H 3OL2A 3CFDB 2DM3A 3MOBL 4JHWL 5C9KA 4PV8A 1BZ7A 3CFBB 3GM8A 4H1LB 4Y4KC 3G9VA 3C2AL 4U0RC 2VDNH 3LEYL 4YHOL 4F3FB 4OT1L 2R23B 3P9LA 1CFQB 4O4YL 5IWLA 1HOCB 1AGCB 3BMWA 5CLWA 1WBXB 3WUWG 1F4XH 1RJLB 1U8NB 1UYWH 5I73C 4MD4A 4Q7DA 2IC2A 1AO7D 3OSKA 3HNSL 1A8JH 1J8HE 3L3HB 2DDQL 5SWZB 3MJ7B 4DFIA 4B7IA 4YAQA 4AMKH 4Y88A 1B4JH 4MAYB 1HYSD 3DTXB 3EJZC 4X6EA 4ZUTA 1J0HA 2OXGA 4ODBD 1I9RH 3E6HB 1AO7A 4TSCH 5J11C 5D2NA 1EPFA 1OHQA 1RUML 3MCG1 3KPLB 4H0GA 2H3NB 4AL8H 4P23B 5F44A 1S7UB 4PJHA 1NANI 2P44B 3S3PA 3G5ZA 4WWKA 2GITA 4NNPH 4XC1L 4YZFF 4EBQH 5EORH 4PJXF 4GAGH 2ICCA 1KIQB 1P6AB 1TZIA 1CE6B 1SYVB 3H2WA 1FCGA 4YDVB 3O0RL 2XQYG 2B2XL 5C0FA 1A4JA 1LDSA 3BWAB 4I0CC 4QHNA 1OAXH 3ALWA 1RUKH 4N90D 2JK5A 5F7NC 4M7JL 1FFOB 5I1KL 3V6ZB 4ZAKD 4L4JA 4OFYD 2PTUA 4CADA 4WW2B 4CRPA 1QFOA 3CX5J 1FVEA 4IRJA 4PLOB 1FORL 4HIIA 4RRPG 3WUWA 1B6UA 1D5MA 3GDBA 4H25B 4M6OL 5ESAB 4RFNB 4ZAKA 4QT5B 4OFYA 3V6OC 5I1AA 1MRCH 1ONQB 2G9HB 4M1DL 5F7HA 2BHZA 4UUJB 1MCSA 4JDVB 2NY5H 4O2CA 3UBXA 1S9YA 5GS0L 5D1ZC 5JO5B 3HFMH 4GG8B 5FA4B 5GQBA 1TVBB 1CD1A 2LFGA 4GAFB 2BMKA 1CVRA 2NX5E 1BLNA 4MB3A 1GC1C 4XPHL 1IAOB 3FQWA 3VFGH 5HHPB 1DFBL 4MCYB 2XWTA 4GG6E 4S1QH 1D5XB 3KYNB 1J0JA 3BPLB 4HS8H 1OAQL 1C8PA 4U3HA 3P4NB 5IUSA 3QDME 4HWUA 2FB4L 4M5ZL 2FWOB 2A9ML 4GAJL 1BFSA 2I26N 3D2UD 3H8NA 4UQ2A 1X3DA 3G5YB 1ETZB 1CE1H 3GKWH 5L2KD 4R4BA 2XN9B 3FB5B 4JKWA 5DJZB 4GQPH 1DLFL 5DJ8A 5I75C 1BPVA 4POZD 5FK9A 4H0HB 2G5BA 4JFXB 4Z76A 1I7UB 5I18L 1GOFA 3D2UA 3VXMD 4ENEC 5L2KA 5BJTB 3ARDD 2XACC 4LCCC 1BFOB 4PJ7F 4ODVH 4BQ9A 2DQEL 5DUPH 4AEIL 4IJ3C 1OGAB 1NGWB 2IEPA 2HFGH 4UNVA 3BE1H 1LO5A 3U36A 4GBXB 2VQ1A 3MGTA 3VXMA 4EOWL 3ULUF 1T66C 1ZOXA 3TVMC 1RURL 1Q9KB 5FUCC 4GUPB 3AREB 2O5ZL 1MQKL 4P4KD 2NY6C 3ESUF 4PYHA 5C0RL 1T0MA 5GRVK 4JLRB 1Z9LA 2EDRA 3WNOA 3MRDB 2Q8AH 5CWSB 1J5OL 1U58B 3OKOB 3LZFL 4YXLL 4DK6A 3QULB 5T1LA 1AI1H 4NWTL 1MVFA 5DHXB 5ACLA 2PYFA 1J8HB 4KUCD 2X4PB 5EBMB 4NKIH 5MEQA 1F11B 1YQVL 4LQ1A 2QR0B 1BQHA 2R2BA 2DMKA 4HGWA 4MD5B 1KENH 1FBIH 4HUUB 4PV9B 1K6QL 5FM4A 2YC1B 1JFQL 2HT2C 3D39A 3TPKA 1BMGA 4B50A 1KCUL 1MAML 4HW6A 5EU7E 4BQBA 4H26A 1ZTXL 2GTZB 4HC1A 2HWZH 4U1GC 3SEPA 2AK1H 5CINH 4CN4A 4U1NA 1AC0A 3LN9A 5DSCB 4R7DB 1MHCA 4S11A 3V6FA 1ADQH 1I1YA 2AI0L 1KIPB 2Z31D 5J1SC 3VXOA 4JFYA 3VFWA 4AG4H 4GXUN 4P2QA 1CTNA 4OJFH 1IQDA 1OTSC 1F90L 3GSOB 3DUHA 2HMID 3MA7A 5DJCA 2Z31A 1ND0A 5LGHH 5C0AD 5JOPE 5D72H 1X5XA 3LN4A 4YGVA 2OQJB 3MLVL 1SVCP 2AQ3A 4WFHD 1NCTA 4JFPA 4FQIL 2MCPL 3E1F1 3BGAA 2ZNWA 4ZYKA 1FFPB 3P4OA 3QB7C 3OZ9H 3G5VA 3L5HA 3O9WD 4NPYA 2D3VA 2HP4A 1LO2L 2NX5B 4U6YB 3QEGL 2V17H 1A7PH 3F6LA 4J2XA 2HLFC 1E27B 3QIUB 2COQA 3MREB 1GHFH 3O9WA 1RQ5A 5F1IB 4QHUA 5BV7C 5AUMB 4JM2C 3KYMB 3T0EA 1KBGL 3PHOA 2X4SB 1WAAF 4PRNB 3U48A 2BFVL 4BK5A 2BSSB 5L2JB 2FL5B 4ZD3L 4OFDA 1K4CA 3QDMB 4HK3J 1SBSL 3MNWB 5EO0B 1Y0LA 4G6FD 4MQ7A 4P2RD 2Q3AA 5E0QA 1OCWH 3ZHKA 5HJ3B 3A6BL 5HYJE 1LEGB 1GC1H 3F7VA 4PLKD 1S3KH 2BJMH 5CZVL 1KG0A 2F58H 2APWA 2XZCH 4NHUB 5E03A 1JPGB 4G5ZH 4EXKA 5SWSB 3RGHA 5I6XC 4JFDB 1JCKA 1NEZG 1R3KA 1MJJA 2DQFA 3BDYL 3V6OE 4C59B 5IMOA 1RY7B 5I1CL 1YNKH 5D7IA 1IC5L 3KG5A 4DW2H 4D0BB 2ZPKH 1U6AL 5BQ7A 2DLIA 1OWRM 2IH3B 4PJ9A 3HI5L 5HYQA 3ZDYE 3SCMB 5MEPA 1WITA 4KDVA 5IK3A 4K94L 5I2IB 1BJ1J 5D1XC 3H9HB 3QPQD 2H26B 4O9HL 4XC3L 5IF0B 4ONFH 2BNRD 2DKUA 4XPAL 2XG5A 3MV8D 5EBWA 2A73B 3DI2B 4PGDA 5D7SL 2WWMC 1T20B 2XKUA 5TE7H 1T04B 3NACH 1Q9WA 1U8MA 4WDIB 4JHAH 1CYGA 5DMYA 4NO3B 3QUZC 2ZOLB 3D3VB 3BVNA 1UYWL 5DMKB 3GSVA 1RZGB 2IALA 4U6VH 3J7HA 1BOGA 4WW1A 1XR9B 1FH5H 1N0XH 3QA3A 4AMKL 4HHAB 4ZFGH 1J11A 4J7RA 5E8NA 2QKIA 3PWUB 4KROD 5DMIH 1A4KB 3G5XB 1K8DB 1X5ZA 1NEZA 2FZ3A 2CDFB 4AL8L 1UXWB 4QRRE 5KOVC 1Q94A 5I66B 4ZO8A 5D4QA 1C1EL 4J6RH 1QFUL 3IF1B 3HUJA 4EBQL 3EFDH 2A6KB 3MLSH 5EORL 4LSPH 3OB8A 5GJTH 4CVWA 5FUCE 2HVJA 1MWAA 1WZLA 2Y23A 3O6LH 4U0RB 4D9QD 4L3CB 4KVCH 3E6FA 1MY7A 3OG6B 4HUWB 4DFHA 2LABA 2GW5A 3FQTB 2NTFA 3SE3C 1LP9A 5H8DA 3W9EA 1RUKL 4FTVE 2V7HB 4XGZB 2WUCH 2HFTA 1NCWH 4HKBA 5GHWH 4EI5D 2ATPA 4ZUWB 4L4VD 1UJTA 2D03H 4IRSB 5JHLH 2FGZA 1S9KC 5KSUA 2J1KA 5DR5L 3C5JA 4X6CF 4MJIE 3WIFA 5IJVB 1BX2B 3NCEB 4JZOA 1WQVT 1MRCL 5E1AA 3KR3L 2W1NA 3UTSD 3RU8H 5J11B 3OKLB 4EI5A 2NY5L 3QI9A 4OCXH 2IPTH 2R56H 2Z8WC 3JTTB 4PY7A 3VWKC 1KN4H 1RZKH 3PL6D 1JPSH 3BH9A 3ZE0E 3HFML 4FQQA 1Q9LB 5KVEL 1KPVA 4XI5C 5L8KB 1ERNA 1WZKA 3S36H 5DRZA 3MACH 1T1YA 1YYMH 2M1KA 3Q5YA 1CZ8H 3PL6A 4S1QL 1ZLSL 4OZGE 4JN2A 4XCCH 4JCMA 4XVUC 3U0WL 4XXCA 4RMVA 4HS8L 1VACB 2Z9TA 4DGVL 5BS0D 5T1MA 3HC0A 2A38A 2WIIB 3EKCA 3LV3A 1QYGH 3FRUA 3GKWL 1CE1L 3B3IA 2C3VA 3PV6A 4UDUB 4R2GD 4JFED 5BS0A 1JK8B 1MHHB 4GXVH 4PGEA 1BREA 1PY4A 3CX2A 3PGCB 3I75A 1XCTB 4KRPC 3CDGB 1AR1D 4ODVL 3I50L 4JFEA 4GRMA 3LS5H 1A3QA 5D1ZB 5GS2D 3KLDA 1JRHI 1OB1A 1W0WB 2HFGL 3RVVD 3BE1L 4KKAC 1OP3H 3T0BA 5E2UH 3DRTB 4TSAL 3OJVC 4MWFB 3SKNA 5DT1H 5KZCD 5ESQB 3VDAA 1T5WA 4YGAB 3SGKC 1UXSB 3S4SA 3KPQB 1X5AA 1KN2L 2Q8AL 3IJSA 2FGWH 4HIJB 4M03A 1NLBL 5CBAB 1AI1L 3WJLC 1KT2B 1EEZA 3K80A 4P46B 3GUTA 2XXCB 4JPKH 4KJYB 4LQFH 5I1JL 4O02H 4YFLF 4H0IA 4GT7A 2GTWB 3NPSC 1CN4A 4UINH 1KENL 1FBIL 4HX1A 3P0GB 3IFPA 1NBVH 4P3WA 5EFIB 4LCCB 2AGJH 1RZ7H 2VH5H 5JORB 3MRQB 4IDJH 1S78D 4W4OC 2XFXA 2HWZL 4MLIA 3MRLB 4RGOL 3I02B 3NFNB 4HFWA 3ZHLA 1HHIB 3GIVB 4OSUH 1ZGLM 3NA4A 1ADQL 4EEEA 4KAQH 1KB5B 5EU6D 4XXDA 3VE0B 2NY6B 3CX5K 3DBXA 2XQBH 4AG4L 4AYFA 4PJIA 2H9GB 1ZSDA 3MV7D 4OFKA 4OJFL 4MXVF 5C0BD 2Y5TB 2VITB 4FTVB 1G6VK 1HILB 1A1OA 3BN9D 3PF2A 1C5BH 5SV3A 3TYGH 5EU6A 4NO0D 2M8XA 5FYKD 3LDBC 1D3CA 2G5RA 1ZLVK 5D72L 2E7HA 4ODWB 5BVJA 4DKAA 3GGWB 1FE8L 5DEZA 3CSYA 4MJIB 4V1DB 4EUPB 43CAA 2ADFL 5C70A 2VLRB 4U1SA 5D7KE 3L5WA 4XNUH 4X5XB 5GRZA 3FB7B 2Q86A 4HPYH 4KMTH 1ZMYA 3MOAH 3QIWB 3ULVF 3OZ9L 4U1GB 1IM3A 4DZ8B 3BWUC 1SEBA 3RUGF 2YD9A 2FSEA 1A6ZB 1ZGLP 2V17L 1A7PL 1DL7H 4LU5H 2ATKB 5IM7A 3FAXA 1GHFL 4OZGB 4ZFZB 2FO1A 3QDGD 3U0PA 3KPRA 4LLUB 1JPST 3O6FC 4KKBD 1WBZA 1OARH 4PPTA 1JVKA 3DV4B 3V6BR 4HULB 2XWBA 3OJDA 3OR6B 4WVRA 3T0VA 4UNTA 5LGKA 3QDGA 1YY9D 4NUJB 1NGZB 5E9DE 3P9MA 5DFVC 3F7PC 2AV7B 2ADGB 1J12A 3RZWA 5C3LD 4Z7VB 1GC1L 1NCBL 2P5EE 1BBJB 5TDNB 1AKJD 1EVTC 3PXHA 2BJML 1YZZA 3GSNA 1XH3B 4G5ZL 4KMQA 4J12A 5KANG 1AHWC 5CEYA 3EYVB 1E0OB 3S97C 3QH3B 2BVYA 1YNKL 4FQHB 4DW2L 4NOBA 1QEWB 3V4UL 2EDTA 2ZPKL 5HI5D 5CGMA 3U6RB 2EEAA 5FGRA 5BV7B 4QXTB 1CCZA 5C0GA 1U3JA 4JM2B 4PJBA 2Y07L 5GGTH 5C07B 3KDMA 3FFCD 1W72H 4ONFL 2QSCL 1OOAA 1AXSB 1AJ7H 2D9QB 3KPPB 1DP0A 4JREC 2IANB 3FQXB 4GKNA 4L8DB 4ZSOA 5TE7L 2YPLE 4JHAL 2BY3A 4LL9A 2XOTA 3T2QA 3IRPX 5IW6B 3MLUL 5IW1A 2DD8H 2W0FB 2DJ4A 2JB6A 2AS5M 3B5GA 2YOCA 2DQGL 1TQCC 5FUZH 5T1KA 1FH5L 2ILLA 4DGYH 1RJZA 3R1GL 5DRWA 2R2HB 4ZFGL 3RVWC 3QJHB 4M1CD 5DS8A 3JVGA 5DMIL 4LVEA 1JGEA 4MZ3A 4ODXA 1IAKA 1NMCC 3TBVB 3SO3C 4FMFA 4YHLH 4X4XA 1TFHA 4J6RL 5D1XB 3EFDL 3LD8C 5GJTL 1E28B 2XV6B 3PGDB 3BP6B 2CO7B 2UY7A 3LEVH 1G7IB 3O6LL 3ISWA 1G7QB 3CMGA 4ZOCA 1XGRB 3G6JF 4YIQA 1JV5B 1IAMA 1ED3A 4U1IB 5HHOA 3OAYH 3GI8L 3WXWH 1XF4B 2N56A 4KVNH 2BVOA 3QQ9C 5HHNA 5F7DB 2DQJH 2H32H 2FJGA 2IBZX 4KI1A 5GHWL 3BKMH 3K2MC 1ZGLB 3HPLA 5FO8B 4Z95H 2D03L 1R3HB 4PGJA 2ED9A 4I48A 4JO1H 4ZTPL 1NDMB 3SDXE 4F2MB 4MAUL 3RU8L 3MOQA 3LY6A 3EDKA 3QCUH 4U1MA 1J9CT 4NCC1 4X6DA 2IPTL 2R56L 4X0KB 1UADC 1IARB 4YHIA 5CLTA 2DLHA 4TN9A 1JTTA 1KN4L 3QZWB 4LNRB 4WWKC 5E99H 1JPSL 1FAIH 4NRYB 3WD5H 3D9AH 2JJSA 3QXVA 5C09D 4OAWB 4ONGH 3FT2A 1CZ8L 1T2XA 5I8OH 5GS1A 3IAGC 4KTEH 5E9DB 1FO0H 4KMLB 5FYJD 5EU5A 4F33B 2J4WH 4RMSA 2D7PA 2EXYC 1FHGA 2EDLA 1UWEH 3LKRA 1I7RB 5JPNB 2P5EB 2VLJE 3TO2B 3OXSB 4IRJC 4RX4D 3BUYB 5BV7L 3VFNB 1CLYH 1F58H 1H8SA 2PTTB 3L3OA 3UTTD 5T3ZH 2GT9B 1XFPA 1XF3B 3LSOA 1BM3H 4BELD 1QLFB 2HG5A 1U8QB 4LKCA 2IADB 3F58H 3W9DB 4GXVL 5KSAD 1KV3A 3UTPE 3MV9A 4H20H 5GRJH 4QHLB 1CFVH 1KB9K 3NZ8A 2RCSL 3UTTA 4RWYL 1L7TH 5CEZE 4LEXH 4JY4B 4TNVF 4YX2H 3FO9A 4WI3A 1JGDA 5EBLB 3AAZB 1SJVA 1KJ3H 1KXTB 1WIPA 5C08B 2C9AA 3CDFA 3K81A 5DT1L 5LGJB 5DK0A 3SGEI 4ETQA 4NUGL 3W11C 4JGJA 4G6JH 5T3ZE 5HYSB 3GSRB 3OKNA 2YPLB 4DQOL 5EU4B 1LQSR 3G04A 4GRWH 1IEBA 5AWNH 4BYHA 4R8WH 4E42B 4OCWH 5FM5M 1Q8MA 3ZHDA 1QSED 1BZ9A 2EIZA 3BSZH 1R5IB 4JDTH 3U82B 4LQFL 4DCQB 4ISVB 4KKLC 1NUNB 1WWAX 1PZ5B 3UO1H 4PY8J 5I17B 4UINL 4K8RC 3N1FC 1QSEA 3NCJH 5KSVB 2VXQL 5CGTA 4LNVA 4KRPB 2VH5L 1AD9A 1DDHA 1PBYA 2A9NL 1HHHB 1MJ8H 1YUHB 1PG7X 4M4PA 3IETB 3MLZL 3BZFA 1EA9C 4OSUL 1F3DJ 4XVSH 4GRWE 2GYSA 2X70A 3DGCR 4OUUB 4KAQL 3VFOB 3VXUD 2ZWLT 4YC2C 4OIIH 3KLAB 3UAJD 1QA9A 5MHSE 1KCSL 2XQBL 3TCLB 1DBML 4WV1A 2VISA 4WHTA 4R90H 5CSZA 3U9UA 5H94A 1GOHA 3QEQE 8CGTA 4WI5A 1SBBA 1NANH 2VWEC 3VXUA 4S1DC 2R0ZH 1GJIA 3TYGL 15C8L 1OAYL 5LVEA 4I9WE 3OAZH 4KK6D 4XVJH 3SKUD 5F3BA 2HT3C 2B4CH 5I15H 1RZJC 3VRJA 3I6KB 3OPZH 3I3DA 4F7TA 2R29H 3NPSB 5D2LA 1MFDL 3BD3A 3TV3L 3LKPB 2PF6A 4HPYL 1FL6A 4KMTL 3KLHD 4N5UA 5GGVY 4HD9A 2IBZY 3FN9A 4G8EB 4BK4A 1KCKA 1NGQL 1QHOA 1YC8A 4LLYB 3K1KC 1I3RA 3DOSA 4XB7A 2D9CA 4LU5L 4LCUB 4HKJB 4F9LA 4WUKL 5JW3H 3MUZ1 3MMEA 3SY0A 1FIEA 4JANB 2E7MA 1BJMA 4OM1H 5I0ZA 1OARL 2AJUH 2KH2B 4HJGA 5TPWH 2V9TA 2VLJB 4RBPH 1J0IA 1ZT7B 4Z7OF 1YEHH 2DS4A 3LDBB 4GH7B 3SKOA 5FOJA 4OGAD 5C0JA 4HUMB 3OXRA 3IVKA 4LAQH 2NZ9D 3LKNA 1KACB 1ACYH 2DLGA 4XH2A 4LLDA 1LO0H 1WZMA 3SJVD 2AAVA 1N6UA 1RMFH 4G6AC 1PLGL 5BRZD 1TXKA 1ZA3B 2ICEA 1NKOA 2Z93A 1QZ1A 3W0WA 2EDOA 4X7TA 1M71B 1N3NB 3EOAB 5DJXB 2VE6B 3BQUD 5BRZA 6CGTA 1IE5A 3LKSA 1XIWA 2WQRA 3T0EC 1VADA 3EYSL 3BO8B 3O6FB 5DQJA 5CBEA 3IKCA 4X9BA 2VNCA 1JHKH 2FJHB 2QL1A 4HCRA 5J6GA 3BQUA 1W72L 5MI0B 1QFWI 5EPMB 5IR1A 3Q48A 4NO5A 1JZ8A 5E8EA 1KPUB 4Y19D 3UJJH 5ITFA 3DETC 1DQQB 3O3AA 3MROB 4OLZH 4C56B 4Z77A 2YUVA 2PUQT 3O2WH 4BQ6A 3O3EB 1ZA6A 4CMHC 5GIRB 4Y19A 4OB5H 5KOMC 5FUZL 5DI8A 4FXGA 1G6RB 4ZS6D 1HIMH 1SJHA 1AGBA 4OZIE 2CKBH 3C5ZC 4GKOA 1HK6A 4DGYL 1AHWB 1FYTB 4ZOAA 4YDIL 4MXQD 5C0ND 1FNGB 3BZEA 2C1PB 4Z0XA 1GH7A 4PJ9C 4KC3B 3P0YH 4D0CB 3CLEH 4X9IA 1J88A 4LSVH 5K93A 4G6MH 5CD5D 4PB0H 2AJVH 4YHLL 2VAAA 4EI6B 1Z5LA 5D70L 2HJFA 3DLQR 3VD4A 2R9HD 5IGXL 1SJXA 1RU9L 3MRMB 4NRXB 1E6OH 1L7IH 4JREB 1DLHA 1KJ2H 4BUGA 2ZCLH 4XBPB 3FQUA 4KVNL 5L88L 2CLRB 2W65A 4OBRA 3RVTD 3I3BA 2PXYC 3JSSA 2DQJL 3RWGB 2AJZA 4XAKE 4Y5XA 3BKML 5K9KA 3O6MH 1OGTA 1BBDH 3ZDZF 1CGSH 5DTFA 4JO1L 4UDTB 4U1LA 4K2UH 3EYFA 5IQ9A 2B0SH 1I3VA 2DQTL 2NXYC 1IM9B 3QCUL 5DWUL 1RZJH 1C12A 2FHFA 4G43B 3L7FA 3FRPA 1MCOH 1FAIL 2ZUVA 4ZQKB 1X5HA 2BRRH 4Y16A 3WD5L 4PV8B 1BZ7B 2FLBT 3D9AL 4YFLI 5F7LB 3LD8B 1FLRL 2W0KA 2NXZC 5CEZL 4ONGL 3P9LB 1TCMA 5I8OL 4KTEL 2A1WH 1HINH 4LSRH 5KW9H 3QPXH 2J4WL 1LNUB 3TLRA 1UWEL 4MD4B 5B4MC 4TVPH 3ZYIA 2VWEE 1CLYL 1F58L 2AXJA 4YAQB 5T3ZL 1FQ9C 4PRBA 1BM3L 4ZUTB 3PWLA 4DN3L 5JPMA 2NY4D 1IILE 5D2NB 3D39E 5C7XH 2WP3T 4JO2H 3QI9C 3T0DA 4HJ0C 1CFVL 4KUZL 4X8XA 1L7TL 5GSRA 4KRNA 2R0WH 5E2WH 5I8EA 4LEXL 3SDYL 3G5ZB 4YX2L 4WWKB 2GITB 1P9MA 2VR4A 1RFDH 1KJ3L 2EKSA 1HQRA 4M93C 4U49A 5GISH 1TZIB 1IC4L 1AGDA 1G0XA 3VGGA 5K9OA 2IPKB 5C0FB 4P2QE 1A4JB 4AENA 2Y6SD 1ZXQA 4QHNB 4PYGA 3KAAA 4G6JL 5E7FA 3RGVC 4Z78A 4KJWC 2JK5B 1ZV5A 2XG4A 5J56B 4DAGL 4CADB 4R8WL 4OCWL 1FVEB 1OL0A 5INCB 4IRJB 4HIIB 3WUWB 3B2VH 2R1WA 1D5MB 4J4PC 2EXWC 4JDTL 4ZAKB 5B3NA 5I1AB 1A6VH 1IRAY 3UO1L 2E27L 3H42H 1OT1A 5CP7A 3G9AB 4X4ME 1CDHA 3GSQA 1IGTA 3NCJL 3X3FH 3EO1A 3R8QA 4Q9QH 3UBXB 1S9YB 5DJ0A 4P5TD 1CD1B 1UJ3A 1MJ8L 4JE4B 2BMKB 4ODUA 1BLNB 3SE9H 3QIBA 4XCEA 3FQWB 4KU1A 5KAQF 2XWTB 3FQNA 4L8SC 3UXFA 4XVSL 3DX6A 5F96H 3WHXA 4XPGH 3T0EE 4QF1B 4UT6H 4OIIL 1UQSB 1UZ6F 2VKWA 4KHTH 2ZKHH 2UVEA 4R90L 1VEOA 2I24N 4UQ2B 2R0ZL 3H9SD 4R4BB 2P5WE 2ADJA 1JBJA 5DJ8B 5FKAB 2C1OA 3QDJD 4LP5A 2MTPA 1GAFL 5FK9B 5I15L 2G5BB 1UH3A 4Z76B 3OPZL 4WI9A 3D2UB 5ESVA 4UV4H 5L2KB 4MJ6A 5GRWA 4OD3H 5JDSA 3L6FA 4KTDH 1CU4H 3QDJA 4U33A 4GMSH 1LO5B 1M7DA 3KPOB 3U36B 3MGTB 2VQ1B 3QHFH 5D7IE 3LEXA 5GGRY 4H8WH 1MLBA 2OMNA 1TQBB 3BZ4A 1HDMA 4XHJC 2GEEA 2EIDA 1NCNA 1T0PB 4O5LH 1JZ4A 4YC2B 2XXMB 1T0MB 1T3FA 4OM1L 3DVNA 4EKXA 1NLDH 3U83A 4HIXH 3VW3H 1E4KA 4IOFD 4PLJC 2V9RA 2AJUL 1BP3B 5T1LB 1PQZA 5TPWL 2PYFB 4Y2DD 4XP6H 1YEHL 4PJ8C 3UJTH 4PGZA 5MEQB 1BIIA 1UKTA 3VMPA 2VDRL 4N0CD 1BQHB 2R2BB 5I1EH 4HGWB 5I1LA 5J1TC 5JZ7C 4LAQL 3D39B 3KHOA 3V52H 3WS3A 4Q6IC 1XR8A 5F88A 3TM6A 1H3TA 3WDHA 2E7CA 4H26B 4JVWA 1KXQE 3ZTNH 3KNBA 1EBPA 1ORQA 4MJ2A 5ICXA 1RMFL 2Q3ZA 4U1NB 3WKMH 2NY1D 2X9YA 5CP3H 1MHCB 2YMXH 2DWEA 3V6FB 5J4MA 1I1YB 5ERWB 2YA1A 2PN5A 3QWQB 2W91A 3VXOB 1IAII 4I18A 4JFYB 3VFWB 2UWEE 4WFFD 4P2QB 1CDBA 3ZMRA 2YSSA 1IQDB 1DBAH 2GFBA 3AXLA 3WO3B 4FNLH 3C60D 3MA7B 4JPVL 1N7MH 3BP5A 5DJCB 1OTUC 2JIXD 3P0VH 2X1XR 5CHNA 3RKDD 1ND0B 2CK2A 1JRHH 1KFAH 3LN4B 4UV7L 4YGVB 1ZLWH 2DLTA 4LHUD 3C60A 1B0WA 4JRXA 4OKVA 2JIXA 4JFPB 5D7JD 3QRGL 2SEBA 4HWNA 4CUCA 2XPGB 2RAMA 3O2WL 3FZUD 2XNAB 3G5VB 4OB5L 2F5BH 5D7JA 5KSBF 2CKBL 5I1DA 3HR6A 1I3UA 5C0IA 4O58H 4AEEA 3JV5A 4X83A 4BJLA 4LPCA 2EDQA 3TIEA 4MNGA 3O9WB 3P0YL 2WLZA 4QHUB 5DQ9B 3T0EB 3EDDA 3PHOB 3LRSA 1ZHBA 4LSVL 4G6ML 4ODTH 4K8RL 2BHYA 2AJVL 4P2OD 1K4CB 2V2XA 3QUYD 4PJAF 1E6JH 1Y0LB 4LMQI 4MQ7B 4AM0A 5L8JB 4KTYA 3T77A 1E6OL 1L7IL 2EDYA 4P2OA 3F7VB 3QUYA 2ZCLL 5JIPA 4DWHA 4J3OC 4G6FB 2IFGA 2GQHA 1KYOJ 4CMHB 2X10A 3D48R 3ULUC 4GAYA 1IT9L 5BS0E 1TMCB 3NFSH 1BBDL 4NQCE 2DQFB 3M8OH 3UC0H 5IMOB 4HWZA 1JZ5A 4RSVA 4FQ1L 4F37K 5D7IB 3H0TA 4YJZL 2ZUWA 5KBNC 1S9WB 2VL5A 5BQ7B 5F71A 4MJ5A 3K8MA 3IDJA 1BD2D 3GEWB 4PBVC 4PJ9B 5A2LH 1YEKH 4DJMA 2ICWA 5HYQB 1RZJL 4OM0L 3S96A 5I1GH 3B43A 5IK3B 2YUWA 1MCOL 5LWYH 3M1BA 2J8OA 5C8JA 5DEFA 5DO2D 3RDTD 5DMGD 4PGDB 1DJSA 5EG6C 1ZLUK 5L7XH 4ELME 2QADD 4IIQA 2A1WL 1Q9WB 1U3HC 1U8MB 1HINL 4D0DA 4LSRL 4L3EE 4OZHE 5KW9L 1CD8A 3QPXL 3SDAA 5DGRA 1WBYA 2R0KH 3BVNB 5HHMD 3RDTA 2DJSA 3GSVB 3WFBH 4JKLA 1CFSA 3E8UH 1BOGB 4WW1B 2J6EA 1SHMA 3MUGA 5T3XH 3VD9A 3MNVA 4ZNCD 4HSQA 4JRYD 4QNPF 3LHPL 4FQ2H 5E8NB 2QKIB 1UKSA 3RBSA 1N6VA 1NEZB 1C16A 2FZ3B 2X09A 1Q94B 4JRYA 1TPXB 3FQRA 1I8IA 3REVA 4KKCD 1INEH 1RAMA 3ARGC 2A6JB 4PJFA 1SY6H 4X5LA 3HUJB 2NW2A 2YD7A 3U46A 5HHVL 4PTTA 2GY5A 1MWAB 2HVJB 3BZDA 4I1NB 1IZJA 5EZLA 1T7XA 1GGIH 3OB0K 2ED7A 1VGEH 3TZVD 2NTFB 3RIAK 5T3XE 2Y9RT 3T0AA 2BOCA 3WIHA 1LP9B 3W9EB 2PO6A 2I5YL 3DIFA 3IFOA 5EU6E 1HHGB 3P11H 4HKBB 2ATPB 2CRIA 4LSSH 2CDEA 1AGEA 2IGFH 4PS4L 3V95A 3C5JB 3WIFB 1A6VL 5EUOF 5GZOD 4JZOB 1XGYL 3H42L 5E1AB 4NQDA 1CI5A 4EI5B 4Y1AE 1OQXA 3X3FL 4H5SA 2KQNA 3QI9B 2YPVL 5T5NG 4YZFE 4MXWH 1YMME 2GJZA 4KJQC 5AEAA 4Q9QL 1A6WH 4PJXE 3BH9B 4FQQB 1KPVB 1WIOA 2JCCF 3JBG7 5DRZB 4XWGH 2V2TB 5ILTH 3FT4A 1QBLH 4D2NA 4JN2B 2VDOH 5F96L 4LASH 4XPGL 3KPRE 4UT6L 2IPUK 1NQBA 2XA8H 2IQ9H 3HMWH 2BSED 1AQKH 5FO9A 5T1MB 1CT8A 3U1SL 3HC0B 4KHTL 2ZKHL 3U79A 5GS0D 4N5ED 1KLGA 4YWGL 4CVUA 3CFKA 3LV3B 4KH2A 3FRUB 3V8CA 3GSXB 3B3IB 2C3VB 1T1XB 2A0LD 3PV6B 5BS0B 2B5IB 2XKNA 2ITCA 3IKKA 1L6XA 4NQCB 1S7SA 4PGEB 3I75B 4UV4L 5HI3D 4OD3L 1U8KA 4X4YA 4R2GB 1JHTA 4KTDL 4JFEB 4HGKC 4GRMB 4LPTA 3NN8A 4GMSL 4KI5F 1H8OA 4LOUC 5CFHA 1OB1B 5HHXL 1FFQA 1CFNA 3PWVA 3FFDA 4JHBA 4Z7UF 3SKNB 3BYYA 3T2PA 2OK0H 1KELH 3ULUH 5EZJA 3ZKMC 4PJBE 4O5LL 4R7NA 2HKHH 3OF6D 3S4SB 3SBWC 4OCLC 1NLDL 3IJSB 4HIXL 3VW3L 5KZCB 4NC2B 3VXRE 3WFDH 4JO4H 3R0NA 3R4DA 5E6ZA 3NOIA 1EEZB 3CFBA 5L9DH 4H1LA 3GUTB 5A3IC 4P2CG 2YKLH 3OF6A 4UTAH 4ZSOE 3UJTL 5KVFL 4P48A 4HGMA 1DBKH 2DQDL 5FM5O 5I1EL 3NCYP 1QR4A 4HX1B 2YEZA 1MWAL 4MAYD 3MLYL 1WJ3A 1YNTA 3V52L 1F4WL 4Z0BH 3ULUE 3BDBA 2XFXB 1JP5A 3L3HA 4P23D 2A83A 4YXHH 3WKML 4XBGA 4LCIH 4HFWB 3HAEA 2JB5L 5FF6A 1CGWA 1A6AB 1TITA 2ARJQ 4MA7H 3TESA 5A1AA 3UDWA 1QP1A 1U92A 4F9LC 3MFGB 2DM2A 3DBXB 4Y5VA 4PJIB 1JN6B 4QRQA 1ZSDB 1I85A 3INUH 5IB2A 2C7UA 4OQTL 4UT9H 3HB3C 1NKRA 1WISA 4FNLL 1A1OB 2X7LA 5EU6B 4TUOA 4PJCF 5J9PA 1JRHL 1YEIH 1LEKA 5C0CD 3TJHC 5BVJB 5DVNA 3IDMA 5HHOE 1IC7H 3CSYB 3GMNA 4XP9H 5IBLD 43CAB 4HWEH 4U1SB 1BVZA 3DYMA 3L5WB 4URTB 3SGEH 3V6ZA 5KAQG 2Q86B 5C0CA 3LH2H 1HSBA 1NC4D 1UH2A 3LVEA 3BX7C 1IM3B 2F5BL 4NZUL 3WN5C 3K4AA 5JXED 2Y25A 1AY1H 4F7CA 1EAPA 1SEBB 1VDGA 1QLRA 4LHQB 2FSEB 1ONQA 3IU3A 1Q1JH 1NC4A 2H41A 3DHJA 2OR9L 4X6DE 2EO9A 2ZUXA 1XIWC 5IM7B 2HTLD 3VI4F 3U0PB 1YEEL 3KPRB 3IS1X 4YPJA 4GMTH 1WBZB 4ZOBA 4WI4A 4ONHB 3HZMA 7FABH 1UGNA 1B0RA 4K7FB 2XWBB 3OJDB 4JZJA 3RI5K 1E6JL 1D9KA 1NSNH 3QDGB 2VLME 3P9MB 1D5XA 1QPPA 3W5NA 5DK2A 3LOWA 5IVXF 3X17A 2QSTA 2X4NA 3RL1A 1O7VA 2CKNA 3RTQC 1UWXH 2QEJA 4LIQE 3GSNB 2OMBA 5C6TH 2Y1VA 4N1EA 3P2TA 1WFNA 4TUKL 2DMBA 4KK8C 2VDLH 2D4FA 4I13B 3HC4H 3NFSL 4I77H 3M8OL 4OGYH 3GMRA 1FPTH 3RWEA 5EO1B 1V7MH 4NKDA 4BZ2H 3MV9E 5JMOC 1JNNH 3GJFA 1I7UA 1OSZB 4GBXD 5A2FA 4E0RB 4OUOA 5C0GB 1YEKL 3CIQA 4PJBB 1MFBH 3KDMB 1N4XH 4ERSH 2CDGA 2IF7A 5LWYL 1D5ZA 3AM8A 3AGVA 3VXRB 3ILQD 2ZG2A 3G08A 3IXAA 3O2DH 2VIRA 5IB4A 1MH5B 1EJOH 4PG2C 5I30L 1BGXH 3LCYA 4P9MH 2KUTA 5L7XL 4GKNB 4ZSOB 5C6PB 3DVIA 1T1WA 3P77A 3V7AG 2EDXA 5B8CA 2R0KL 3PHSA 3FO2A 1U58A 5IW1B 2JB6B 1MREL 4U05A 3T4AA 3E8UL 4XNYH 5T1KB 4M6MH 2BDNH 5T3XL 1RJZB 3AMKA 3TBTA 4X9GA 5DRWB 1T7WA 4PV9A 5DS8B 1UCTA 4L9LC 4Q9BA 1CDUA 4K3HA 3MLWH 5LQBH 2HA1A 4MZ2A 1JGEB 4YFDB 1CG9B 3CVHH 4ODXB 4WTZA 1IAKB 2OTWA 4BM7A 2BVQA 3T8XA 3RY4A 3EDEA 1INEL 2QBWA 4UBDD 4U0QB 3EHBD 1FC1A 4X4XB 4Y16C 5DSCA 4ZFOB 4P3DB 5ADOH 3KPMA 2LU4A 1KIPA 3BMVA 3KS0H 1GGIL 1BFVH 3MRCA 4TOYH 1VGEL 4YIQB 1ED3B 5HHOB 2G2RA 3ULVC 2BVOB 3QNYA 4P9HH 5HHNB 1FNLA 2FJGB 1RI8A 2B20A 1FFRA 4LSSL 3ES6A 3REWA 3VMOA 4WIQA 2ZG3A 3HE7C 4N0UE 1FL5A 1CL7I 1UWGH 4I48B 1NCAH 2IGFL 3WUZA 1QFWH 4C83A 3RZCD 1DVFC 3C6LA 2DQHH 1OP5K 4PRIA 1A3RH 2NX5D 4U1MB 4MXWL 4X6DB 4YHIB 2QHLA 4HMCA 1A6WL 1MF2H 4J1UA 1M7XA 3QIUD 3PWPE 4M7LH 3RZCA 3T2OA 3GSNL 3VG9B 2NX5A 3K8KA 2CXGA 4XWGL 4JFQA 1YPZA 1QBLL 3FT2B 3QDMD 2VDOL 2VUOA 4GG6A 3QIUA 4LASL 2C3XA 5EU5B 1KYOK 1C7SA 1UEYA 5DUMH 4JQXC 2X4SA 3LKRB 1AQKL 3RVUC 4TUJA 2VLLA 4X6CE 4PJEF 4C55A 2XY2A 2PCPA 3MNWA 5T5FL 1TETH 2FCBA 2YR3A 3L3OB 5A16A 1WCBB 5J13C 3LSOB 3GI9L 4R0LC 2NYYC 2HG5B 2Z91A 5AYUH 2F53A 4LKCB 4DN4H 5D5MF 3JZ7A 3VWJA 3MV9B 4YDKH 3WIIL 1QFPA 3NZ8B 3UTTB 3ARXA 4GXUM 3HG1E 2DIAA 3SDCC 5BMFH 1A2YA 2DN7A 1MIMH 3ARYA 5SX5H 1JGDB 3W0WE 2F8OA 3EO9H 4W81A 4Y4HC 3QIBC 1YEFL 4P2YA 1CK0L 3SCMD 4P5KA 3QG6A 5DJ6A 3PQYE 5DA4A 3IJHB 4HS3B 3ULUL 5DK0B 1CDJA 5A40E 4ETQB 5D96C 2CO6B 4WY7H 5EB9A 1R3IH 2YD3A 4UIKL 2HKHL 3OKNB 2V5SA 5TQ0L 3MCKB 4JDZA 4QWWC 3TN0A 3G04B 2Q8BL 1IEBB 1AR2A 4JO4L 5A2JH 1X5GA 5IF0A 2ZOKA 5DVKA 1BZ9B 4WUUE 2EIZB 4OGXH 1IL1A 4YBQC 5L9DL 3ARZA 3WDIA 4R4NC 5T1DH 4UTAL 1T20A 3MLTA 4ZFOL 4WDIA 2ICWJ 4NO3A 3F7QA 3QWOA 3WO4B 1INQA 4K3JH 5C0DA 3ARFD 1A6TA 3VA2C 2YA2A 1AD9B 2WMPA 1DDHB 5EC2A 4KPHH 4Z7WF 1XR9A 5A43C 3GMQA 2KZWA 1OY3B 1CIDA 2VZVA 4KDTC 4LCIL 1OWWA 1RVFH 1D5BA 3BZFB 4CN1A 4RDQF 3ARFA 5HGGS 5D9SA 3B4NA 2X70B 3QFJE 3IDNB 1S7XA 4OI9A 3CU1A 3H3KA 1GRWA 1QA9B 5GGQH 4Y4KD 4WV1B 2VLKA 2VISB 4FFVC 4JN1H 3INUL 4WHTB 5JOPD 5CSZB 5H94B 4UT9L 3AROA 1CLZH 4Y4KA 1X5YA 1MEXH 1YEIL 5F3BB 2W9EL 2DB8A 3VRJB 3ZYZA 1IC7L 4F7TB 2W9DH 4XP9L 5D2LB 3EJZD 3CDCA 3QUXC 1FL6B 3TGXA 3LH2L 3C08H 4PJ5E 1A5FH 1ADQA 3QEHA 4S10A 3ARBC 3L3GA 4DK3A 3LPFA 4LHJB 3ULVH 4JAMA 3S37L 1MFEH 2VXVL 1AY1L 1WWBX 3PWPB 3W5MA 1J18A 4LIQL 1I3RB 5BOPA 1Q1JL 4WGWB 4G8GE 2WINB 3MMEB 4KV5F 3SY0B 4C58B 2XTLA 2DOCA 3VH8G 5E4IA 4L4TE 4MQXC 1PKQE 4M7LT 7FABL 4HJGB 4U31A 3LKQA 5HYJD 4HJJH 4PFEA 3SKOB 3EYUH 3STBA 3C60C 5AZ2L 5C0JB 1CXHA 4OCYH 3ROOB 3IVKB 3L3IA 3TNMA 3LKNB 4ESKA 3ULVE 5HYJA 5IT2L 1MCRA 5JLZA 1GXEA 4LLDB 3BKJH 1AQDA 5C6TL 2DLFH 3GMLA 3MLPA 1KPRA 2NY7H 3RUGE 4GS7C 3M17A 3Q1SL 1J7VR 3WHE0 2VDLL 2ICEB 3HC4L 3THMH 3NTCH 2HVKB 2FHBA 3W0WB 4OGYL 5D1ZD 1FPTL 2IBBA 1V7ML 4PTUA 4OZFG 1VGKB 4BZ2L 4X7TB 1JNNL 2VZSA 5BRZB 3HHRB 3N1PC 1EMTL 2XZZA 3CDGA 4BSWA 1XIWB 3LKSB 4OFPA 3MJ8A 4J23A 1VADB 4JQIH 1K85A 3DRQA 4NM4H 4ODSH 5D1ZA 4DOHE 1MFBL 4UOW0 5DQJB 3IKCB 5CBEB 1N4XL 1G84A 3VGHA 1S7WA