4L8SA

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
NIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCASMDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sA02
1A6ZA 4PJEE 4TSCH 4ZDHB 5IW1B 1JWMB 1MWAB 1T0MA 4PJAA 5FGCB 5DZLA 4I18B 4BZYA 2CLVB 5F7NC 2KPNA 1G84A 4ZAKC 2MQCA 5BCAA 5J6GA 2C3WA 1RUPH 4DN3L 2E7MA 4O51B 3VXRE 2R29L 3VXSA 5HHVH 2C4FU 4MQXD 1QR1B 4QRPB 4JZNB 4PJGF 2OTWB 3ZZ1A 4MJIE 3I9GH 1NH6A 4Y16C 4IRSD 5D1ZB 3IDXH 3B5HA 1NBZA 2RJMA 5IMKA 3PIQA 1I9JL 1W8OA 1OY3B 4H1LH 2WINA 3TN0B 1G9ML 1OAUH 4U49A 4Z0XB 5DD1L 2R0ZL 4RDQG 1U3HA 2PO6C 3MV7B 5D71L 1U8NB 1DQMH 2CLZA 2I60H 2BZDA 2ADGA 1DQDL 5E5RB 3GDBA 4C56A 1EZVY 2BK8A 2CK0L 4ZFZA 3IXAA 2W0FA 4YPJA 2DLHA 4M43H 2E8ZA 4GW1B 5B21A 1A9BB 5BS0B 2FEDC 2E27L 4OM0L 5DDHB 3UCRA 3V52H 4PBWD 1XIWB 1RURL 1T4KA 2H41A 4QGTA 3VFWB 3QNYA 1DE4B 4KVCL 4M5YL 3SKUD 5E6ID 3V2AR 4QWWD 2B1AH 1PQZA 3BW9A 4LF3A 5C86A 4ZFOB 3P9LA 2VO5A 4HZAA 4YK4C 5JTWA 2NY4B 3QUKB 5D1QA 1PW3A 1N64L 3P4OB 4PV8A 3F7VB 4AENB 3PDOA 4P9MH 5E94A 4JJ5B 1Q9OA 2VDLH 5TH2B 1OP3H 1HHJA 3WFHB 5IB4B 1N8ZB 3KPPA 5ISZA 1T7WA 4MNQA 1HIMH 3D3VA 4MLSA 5GRJL 1JRHI 4XVSL 3SCMC 1YEJH 3V6ZB 1NMBL 4ZO7A 5H37H 4U3HA 1I7ZB 1WAAF 1MPAH 1IC7H 3QAZB 4XBEH 4NUGH 1AQDB 1V7NL 2R0KH 3W2DH 5FDWA 4TUOB 4PUBH 3BKJH 5BVJA 2PN5A 3D2UD 5FYKL 1UA6L 5C0DB 3FQXB 4N1HB 4V1DA 5HGDB 2H1PL 3SDAC 2NY2D 3AB0C 3CIQA 5CKGA 4PJAB 1CS6A 4PRPA 4OFPA 5D2LB 3LKNB 4OT1L 4GXVL 4YUEL 4NKMA 3TA3B 3BUYB 3QUMH 4MGXA 2B20A 1A64A 3L5XH 3KAAA 1IQWL 1PZ5A 1XCTA 1AD9B 5CZXD 1FE8L 1X4XA 4JR9H 1ONQB 5B39A 2B39A 4F9PC 5EBLA 1BREA 2HN7A 5CJQH 3SO3B 2XTJD 4GAJH 1MRDH 1U3ZA 4DKAA 2WBJD 4YDIL 3RWEA 1JPSH 2C5DC 3CCHA 1JNLH 1FIGH 5L6YL 3LN5A 1M4KA 1CXIA 5IMKB 2OL3A 2NX5D 5DHVA 2WINB 3MLXL 1MI5E 4MNGB 4WENB 1CTOA 2WWMD 1XEDA 4PJEB 5I71C 3WFCL 3P3YA 4ONGL 1U3HB 4NBZB 4UDTA 5DMIL 2XPGA 4AG4L 3FB6A 3ILPA 3FO0L 1BGXH 3GNMH 4LPVA 1INQA 5IT2H 2CLZB 2RGSA 4CNIB 3D39D 1SYSA 1VFUA 2G2RB 4M6ML 4L4TE 4YHKH 3RAJH 2FCBA 2WSKA 3VXNB 1DL7L 3KPRD 3VXRB 4LAQH 3FAXA 3GBNL 5CP3A 4N5ED 2YN5A 4XI5C 3VMOA 1A5FL 4MJIB 5HDLA 5SX5K 1RZIA 1LO0L 2ZUTA 4P4KA 5DVLA 4NNPH 4D0DB 1FZMB 3G9AB 3VXPB 1V8HA 1FZJB 3PP3K 1ZOXA 1MCHA 2AEWA 2GIYA 3ZL4H 5IP4A 5KVGL 4LARL 5EO9B 3T0EC 1O0VA 1T7ZA 3P9LB 2X2YA 2FHFA 4CMHC 1BJMA 4NNXA 2VLME 5I16B 5JXAL 1T7VA 3TZVC 3NIGF 3V6OC 3EO1B 5KZCD 3B3IA 4KZEH 5DZOA 2Q7YA 5ERWB 2ENSA 3KPPB 3RNQB 3UXFA 3CDGA 1A7RL 2CR6A 2YRLA 4J2XA 1LK3L 1MIEL 3QQNA 1F58H 1LD9B 1ACYL 3ILQC 1NBYA 4OFKA 3VD4A 5I1HH 4YO0A 1U93A 3QNXB 1MJ7L 3GMRB 4P3CL 4ETQA 4HKBA 2DWEB 4EOWH 3IDNA 3NIFF 5EC1B 4P2OA 4R8WL 4OB5H 5IHLB 4ZAKD 5TGBA 5JA9A 2VKXA 3HC0A 2FECL 3C5ZB 1KPRB 2CKNA 2IH1B 5IB5B 3VFMA 4EDWL 1JGVH 1HSAA 1XR9B 2GUOB 3IDYB 1TZHA 2EXWC 5HVGB 4LHUA 4UMGA 4Y5XA 43C9B 1AO7D 5FF6B 4LSPL 4DZBB 1KG0A 1WBXA 2FX9L 3GIVB 4TQEH 5EBWA 4KAQL 1BWWA 1HZHL 4NKOA 3W11C 1LNUA 2PO6D 2W60B 3QUZA 2X4UA 1L9NA 3CDYA 1Q9WB 2Z93A 3HS0A 2OMNA 3O3BA 5EOCL 4R2GB 5HYJE 1MH5A 1EVUA 3ZTJH 3VGEA 5GS0C 5FOBB 1I1FA 4DN3H 4BFIB 1ADQL 2R29H 5DSCB 4UDUB 1G6RA 3SBWA 5IK3A 3QIBA 1SYSB 1DQQB 1IL1A 1D6EA 3G04A 5DJ2A 1TQBB 5BQ7B 3MRCB 1ES0A 1RIUH 5DJ0A 5EWIH 2P49B 1P69B 2LU3A 4AT6B 4Y8AA 2I26N 3BZ4B 5D6DA 1I9JH 3MO1A 4NCC1 5F9WC 3VXTA 4OZHE 1OWWA 1H8NA 1MFBL 2F15A 5DD1H 2W38A 5JUEL 1QBLH 1UXWB 2YUWA 1QZ1A 2Q6WA 2PW1B 1MCWW 4NZRH 4EUPB 4JRXE 4KDWA 4X7TA 3C9NA 1NFDF 5IW3A 2BOBA 1MI5B 3IJYB 2V5YA 4NQVA 3RNKB 1BQHA 4NIKB 3AMLA 3UX9B 2DKMA 5J57B 3KYKH 3SCMD 4FQPA 3NTCL 4OZGE 3B3IB 5HHOA 1A3LL 2E27H 4OM0H 4WW2B 3TBYA 1CGYA 2APWA 5F7MC 1RURH 4MDJA 4M5ZH 4I3SH 3MNZB 4BQ8A 1ZHLB 1KLUA 2W0KA 4L4TB 2ZUQB 3S35L 4KK6C 5ACZB 1F3JB 3IRPX 1R24B 2BFVH 3L5JA 4AIZB 3SDAD 3FO2A 4ETQB 4LPXA 4HKBB 3S4SG 2YD7A 5EU6E 1HE7A 3ARQA 1N64H 1HHKB 1NL0L 4KGLA 4L4VD 1XF1A 1JHTB 5INDB 4QO1A 3RL1A 4A2LA 4O02L 1DTUA 4JGMA 2XA8L 4YDJA 5HD8C 4GQPH 3O9WA 4GRLA 3OWEA 1LP9E 4P49A 5C0RL 1LE9A 1J87A 5J1SC 5GRJH 5I1KL 1OCWL 1GL4B 5D2NA 3QSKB 3ZKSD 1CD8A 1S78C 3ARFD 4PJ8C 4JRYD 2GT9A 2LQRA 2PW2A 2VISA 1NMBH 2V2XA 5E2VL 3MLZL 5CP7A 4YAQB 1KG0B 1WBXB 2FLBT 2VXTL 1V7NH 5JR1H 4KTEL 1UA6H 3KPSE 3DETC 2H1PH 3GMLA 1LNUB 3AXLA 3VFSB 4U6HA 1IEBB 3K7UA 1NDMB 1A7PH 1TVHB 4DVRL 3K8KA 5CBAB 3HR6A 4JDZA 4GXVH 3VFVA 4YUEH 1G1CA 4JDVB 4PJXE 3IKKA 4Y4HA 1IQWH 2IAMB 3BGAA 5GGTA 1X6LA 2WIMA 1FE8H 4D2NA 4G80A 4TRPL 1CGWA 1BZ7B 4MA3B 2EDLA 5C0IA 1G6RB 5DUPL 1K4CB 4MX7B 1QRKA 4YDIH 5EBMB 1I3VA 1UB5B 2VLJE 4M3KB 5EZJB 3V95A 1AE6L 3ABZA 1V7MH 3AAZB 3G5XA 3T0ED 3MLXH 4U7MA 4JVPA 4BK4A 3LQZA 3VA6A 3LMJL 3HR5A 4MD4B 4QXUH 5D1XB 5L0QB 1J7VR 3WFCH 4OQTA 1BD2D 2A74A 3TZVD 5DMIH 1T1XB 4AG4H 2AP2A 5GGVL 4WEBL 3FO0H 1SMOA 1ODAA 2R15A 2JB6A 3I50L 3OAZH 5HYJB 5GGQL 5CSZB 4P5KB 1TZIB 4F58L 5A2IH 1KF9B 3UBXB 5IEKB 4M6MH 1BQHB 2GJZA 4L8SA 5LKNA 1IGJA 3B43A 5LQBH 1A6PA 3ILQD 4H5SB 4KDVA 5HHXL 5FA3A 3JV4A 1CQKA 4JN2B 1A5FH 2FJGB 3U1SL 1X5HA 1KLUB 1LO0H 5FUZH 1IJ9A 4PD4J 3FQRA 2I25N 3RIFF 3QWRD 5HVFB 3LDBB 2GSGA 4N1CA 2NXZB 3IAGC 3G5ZA 2C4XA 5CMAB 5KVGH 2H45A 4LARH 4OZHB 3TBVB 2ILLA 1UJ3C 1WCBB 5HJ3A 2XWBA 5JXAH 1VCAA 4QF1A 3RL1B 1G7JA 2J6EL 4LK4A 4JAMA 4I3GA 3I85A 3O9WB 4N9GA 5FYLD 4JRXB 5E4IA 3VI3E 3GBLA 1DFBL 1A7RH 3BRDA 2F58H 4CW1B 3EJZC 1LK3H 4JHBA 4I9WE 1MIEH 2OMBA 4OF3A 5CEYA 3VGGA 2VISB 4OZGB 5B38A 2NTFB 4OKVB 3W11D 1JP5A 3QUXC 4NO3A 4NT6B 1E0OB 4P3CH 4JVUA 1Z2KA 3UPRB 3WUWB 4R8WH 2HJKB 3EBAA 3PWNA 3C09C 1KB5H 4M1DL 4UNUA 4HXAL 4XNMA 5HPOA 3V79C 2X05A 1OB1A 3MRQA 2ICEA 5JHDD 2WLYA 4K8RL 1QBBA 4DTGH 3CXHJ 4R0LC 1YEGL 5EU6B 1VACA 5E99L 5HDBE 1DBAH 1G0XA 2NZ9D 3OQ3B 4LP4A 1X3DA 4KZDL 1H9VA 4PY7B 4RDQF 2E9JA 4XNUL 1F45A 2Y72A 5CD5C 4LEXL 2XTJE 3FQUB 1LP9B 5IHBA 3REVA 1S5IL 3L1OH 3FONB 4WFED 1CTNA 5BO1L 4KAQH 1JCKA 4FQHB 5HDQH 2WV3A 2R39A 1L7TH 1CLCA 4YQXH 3BGMB 4XP6H 5EOCH 4LLDA 4YHNB 4EDXB 3GSXB 3KPSB 3TBWA 4CL7A 5T3ZH 2X4QA 1FL5A 1RUAL 4PJGA 2HLFD 3AM8A 1YC8A 2A74B 3TCXA 1ADQH 3D39E 2KDGA 4U3CA 1N59A 1YYLH 2P8LA 5GZOC 1RMFH 4Z7OF 5IR1B 5CEZH 4PJXB 3WO4B 2F54D 4I4WA 3VGBA 4L1HA 3IDMB 4JO3L 2QQLH 3U30B 4IM8A 1NGXA 1FO0A 3GMQA 1XH3A 4KK6D 1XMWA 4WFGD 2EXYC 4YGAB 3TJEL 1AQKH 1H5BA 4IRSB 3V6BR 3CLFL 5EZLB 3FHAA 2WBJA 3ES6A 4GKSA 2HT4C 3MXVH 1MFBH 3U36B 4YJZL 1FL6B 1AGBB 4QKXB 1I1AD 3MGTA 5JUEH 1EBAA 4F3FA 5FO7A 2NX5A 1R5IB 2AJUH 3SE9H 1CFQB 5BV7B 2O5ZL 2VLJB 4QRRD 5C0GB 1KELL 3D6GA 1QFOA 1CF8L 3M07A 3DROA 1RIVL 32C2B 5C07E 1EO8H 2D31A 3ZTNL 4XPBH 5EUOE 1ZE3C 1TFHA 3S36L 3R8BB 3NTCH 3TIDB 1ED3B 1YMMA 4RAUA 3OB8A 3T77B 3TBSA 3QQ9C 1I9RL 4N9GB 4NNYA 1FYTD 3QG6A 2VZVA 5ESAB 4V2BA 2DDQH 3P11L 3KPRA 4G8FA 3BISA 3S35H 4G8IB 1V3KA 3DRQA 3MSPA 3DETD 2A83A 4YX2L 3KJ6L 1KFAL 3ARBB 1U95A 5C08D 2IQAA 5E6IB 1W0WB 1YNTB 1YMHA 4P2QE 1FNHA 4FABL 4G8GD 5H2BB 4NCDA 1NL0H 4JFQA 3TVMD 3DRTB 4O02H 3P40A 2FO1A 1AD0A 4H1LG 1N2RB 4NHUB 5TF1H 5I1KH 1XF4B 3O6FD 5CJ5A 2JF1A 3JUZA 5FYJE 4KJYB 5AZEL 1WAAA 4ODWA 1BOGB 5E2VH 2VZOA 4HPOL 5DFWH 5FXCH 3ZKQD 1U8PB 2VXTH 4U4BA 4OI9A 3ROOA 4HFWA 1KXVC 1ZGLA 3HE6D 4KTEH 3EOBA 4YHYB 1ZVSB 5DO2C 4N0FA 5F1NB 4PP2A 5I1AB 2YD1A 3C60C 2XZQH 4DVRH 4ODHH 3D2UB 5MEOA 4DK6A 1SJXA 3BUTA 1BOYA 4ZAKA 3FQNA 1ZGLP 4FXLA 4LLDB 4D9QD 2DAVA 4KQ4L 1H8OA 2X4QB 1GZPB 3AREC 3MROB 2NY3B 1UACL 4HC1A 4CDGC 1N59B 4ZFOL 1RZFL 4YHZL 3M17B 2VRAA 2I5YH 1G0DA 5MEPB 1MCOH 3FB5A 3C2AL 5I19L 1AO7A 3IB4A 4F7CA 4XNYH 4HD9A 1FO0B 3BPLB 3HMWL 5JO5B 1GC1L 2XTJB 3SDXE 4YC2C 3RX8A 1RJYA 5D7LD 1QPPA 1G0YR 4JHAL 1TVBB 4OZFG 3QZWA 3LMJH 1G7IB 2AXHA 4HIJA 3LPGA 1KCUH 3CX2A 2FSEB 5E70A 5M94B 1T22B 5GGVH 8FABA 4RMVA 2BERA 3SJVD 3I50H 5GGQH 4X4MA 3DROB 4UQ2B 3EJZD 5H35A 3L95B 3MLTA 1OL0A 3D39B 5HHXH 4U1LB 1D5XA 5GSRB 4O2FB 4X6FA 4BQBA 3U1SH 4ZFGL 5LXGH 3OKLA 5J4MA 3NFNB 3D87B 4WI5A 1FAKT 5F96L 5EU7C 2D4FA 1T20B 1RHHA 4RAVA 4HS6B 1U95B 4IBLT 5DI8B 2HTKC 5EUKB 5T5NG 4L4JA 1AC0A 5L2KA 2XKNA 1FJ1B 4RMWA 3DUSA 1WTGT 3X13A 4K2UH 1T2JA 4PV9B 4OZ4A 3NCJL 4G6AD 3WO3B 5C07B 1S7SB 5EUOB 2JB5L 3NABH 3B2UC 4HK3J 4XRCB 35C8L 5TDPA 5JQHC 2IALA 4KY1L 3VWJB 2XXCB 1G7PB 3CPLA 4M1DH 4IOIB 4N0FB 1NGWB 2A0LC 2BSED 4AQ1B 1N6QL 3U4BL 1HXYB 3PHQA 3WJJC 4O00A 1N4XL 4I0KA 4L4VA 4ZAKB 4P2QB 25C8H 3V7AG 3Q5TA 1MQKH 4BJLA 5EN2B 1F3DH 4NN5C 3VFTA 4LEXH 3ARFA 1WWAX 1S5IH 2CKBB 4JRYA 4Y16B 3DYPA 2IGFL 4R4ND 5BO1H 2M2DA 2VIRA 5I1IL 3MOQA 2FH6A 4QHKI 3Q6GH 4TOYL 2Y5EA 4WO4D 5T1KB 3KYAA 2EKJA 1C1EH 2DJSA 3T0EE 3OKMB 2KZ1B 4FQQB 4BFGA 4NKIL 2BY2A 2CLRA 1BD2E 3EYVA 3KPNB 3V6OE 2PO6B 3STBA 4WUKL 4MDIB 2H2SD 1CU4L 2AABL 2BJML 4XC3L 3JUYA 1FL3A 4UOJA 3LKPB 4R97C 3BX7C 2AJ3B 3QQ9D 2NY6C 2YWYA 4NRYA 3NCCB 2P24A 2W9DL 5IROA 4MJ6A 3HA0A 2ORBH 1YUHA 3IJSA 2R2EA 3QFJE 3QB7C 1T1YA 1ROWA 1MEXL 2YWZA 2OJZL 4X8JB 3TJEH 3WFDL 2PUQT 2BNQE 1FV1A 3V4PL 5DTFA 1OT2A 5ANMA 3BZFB 4ERSL 3RY6A 4ODTH 1BX2A 2R1WA 2O61B 4HEPG 1NFDA 3QDMD 2WM0A 3T0EA 4Y5YC 4F8TA 3SDXB 4WV1C 4YK4B 3REWA 4HIXL 3S37L 4EN3C 1CF8H 3PWVA 3FOLB 2F5AH 1RIVH 3TZVA 4Z5RB 4M7LH 1JF6A 4XH2A 3ZTNH 5FYLE 3S36H 4JZOA 4P2CG 1MWAH 4ONHB 3S5LG 5CIPH 1BBJB 4M03A 3LRHA 1T5WA 4QCIA 5FA4A 4N8CL 3OXRA 4OZ4B 1FNFA 1ZEAL 4L8BA 1HI6B 2ITCB 3SCMB 3P11H 4XAKD 3T3PF 3V5KA 3QJHB 3GMNB 4WRLA 1VFAA 1R5VA 3STZB 4YHOL 5HY9B 4MS8C 4NO2B 3QWRA 2D7NA 3KPLA 1MJUH 1F02I 1UYWL 1P9MA 2R0WH 4FABH 1UWXH 2GITA 1M7IA 4GQ9L 3SDAB 4HIEB 3AB0B 4YNYB 3WSQL 3ARED 3RWGB 4DN4H 4AEIL 3DV6B 3ZDYF 3QWOA 2D0HA 1S8DB 4UZGA 2XKUA 3QA3A 5AZEH 5GS1C 1MF2L 2ADJA 3AS0A 5IEHB 5MI0C 3DO7B 3VFTB 3EDFA 1OAKL 4M7JL 2BVPA 4P5MA 3TYFA 2VL5B 5T1LB 3N1GC 5K9KB 1MFDL 1Y0LB 2G5RA 3WNOA 3QDJD 4XPAH 1R3KB 4FTVD 3GSOB 2FIKB 1QFWL 4GRMA 2FX7H 2UUDH 4ALAH 5I71B 1F5WA 4KQ4H 1E4KC 1NCTA 5C0AD 5JHDA 1EHLL 3CDCA 1JPFA 1UACH 2Q8BL 1FL3B 3KG5A 5DR5H 2F54E 2K1MA 1RZFH 1PD6A 4YHMH 1WGOA 4Y5VA 4C4KT 4XCNA 5IBTL 3I3BA 4R4BA 4RMQA 4X0KA 5I1LB 2VDOL 2WBKA 5ID0A 3HMWH 4WCYL 2NY0D 1BECA 1KJMA 1FV1B 4OLZH 1IGTB 1A47A 3MLPA 5HTSA 5JW4M 4YZFF 1M71B 2FJHA 3KHOA 4MXWL 1G7HB 1T5XA 4QRRE 4UQ3A 2HTLD 4XPGL 3KPOB 1RZJL 3SKJH 1TNNA 4R90L 3T0EB 1D5MA 4CMHB 2OYPA 4L5FL 5C2BH 2ZZUT 4U33A 4PP1C 1BD2B 4MA1B 3UTTA 1BZQK 4KMLB 3B2UD 1CFNA 4NQCD 3BZDA 4QCIB 3OXRB 1OM3L 3RVXD 2VDNH 4ZFGH 2EDXA 3FFCD 4O2CA 2A2QT 1LEIA 3V5KB 3KWWB 3QFJB 4S0SD 4LLUA 3BZEA 5F96H 1UVQB 1C5BH 2BNQB 4G8GE 1I1AA 4Y2DC 1YY9C 1I7UB 2C1PA 1WIPA 3H6JA 4UB0H 4WHTB 4QRRA 3F12B 2P5WD 1KN2L 1UG9A 5DS8B 3MJ9H 4Z18A 1OP5H 3TNMA 2VYRE 4YR6A 1VESA 4RISH 3QA3B 4FQIL 1K8IB 2ATPA 2JB5H 2NNAB 1FFOA 3LV3A 1FYTA 3QXDB 4KY1H 2YR3A 1II4E 1HINL 3T0AA 2GTWB 3KR3L 3L7EB 3L5WA 3CFDA 5F7DA 3OAUH 3RIAK 3C2SA 2BDNL 3DXAD 4QT5B 5C08A 4KJPD 3HNSH 3GB7B 3U4BH 3QEGL 2FNBA 4G8GA 3LS5H 4RZCA 3TVMA 4HFUL 2F5BH 1B0WA 3OBAA 5JIHA 4KGJA 4DGYH 1ZT4A 2YRZA 5IMOB 2FD6L 2MJWA 1WWCA 1VGEH 2DQTH 3WIHH 3O6FA 3BP6A 3IGAB 3LCYA 3TPUB 4QHMA 1RZKL 1OARH 2VERN 4HZLA 2X89D 1X5LA 5HI5D 5I1IH 5H94A 5I17A 4CVXB 5HGBA 4TOYH 5F9WB 3OHXB 1NGPL 3HE6A 3HE7C 1UXSB 1S7VB 1PDKA 1RJLB 4NKIH 5DT1L 3C8KA 4XMLL 2AXFB 4EN3D 1JGDA 4HBCH 3RA7H 2H3NA 4WUKH 5DUML 3SJVE 4GG6E 4HK0A 5F72S 2DQEL 1CU4H 2AABH 5DJCA 2BJMH 3MV9D 4XC3H 3RVVD 3HNVL 1A9EB 5JLZA 3QEUA 3BN9C 4JKLA 2W9DH 3HI5L 2E6PA 4LCCA 4LOUD 5F7FA 1MJJA 4BQCA 3CZJA 1MEXH 5C7XH 1O5DT 1CGUA 2OJZH 1A2YB 1IAOA 1NLBH 2F54B 5F8RC 3WFDH 3MA7A 3V4PH 4J3SA 4F33B 4PR5A 5CCKH 4ERSH 3L3DB 4PIRF 2YBRA 1TVDA 4A2MA 4LNVA 5SX5H 4BH8B 5D7LA 1QBMH 3TCLA 1ZVYA 4CMMB 4JG1L 5DJYB 3OKNA 4HIXH 3S37H 2HT2C 4S1QL 1PKOA 5J9PA 1EERB 2JJUA 1BFOA 3VXUD 1KLGB 4QRRB 4EI5D 4L3EE 1JN6B 5CGYC 2ITDA 2F53A 1WZKA 1J0JA 1IKFL 4PJ8B 2X4TB 5GRUL 2ATPB 1OGTA 3QT2A 4JANB 4MNHA 1EA9C 4YHOH 5L8JB 1CDJA 1BJ1J 1B0RA 1ZT1A 3TJHC 1UYWH 4EIGB 3VJ6A 5KSUB 2L4OA 1ORSA 1VEMA 3MGOA 4OCWL 4P5TC 5AD0A 4AYFA 2IEPA 3WSQH 1L6ZA 4WEUD 1WF5A 4G8GB 5E8PA 1Q9LB 3LN9A 5TDOB 4J3XA 1RULH 2YD4A 3LEVL 3ZSTA 1MF2H 4JKKA 4EUPH 1CDGA 2QBWA 3NFPA 1YPZF 3BDYH 3WNMA 5HYFA 4M7JH 5D8JL 4M7KH 1MLBB 3O8XD 1BHGA 4XP5H 5I17B 1MFDH 3IDUA 1L0XA 3OXSB 1HCVA 5ENWB 1NC4B 4PG2C 1H0DA 3L3IB 1LHZA 2EE6A 3ZYJA 5C0FB 4PS4L 1UEYA 4XWOC 2UWEE 5EPMA 2H3NB 3RP1A 2FB4H 2Q8BH 1OHQA 4MAUL 1A7QL 5I1DA 2ICWB 1G9NL 4J3WA 4LVHC 2DM4A 3WIFB 3UTZB 1KYOJ 5IBTH 1NEZA 4LGSB 4DVBB 1V3MA 2VDOH 4X80H 1KTKE 4LHJB 1P4LB 3S35X 4K55A 1K8DA 1D5ZA 4DGIL 3MA7B 3DX9A 4JZJC 4F37F 4U1NB 2YA1A 3OGCB 1NANI 4WO4A 1P4BH 4MXWH 1IM9D 4XC1L 4IMLB 1SBSH 4HWBA 4UV4H 4XCFL 3QPXH 2ED9A 1WBZA 4GW5B 4U2ZA 4N8VG 4WUUE 1DLHA 1UJ3B 1GGTA 5HYSG 4L5FH 2FR4A 4TYUA 4E5XA 4YDVA 3JTSA 2FEEL 4XWGL 1ORQA 5AYQA 5J9PB 1OQOA 1W8NA 1QYGL 4ETYA 3VU2A 1XCQA 2YS4A 3SJVB 4GG6B 2AV7B 4JPVL 2KH2B 4OGAC 1N26A 1AP2B 3RZWA 3T0VA 3QBTB 4OM1L 1U8OA 1ZSDA 3LRSB 4XAKE 2VDPL 1OM3H 1G9MC 2NW2B 3L3HA 3MJ8A 4NC0B 3HCVB 3CFJB 1QEWB 3UJJH 3QUXB 5IESL 3V9FA 4UT9L 4MNHB 1DSFH 1EXUA 2R2CA 3C09B 4GKNA 1EDQA 3HC3L 2K7QA 3MRHA 2EDOA 1I1CA 4YBQC 3U83A 3QDMA 1RJZB 3N85H 5AD0B 3GUTB 1KN2H 1B88A 4U0RC 3HUJF 4R0LB 5E8PB 1UC6A 1AY1H 3KVQA 1KPUA 2FX8H 4M6AA 4WU7A 5FUCC 4FQIH 3MXWL 4N0YL 3F65A 4KU1A 1S7TA 2HKFL 1SJEB 4L3EB 2C9AA 4GBXA 3Q1SH 1HINH 4LLQB 4FXGA 3SGJA 1UB6A 3CFBB 5I9QC 2Z91A 3VRLF 3T65B 4PTUA 5EO0A 4RQQB 5EIIA 3CVHA 2OLDA 4AY0A 4D0BA 2N4IA 1R5WA 1Q38A 5C0AE 4HFUH 4XMKL 3ZT5A 1WBYB 1W72A 4NRXB 4HWZA 3GMOB 1GIGH 3P30L 1IT9L 1TPXC 3AREA 5I8CB 5IOPB 4F15C 3PV6A 2BRRL 3HFML 4R26L 2FD6H 3QJFB 1KIUA 3RGVD 3E1F1 2VMFA 2XV6B 3ARVA 2VN4A 2A73A 1ND0A 1RVFL 4ONOA 2I9LB 1Q94A 1BP3B 1T21B 2PCPB 1NEZB 2IBZX 3BIKB 1J0KA 2HFFB 5EU7E 2AK1L 4PRBA 3GKZA 3UTPD 1NGPH 1K8DB 3AMKA 4LVNC 4FQCL 1D5ZB 3R06B 5DT1H 4XMLH 4JFED 2HT2D 5K9OB 1TITA 3I84A 1BAFL 4ZTPH 3QDJA 4FTVA 1CLOH 3QXUA 1MIMH 4PLNC 2DQEH 2GEEA 4PGBB 3MTRA 4XB7A 4Z8FL 4ACPA 3HNVH 4Q0XL 3RRQA 4H88L 5FHAL 1Z9OA 5C0AA 2G9HA 3K80A 1X4YA 1Z5LB 4OTXL 3HN3A 3GRWL 4E5XB 1JF1B 3PGFL 2UWEB 4HX1B 2APBA 3SE8L 2OK0L 5I76A 4G43A 3OV6A 4PJCF 4KDTC 4NJ9H 4Y4KC 1FH5H 1A3QA 1TCRA 1FVCA 2BC4A 4F9LC 2XWJA 3L3HB 4S1DC 5FUOL 1KB9J 1T2XA 4LSSL 5FO9A 4PGZA 3TO2B 5KN5A 2HWZL 4H25B 1L9MA 1IC5L 4JG1H 4Q9RL 2CKBL 3FAWA 4S1QH 5FYJL 3W81A 4G3YH 3T4AB 2OX5A 5J0BA 5DK2B 1HOCA 3DI3B 1ZLWH 1ZHNA 4WUUB 1B6DA 2DQFA 2AEIT 2WLZA 1J1OL 2X70B 3WJLA 2VUOA 4G9DA 4LRIA 5GRUH 2NTSP 4NQCA 3MRNB 3MUZ1 5L7XL 3U0WH 3HMXL 1S7TB 3GFUA 3FFCA 4ZNEE 4GSDL 3VG9C 1MCKA 4M1CC 4BSVA 1XF5A 3DXAE 5CAYB 4FFZL 1KIPB 4ELKA 4HIIA 1E4WL 3LQAL 3NA9L 3C60B 1CGTA 4XWOD 4BH7B 4Y1AE 5EO0B 1J1XL 4LDEB 3CVHB 1K3IA 3GGWA 3IFOB 4Z78B 1R3HB 2VITB 3WS6C 3WD5L 2P5WA 4TN9A 4B50A 2OSLB 5KVMC 4HWZB 1Z3GL 2ZKHL 2PKDA 4NZUL 3AREB 4NQED 5KAQG 1RHFA 5BVPL 3QG7H 3NPZB 3OAYH 3QNZA 4CN6A 1HDMA 1FZKB 1ND0B 3ZDXF 2CRYA 4OAWA 4R96A 3BAEH 1OLZA 3HG1E 2WWKO 2Y7QA 1XFPA 3ARWA 3QEQA 1MCCA 1YQVL 3B2VL 2LAAA 4PRBB 4YC2B 4HKXA 1IEAA 2Z0BA 4R3SA 3TH3T 1T89C 2D7TL 2HJFA 3DXAA 2Q8AH 4I1NB 1F4YL 2X4RA 3DECA 3G5YA 1Q72H 1I7RA 2OCFD 1F8TH 3MV9E 4J4PD 2ZSVB 3FOMB 3SDCA 4ZSOE 3STLB 4OGAD 3OL2A 3S36X 4JM2F 1G9NH 1B4RA 1OSZA 1QSED 5C0AB 1U0QA 4OUUA 4NM4L 5TE6L 1HEZB 5KSAD 1VEOA 4U1MB 4DWHA 2ZNXA 4QRSB 2CK2A 1GZQB 5JZ7C 4RMUA 2DWDA 2X89A 5CGMA 3P73B 5TPWL 1TCRB 1FVCB 3EYOA 4DGIH 3H3PL 3O6ML 1MHPH 3SDDC 1OD7A 2VZUA 4GLRI 3FCTB 1K9TA 4YBQD 3KPQB 4RFEA 1YNLH 2VN7A 4Y5YA 3UJTH 1EGJA 1D6VL 1GAFL 4XCYA 3QCVL 4HV8A 1CD9B 3C5JB 4XWGH 3MV9A 1INEL 4S2SB 1NEUA 4JPVH 5DF0A 3QXAA 4JFZL 4LAJH 3MRFA 4OM1H 5T5FH 5B22A 2VDPH 3MRGA 2GJJA 4POZD 1FZOA 4OI7A 4FQLH 3A6CL 2E6JA 4IMKA 2BXZA 3P77A 2BVUA 3UTSA 5IESH 1SEBA 3F58L 3RJDA 1JPST 1Y6KR 2PYFA 4R4FL 5JOFA 4LPTA 5DJDB 1X5GA 1IM3A 3R1GL 3HC3H 4QOKD 1ZA3A 2EDYA 5IFAL 3D5OF 4ELKB 1QSVA 3H0TB 1UQSB 3PQYD 5ESQA 5GRWA 2Z92B 3R8QA 3WN5A 4PREB 3BDXA 3C87A 4KK8D 3C08L 4PJBF 2P7TB 1S9XA 3MV8A 3QRFM 3VXUA 4EI5A 3EOTH 4YFEA 5GS1A 3KYOB 3MXWH 5IM7A 3HHRB 1J05A 2EDEA 4MCZA 3MCLH 4NN5B 5LWYL 4XHJC 2HKFH 1RFDH 3VH8B 1AGEB 3MV01 5ICXB 3QNZB 4H8WC 1HDMB 5DHXB 1CVRA 1ZK9A 3W9EA 2R23A 2EC9T 3MC0A 1A7NL 5TQ0H 4OCXL 1O7SA 1FRGL 2IWGA 1NCAL 1I8IA 1UWGL 4GW4B 4BA8A 4A6YB 1OW0C 4JO2L 4M9PA 3DXAB 2UVFA 4D9LH 2X4NB 3CC5A 3L3JB 5DWUL 5E2JA 3FO1B 2BRRH 4Y1AB 4JJHA 4X5WB 2V2TB 4R97B 5BRZD 5F1IB 2NY6B 5JPNA 4XP4L 2FGZA 2YC1A 3Q6FA 3TIEB 5IB2B 1RVFH 1BVZA 1VEPA 1XF2B 4S1DD 2I9TA 1E4XL 1TENA 4NFBA 2XNAA 3MBEC 2AK1H 2Z35B 4I2XA 3T8XB 2XWTB 4PRAB 5E56A 1UZ6E 3PNWB 7CGTA 3O8XA 1A6AB 3HG1B 4YFDB 3RZCD 3GSUA 1BAFH 1OTUC 1WFUA 2P8MA 2DQDL 1JGUH 3SKMA 4UNVA 2OJEA 4R7DB 1L0YA 1HXMA 4WV1B 4D3CH 3QXWA 4Z8FH 3IXTA 5EIVA 4EN3B 1FGNL 1ERNA 5C0EA 2G5BA 3PGFH 4HWUA 1JNHA 3MV9B 4LL9A 3SE8H 3VFGL 2OK0H 5DFTA 3VW3L 1P7QD 4H1LA 4ZXBC 4ZSOB 1DR9A 4WTZA 3ARGD 1G7MA 1E6OL 4QTHA 2VLKE 3JXAA 4HPYL 4LLYA 3V4VL 3ARDC 2AV1A 2DTML 2Y36L 5FUOH 1U8QA 3ALWA 4M1CD 5GS0L 4LSSH 1IAIM 3P77B 3FT3B 2HWZH 2CIIB 5F88A 4WHCA 3H9HB 4HHAA 2JK5A 2AEPH 4QNPF 4Q9RH 1FNGA 2CKBH 5EDXA 2NMSA 4PYHA 1IM3B 4UIMB 2BSRB 4LSDA 5FYJH 3M8OL 1UZ8A 1X9QA 1HYSC 5ESQB 4PJHF 3DTXA 3QEHA 1UCTA 4GJTB 4ZUVA 5IQ7L 2BY0A 1CDBA 4X4XB 5ID1A 2C7UB 5BXFA 1OTSC 3BO8B 4I48B 2HFEB 4UAOC 3VWKC 5GS1B 3VI4F 5IM7B 1T03H 5MI0B 3HMXH 3VGHA 4JPIB 3KXFE 5GS2H 1F6FB 4GSDH 4Q6IA 3MLWL 3LIZL 3VXME 3JWDC 4O2EA 2VLRE 3LQAH 2PXYD 2QV2A 1J1XH 1LDPL 4WY7L 1QHPA 5ETUA 2AJXL 2HVKB 4GXUM 3DX8B 2QL1A 4ONFL 3MCKA 2XFXB 3WD5H 2YPLD 3EFFA 5L2JA 2ZKHH 3VD9A 1FVEB 1YPZA 2BHZA 3N1FC 3OKOA 1MCEA 4DZ8B 5BVPH 5E6YA 4JQXA 4FNLL 4JY5L 4MVBC 1TJGH 1D9KA 4NRZA 5JZ7D 1W0VA 4XGZA 2YC1B 3Q6FB 1M05A 1OOAA 2Q86A 3K2MC 1FBIL 4X5XB 3SDDD 3CSYA 2AI0L 4EBQL 5T3ZD 1YQVH 3D18B 1KIQA 2XNAB 3WMSA 2WUCL 3UTPE 3B2VH 3CFEA 4JRWA 5HVHC 4K8RC 4HUMB 1Y18A 3QUMA 5F93C 4Z76A 4G6KL 5FGBC 2D7TH 1F4YH 3DGCR 1P5VA 3RY4A 3S37X 3JV6B 2NY5L 5IVXF 1HXMB 4PY8I 1QD0A 3VDBA 2ZCLL 3MLSH 1AGCA 5I30L 5E03A 4NM4H 4ZFFA 5C9JA 5TE6H 1MFCL 5HGGS 4HULB 3RGVA 2G5BB 2PR4L 1JNHB 2X6MA 3A67H 4HUXA 4UTAL 1U9KA 5L88L 3WLBB 1MVFA 2EH7L 3CU7A 4KKLC 2X44D 1MCWM 2YPVL 3H3PH 2BVOB 3KLHD 1E28B 2VUYA 3S8WA 4X9BA 1AI1L 2DYPD 3E3QC 1D6VH 1GAFH 3QCVH 3ALXA 1EK3A 4JFEA 4EUPG 4GUPB 3NCBB 4Y2DB 1FNGB 1S7UA 5DEFA 1HCFX 2J3SA 1IM9B 4MXVE 2EDKA 3H9ZA 1NKRA 3ZHKA 3QEHB 1B4JH 3RJQB 4ZUTA 1DLFH 1INEH 3BP4A 4X4YA 3U0TB 4JFZH 1P2CA 4XHJD 2M1KA 5I8KH 4JQVA 3PWPE 1KBGH 3GIZH 3O4LD 3A6CH 3HPLA 2VE6B 5DC0A 4TUJA 2DIJA 4NQUA 1OD9A 4B7IA 4X9FA 2VLKB 2F8XC 1U8LB 4X7DC 1A14L 3EGSB 3OR7A 3R1GH 5DJ8A 4E42B 3U7WH 4F37K 1D5IL 2BNRE 2A38A 3HUJA 2EDFA 1M7DB 1ZXQA 3C08H 1NDGA 1GOHA 4JY6B 5IIEA 5IW6A 2HP4A 1GGBL 4YHIB 4MB5A 4NQEE 1AIFA 3BESR 3JTTA 3E8UL 5CJOL 5LWYH 3ARPA 4H0GA 3MBED 1NCDH 3K4DA 3I6LE 4HIHA 5ICZA 4NYLB 4JFOB 4NRZB 4HKZB 1NC2B 5D7SL 2QQKL 4JFHD 5EOTB 3BP7A 3HRZB 4HDIB 4Q2ZA 3K0WA 3P2TA 1LO2L 4M48L 5D7IE 5FKPA 3WS3A 1GXEA 1P84J 3HE7B 1FRGH 2BMKB 1NCAH 3QRGL 4TULL 3KXFB 4OD1L 1UWGH 3RWJA 3WE6B 3RVUD 3FN0L 4JO2H 3VXMB 2OXHA 1MELA 4KV5F 3MREA 2QSCL 2VLRB 1JYWA 4X98A 5DWUH 2YPKB 4WJ5B 4RIRA 4YIQA 3FO9B 3RPIA 4X6BA 5DJZB 5DVMA 4XMPH 3VGAC 1UGNA 4J1UB 3ZE0E 3ZKNC 4HUUA 4FXKB 1OAYL 3O3AA 1I7TA 5TFSL 5DA0B 3S5LA 3ZE2E 1VA9A 4HUXB 4GKOA 4Z95L 5I0DA 3ISWA 3IDJB 1K3ZA 3TO4C 1A1OB 4YFLI 3BD3A 3FTGA 4RMTA 3WIIL 3LAFA 5D9SA 1MCPH 1JK8B 3MR9B 2EO9A 3U7YL 1X7QB 4NUJB 4UBDD 1HYSD 3KGRA 4HJGA 3AGVA 5DD5L 3U9UA 3QDGE 1NJ9A 5B8CA 5E5MA 4JFDD 4BZ2H 1DVFA 3LKSA 3PL6C 1IAII 3L5IA 1OTSD 1FGNH 5L9DL 5DEFB 3SGEI 5FUCE 1G7LA 4J4PA 3FMGL 4PJCA 3UBXG 5JW3L 1BQHG 1SJHB 3VFGH 4WW1A 1IBGL 3DNKA 3VW3H 1GC1C 1QSEA 4EKXA 1E6OH 3D48R 2OR8A 4MJ2A 4HPYH 1CL7L 5KSAA 5FFLA 4PRHE 2DTMH 5EFIA 3BEVA 5GS0H 2NPLX 1SEQH 2CXGA 4PJ5E 3WCYA 5CHNB 4HJJH 5KAQF 1CE1L 1U8JB 5DJXA 4UIKL 5E0QA 1MHEB 3GSRA 4JQIL 1NLDL 5IBUB 1D3CA 5CILL 2VLLA 4P5TB 4PGEB 3M8OH 2IJ0C 5IQ7H 1FFQA 2AEQL 2EZ0C 4DQOL 5SWSD 4U1GC 4FZ8H 4BSWB 3S88H 5KG9A 5FYKE 2R56L 4YWGH 3LQMA 5DD6B 4ODVL 1VFMA 2P47B 4N0UE 3MV11 4OGXL 3DARA 1Q9KA 3T2PA 2HLAB 3SO5A 3PWPB 3FT4A 4K8RD 3ZSSA 1YN7A 2FO4B 3BP7B 4Q74A 4LVEA 1N0XH 2DRUA 3U2SB 4NKQB 3P0VL 4P3DB 2CRZA 4OLYH 2B1HL 4L8DB 4QOKA 5IQ9A 3PQYA 3ULUL 5D93C 5K59E 4PB9L 2NR6C 1EFXB 4XVUD 2BNRB 5FK9B 4GKZA 5E00B 1CBVL 3B4NA 4RIRB 5CSBA 4LVHB 3VRJB 4X6BB 4FNLH 3MRKB 3O2WL 5DRWA 4KKLD 4NQEB 2AKRA 1F6AB 1G7QA 4KKAC 1FBIH 4X99A 2AI0H 3SKNA 4EBQH 3BKMH 3UO1L 4AM0B 4GAYA 4QHUA 1NBVL 2Z31C 3D85D 2W0PA 4JZJB 4GG8A 5C09E 2QADC 2X1XR 5C9KA 2LVEA 4G6KH 2MSPA 3MRDA 5D7IB 3T1FB 2NY5H 2A1WL 1PYWA 4JM2A 3T08A 3SQOL 3QDAA 4NPYB 3ESVF 2ZCLH 1I85A 4WI8A 3ZO0A 4AEFA 4LQFL 5I30H 3CVIL 5DQ9B 1MFCH 4W4OA 3LN4B 2PR4H 1F42A 5BRZA 1RPQA 4UTAH 5L88H 3QQ4B 1YNKH 5D7JA 5DLMH 3EYUH 2EH7H 3K4ZA 1C5DB 4NKDB 2YPVH 4M8QB 5IWLA 4IRJC 2EYSB 1AI1H 4HCRL 1PZUB 3RZCA 2OTUA 1EJOL 1OGAE 4MAYC 3T4YA 5GZND 2MOVA 5F8QC 4NQDA 5TF0A 4J7RA 3QDGB 4U0RB 1N6VA 1OTTD 4UUJA 5F3BA 3NZ8B 1CDCA 4QRPD 5D2LF 2ZOKB 4M93C 5BJTA 1BM3L 1SQ2N 1AXIB 2E7CA 5D1ZD 3ARGA 2MKLC 5KSVA 2GQHA 5C6TL 4NC1C 4XP9L 1HQRB 2VJXA 3HZMA 2QHRL 3HZYB 3ROLA 2ZJSL 2AS5M 4PG9A 4BELD 3QQ3B 4PRHB 5I9QB 1A14H 3AS1A 2IFFL 4RA0C 4IIQC 1YEDA 4PJ5B 3S3PA 4PJBA 3QUYC 5IF0B 5IG7A 3MMEA 1UM5L 1T66C 3ARZA 4EZMA 4F2MA 3WS6A 3LZFL 4PGDB 4F7MA 5IQ9B 3BGFC 4HH8A 3MOBH 1GGBH 5T1MA 5F6HI 3ZKND 3OAZK 1TPXB 1YEHH 3BH9B 3SN6N 2H6PA 4JM4L 4LSVL 4ZUSA 3D25A 4FQJL 4PJEF 5CJOH 2ZUXA 4FFYL 3ALPA 5EZOH 2GK2A 2YEZB 4QHLB 4AMKL 5BS0D 1XZ0A 3GHBH 3V0WL 4HS3A 5DRWB 1KB5A 5C3TA 5GGUB 2QQKH 2GTZA 2DJ4A 4KK5C 2WBWB 4X99B 5TQ2L 1LO2H 4M48H 4JKWA 4N0UB 2P5EE 5BOPA 2BY3A 4LVNB 3CZFB 3QRGH 4TULH 1ZGLM 1CFSA 1U8HA 2PXYA 2YHGA 3MRDB 1HK6A 2CDFA 2NY4D 1R0AH 4D94A 2QSCH 4F7TA 1J8KA 1MRFL 3RGHA 1S9WA 5D6CB 1PYWB 4NN6C 4C55A 2W65B 5MHSD 2YPLA 1YECH 5GGTL 3WHXB 5MENE 5ADOL 1OAYH 4OF7A 1AHWA 4ZQKA 1KN4L 2MCPL 1KCVL 3DGGB 4JREC 2BNUA 5GGRA 4Z95H 3U48A 4Y4KB 2PETA 1G9EA 1MVUA 4UINH 5IMMA 5HYQA 5SX4I 3SDDA 5FDYA 4RA3A 2FDBP 3U7YH 1ADQA 4XT1C 1KCKA 3QPQC 4IDLA 1KTLB 5DD5H 3RWHB 4PRNB 4NHCL 3W9DB 1C7TA 1DBML 2OTUB 2W9EH 1JPGB 3MUGA 4OQTL 5C09B 5L9DH 4LU5L 1EV2E 1BJ1H 1XAUA 5DEZA 3VI4E 3MZTA 4G42B 4QRQB 1HSBA 4GRWE 5T33L 2W91A 2AGJL 4R9HA 1IBGH 1VADB 4C83A 3O4LE 1CL7H 3IJHB 3PABA 4K07A 3SGKC 1P7QB 4KXZH 1LO4L 5GHWH 4XPTL 2AXGB 2X5PA 2J8UE 1RZJC 3WYRA 2WIIB 1DQJA 3VG9B 3H9SA 4PJHA 5F7WC 2V2WA 5CILH 1OAQH 5F71A 3H7BA 3WFBL 4YEFA 2NR6D 1YEDB 3MNWB 1J86A 4NDMA 5DEGA 4DOHE 2AEQH 5GGRY 5CUSL 4DQOH 2BOCA 4HUVA 1OGAB 2R56H 1RUKL 3W5MA 5I8EA 4E41E 1S7RB 4LRNL 3RBSA 4FS0A 2PTUA 4ODVH 1LE5B 3HTLX 4P46C 2KQNA 4OGXH 1I75A 3CSPA 3VXRD 5JQ6L 1KTDA 1S5HB 3IDIB 3O4LA 5CBEB 5JOEA 4WHYG 4HS3B 4JN1L 4MJID 2H2PD 3NACH 2FZ3A 3EDJA 3P0VH 3BEWA 1X5FA 1S7XB 3QIUC 4XCEA 5F89B 2Q87A 1AXSA 1TCMA 4U1JB 3T2NL 4MA8L 1AGDB 2R9HC 2GCYA 3OF6A 4PB9H 1GPOL 4F7TB 1RUQL 4AEEA 2D0FA 1S9WB 4M7LT 4N8VA 5IFHH 4LSQH 5C8JB 2HMIC 5HYSA 1JGEA 3OX8A 1OPGH 3BH8A 1UKSA 1SHMA 4PTTA 3O2WH 1QNZL 1UEMA 1I3RB 1KXQE 3ZMRA 5JW4R 3OSKA 5AG9A 3UO1H 2X1PA 4XXCC 3KNBB 4WW2F 2EDJA 3SDDB 3MRRB 4TTGA 3GKWH 1QVOA 1BVKA 1PVHA 4YHPA 3WLWC 5IVXA 1HHIB 3SDYL 2HFTA 5FCUL 5DFVD 2ZSWA 2P5EB 4LLMA 1K85A 5HXMA 2NXZC 3RL2A 2A1WH 4QRTA 5GIRA 3SQOH 4GMTH 3L3OA 2EIZA 2YD9A 4IRZL 4J6RL 4OLWL 2OZ4L 4LQFH 1B0GA 3CVIH 4ODUA 1RZKC 3KLAB 3GK8H 1E4JA 3IS0X 3SKOA 4CADB 3V0VA 1AR2A 2BSSB 3HLAA 1P1ZA 5I1CH 4PLOB 4B53A 4LCWD 2X4OA 4L29B 5E8EB 5GSVA 5MENB 2G75B 4MCYA 2KL6A 5IJKC 3DI2B 4MQTB 2YKLL 3BYYA 3BPNC 5E08L 4HCRH 3IKCA 2J1KA 4PRDB 4NOBA 3G6DL 3PWLB 1YDPA 3CH1B 1ZAGA 5ITFB 3DBXA 1T66D 4MWFB 4PJ9C 3HZKB 2R4SL 2JLLA 1QSZA 2WP3O 4OFYA 4R2GD 3X3FL 2DYPB 5EO1B 1LEKA 4JFDA 3O6KL 2M26A 4NDMB 3AY4C 3U82B 4HG4J 4HUVB 3LEXB 1BM3H 3X17A 5I8EB 4AEHL 4GRWB 4ZS7H 3G5VB 2DQUL 2VWEC 3SE3A 5C6TH 4XP9H 4IOFD 5E8DL 2DLTA 3O4LB 3WEXA 2ZJSH 3O3DA 1BIHA 4X9IA 5CJBA 3B6SB 3IRZA 2IFFH 4TPRH 4JFPA 1U41A 2R2HB 2J8UB 4I5BA 3N06B 5AZ2L 1MAML 1S7QB 4K94C 3FZUC 1FIEA 4CJ0A 5GGSB 1CZ8L 4RNRB 4JM4H 1MJ8L 3WKNA 4FQJH 1EEYB 2VAJA 2HJLA 5SWSA 1JE6A 3MFFA 3MLRH 5GGVY 4DOHB 4HXBH 3DX6B 4LCUB 4JFFE 3BH8B 3OX8B 2GK0B 4U6XB 2Z8VC 4E41B 2DBLH 3MBEB 4U6YB 3VFUB 2NXYC 4FOMA 5ESVB 5EZIL 3E3QE 3LKOB 3MJGX 4PLJD 1J0YA 1LMKA 5I2IB 4X6EA 4ORGA 2IBZY 4WFHE 4NP4H 2J8HA 3FFDA 2P8PB 3BSZH 3MRIA 4M4RA 1GSMA 1T1ZB 1KNOA 2Y25A 3GMPA 5E9DE 5J1AB 3QHFL 5DRNA 4NJAL 2W0LA 4OZHF 2PTTB 4NN7C 3ZKXC 4P23C 1MCLA 1B0GB 1SY6H 4HWEH 2VLMD 4HC1L 2V7HB 1KN4H 1PBYA 4ZXBB 2A6JA 3RVTD 3V0VB 1KJVA 1RV6X 3RWCA 4JEGB 4MQSB 4O5LL 3ARDB 4ZODA 1FLTX 4X8XA 3WXVL 3C6SA 2DD8H 1EMTL 2J2ZA 4JB9H 2GI7A 4X4ZA 4OLUL 3D85A 3NVQA 1BFVH 2PYEE 4FP8H 3JV0A 3OKKA 3MRLB 1FORH 2A6IA 4OZGF 4NHCH 5AAWA 2VTFA 2Z8SA 5GRVL 1G9NC 3DBXB 2YK1L 4F7EB 1A4JA 4LU5H 2R8SH 3BN3B 1QLRB 2JELL 5T33H 5F3HB 2GAZA 5C0JA 2IAMD 1HHGB 4ZMAT 2BSTA 4P46D 4OCRL 1LWRA 2LFGA 4UAOB 1VPOL 3VWKB 3KYMA 1KPVA 3TV3L 1ZLSL 5BMFL 1ZS8A 4IJ3C 1GOFA 3IF1B 1BF2A 1DN0A 3I6KB 3RX5A 1JI2A 4QY8B 1EH9A 1CICC 2ED8A 3ZKMC 1JZ4A 4ISVA 3QIUD 1WTLA 3G6JF 3P4MB 1LP9F 1QOKA 1AKJB 1JTTA 2VDMH 3F6IA 4ZDHA 5IW1A 2R9HD 4DKEH 1JWMA 5DGQA 1QHOA 3WFBH 2KZWA 5D1XD 1MWAA 1QRNE 5CIPA 4TSAL 4LSRL 4I18A 2CLVA 2XRAH 3UYRH 1J1PH 4LP5A 4N0RA 5CUSH 4ESKA 1FSKC 1U92B 1RUKH 3V4UL 4O51A 5FM5O 5INCB 4MJ5B 3SE4C 4HAGA 4QRPA 4JZNA 3T04D 1F4AA 5JQ6H 2OTWA 4G5ZL 3OR6B 4GMSL 5JORB 4Q58C 2IPUK 1DBKL 4KVNL 1TTUA 5D1ZA 1LO3H 1JNJA 4FQ1L 4JN1H 4PJXF 5C6PB 5FYJU 5HVHB 4MQ7B 3I6GB 2FWOB 3MPCA 4M6OL 2NXZD 4AIXA 4HK3N 2L0DA 3TN0A 6CGTA 4KTDL 1J0ZA 5DD0L 1QFHA 2FJFB 4F7PB 4KC3B 3BI9X 3MV7A 1PGRB 4DEPC 4PPTA 1KNOB 3LSOB 1DN2A 4JRXD 4OBRA 1QNZH 3MRMB 4LBEB 4GW1A 3VFNB 1A9BA 3CFCL 5BS0A 5DDHA 4K7PL 4LFHG 1XIWA 4LASH 3ZHDA 4JFFB 1R6VA 1DE4A 1I8MB 4MSWA 4J8RB 3SDYH 5FCUH 1NGZB 5D5ME 3HZVB 1FG2B 3L7FA 2GFBB 1PG7L 2IPKB 1UWXK 4OFVA 4ZFOA 1NCCL 3VFPB 1IGIL 3QUKA 4IRZH 5I1GL 3VMNA 3EO9L 4OLWH 3GJEB 3P4OA 2OZ4H 4KPHL 3F7VA 5EU6D 4AENA 4JJ5A 5IB4A 5TH2A 3WFHA 3WNLA 1N8ZA 4ZO9A 3QCUL 5E9DB 1JWSA 2VQUA 2WW8A 3GSQB 4P59H 3O6LL 1DDHA 1NCWH 1JFQH 2VC2L 1NAKL 4M6NL 3GI9L 1FFNB 3V6ZA 4LKXB 3C6LC 4XCCL 2YKLH 5LBSH 4PJDE 1TETL 5E08H 3VD3A 1I7ZA 1MHCB 1S7WB 1AQDA 1NUFA 3INUL 3G6DH 4DKDC 4TUOA 4ISVB 3BKCL 5C0DA 3FQXA 5CEXA 1UCBL 1YY8B 5HGDA 3X3FH 4AIOA 2UUDK 3KPSD 4BZ1L 2VABA 5CJXA 5CIPB 2PYEB 3O6KH 5D2LA 1R3JB 3LKNA 3V5HB 4KK9D 3TA3A 3BUYA 2R69L 4MXQD 2JJSA 3FHQA 2APVA 1AD9A 1ZHBB 4JY4A 4AEHH 2IFGA 1ONQA 3VFOB 5ILTL 5I75C 2DQUH 4J3UA 2X1QA 4S1RL 5E8DH 3N9GL 1N3NA 1MREH 4P2RE 2A9ML 1WICA 1LEGB 5HDBF 3I02B 2X1OA 1DJSA 2UZIH 3KPTA 1F13A 2HT3C 4X6CE 1CN4A 1KACB 3MJ9A 5C1MB 3QCTL 2DQIH 1S9YB 5AZ2H 1HNGA 1MAMH 4UU9B 1BF8A 3X12B 3DMMC 2VLJD 5E1HB 4MNGA 2P1YA 1AC6A 4PJEA 3QIWC 4P23D 4X7CC 1MJ8H 1QRNB 4Y19E 1RZ8B 4HMCA 4CNIA 3VGAB 5JW4Q 2G2RA 1GOGA 4KRPC 1MFEL 4PJFE 3TPKA 1FPTL 4KUZL 3VXNA 4CAGA 3VXRA 3LQAC 1JWUB 3TNNA 3TO4B 1QKZH 1HNFA 2XI9A 4ZOCA 2NYYC 4MJIA 2QQNL 3ARBD 4Q9QH 4D0DA 1FZMA 3EW3B 4MSWB 2VAAB 1KUMA 3VXPA 1M1SA 1FZJA 3DX7B 4HLZG 1F97A 3L7FB 2DTSA 2X4PB 5GJTH 4QHKJ 3PL6B 1KENL 5EO9A 2Q76B 3WIHA 2CDEB 4FFVD 2RCSL 3QHFH 4QXGL 4NJAH 4OUOA 2XQBH 5I16A 3N50A 1OP5K 3T0XA 1MUJB 3EO1A 3MUHL 4W4NA 4NC1E 1CDHA 4LCWE 5ERWA 3RNQA 3GSVB 1F2QA 1WLHA 1JWSB 3W39B 4JPKL 4KKCC 4XXDB 2ZCKL 1F2XK 4X7FC 4NSKB 3ZKMD 1DDHB 5JXEC 1RZGB 5FKAB 1ZT7A 1LD9A 3WXVH 4RBPH 4I9WD 1P4IL 1EMTH 4L3AA 3QNXA 5EUOF 3GMRA 2YD6A 4O4YL 2DWEA 1XT5A 2X9WA 5J3HD 1EEZB 1IFHH 5EC1A 3L3GB 5CEXB 4WNQB 1F90H 5D5MB 1JRHL 4U3XA 2JELH 3C5ZA 2VABB 1KPRA 1RAMA 5ADPH 1IGML 2IH1A 3RHWK 2D3VA 4U1GB 5IB5A 4TTDC 1F4WL 2NY3D 1XR9A 2GUOA 2DMCA 1IC1A 5I8OL 3MFGB 1SVZA 1WV7T 1ZLSH 5BMFH 4RWYL 4JGJA 4JY4B 1YEEL 43C9A 5FF6A 4XNQB 2HH0L 4DZBA 3OZ9L 3JVGC 5DQJB 3GIVA 1N3NB 1MNUH 1TMCB 4RX4D 2XT1B 1IC4H 4PJDB 4TSAH 2W60A 4BKLB 1VSCA 1Q9WA 2V7NA 4D8PB 1FNEB 4MHHG 3S96B 2I24N 5D93B 1UT9A 3BJLA 2XIDA 3RWIB 5JW5B 3V4UH 1B9ZA 2O5XL 5FOBA 1TTGA 4BFIA 2XQYK 5DSCA 4PGJA 3BD4A 3DVNB 3HC4L 4P9HL 4UDUA 4OFDA 4GMSH 2BVYA 3KLDA 1RD6A 1ZTXL 5L8KB 4KVNH 1DQQA 3HAEB 5BQ7A 3MRCA 5HBBA 4MZ2A 3B9AA 4AT6A 1CFTB 3BZ4A 1CXLA 3TNNB 3ECBB 1C7SA 4M6OH 2Z31B 1HKLL 4KTDH 1I3UA 2QADB 3D0LB 4P2RB 5SWQB 2JCCE 3DJ9A 4NQXB 1UXWA 3EDKA 2PW1A 4X6CB 5DRZB 4EUPA 1WQVT 2BRQA 1MI5A 3SDXF 3IJYA 1MOEA 3RNKA 5DD3L 5KW9L 2Q1EA 1IKNC 4MA1C 3UZVB 5C07D 1NEZG 3CFCH 1NMCC 4Y19B 2AK4E 4WW2A 1MCJA 4K7PH 1T80A 3MNZA 1ZHLA 1QQDA 2YA0A 3VWJD 2ICWI 3IU3B 3WL9B 4L4TA 4PJFB 1ZT7B 4IRJB 5ACZA 1XGYH 2C3XA 1F3JA 1R24A 1TIUA 4AIZA 4H26B 1JHLL 5HGAA 3O41B 2CGRL 5EC2A 1JGLL 3P9MB 3CJJA 4MAYB 1IGIH 2DBJA 4I13B 2BY1A 5I1GH 2X4SA 3EO9H 1HHKA 1B90A 2BHUA 4KPHH 1JHTA 5INDA 1ZWIB 3BVNB 4P2QD 3RDTC 1YN6B 5I1EL 1Q0XH 2BVQA 4POUB 4XAWH 3QCUH 3MLUL 5DMKA 1IE5A 4HS8L 1Z9LA 1JNNL 4HGKC 4DK3A 4F80A 4M93B 1QACA 1NAKH 2QKIB 4M6NH 3BQUC 4Y16D 4PJ7E 1P7HL 2ZUSA 4L1DA 4XCCH 1PEWA 4OZFB 5FYJD 1GGIH 1ETZB 1TETH 4YAQA 4LCWB 4TUKH 2HT3D 4LNRB 5T1KD 4RWHA 3BKCH 4FQ2L 3DMMD 2A6KB 3O11B 3MYZA 1UCBH 4IIQB 1R3LB 2Z8RA 3VFSA 3QUYB 1EVTC 4UT7L 1IEBA 4BZ1H 1NDMA 1TVHA 5CBAA 2G60L 4YH6A 3RFZC 2V7NB 2XG4A 3BGFB 4JDVA 1JZ6A 1V3LA 2R69H 2VXQL 1PJ9A 4PJIE 1WT5C 5GRZA 5GS2D 5I73C 2VZTA 2IAMA 4KRPD 4P46A 3ETBF 5ILTH 1BZ7A 1MCNA 3CX5J 3KJ4C 1DQTA 2FEDD 4MA3A 5F21B 4S1RH 3U0PA 2W07A 4MHHI 1KCSL 2NYYD 1K4CA 1K5NB 4MX7A 3G9VA 5DYOB 2UYLB 2E9WA 5EBMA 4FG6C 1XR8A 4W6XB 5LG1A 1UB5A 2ZOLB 4N68A 4XVTL 3QIUA 2JE8A 5EZJA 3QCTH 4XNXL 5DHYB 2KKQA 3AAZA 3BWUC 1G9MH 4MB3A 2F9BT 5E2WL 5FGSA 5D1XA 4MD4A 5K33A 2NY1C 3ZYIA 1I4FB 2R0ZH 1U2HA 1T1XA 5D71H 4NN6B 1N5YL 5C6WH 1OF2A 5HYJA 3RVWC 1DQDH 4OKDA 3X14B 4XZUB 5CSZA 4N0CC 1TZIA 4P5KA 3UYPA 4KKCD 4YBHA 2CK0H 1BEYL 3UBXA 5IEKA 1MFEH 5KS9E 1MCDA 2QR0B 4KXZI 4JREB 4H5SA 1UH2A 1I3GL 4FQXC 4JN2A 1S9VB 5A2LH 2FJGA 4DKFL 1QQDB 4KVCH 4M5YH 8CGTA 3THML 5HGAB 5CMAA 4OZHA 4FA8A 5EC2B 2V6HA 1GCFA 3VA2C 1U42A 3TBVA 4H8WL 2RCSH 3C8HA 4QXGH 2JCCB 1BLNB 2X4SB 1YA5A 4HKJB 1B2WL 1WCBA 1WFTA 3G6AB 3MRJB 2GJ6E 4G6FD 1A7BA 1CWVA 5ITBL 2EC8A 2DM3A 4X6DF 2VWEE 4EEEA 3SY0A 2BVQB 3G6JE 3PHOB 4WI7A 1MLCB 4JRXA 5DMKB 2J12B 4NZTL 4JPKH 5IJKA 3RUGE 4OJFL 4CW1A 4CDHA 1HH6A 1CYGA 4XVSH 1I8LA 1XGPB 4OZGA 5T1LD 2NTFA 4OKVA 4NT6A 2AK4B 2NY5C 1L7IL 4M7ZC 4QEGA 5CLTA 3UPRA 3WUWA 2HJKA 5FYKH 5BW7C 4HWBL 3LKQB 1IILE 4ORZC 1JRHH 2YD5A 4MMXC 5BZDB 3R4DA 3RKPA 4OT1H 5EU6A 1INDL 1F4WH 1M7XA 2MWCA 1CE6B 4YBLC 1FFPB 1ULVA 3EYFB 5DJAB 3UC0L 1RK0B 4PY7A 4P46B 3CU1A 2IANE 3QO1B 2F8OA 2HH0H 3G6JA 3OZ9H 1T83C 3FQUA 1LP9A 3U0PB 3T2OA 3Q3GB 4XI5D 5IHZB 3FONA 1A6TB 5CZKA 1CGSL 4PJ7B 5DMGC 1Z0MA 4FQHA 5LGKA 1XR8B 1WC7B 4XVJL 1QSFD 1U6AL 3QIUB 2QHLA 1T0NB 5L6YH 1MHHB 3BGMA 3JBG7 4QXWA 2FGWL 5F97E 1WEJL 4YHNA 4EDXA 3GSXA 3KPSA 2CMRL 5AUMB 3GEWB 5TJWK 4ONGH 2O5XH 2RQ8A 2YOCA 4HJ0C 5J12C 3BKYL 4P9HH 3VH8G 3UPAA 1OF2B 5IR1A 4PJXA 4OI8A 5C0CD 3IDMA 3GSNB 4PJIB 4UT6L 2D9QB 1DL7H 2EKSB 5DRXB 3RWDB 2B2XL 3QFJD 5D1QC 3I75B 3GBNH 2IQ9L 4IRSA 5EZLA 3FT2B 1HKLH 2CRIA 3RIAF 2HVJB 3U36A 2E6QA 4F57L 1FL6A 1AGBA 2BNQD 1GGUA 3MJ6A 3EUUA 3RU8L 5EU5B 1R5IA 4K7FB 4XNZC 3RDTD 4B0MM 1E6JL 1CFQA 2VLJA 1U8IB 2ZG1A 3SGDH 2R4RL 5C0GA 4P23A 4UILL 1ZLWK 2DKUA 5C0BE 3ARRA 32C2A 3JWDL 1JMZA 5FOJA 1JYXA 2EXWD 3BQUD 3TIDA 1ED3A 3SY0B 3T77A 3Q48A 4NGHL 5ESAA 2MCG1 4LCYB 1HH6B 5KS9B 4G8IA 3BPNB 1ACYH 3AROA 4NO5B 3ARBA 1MJ7H 3K4AA 2CGRH 5GQBA 5E6IA 1JGLH 4U31A 1W0WA 1YNTA 4PJ9B 3IVKB 3DV4B 2A9NL 1UM6L 5JNYB 3OB0K 5H2BA 2CJUL 1GGCL 2Z4QA 3DRTA 5E8OB 1IGYB 1CVSC 4YE4L 1NCBL 4U1KB 5GS0D 3IETB 4EQ3A 3MLUH 4HS8H 1N2RA 4NHUA 5A16B 4EDWH 2A77L 2EDWA 1XF4A 1KJ3L 3OAYK 5F1OB 2GJ6B 4KJYA 3A0OA 1BOGA 3U6RB 1EEUA 1JUFB 1QLFB 2GY5A 2JJWA 2H9GB 3G6JB 4LSPH 1U8PA 2FX9H 4LFHD 3O3EB 3WNKA 3RUGB 3VG0L 4W6WB 2OTPA 1ZVSA 3KDMB 2COQA 5F1NA 5I1AA 2NY1D 1NGYB 4JLRB 1HZHH 4XBGA 2DQJL 4UT7H 2G60H 3D2UA 2W92A 4PD4K 1DANU 4K23L 1VKXB 5DUBB 1VFOA 4GH7B 5AWNL 4L9LB 3RVWD 4E0RB 1UKQA 2VXQH 2VDRL 3MYJB 3IDGB 5DC4B 3FN3A 1GZPA 1N0LA 3MROA 1ZA6B 3GMMA 4CBPA 4P4KC 4ZUUB 3M17A 3HI1B 1KCSH 2E8YA 2JJTC 5MEPA 3P0YL 1LK2B 2NXYB 2HRPL 2IANB 2IH3B 5JO5A 4CRPA 4BFBD 2C4FT 1HH9B 4XNXH 1L4IA 1GH7A 4RX4A 1TVBA 2A6DA 2Y6SC 5E2WH 1G7IA 2ERJC 1T6WA 4BQ9A 4WEMB 3L9RB 1KT2B 3MLVL 4WHDA 2FSEA 1T22A 4TVPL 5FECA 5DURB 3QP3A 5HD8D 4W81A 5DC9B 1BZ9B 4NN7B 3ZKXB 3PWJB 4P23B 4UQ2A 1BEYH 4EQ2A 1CFVL 4WGWB 1S78D 3L95A 4UTBL 4PJ8D 3D39A 2KBGA 3CXHK 2VQTA 3UDWA 4P2OC 4U1LA 1A3LH 3KPMB 4GG6F 5GSRA 1XGQB 4O2FA 1IAKB 2P43B 4DKFH 2QQQA 4QYOB 3NFNA 3ULUC 2V9TA 3THMH 2MHAB 4GRWH 5DJ6B 3MODL 1CLYL 4K3JL 5E6ZA 1T20A 1PKQE 4HS6A 1DEEB 1SJVA 2ESVE 4S1SL 4H8WH 3E6HB 5DI8A 5ALBL 5EUKA 4Y5XC 5BOZG 1B2WH 2Z4QB 5ITBH 1FJ1A 1CD1B 2JJVA 2R1XA 2XA8H 4KKNA 4PV9A 4NZTH 2H8PB 3OKDA 4WTZG 1MCRA 4I77L 5C0RH 5I0ZA 5C0BB 7FABL 1OCWH 4IJ3B 5C07A 43CAA 1S7SA 5EUOA 1X5JA 2C26A 3QUZC 5DMGD 4XRCA 3MLZH 1EBPA 4QXTB 1TTFA 1CICB 5E2UL 3VWJA 4C56D 4RRPA 4KH2A 1G7PA 1IARB 1NC4D 1EGJL 3WFEL 4HWBH 4L8CB 2OQJB 4IOIA 1NGWA 3OJVC 3D0VB 4XBGB 1UKTA 4X7SL 1HXYA 4CKVX 3QIBC 1JTPA 3ZYOA 2SEBB 4GAGL 2EYRB 1VFBB 3FKUS 1FSKB 4P2QA 2IPTL 5I66B 5EU4B 3FRPG 5KSBE 5D6DC 3UC0H 5EN2A 5B3JE 4D0CB 4TRPH 3FRUB 3GMMB 2XY1A 1H3VA 4UNTA 4RMSA 2CKBA 4Y16A 2H32B 5DUPH 1QA9B 2QJDA 1JF5A 2NZIA 1JHKL 2Q3ZA 4OIAA 5MEQB 2WWKT 5T1KA 3FB8B 4DCQA 3QXVA 4MNQD 3IT8D 3OKMA 4V2CB 4FQQA 1AE6H 3KHQA 2FGWH 2X7LB 3GM0A 1CK0L 1WUNT 2A6DB 2CMRH 1UH3A 3KPNA 3IFPB 2PO6A 3OJDB 5FV1L 4MDIA 5H37G 4DEPB 3EHBC 5HPMB 3HMXA 5H8DA 5FECB 3LKPA 4WEBH 2YSSB 5TE7L 1AFVL 1PLGL 2AJ3A 3G08B 4KROC 3WKML 4D9RE 2CH8A 4F58H 1NFIB 4UT6H 5J7CC 3ARXA 1RZ7L 1A6VL 2N56A 3L6FB 5FM8A 2UWEF 4X8JA 5JIPA 2OR7A 3QUXD 1HILB 2IQ9H 4JFYA 4KUCF 3UYOD 1D5BB 3BZFA 3QO0B 2B4CC 1PAMA 2ZUVA 3NMEA 4JKMA 3V0AC 2O61A 2QTEA 6FABL 2DL2A 3D69B 4GRLC 3SDXA 1R3IL 3LH2L 5D2NC 2R4RH 4I0PC 4FZEL 4UILH 3FOLA 4OFIA 4U1SB 4Z5RA 1KEGL 3GBML 3JWDH 4L3CB 4LCIL 1FCGA 2J6EH 4ONHA 4LVOC 2R1XB 1BBJA 3BDBA 4TVSa 1JVKA 1AXTL 3OKDB 5CD5D 1DFBH 1HI6A 1J8HD 4L3ED 2ITCA 3SCMA 4EJ1C 5FCSH 43CAB 3C6LB 5KOMC 5J6HB 3ULVL 3QJHA 4CUCA 5CD3A 3GMNA 1DUYB 4Z7VE 1C08B 4N5UA 3STZA 5IFJB 5HY9A 1RUPL 4KJWC 2J4WL 4NO2A 4Y4HC 1X4ZA 4Z9KB 4KKBC 1WZ1L 4U1IB 3U79A 3SDAA 2CJUH 5FO8B 1GGCH 4HIEA 1OSPL 4HXAH 3I9GL 4YE4H 4YNYA 2IMMA 2HG5B 3IDXL 3RWGA 1PKQB 1YYML 2VDQL 3DV6A 4K8RH 2ESVB 3WV0A 3VCLB 2A77H 1YEGH 5GZOD 5E99H 3PGDB 1S8DA 1E27B 3BE1L 1A7OL 1KJ3H 4ZPTB 4KZDH 3SOBL 5I75B 3H42L 3NIDE 5IBLC 5K9QG 4ZO8A 4F9PA 4XNUH 5IEHA 3DO7A 3NN8B 1Q0YL 4IS6B 4K71C 2EXYD 5JMOC 1F3DJ 2YXFA 2VL5A 4ZUWB 4XBPB 2EDRA 3WHE0 5I6XC 1MCQA 2VR4A 5J06A 2HT4D 5T1LA 2I60L 3K3QA 1QSFE 2LU4A 5K9KA 1Y0LA 1ZHKA 2DQJH 1QG3A 4DCQB 1R3KA 1QO3B 4U0QB 3GSOA 2DLGA 2FIKA 3FQWB 3DMMB 4L8SC 5IB3B 2APTA 3QIWB 4R6UA 2VDRH 2R1YB 1YJDC 1Y6MR 1RUAH 1L0QA 1LDSA 1HWHB 4LDOB 4KI5C 2J88L 4PYGA 2WZPD 1PY4A 1RI8A 5C0CE 4RFOL 2B1AL 3JZ7A 4KUCD 4KRPB 5F9DC 3BP5B 4K7PX 4JO3H 3P0YH 5KSBB 5I1LA 5HHQB 2HRPH 4Z0BL 4OD2B 3QWQB 4JFYB 2NW3B 3CLFH 1PG7X 1RQ5A 1IGTA 3OG4B 3GSWB 4X6DE 1LO5B 1M71A 1QSFA 4YXKL 1HIML 1G7HA 5SWZE 3NBNA 5JDSB 3KPOA 4ZTOL 4TVPH 4OGZA 3WDHA 2O5ZH 1YEJL 3L3KB 3UZQA 4Z7WE 1KELH 4M00A 1KGCE 2EIBA 2EYTA 2CDGB 5IB1B 1BD2A 4WUUD 1OT1A 1MPAL 3V6OA 1CFVH 4XBEL 2R0KL 3W2DL 4OV5B 4Z7NE 4PUBL 4UTBH 2Y4SA 3QUZD 4QWWC 4Y0GA 5C0CA 1I9RH 1X44A 5EBGA 1FYHB 1N5AB 2XACC 3GHEL 3ZTJG 3KWWA 3QFJA 3MQIA 4X9GA 4NOFA 5CD3B 2YRPA 5DO2D 3QUML 5C92A 3EDDA 4YX2H 3KJ6H 1UVQA 1KFAH 2ADIB 1YEIL 3C60D 4K3JH 4JVWA 2BNQA 3QDHA 4S1SH 4AH2B 4JR9L 1I7UA 4X6DA 2ADFL 1B3JA 1U58B 4WHTA 3F12A 4GAJL 5DS8A 4YDKL 3K74B 1MRDL 3NCEB 1FAIL 2FYYB 5HVWA 1XF3B 4G6FB 1JNLL 3W0WE 1S3KL 1K8IA 2NNAA 1IQDB 3QXDA 4EVNA 4HPOH 5E2UH 1C12B 3O2DA 2NY2C 2GTWA 3L7EA 4BQ6A 2DQCL 3PHSA 3AM8C 5IT2L 2DLIA 2P42B 3ZE1F 3EFDL 4JHZA 4QT5A 1MRCL 5HHOD 5K9QI 1ZHKB 5J89A 4Z7VB 1U3JA 3GB7A 4X7SH 3RAJL 4POYA 4JPWL 1P6AB 1T04B 4GAGH 2ZWLT 1WT5A 1NCNA 1W0YT 4HH9B 5IMOA 1A1NB 1FVDB 1H5BC 2YZ1A 2FLRT 2WBJC 5F7HA 4KI5F 3GJFH 4YHZH 3IGAA 2D4DA 3TPUA 4CVZB 4QHNA 1JZ3A 5F9JB 3C2AH 1QPXA 5I19H 1BQLL 4QRUB 4CVXA 2WWMC 1I8KB 1GC1H 3OHXA 2F74B 2X1WL 4MA7L 1UXSA 1S7VA 4UOW0 1RJLA 1YEKL 1U8KB 2ZNWA 4I0PD 1CK0H 4JHAH 2APFA 2AXFA 4LHQB 2HTKD 4OSUL 1QSFB 2E9BA 3DUUA 3QULB 2FBJL 3BWAB 1A02N 3MJ7B 1AFVH 5ICYB 1PLGH 1A9EA 3WKMH 2VZ3A 2YZ8A 1DQLL 2EYTB 3QHTC 1NMCB 2CXKA 3F7YB 1A6VH 4OB5L 2H26B 1SYVB 1A2YA 2F54A 5C0CB 1T1WB 4I0CC 3I2CL 3VXSE 4F33A 4KKBD 2RFXB 3L3DA 4U05A 6FABH 5HI4C 2RAMA 4BH8A 3TBTB 2A0LD 3BT2L 4CMMA 5DJYA 3LH2H 3RPKA 4OD3L 2EE3A 1ZLUK 5D7KE 1HQ4B 1H3XA 1F11B 4AL8L 4X6DB 3RDTB 3U4EB 1FCCA 3GBMH 1KEGH 4GFTB 5SWZB 1KLGA 5JOPE 1JV5B 4TQEL 4DFHA 12E8L 4NQSB 1JN6A 3UP1A 1UJTA 4Z7WB 1DUZA 1AXTH 4PY8J 3NCJH 2E5EA 2FL5B 3NGBC 4PJ8A 3BQUB 2X4TA 3HRPA 3ULVH 3V8CA 4PGCB 4C56E 2BHYA 4JANA 35C8H 4EVNB 3UAJC 5DK0A 5IUSA 1XGRB 2J4WH 4JCMA 5LAXB 5BW7A 1WZ1H 4JFXB 3MRBB 3GSNL 5KSUA 3HAEH 3BXNB 1BWMA 1OSPH 2AQ2A 2CIKB 1M6OB 1AGFB 1N6QH 4KI5D 1YYMH 4PBXA 2VDQH 4Y1AD 1N4XH 1Q9LA 1RIUL 5EWIL 5TDOA 5I73B 2NY6D 3BE1H 1A7OH 2C1OB 2HA1A 2UY6A 4G6ML 1X5AA 4J3TA 5HGHB 3D9AL 3SOBH 3VXOB 4U7SA 3H42H 1T83A 2MQ3A 4ELMF 3A6BL 3KJ4B 1Z9MA 1Q0YH 1QBLL 5FHBL 3K8LA 3PWUB 9CGTA 1KULA 2ZUUA 3MUJA 1CR9L 2IGFH 4NZRL 4QHNB 1MLBA 1EAPA 3W0WB 4RGNC 5ISZE 4MNQE 3HG1D 4DUWA 4C57C 3D3VE 3DWTA 3OXSA 1EAJA 5ENWA 2RBLA 1NC4A 3DVGB 3KYKL 1CT8B 3L3IA 3VRIB 5C0FA 1NBQA 2NY1B 2R2BB 3DLQR 5LGJB 4M5ZL 4M61B 4I3SL 3DUUB 1DBJL 3U4AA 3DURB 3MRPB 1K2DB 3TLRA 2J88H 5BZWB 5TDNB 2EDBA 1AJ7L 2ICWA 2LAGB 2YUXA 4RFOH 4V1DE 3WIFA 5IVZB 2BFVL 1DANT 3UTZA 3K1DA 3O45B 3V5DB 1RK1B 4PRPE 5HDOA 4DVBA 1P7KA 2FBOJ 4FQXB 2QSVA 4Z0BH 1P4LA 3F7QA 3AS2A 3S3SA 4HMEA 3R0MA 4W68A 4MS8D 1U8MA 3O0RL 4U1NA 4XX1G 3OGCA 5IKCB 5IVOA 1FN4B 4YXKH 3B8SA 1EIBA 2FRGP 3FJTA 2DN7A 3HPJB 4IMLA 4OQ1A 4OZFH 4ZTOH 1VENA 4GW5A 1UJ3A 3H9YA 4K9EL 4ZOEA 1UZ6F 4Q9CA 1PX3A 3SJVA 4GG6A 2AV7A 5JR1L 5DMYA 2EH8L 3CUPB 4WTWA 1AP2A 1A6ZB 1J8HE 5IV2A 2Y9RT 4N8CH 3LRSA 1DUZB 2NW2A 1ZEAH 4K94L 5DVNA 1T0MB 1T7XA 1A7PL 3HCVA 3GHEH 3CFJA 2VZSA 1QEWA 3C8DA 3QUXA 2UVEA 4M7ZB 3PXHA 1YEIH 2MKWA 4ZG1A 5DK0B 5J6GB 3IFLL 3VXSB 4B5EA 2ADFH 2J5LC 1RJZA 2AJSL 4GQ9H 3GUTA 5HYEA 1H3TA 3ARFC 4YDKH 1FAIH 4R0LA 4AEIH 4NO0D 5AG8A 4YBLB 1NBZB 3LB6C 3PIQB 1S3KH 1V7ML 2X10A 1SJEA 4QXUL 1J8HA 4L3EA 5I18L 1KC5L 2LU7A 4LLQA 1OAKH 2DQCH 3QR2A 3CFBA 1EAPB 3V8OA 2ADGB 3T65A 5F6IC 1YMMD 3EFDH 2VQ1A 3WBDA 4C56B 1MRCH 1U91A 1Z6JT 4RQQA 1KIRA 4ZFZB 3IXAB 2W0FB 3NCYS 5E4EC 2DQGL 1QFWH 4JPWH 5IROC 3SGDI 1ZLVH 5LQBL 1WBYA 2UZXB 4NRXA 3GMOA 4PP1D 5I8CA 5J12B 4AK1A 2VH5L 1T4KB 4KRLB 5IOPA 1EHLH 3QJFA 1T3FA 5FUZL 3QNYB 4MD5A 2JJTA 5JMRA 3RY6C 5M95B 3ULUE 2XTLA 3S3JA 4HUNB 1PQZB 4FFWC 4YPGA 2I9LA 4ZYKA 3BW9B 4LF3B 1T21A 2PCPA 5FYKU 3BIKA 4Y7MA 1BQLH 5GS3A 1P7KB 2HFFA 4OLVL 5D1QB 3AC0A 4WCYH 5HI4D 4MA7H 4PV8B 3PDOB 2LE9A 3R06A 1YEKH 2DI9A 5E94B 1Q9OB 1U8MB 5K9OA 1HHJB 4Y2DD 5T3XL 1YY9D 4OSUH 5ISZB 4MNQB 2ARWA 4XNZB 2F58L 2FBJH 3D3VB 2UY7A 4XPGH 1RZJH 2FECI 4PGBA 2XKSA 4R90H 4ZOAA 5A2JH 1Z5LA 3BRGC 1DQLH 4IEFB 1JF1A 3EZ8A 5A1AA 2UWEA 4HX1A 3H3BC 5FDWB 5BVJB 3P4LA 1KB5L 4PB0L 3UAJD 1P9MC 4V1DB 5IV2B 1HKFA 3I2CH 5D72L 3PJSA 4XPFL 2VLKD 4PRPB 4M4PA 3TO2A 3LOWA 4DTGL 4NKMB 1DBAL 3L5HA 3QI9C 1NUDA 4H25A 3BT2H 1PZ5B 1XCTB 4OD3H 2ZCHL 2CSPA 4H0HB 5B39B 4AL8H 3T4AA 5EBLB 3L1OL 3NZHL 2AJVL 2HN7B 5DK2A 12E8H 1A22B 4WUUA 3RWEB 5HDQL 3CCHB 2X70A 4DGVL 3LN5B 1L7TL 4YQXL 1NC2D 2OL3B 4TNWK 4XP6L 1O7VA 5DHVB 3MRNA 4RGND 4MXVF 4Y2OA 1BJ8A 5F44A 5T3ZL 1J8HB 1KYOK 2LTQC 3CFKA 3HE7D 3KR3H 3UROR 4UDTB 4FN0A 2XPGB 3KXFD 1IMHC 3FB6B 3GSNH 3ILPB 1KIPA 5HHOE 1YYLL 1INQB 2ZUYA 5GRXG 3C60A 1W2KT 1RMFL 2BDNH 1BFSA 4ZD3L 3RKDC 2NZ9C 3VXMD 4BH7A 2VQ1B 5CEZL 1U91B 2VLRD 1KIRB 2QQLL 4OIBA 2VXUL 3QEGH 4Y5VC 3IFOA 2CO6B 4Z78A 1R3HA 2VITA 3RY5A 2OSLA 3BN9D 1AQKL 4G6MH 3D9AH 3MXVL 4HCRA 1RZIB 1T3FB 3A6BH 1OAXL 4P4KB 3V6FA 4MD5B 4EXKA 1WK0A 5FHBH 2AJUL 3SE9L 1FZKA 1CR9H 5L2KD 4YPGB 3TH2T 1RZKH 4ZYKB 3CSGA 1MQ8A 1KSRA 4NNXB 1JZ7A 5D2NE 2E7BA 1EO8L 2HLFC 4XPBL 3BPOC 1JZ2A 2ERJB 2Q7YB 5HHNA 3CDGB 4WGVB 1DBJH 2ZSVA 3FOMA 5DUMH 2DDQL 5D7IF 3TF7C 3STLA 1AJ7H 1NBYB 3V7MA 3ZHLA 3TWCL 5CFHA 4RFNC 1KJ2L 5CGYD 4YO0B 1HEZA 1CXKA 1U93B 3HI5H 5F6HJ 2R0LL 3IDNB 4U1MA 5AAMA 4QRSA 4P2OB 4HSQA 1I1AC 1GZQA 2L7JA 3ORJA 2BVEA 2Z8WC 5TGBB 3P73A 3HC0B 3O0RH 3PJSB 3FCTA 3TJHD 1OLLA 3ZE0F 4OF5A 5DGRA 3VFMB 3KPQA 4BFEA 1HSAB 4P5TD 5TF1L 1TZHB 3ZE2F 4I0PA 1GVIA 2DM2A 4P9HC 3C5JA 5E5UB 4LHUB 4K9EH 4Y5XB 3LB6D 1MY7A 1MCBA 4S2SA 1EUTA 5JHLL 1IGFL 2EH8H 5EBWB 3VE0A 2WQ8A 1K6QL 3T0DA 2E3VA 1SBBA 4NKOB 4K94H 3CXDL 2XZQL 3FB7A 5HHPA 3ZE1E 1IKFH 3PWPD 4ODHL 3QUZB 2X4UB 1FDLL 3HS0B 2Z93B 3T3ME 3O3BB 1MH5B 3TVMC 2FIRT 4MB4A 5DJDA 3CFKB 3IFLH 1I1FB 2BVTA 1MAKA 4GO6B 1SY6A 1F6LL 3H0TA 1UQSA 4W70A 4URTB 2AJSH 2Z92A 4OCWH 2I5YL 4KI5E 4PREA 3O6FC 5IK3B 3QIBB 3WJJA